WorldWideScience

Sample records for astatine 191

  1. Radiochemistry of astatine

    Energy Technology Data Exchange (ETDEWEB)

    Ruth, T J; Dombsky, M; D' Auria, J M; Ward, T E

    1988-01-01

    This monograph is a review of the literature through 1987 and covers the methods of producing the radioisotopes of astatine and the inorganic, nuclear, and organic chemistry of astatine. The discussion is limited to chemical and physical chemical properties of astatine. The monograph, after the introduction, is divided into chapters titled: production methods, nuclear spectroscopy, chemistry of astatine, separation and isolation (dry and wet), and selected procedures. 209 refs., 15 figs., 7 tabs. (DLC)

  2. Discovery of the astatine, radon, francium, and radium isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Fry, C.; Thoennessen, M., E-mail: thoennessen@nscl.msu.edu

    2013-09-15

    Thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  3. Discovery of the astatine, radon, francium, and radium isotopes

    CERN Document Server

    Fry, C

    2012-01-01

    Currently, thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  4. Discovery of the astatine, radon, francium, and radium isotopes

    Science.gov (United States)

    Fry, C.; Thoennessen, M.

    2013-09-01

    Thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  5. Delayed and In-beam Spectroscopy on Francium and Astatine Nuclei at the Proton Drip Line

    Energy Technology Data Exchange (ETDEWEB)

    Uusitalo, J.; Jakobsson, U. [Department of Physics, University of Jyvaeskylae (Finland); Collaboration: RITU-Gamma Gollaboration

    2011-11-30

    Delayed and in-beam spectroscopy on francium and astatine nuclei at and beyond the proton drip line has been performed. In neutron deficient astatine nuclei a shift to deformed shapes as a function of decreasing neutron has been obtained. In neutron deficient francium isotope the same shift is evident.

  6. Delayed and In-beam Spectroscopy on Francium and Astatine Nuclei at the Proton Drip Line

    Science.gov (United States)

    Uusitalo, J.; Jakobsson, U.

    2011-11-01

    Delayed and in-beam spectroscopy on francium and astatine nuclei at and beyond the proton drip line has been performed. In neutron deficient astatine nuclei a shift to deformed shapes as a function of decreasing neutron has been obtained. In neutron deficient francium isotope the same shift is evident.

  7. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    CERN Document Server

    Rothe, S; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yu; Köster, U; Lane, J; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt K D A

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of smallest quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.317510(8) eV. New ab initio calculations were performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of super-heavy element 117, the heaviest homologue of astatine.

  8. Measurement of the first ionization potential of astatine by laser ionization spectroscopy.

    Science.gov (United States)

    Rothe, S; Andreyev, A N; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yuri; Köster, U; Lane, J F W; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt, K D A

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.31751(8) eV. New ab initio calculations are performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of superheavy element 117, the heaviest homologue of astatine.

  9. Spectroscopy of low-lying states in neutron-deficient astatine and francium nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Jakobsson, U., E-mail: ulrjak@kth.se; Cederwall, B. [KTH, The Division of Nuclear Physics, AlbaNova University Center, SE-10691 Stockholm (Sweden); Uusitalo, J.; Auranen, K.; Badran, H.; Cox, D. M.; Grahn, T.; Greenlees, P. T.; Julin, R.; Juutinen, S.; Herzáň, A.; Konki, J.; Leino, M.; Mallaburn, M.; Pakarinen, J.; Papadakis, P.; Partanen, J.; Rahkila, P.; Sandzelius, M.; Sarén, J. [University of Jyvaskyla, Department of Physics, P.O. Box 35, FI-40014 University of Jyvaskyla (Finland); and others

    2015-10-15

    Low-lying states in neutron-deficient astatine and francium nuclei have been studied by means of in-beam and delayed spectroscopy. The 13/2{sup +} state has been observed in francium nuclei with a similar down-sloping trend as in neighbouring astatine and bismuth isotopes, as a function of decreasing neutron number. A systematic trend can also now be seen for the 1/2{sup +} state both in astatine and francium nuclei, where the level energy decreases steeply as a function of neutron number when moving further away from the neutron shell closure. This trend is very similar between astatine nuclei and their francium isotones. Moreover, shape coexistence has been observed between the 13/2{sup +} state and the spherical 9/2{sup −} ground state in {sup 203}Fr and {sup 205}Fr.

  10. Spectroscopy of low-lying states in neutron-deficient astatine and francium nuclei

    Science.gov (United States)

    Jakobsson, U.; Uusitalo, J.; Auranen, K.; Badran, H.; Cederwall, B.; Cox, D. M.; Grahn, T.; Greenlees, P. T.; Julin, R.; Juutinen, S.; HerzáÅ, A.; Konki, J.; Leino, M.; Mallaburn, M.; Pakarinen, J.; Papadakis, P.; Partanen, J.; Rahkila, P.; Sandzelius, M.; Sarén, J.; Scholey, C.; Sorri, J.; Stolze, S.

    2015-10-01

    Low-lying states in neutron-deficient astatine and francium nuclei have been studied by means of in-beam and delayed spectroscopy. The 13/2+ state has been observed in francium nuclei with a similar down-sloping trend as in neighbouring astatine and bismuth isotopes, as a function of decreasing neutron number. A systematic trend can also now be seen for the 1/2+ state both in astatine and francium nuclei, where the level energy decreases steeply as a function of neutron number when moving further away from the neutron shell closure. This trend is very similar between astatine nuclei and their francium isotones. Moreover, shape coexistence has been observed between the 13/2+ state and the spherical 9/2- ground state in 203Fr and 205Fr.

  11. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    DEFF Research Database (Denmark)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom

    2015-01-01

    To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical...

  12. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    NARCIS (Netherlands)

    Rothe, S.; Andreyev, A. N.; Antalic, S.; Borschevsky, A.; Capponi, L.; Cocolios, T. E.; De Witte, H.; Eliav, E.; Fedorov, D. V.; Fedosseev, V. N.; Fink, D. A.; Fritzsche, S.; Ghys, L.; Huyse, M.; Imai, N.; Kaldor, U.; Kudryavtsev, Yuri; Koester, U.; Lane, J. F. W.; Lassen, J.; Liberati, V.; Lynch, K. M.; Marsh, B. A.; Nishio, K.; Pauwels, D.; Pershina, V.; Popescu, L.; Procter, T. J.; Radulov, D.; Raeder, S.; Rajabali, M. M.; Rapisarda, E.; Rossel, R. E.; Sandhu, K.; Seliverstov, M. D.; Sjoedin, A. M.; Van den Bergh, P.; Van Duppen, P.; Venhart, M.; Wakabayashi, Y.; Wendt, K. D. A.

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical

  13. An attempt to explore the production routes of Astatine radionuclides: Theoretical approach

    OpenAIRE

    Maiti, Moumita; Lahiri, Susanta

    2008-01-01

    In order to fulfil the recent thrust of Astatine radionuclides in the field of nuclear medicine various production routes have been explored in the present work. The possible production routes of $^{209-211}$At comprise both light and heavy ion induced reactions at the bombarding energy range starting from threshold to maximum 100 MeV energy. For this purpose, we have used the nuclear reaction model codes TALYS, ALICE91 and PACE-II. Excitation functions of those radionuclides, produced throug...

  14. Synthesis and Evaluation of Astatinated N-[2-(Maleimido)ethyl]-3-(trimethylstannyl)benzamide Immunoconjugates

    DEFF Research Database (Denmark)

    Aneheim, Emma; Gustafsson, Anna; Albertsson, Per

    2016-01-01

    Effective treatment of metastasis is a great challenge in the treatment of different types of cancers. Targeted alpha therapy utilizes the short tissue range (50-100 μm) of α particles, making the method suitable for treatment of disseminated occult cancers in the form of microtumors or even sing...... of the in vivo distribution of the new immunoconjugate with other tin-based immunoconjugates in tumor-bearing mice, the MSB conjugation method was found to be a viable option for successful astatine labeling of different monoclonal antibodies....

  15. Laser photodetachment of radioactive ions: towards the determination of the electronegativity of astatine

    CERN Multimedia

    Rothe, Sebastian; Welander, Jakob Emanuel; Chrysalidis, Katerina; Day Goodacre, Thomas; Fedosseev, Valentine; Fiotakis, Spyridon; Forstner, Oliver; Heinke, Reinhard Matthias; Johnston, Karl; Kron, Tobias; Koester, Ulli; Liu, Yuan; Marsh, Bruce; Ringvall Moberg, Annie; Rossel, Ralf Erik; Seiffert, Christoph; Studer, Dominik; Wendt, Klaus; Hanstorp, Dag

    2017-01-01

    Negatively charged ions are mainly stabilized through the electron correlation effect. A measure of the stability of a negative ion is the electron affinity, which the energy gain by attaching an electron to a neutral atom. This fundamental quantity is, due to the almost general lack of bound excited states, the only atomic property that can be determined with high accuracy for negative ions. We will present the results of the first laser photodetachment studies of radioactive negative ions at CERN-ISOLDE. The photodetachment threshold for the radiogenic iodine isotope 128I was measured successfully, demonstrating the performance of the upgraded GANDALPH experimental beam line. The first detection of photo-detached astatine atoms marks a milestone towards the determination of the EA of this radioactive element.

  16. Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical

    Energy Technology Data Exchange (ETDEWEB)

    Lahiri, Susanta [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India)], E-mail: susanta.lahiri@saha.ac.in; Roy, Kamalika [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India); Sen, Souvik [Berhampur Sadar Hospital, Berhampur, Murshidabad 742 101 (India)

    2008-12-15

    No-carrier-added astatine radionuclides produced in the {sup 7}Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about {approx}12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h.

  17. Determination of the electron affinity of astatine and polonium by laser photodetachment

    CERN Multimedia

    We propose to conduct the first electron affinity (EA) measurements of the two elements astatine (At) and polonium (Po). Collinear photo-detachment spectroscopy will allow us to measure these quantities with an uncertainty limited only by the spectral line width of the laser. We plan to use negative ion beams of the two radioactive elements At and Po, which are only accessible on-line and at ISOLDE. The feasibility of our proposed method and the functionality of the experimental setup have been demonstrated at ISOLDE in off-line tests by the clear observation of the photo-detachment threshold for stable iodine. This proposal is based on our Letter of Intent I-148.

  18. Adsorption of the astatine species on a gold surface: A relativistic density functional theory study

    Science.gov (United States)

    Demidov, Yuriy; Zaitsevskii, Andréi

    2018-01-01

    We report first-principle based studies of the adsorption interaction of astatine species on a gold surface. These studies are aimed primarily at the support and interpretation of gas chromatographic experiments with superheavy elements, tennessine (Ts, Z = 117), a heavier homologue of At, and possibly its pseudo-homologue nihonium (Nh, Z = 113). We use gold clusters with up to 69 atoms to simulate the adsorption sites and estimate the desorption energies of At & AtOH from a stable gold (1 1 1) surface. To describe the electronic structure of At -Aun and AtOH -Aun complexes, we combine accurate shape-consistent relativistic pseudopotentials and non-collinear two-component relativistic density functional theory. The predicted desorption energies of At and AtOH on gold are 130 ± 10 kJ/mol and 90 ± 10 kJ/mol, respectively. These results confirm the validity of the estimates derived from chromatographic data (147 ± 15 kJ/mol for At, and 100-10+20 kJ/mol for AtOH).

  19. ASTATINE-211 RADIOCHEMISTRY: THE DEVELOPMENT OF METHODOLOGIES FOR HIGH ACTIVITY LEVEL RADIOSYNTHESIS

    Energy Technology Data Exchange (ETDEWEB)

    MICHAEL R. ZALUTSKY

    2012-08-08

    Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At

  20. 19 CFR 191.13 - Packaging materials.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Packaging materials. 191.13 Section 191.13 Customs... (CONTINUED) DRAWBACK General Provisions § 191.13 Packaging materials. (a) Imported packaging material... packaging material when used to package or repackage merchandise or articles exported or destroyed pursuant...

  1. 32 CFR 191.10 - Effective date.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Effective date. 191.10 Section 191.10 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS THE DOD CIVILIAN EQUAL EMPLOYMENT OPPORTUNITY (EEO) PROGRAM § 191.10 Effective date. This part is...

  2. 29 CFR 19.1 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 1 2010-07-01 2010-07-01 true Definitions. 19.1 Section 19.1 Labor Office of the Secretary of Labor RIGHT TO FINANCIAL PRIVACY ACT § 19.1 Definitions. For purposes of this regulation, the term..., savings and loan, building and loan, or homestead association (including cooperative banks), credit union...

  3. 19 CFR 191.111 - Drawback allowance.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Drawback allowance. 191.111 Section 191.111 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) DRAWBACK Supplies for Certain Vessels and Aircraft § 191.111 Drawback allowance...

  4. 19 CFR 191.101 - Drawback allowance.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Drawback allowance. 191.101 Section 191.101... Preparations (Including Perfumery) Manufactured From Domestic Tax-Paid Alcohol § 191.101 Drawback allowance. (a....C. 7653(c)). However, there is no authority of law for the allowance of drawback of internal-revenue...

  5. 19 CFR 191.131 - Drawback allowance.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Drawback allowance. 191.131 Section 191.131 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE... Foreign Ownership and Account § 191.131 Drawback allowance. Section 313(g) of the Act, as amended (19 U.S...

  6. 19 CFR 191.121 - Drawback allowance.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Drawback allowance. 191.121 Section 191.121... TREASURY (CONTINUED) DRAWBACK Meats Cured With Imported Salt § 191.121 Drawback allowance. Section 313(f) of the Act, as amended (19 U.S.C. 1313(f)), provides for the allowance of drawback upon the...

  7. 32 CFR 191.5 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Responsibilities. 191.5 Section 191.5 National... DOD CIVILIAN EQUAL EMPLOYMENT OPPORTUNITY (EEO) PROGRAM § 191.5 Responsibilities. (a) The Assistant... responsibilities. (7) Ensure fair, impartial, and timely investigation and resolution of complaints of...

  8. 19 CFR 191.31 - Direct identification.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Direct identification. 191.31 Section 191.31 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) DRAWBACK Unused Merchandise Drawback § 191.31 Direct identification. (a) General...

  9. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    Energy Technology Data Exchange (ETDEWEB)

    Rothe, Sebastian

    2012-09-24

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  10. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE, CERN

    CERN Document Server

    Rothe, Sebastian; Nörtershäuser, W

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at ISOLDE, CERN, by the addition of an all-solid state tuneable titanium: sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE, CERN, and at ISAC, TRIUMF, radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  11. 27 CFR 19.1 - General.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false General. 19.1 Section 19.1 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE... location, construction, equipment, arrangement, qualification, and operation (including activities incident...

  12. 19 CFR 191.0 - Scope.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Scope. 191.0 Section 191.0 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED... specialized provisions applicable to specific types of drawback claims. Additional drawback provisions...

  13. 19 CFR 191.172 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Definitions. 191.172 Section 191.172 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY... (naphtha or kerosene-type), both falling under the same HTSUS classification (2710.00.15) would be...

  14. 21 CFR 155.191 - Tomato concentrates.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Tomato concentrates. 155.191 Section 155.191 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR... considered added salt). (ii) Lemon juice, concentrated lemon juice, or organic acids. (iii) Sodium...

  15. 27 CFR 20.191 - Bulk articles.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Bulk articles. 20.191... Users of Specially Denatured Spirits Operations by Users § 20.191 Bulk articles. Users who convey articles in containers exceeding one gallon may provide the recipient with a photocopy of subpart G of this...

  16. 19 CFR 191.151 - Drawback allowance.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Drawback allowance. 191.151 Section 191.151 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE... allowance. (a) Eligibility of entered or withdrawn merchandise—(1) Under 19 U.S.C. 1557(a). Section 557(a...

  17. 19 CFR 191.181 - Drawback allowance.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Drawback allowance. 191.181 Section 191.181 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE....181 Drawback allowance. The fourth proviso of § 3 of the Foreign Trade Zones Act of June 18, 1934, as...

  18. 19 CFR 191.141 - Drawback allowance.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Drawback allowance. 191.141 Section 191.141 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE... Drawback allowance. Section 313(h) of the Act, as amended (19 U.S.C. 1313(h)), provides for drawback on the...

  19. 30 CFR 19.1 - Purpose.

    Science.gov (United States)

    2010-07-01

    ... based on sound engineering principles, and is safe for its intended use. MSHA reserves the right to... PRODUCTS ELECTRIC CAP LAMPS § 19.1 Purpose. (a) The purpose of investigations made under this part is to promote the development of electric cap lamps that may be used in mines, especially in mines that may...

  20. Final Report for research grant "Development of Methods for High Specific Activity Labeling of Biomolecules Using Astatine-211 in Different Oxidation States"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, D. Scott [Univ. of Washington, Seattle, WA (United States)

    2011-12-14

    The overall objective of this research effort was to develop methods for labeling biomolecules with higher oxidation state species of At-211. This was to be done in an effort to develop reagents that had higher in vivo stability than the present carbon-bonded At-211-labeled compounds. We were unsuccessful in that effort, as none of the approaches studied provided reagents that were stable to in vivo deastatination. However, we gained a lot of information about At-211 in higher oxidation states. The studies proved to be very difficult as small changes in pH and other conditions appeared to change the nature of the species that obtained (by HPLC retention time analyses), with many of the species being unidentifiable. The fact that there are no stable isotopes of astatine, and the chemistry of the nearest halogen iodine is quite different, made it very difficult to interpret results of some experiments. With that said, we believe that a lot of valuable information was obtained from the studies. The research effort evaluated: (1) methods for chemical oxidation of At-211, (2) approaches to chelation of oxidized At-211, and (3) approaches to oxidation of astatophenyl compounds. A major hurdle that had to be surmounted to conduct the research was the development of HPLC conditions to separate and identify the various oxidized species formed. Attempts to develop conditions for separation of iodine and astatine species by normal and reversed-phase TLC and ITLC were not successful. However, we were successful in developing conditions (from a large number of attempts) to separate oxidized forms of iodine ([I-125]iodide, [I-125]iodate and [I-125]periodate) and astatine ([At-211]astatide, [At-211]astatate, [At-211]perastatate, and several unidentified At-211 species). Information on the basic oxidation and characterization of At-211 species is provided under Objective 1. Conditions were developed to obtain new At-211 labeling method where At-211 is chelated with the DOTA and

  1. 19 CFR 191.164 - Return to Customs custody.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Return to Customs custody. 191.164 Section 191.164... to Sample or Specifications § 191.164 Return to Customs custody. There is no time limit for the return to Customs custody of distilled spirits, wine, or beer subject to refund of taxes under the...

  2. 19 CFR 191.153 - Continuous Customs custody.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Continuous Customs custody. 191.153 Section 191... THE TREASURY (CONTINUED) DRAWBACK Merchandise Exported From Continuous Customs Custody § 191.153 Continuous Customs custody. (a) Merchandise released under an importer's bond and returned. Merchandise...

  3. 19 CFR 191.0a - Claims filed under NAFTA.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Claims filed under NAFTA. 191.0a Section 191.0a Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) DRAWBACK § 191.0a Claims filed under NAFTA. Claims for drawback filed under the...

  4. 27 CFR 24.191 - Segregation of operations.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Segregation of operations. 24.191 Section 24.191 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS WINE Production of Effervescent Wine § 24.191 Segregation of operations...

  5. 19 CFR 191.44 - Destruction under Customs supervision.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Destruction under Customs supervision. 191.44 Section 191.44 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) DRAWBACK Rejected Merchandise § 191.44 Destruction under Customs...

  6. 19 CFR 191.25 - Destruction under Customs supervision.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Destruction under Customs supervision. 191.25 Section 191.25 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) DRAWBACK Manufacturing Drawback § 191.25 Destruction under Customs...

  7. 19 CFR 19.1 - Classes of customs warehouses.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Classes of customs warehouses. 19.1 Section 19.1 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS WAREHOUSES, CONTAINER STATIONS AND CONTROL OF MERCHANDISE THEREIN § 19.1 Classes of...

  8. Superdeformed bands in [sup 191]Tl

    Energy Technology Data Exchange (ETDEWEB)

    Pilotte, S.; Yu, C.; Jin, H.Q.; Lewis, J.M.; Riedinger, L.L. (Department of Physics, University of Tennessee, Knoxville, Tennessee 37996 (United States)); Liang, Y.; Janssens, R.V.F.; Carpenter, M.P.; Khoo, T.L.; Lauritsen, T.; Soramel, F. (Argonne National Laboratory, Argonne, Illinois 60439 (United States)); Bearden, I.G. (Purdue University, West Lafayette, Indiana 47907 (United States)); Baktash, C.; Garrett, J.D.; Johnson, N.R.; Lee, I.Y.; McGowan, F.K. (Oak Ridge National Laboratory, Oak Ridge, Tennessee 37830 (United States))

    1994-02-01

    High spin states in the [sup 191]Tl nucleus have been populated via the [sup 159]Tb ([sup 36]S,4[ital n]) reaction at 165 MeV. Two weakly populated rotational bands have been observed with properties (energy spacings and dynamic moments of inertia) very similar to those of other superdeformed bands in the [ital A][similar to]190 region. The two bands can be interpreted as signature partners which exhibit some signature splitting for rotational frequencies [h bar][omega][ge]0.2 MeV. They are interpreted within the framework of cranked Woods-Saxon calculations as being based on the proton [ital i][sub 13/2]([Omega]=5/2) intruder orbital, in agreement with pairs of superdeformed bands seen in neighboring odd Tl nuclei.

  9. 47 CFR 87.191 - Foreign aircraft stations.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Foreign aircraft stations. 87.191 Section 87... AVIATION SERVICES Aircraft Stations § 87.191 Foreign aircraft stations. (a) Aircraft of member States of... States airspace only if a license has been issued by the State in which the aircraft is registered and...

  10. 49 CFR 192.191 - Design pressure of plastic fittings.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Design pressure of plastic fittings. 192.191... Components § 192.191 Design pressure of plastic fittings. (a) Thermosetting fittings for plastic pipe must conform to ASTM D 2517, (incorporated by reference, see § 192.7). (b) Thermoplastic fittings for plastic...

  11. 19 CFR 191.24 - Certificate of manufacture and delivery.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Certificate of manufacture and delivery. 191.24...; DEPARTMENT OF THE TREASURY (CONTINUED) DRAWBACK Manufacturing Drawback § 191.24 Certificate of manufacture... manufacturer or producer to another party, a certificate of manufacture and delivery shall be prepared and...

  12. 19 CFR 191.152 - Merchandise released from Customs custody.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Merchandise released from Customs custody. 191.152...; DEPARTMENT OF THE TREASURY (CONTINUED) DRAWBACK Merchandise Exported From Continuous Customs Custody § 191.152 Merchandise released from Customs custody. No remission, refund, abatement, or drawback of duty...

  13. 27 CFR 31.191 - Period of retention.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Period of retention. 31.191 Section 31.191 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS ALCOHOL BEVERAGE DEALERS Records and Reports Retention of Records and...

  14. 19 CFR 191.133 - Explanation of terms.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Explanation of terms. 191.133 Section 191.133 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE... or aircraft, changes the type of the vessel or aircraft, substantially prolongs the life of the...

  15. 19 CFR 191.37 - Destruction under Customs supervision.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Destruction under Customs supervision. 191.37 Section 191.37 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY... Customs supervision. A claimant may destroy merchandise and obtain unused merchandise drawback by...

  16. 19 CFR 191.171 - General; drawback allowance.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false General; drawback allowance. 191.171 Section 191...; drawback allowance. (a) General. Section 313(p) of the Act, as amended (19 U.S.C. 1313(p)), provides for... drawback under the manufacturing drawback law (19 U.S.C. 1313(a) or (b)). (b) Allowance of drawback...

  17. [Sensorial strabismus: a study of 191 cases].

    Science.gov (United States)

    Oliveira, Bráulio Folco Telles de; Bigolin, Silvane; Souza, Murilo Barreto; Polati, Mariza

    2006-01-01

    To evaluate the charts of patients with sensorial strabismus regarding range of different aspects, such as etiology, the type and the amount of deviation, relationship between the type of deviation and the patient's age when the disease occurred and the surgical outcome. A retrospective analysis of data charts of 191 patients seen at the section of Ophthalmology at the University of São Paulo, from September 1990 to July 2002. There were 84 male and 107 female patients. The most frequent diagnosis responsible for low vision in the squinted eye was atrophic chorioretinitis in 49 patients. Eighty-seven were exotropes and 97 were esotropes. Fifty patients were operated on, but 8 of them were lost to follow-up. In 90.5% the surgical outcome was successful: less than 15 prismatic diopters of hyper or undercorrection after surgery. The good surgical outcome seen in this and other studies enhances and justifies the need for surgical correction of this type of strabismus.

  18. An automated flow system incorporating in-line acid dissolution of bismuth metal from a cyclotron irradiated target assembly for use in the isolation of astatine-211

    Energy Technology Data Exchange (ETDEWEB)

    O’Hara, Matthew J.; Krzysko, Anthony J.; Niver, Cynthia M.; Morrison, Samuel S.; Owsley, Stanley L.; Hamlin, Donald K.; Dorman, Eric F.; Scott Wilbur, D.

    2017-04-01

    Astatine-211 (211At) is a promising cyclotron-produced radionuclide being investigated for use in targeted alpha therapy of blood borne and metastatic cancers, as well as treatment of tumor remnants after surgical resections. The isolation of trace quantities of 211At, produced within several grams of a Bi metal cyclotron target, involves a complex, multi-step procedure: (1) Bi metal dissolution in strong HNO3, (2) distillation of the HNO3 to yield Bi salts containing 211At, (3) dissolution of the salts in strong HCl, (4) solvent extraction of 211At from bismuth salts with diisopropyl ether (DIPE), and (5) back-extraction of 211At from DIPE into NaOH, leading to a purified 211At product. Step (1) has been addressed first to begin the process of automating the onerous 211At isolation process. A computer-controlled Bi target dissolution system has been designed. The system performs in-line dissolution of Bi metal from the target assembly using an enclosed target dissolution block, routing the resulting solubilized 211At/Bi mixture to the subsequent process step. The primary parameters involved in Bi metal solubilization (HNO3 concentration and influent flow rate) were optimized prior to evaluation of the system performance on replicate cyclotron irradiated targets. The results indicate that the system performs reproducibly, having nearly quantitative release of 211At from irradiated targets, with cumulative 211At recoveries that follow a sigmoidal function. The predictable nature of the 211At release profile allows the user to tune the system to meet target processing requirements.

  19. Reagents for astatination of biomolecules. 2. Conjugation of anionic boron cage pendant groups to a protein provides a method for direct labeling that is stable to in vivo deastatination.

    Science.gov (United States)

    Wilbur, D Scott; Chyan, Ming-Kuan; Hamlin, Donald K; Vessella, Robert L; Wedge, Timothy J; Hawthorne, M Frederick

    2007-01-01

    Cancer-targeting biomolecules labeled with 211At must be stable to in vivo deastatination, as control of the 211At distribution is critical due to the highly toxic nature of alpha-particle emission. Unfortunately, no astatinated aryl conjugates have shown in vivo stability toward deastatination when (relatively) rapidly metabolized proteins, such as monoclonal antibody Fab' fragments, are labeled. As a means of increasing the in vivo stability of 211At-labeled proteins, we have been investigating antibody conjugates of boron cage moieties. In this investigation, protein-reactive derivatives containing a nido-carborane (2), a bis-nido-carborane derivative (Venus Flytrap Complex, 3), and four 2-nonahydro-closo-decaborate(2-) derivatives (4-7) were prepared and conjugated with an antibody Fab' fragment such that subsequent astatination and in vivo tissue distributions could be obtained. To aid in determination of stability toward in vivo deastatination, the Fab'-borane conjugates were also labeled with 125I, and that material was coinjected with the 211At-labeled Fab'. For comparison, direct labeling of the Fab' with 125I and 211At was conducted. Direct labeling with Na[125I]I and Chloramine-T gave an 89% radiochemical yield. However, direct labeling of the Fab' with Na[211At]At and Chloramine-T resulted in a yield of Studies to optimize the closo-decaborate(2-) conjugates for protein labeling are underway.

  20. Phenotype abnormality: 191 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 191 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u697i decreased number... of light-harvesting complex in organ named vascular leaf ... vascular leaf ... present in fewer numbers in organism ...

  1. 19 CFR 191.175 - Drawback claimant; maintenance of records.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Drawback claimant; maintenance of records. 191.175... Drawback claimant; maintenance of records. (a) Drawback claimant. A drawback claimant under 19 U.S.C. 1313... party who issues the applicable certificate for the transferred article must expressly state on the...

  2. Estrabismo sensorial: estudo de 191 casos Sensorial strabismus: a study of 191 cases

    Directory of Open Access Journals (Sweden)

    Bráulio Folco Telles de Oliveira

    2006-02-01

    Full Text Available OBJETIVO: Avaliar os prontuários dos pacientes com estrabismo sensorial em aspectos variados, como etiologia, tipo e medida do desvio, correlação do tipo do desvio com a idade de aparecimento da doença de base, e resultado cirúrgico dos casos operados. MÉTODOS: Avaliação dos prontuários médicos dos pacientes com estrabismo sensorial atendidos no Hospital das Clínicas da Faculdade de Medicina da Universidade de São Paulo - USP - no setor de Motilidade Ocular Extrínseca, no período de setembro de 1990 a julho de 2002. RESULTADOS: Foram avaliados 84 pacientes masculinos e 107 femininos; o diagnóstico mais freqüente para baixa visual foi coriorretinite atrófica em 49 casos. Oitenta e sete pacientes tinham exotropia e 97 tinham esotropia. Oitenta e dois pacientes tiveram cirurgia indicada, e 50 foram operados. Em 42 deles, foi constatado sucesso cirúrgico de 90,5% (desvio longe e perto menor ou igual a 15 dioptrias prismáticas. CONCLUSÕES: O bom resultado cirúrgico observado neste e em outros estudos reforça a necessidade da correção cirúrgica nesses casos.PURPOSE: To evaluate the charts of patients with sensorial strabismus regarding range of different aspects, such as etiology, the type and the amount of deviation, relationship between the type of deviation and the patient's age when the disease occurred and the surgical outcome. METHODS: A retrospective analysis of data charts of 191 patients seen at the section of Ophthalmology at the University of São Paulo, from September 1990 to July 2002. RESULTS: There were 84 male and 107 female patients. The most frequent diagnosis responsible for low vision in the squinted eye was atrophic chorioretinitis in 49 patients. Eighty-seven were exotropes and 97 were esotropes. Fifty patients were operated on, but 8 of them were lost to follow-up. In 90.5% the surgical outcome was successful: less than 15 prismatic diopters of hyper or undercorrection after surgery. CONCLUSIONS: The

  3. miR-191: An emerging player in disease biology

    Directory of Open Access Journals (Sweden)

    Ritu eKulshreshtha

    2014-04-01

    Full Text Available Specific microRNAs have emerged as key players in disease biology by playing crucial role in disease development and progression. This review draws attention to one such microRNA, miR-191 that has been recently reported to be abnormally expressed in several cancers (>20 and various other diseases like diabetes-type 2, Crohn’s, pulmonary hypertension and Alzheimer’s. It regulates important cellular processes such as cell proliferation, differentiation, apoptosis and migration by targeting important transcription factors, chromatin remodelers and cell cycle associated genes. Several studies have demonstrated it to be an excellent biomarker for cancer diagnosis and prognosis leading to two patents already in its kitty. In this first review we summarize the current knowledge of the regulation, functions and targets of miR-191 and discuss its potential as a promising disease biomarker and therapeutic target.

  4. 19 CFR 191.173 - Imported duty-paid derivatives (no manufacture).

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Imported duty-paid derivatives (no manufacture). 191.173 Section 191.173 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND... § 191.173 Imported duty-paid derivatives (no manufacture). When the basis for drawback under 19 U.S.C...

  5. 19 CFR 191.184 - Merchandise transferred from continuous Customs custody.

    Science.gov (United States)

    2010-04-01

    ... custody. 191.184 Section 191.184 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND... From Customs Territory § 191.184 Merchandise transferred from continuous Customs custody. (a) Procedure..., for drawback on merchandise transferred to a foreign trade zone from continuous Customs custody. (b...

  6. 27 CFR 479.191 - Applicability of other provisions of internal revenue laws.

    Science.gov (United States)

    2010-04-01

    ... GUNS, DESTRUCTIVE DEVICES, AND CERTAIN OTHER FIREARMS Other Laws Applicable § 479.191 Applicability of other provisions of internal revenue laws. All of the provisions of the internal revenue laws not... provisions of internal revenue laws. 479.191 Section 479.191 Alcohol, Tobacco Products, and Firearms BUREAU...

  7. 9 CFR 381.191 - Distribution of inspected products to small lot buyers.

    Science.gov (United States)

    2010-01-01

    ... small lot buyers. 381.191 Section 381.191 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE...; Exportation; or Sale of Poultry or Poultry Products § 381.191 Distribution of inspected products to small lot... small lot buyers (such as small restaurants), distributors or jobbers may remove inspected and passed...

  8. Establishment of transgenic mice carrying gene encoding human zinc finger protein 191

    Science.gov (United States)

    Li, Jian-Zhong; Chen, Xia; Yang, Hua; Wang, Shui-Liang; Gong, Xue-Lian; Feng, Hao; Guo, Bao-Yu; Yu, Long; Wang, Zhu-Gang; Fu, Ji-Liang

    2004-01-01

    AIM: Human zinc finger protein 191 (ZNF191) was cloned and characterized as a Krüppel-like transcription factor, which might be relevant to many diseases such as liver cancer, neuropsychiatric and cardiovascular diseases. Although progress has been made recently, the biological function of ZNF191 remains largely unidentified. The aim of this study was to establish a ZNF 191 transgenic mouse model, which would promote the functional study of ZNF191. METHODS: Transgene fragments were microinjected into fertilized eggs of mice. The manipulated embryos were transferred into the oviducts of pseudo-pregnant female mice. The offsprings were identified by PCR and Southern blot analysis. ZNF 191 gene expression was analyzed by RT-PCR. Transgenic founder mice were used to establish transgenic mouse lineages. The first generation (F1) and the second generation (F2) mice were identified by PCR analysis. Ten-week transgenic mice were used for pathological examination. RESULTS: Four mice were identified as carrying copies of ZNF191 gene. The results of RT-PCR showed that ZNF 191 gene was expressed in the liver, testis and brain in one of the transgenic mouse lineages. Genetic analysis of transgenic mice demonstrated that ZNF 191 gene was integrated into the chromosome at a single site and could be transmitted stably. Pathological analysis showed that the expression of ZNF 191 did not cause obvious pathological changes in multiple tissues of transgenic mice. CONCLUSION: ZNF 191 transgenic mouse model would facilitate the investigation of biological functions of ZNF191 in vivo. PMID:14716836

  9. 19 CFR 191.71 - Drawback on articles destroyed under Customs supervision.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Drawback on articles destroyed under Customs supervision. 191.71 Section 191.71 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND... articles destroyed under Customs supervision. (a) Procedure. At least 7 working days before the intended...

  10. 19 CFR 191.1 - Authority of the Commissioner of Customs.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Authority of the Commissioner of Customs. 191.1 Section 191.1 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY... Customs. Pursuant to Treasury Department Order No. 165, Revised (T.D. 53654, 19 FR 7241), as amended, the...

  11. Accelerated fatigue testing of LM 19.1 blades

    Energy Technology Data Exchange (ETDEWEB)

    Dahl Kristensen, O.J.; Joergensen, E.R.

    2003-04-01

    A series of 19.1 metre wind turbine blades manufactured by LM Glasfiber A/S of Lunderskov, Denmark were subjected to a series of flapwise fatigue tests. The object of these fatigue tests is to evaluate the impact of an increased load on the blade in a fatigue test and to give information if it is possible to increase the load in fatigue test to shorten test time. The tests were carried out as a part of a project financed by the Danish Energy Agency. During the fatigue tests the blades have been surveyed with thermal imaging equipment to determine how an increase in fatigue load affects the blade material. In addition to the thermal imaging surveillance the blades were instrumented with strain gauges. This report presents the temperature during test, calibration test results, moment range measurements, strain statistics, thermal imaging registrations and a determination of the size and cause of the damages. The report is also giving information on the blade-to-blade variation. (au)

  12. Structure of $^{191}$Pb from $\\alpha$- and $\\beta$-decay spectroscopy

    CERN Document Server

    Cocolios, T E; Van de Walle, J; Franchoo, S; Marsh, B A; Sjoedin, A M; Huyse, M; Zemlyanoy, S; Cocolios, T E; Bastin, B; Barzakh, A; Page, R D; Mane, E; Van Duppen, P; Darby, I G; Venhart, M; Kudryavtsev, Yu; Huber, G; Fedosseev, V N; Andreyev, A N; Keupers, M; Flanagan, K T; Stefan, I; Dexters, W; Koester, U; Antalic, S; Buscher, J; Molkanov, P; Fedorov, D V

    2010-01-01

    Complementary studies of $^{191}$Pb have been made in the $\\beta$- decay of $^{191}$Bi at LISOL (CRC) and in the $\\alpha$- decay of $^{195}$Po at ISOLDE (CERN). Fine structures in the $\\alpha$- decay of the low-spin and high-spin isomers of $^{195}$Po have been fully resolved. Identification of the parent state is made possible via isomer selection based on narrow-band laser frequency scanning. The $\\alpha$-particle and $\\gamma$-ray energies have been determined with greater precision. New $\\alpha$-particle and $\\gamma$-ray energies are identified. Branching ratios in the decay of $^{195}$Po and $^{191}$Pb have been examined.

  13. Ferimentos cervicais: análise retrospectiva de 191 casos

    Directory of Open Access Journals (Sweden)

    Luiz Carlos Von Bahten

    Full Text Available OBJETIVOS: Analisar a epidemiologia e a conduta nos ferimentos cervicais. MÉTODO: Foram analisados 487.128 prontuários de pacientes que ingressaram no Serviço de Emergência do Hospital Universitário Cajuru no período de 01/1996 a 06/2001. Destes, selecionaram-se 378 pacientes com ferimentos cervicais. Foram excluídos 153 que apresentavam lesões associadas e 14 por óbito no atendimento inicial. O estudo foi feito , assim, em 191 pacientes com lesões cervicais exclusivas. Avaliou-se a localização da ferida, o mecanismo de trauma, o comprometimento do platisma, sinais e sintomas, a hora de admissão e a conduta empregada. RESULTADOS: Cento e sessenta e quatro (86% pacientes eram masculinos. A média de idade foi de 28 anos (10-72. Noventa (47% ferimentos foram por arma de fogo (FAF e 88 (46% por arma branca (FAB. O principal horário de admissão foi entre 20 e 04 horas. Quanto à localização, 53% das lesões foram à esquerda, 45% à direita e 2% medianos; 36% em zona I, 55% em zona II e 9% em zona III. Em 101 o ferimento penetrou o platisma: cinqüenta e um (50% apresentaram sinais e sintomas clínicos e receberam conduta operatória. As lesões vasculares foram as mais encontradas (20. Houve 24 (47% cervicotomias não-terapêuticas. O tratamento conservador foi empregado em 41 (45% casos de acordo com os exames físico e complementares. CONCLUSÕES: Homens jovens são mais acometidos quanto aos ferimentos cervicais. Estes ocorrem mais freqüentemente na zona II, e a incidência dos FAF e FAB foi equivalente. É adequado um manejo mais seletivo em relação aos ferimentos cervicais, devendo o manejo da zona II adequar-se à disposição de recursos dos serviços de trauma.

  14. 50 CFR 216.191 - Designation of Offshore Biologically Important Marine Mammal Areas.

    Science.gov (United States)

    2010-10-01

    ... Operations of Surveillance Towed Array Sensor System Low Frequency Active (SURTASS LFA sonar) Sonar § 216.191... nominated area warrants further study. If so, NMFS will begin a scientific review of the area. (e)(1) If...

  15. P53-miR-191-SOX4 regulatory loop affects apoptosis in breast cancer.

    Science.gov (United States)

    Sharma, Shivani; Nagpal, Neha; Ghosh, Prahlad C; Kulshreshtha, Ritu

    2017-08-01

    miRNAs have emerged as key participants of p53 signaling pathways because they regulate or are regulated by p53. Here, we provide the first study demonstrating direct regulation of an oncogenic miRNA, miR-191-5p, by p53 and existence of a regulatory feedback loop. Using a combination of qRT-PCR, promoter-luciferase, and chromatin-immunoprecipitation assays, we show that p53 brings about down-regulation of miR-191-5p in breast cancer. miR-191-5p overexpression brought about inhibition of apoptosis in breast cancer cell lines (MCF7 and ZR-75) as demonstrated by reduction in annexin-V stained cells and caspase 3/7 activity, whereas miR-191-5p down-regulation showed the opposite. We further unveiled that SOX4 was a direct target of miR-191-5p. SOX4 overexpression was shown to increase p53 protein levels in MCF7 cells. miR-191-5p overexpression brought about down-regulation of SOX4 and thus p53 levels, suggesting the existence of a regulatory feedback loop. Breast cancer treatment by doxorubicin, an anti-cancer drug, involves induction of apoptosis by p53; we thus wanted to check whether miR-191-5p affects doxorubicin sensitivity. Interestingly, Anti-miR-191 treatment significantly decreased the IC50 of the doxorubicin drug and thus sensitized breast cancer cells to doxorubicin treatment by promoting apoptosis. Overall, this work highlights the importance of the p53-miR-191-SOX4 axis in the regulation of apoptosis and drug resistance in breast cancer and offers a preclinical proof-of-concept for use of an Anti-miR-191 and doxorubicin combination as a rational approach to pursue for better breast cancer treatment. © 2017 Sharma et al.; Published by Cold Spring Harbor Laboratory Press for the RNA Society.

  16. Studies of radioactive cisplatin ({sup 191}Pt) for tumour imaging and therapy

    Energy Technology Data Exchange (ETDEWEB)

    Areberg, J

    2000-01-01

    A radioactive variant of the cytostatic agent cis-dichlorodiammineplatinum(II), cisplatin, was synthesised from {sup 191}PtCl{sub 4}. The {sup 191}Pt-cisplatin was found to be a sterile product of high radionuclide, radiochemical and chemical purity. The pharmacokinetics of platinum in tumour tissue and organs at risk of fourteen patients undergoing treatment with cisplatin were studied by exchanging a small fraction of the prescribed amount of cisplatin with {sup 191}Pt-cisplatin. The uptake and retention of platinum were investigated by gamma camera measurements up to ten days after infusion of {sup 191}Pt-cisplatin. Highest concentration of platinum was found in the liver, on average 5.7 {+-} 0.5 {mu}g/g normalised to a given amount of 180 mg cisplatin. Corresponding value for the kidneys was 1.9 {+-} 0.3 {mu}g/g. Uptake of platinum in tumours was visualised in five patients with an average maximum concentration of 4.9 {+-} 1.0 {mu}g/g normalised to a given amount of 180 mg cisplatin. The data from the pharmacokinetic study was used together with data from the literature to estimate the absorbed dose and effective dose to patients receiving radioactive cisplatin. The effective doses were calculated to be 0.10 {+-} 0.02 mSv/MBq, 0.17 {+-} 0.04 mSv/MBq and 0.23 {+-} 0.05 mSv/MBq for {sup 191}Pt-, {sup 193m}Pt-, and {sup 195m}Pt-cisplatin respectively. The combined effect of the radio- and chemotoxicity from {sup 191}Pt-cisplatin was investigated both in vitro and in vivo. A cervical cancer cell line was incubated with cisplatin or {sup 191}Pt-cisplatin with various concentrations and specific activities. It was shown that the surviving fraction was smaller for cells treated with {sup 191}Pt-cisplatin than for cells treated with the same concentration of non-radioactive cisplatin. The surviving fraction decreased with increasing specific activity. Isobologram technique showed that the radio- and chemotoxicity interacted in a supra-additive (synergistic) manner. In

  17. An outbreak of Salmonella Typhimurium DT191a associated with reptile feeder mice.

    Science.gov (United States)

    Harker, K S; Lane, C; De Pinna, E; Adak, G K

    2011-08-01

    In December 2008 an increase of tetracycline-resistant Salmonella Typhimurium definitive phage-type 191a (DT191a) was identified in England and Wales by the reference laboratory. This was confirmed to have a phage-typing pattern that had not previously been seen. Strong statistical evidence for an association between illness and keeping reptiles was demonstrated by a matched case-case study (mOR 16·82, 95% CI 2·78-∞). Questionnaires revealed an association with frozen reptile feeder mice, and mice representing 80% of the UK supply lines were tested for the presence of Salmonella. DT191a was found in three pools of sampled mice, which were traced back to a single supplier in the USA. Imports from this supplier were halted, and tighter regulations are now in place. A leaflet detailing how to prevent contracting Salmonella from pet reptiles has been published as well as updated advice on the Health Protection Agency's website.

  18. Extreme ultraviolet spectroscopy of G191-B2B - Direct observation of ionization edges

    Science.gov (United States)

    Wilkinson, Erik; Green, James C.; Cash, Webster

    1992-01-01

    We present the first spectrum of the hot, DA white dwarf G191-B2B (wd 0501 + 527) between 200 and 330 A. The spectrum, which has about 2 A resolution, was obtained with a sounding rocket-borne, grazing incidence spectrograph. The spectrum shows no evidence of He II, the expected primary opacity source in this wavelength region. Three ionization edges and one absorption feature were observed and are suggestive of O III existing in the photosphere of G191-B2B. Also noted is a broad spectral depression that may result from Fe VI in the photosphere.

  19. Spectroscopic Observation of G191-B2B Between 200 and 340 Angstroms

    Science.gov (United States)

    Wilkinson, E.; Green, J. C.; Cash, W. C.

    1992-05-01

    We present the first spectrum of the hot, DA white dwarf G191-B2B between 200 and 340 Angstroms . The spectrum was acquired using a sounding rocket borne EUV spectrograph launched from White Sands Missile Range on January 10, 1992 at 3:40 am GMT. The spectrum, which has ~1.5 Angstroms resolution, shows possible absorption features of ionized metals. Absorption features of HeII are remarkably absent. This observation rules out He as being the opacity source for lambda \\ short wavelength opacity source in the case of G191-B2B.

  20. 14 CFR 121.191 - Airplanes: Turbine engine powered: En route limitations: One engine inoperative.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Airplanes: Turbine engine powered: En route...: CERTIFICATION AND OPERATIONS OPERATING REQUIREMENTS: DOMESTIC, FLAG, AND SUPPLEMENTAL OPERATIONS Airplane Performance Operating Limitations § 121.191 Airplanes: Turbine engine powered: En route limitations: One...

  1. 26 CFR 31.3121(b)(19)-1 - Services of certain nonresident aliens.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 15 2010-04-01 2010-04-01 false Services of certain nonresident aliens. 31.3121... 1954) General Provisions § 31.3121(b)(19)-1 Services of certain nonresident aliens. (a) (1) Services performed after 1961 by a nonresident alien individual who is temporarily present in the United States as a...

  2. 19 CFR 191.5 - Guantanamo Bay, insular possessions, trust territories.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Guantanamo Bay, insular possessions, trust... SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) DRAWBACK General Provisions § 191.5 Guantanamo Bay, insular possessions, trust territories. Guantanamo Bay Naval Station shall be considered foreign territory...

  3. 37 CFR 2.191 - Business to be transacted in writing.

    Science.gov (United States)

    2010-07-01

    ..., DEPARTMENT OF COMMERCE RULES OF PRACTICE IN TRADEMARK CASES General Information and Correspondence in Trademark Cases § 2.191 Business to be transacted in writing. All business with the Office should be... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Business to be transacted in...

  4. Apiano de Alejandría, traductor (BC IV 45 y V 191

    Directory of Open Access Journals (Sweden)

    José B. Torres

    2006-06-01

    Full Text Available This paper defends that Appian regards as translations two passages in his work (cfr. BC IV 45 and V 191. Both translations show different features which may be explained from the point of view of ancient theories concerning translation.

  5. 19 CFR Appendix A to Part 191 - General Manufacturing Drawback Rulings

    Science.gov (United States)

    2010-04-01

    ... Will Be Used in the Production of the Exported Products Concentrated orange juice for manufacturing (of...) and 55207(1) (see § 191.9 of this part). D. Process of Manufacture or Production 1. Orange juice from... quantity of concentrated orange juice for manufacturing used in the production of the exported articles. It...

  6. A comparison of V/STOL handling requirements with the VAK-191B

    Science.gov (United States)

    Anderson, S. B.

    1977-01-01

    The two available V/STOL criteria references were compared with flight measurements obtained on the VAK-191B along with the pilot's comments relative to the aircraft meeting the specifications. Differences in the specifications themselves were also noted. Handling qualities requirements for shipboard operation were emphasized.

  7. MicroRNA-191 triggers keratinocytes senescence by SATB1 and CDK6 downregulation

    Energy Technology Data Exchange (ETDEWEB)

    Lena, A.M.; Mancini, M.; Rivetti di Val Cervo, P. [University of ' Tor Vergata' , Department of Experimental Medicine and Biochemical Sciences, Via Montpellier 1, Rome 00133 (Italy); Istituto Dermopatico dell' Immacolata-Istituto di Ricovero e Cura a Carattere Scientifico (IDI-IRCCS), Laboratory of Biochemistry c/o Department of Experimental Medicine and Biochemical Sciences, University of Rome ' Tor Vergata' , Rome 00133 (Italy); Saintigny, G.; Mahe, C. [CHANEL Parfums Beaute, 135 av. Charles de Gaulle, F 92521, Neuilly/Seine (France); Melino, G., E-mail: gerry.melino@uniroma2.it [University of ' Tor Vergata' , Department of Experimental Medicine and Biochemical Sciences, Via Montpellier 1, Rome 00133 (Italy); Istituto Dermopatico dell' Immacolata-Istituto di Ricovero e Cura a Carattere Scientifico (IDI-IRCCS), Laboratory of Biochemistry c/o Department of Experimental Medicine and Biochemical Sciences, University of Rome ' Tor Vergata' , Rome 00133 (Italy); Association Cell Death and Differentiation c/o Department of Experimental Medicine and Biochemical Sciences, University of Rome ' Tor Vergata' , Rome 00133 (Italy); and others

    2012-07-06

    Highlights: Black-Right-Pointing-Pointer miR-191 expression is upregulated in senescencent human epidermal keratinocytes. Black-Right-Pointing-Pointer miR-191 overexpression is sufficient per se to induce senescence in keratinocytes. Black-Right-Pointing-Pointer SATB1 and CDK6 are downregulated in senescence and are direct miR-191 targets. Black-Right-Pointing-Pointer SATB1 and CDK6 silencing by siRNA triggers senescence in HEKn cells. -- Abstract: Keratinocyte replicative senescence has an important role in time-dependent changes of the epidermis, a tissue with high turnover. Senescence encompasses growth arrest during which cells remain metabolically active but acquire a typical enlarged, vacuolar and flattened morphology. It is also accompanied by the expression of endogenous senescence-associated-{beta}-galactosidase and specific gene expression profiles. MicroRNAs levels have been shown to be modulated during keratinocytes senescence, playing key roles in inhibiting proliferation and in the acquisition of senescent markers. Here, we identify miR-191 as an anti-proliferative and replicative senescence-associated miRNA in primary human keratinocytes. Its overexpression is sufficient per se to induce senescence, as evaluated by induction of several senescence-associated markers. We show that SATB1 and CDK6 3 Prime UTRs are two miR-191 direct targets involved in this pathway. Cdk6 and Satb1 protein levels decrease during keratinocytes replicative senescence and their silencing by siRNA is able to induce a G1 block in cell cycle, accompanied by an increase in senescence-associated markers.

  8. 25 CFR 900.191 - Are employees of self-determination contractors providing health services under the self...

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 2 2010-04-01 2010-04-01 false Are employees of self-determination contractors providing health services under the self-determination contract protected by FTCA? 900.191 Section 900.191 Indians... HUMAN SERVICES CONTRACTS UNDER THE INDIAN SELF-DETERMINATION AND EDUCATION ASSISTANCE ACT Federal Tort...

  9. Cross Sections for (gamma)-ray Production in the 191Ir (n,xn(gamma)) Reactions

    Energy Technology Data Exchange (ETDEWEB)

    Fotiades, N; Nelson, R O; Devlin, M; Chadwick, M B; Talou, P; Becker, J A; Garrett, P E; Younes, W

    2005-01-11

    Discrete {gamma}-ray spectra have been measured for nuclei populated in {sup 191}Ir(n{sub 4}xn{gamma}) with x{<=}11, as a function of incident neutron energy using neutrons from the 'white' neutron source at the Los Alamos Neutron Science Center's WNR facility. The energy of the neutrons was determined using the time-of-flight technique. The data were taken using the GEANIE spectrometer. The cross sections for emission of 202 {gamma} rays of {sup 181-191}Ir were determined for neutron energies 0.2 MeV < E{sub n} < 300 MeV. Comparison with model calculations, using the GNASH reaction model, and with GEANIE results from the similar {sup 193}Ir(n{sub 4}xn{gamma}) reactions is made.

  10. Critical comments on the US Environmental Protection Agency Standards 40 CFR 191

    Energy Technology Data Exchange (ETDEWEB)

    Pflum, C.G. [Science Applications International Corp., Las Vegas, NV (United States); Van Konynenburg, R.A. [Lawrence Livermore National Lab., CA (United States); Krishna, P. [TRW, Inc., Washington, DC (United States)

    1993-01-14

    This paper is about the US Environmental Protection Agency (EPA) ``Environmental Standards for the Disposal of Spent Nuclear Fuel, High-Level and Transuranic Wastes,`` 40 CFR 191. These standards regulate the disposal of radioactive wastes in geologic repositories. Currently, two repository sites are under investigation: The Waste Isolation Pilot Plant (WIPP) site, located near Carlsbad, New Mexico, may become the repository for defense-generated transuranic waste (TRU); and the Yucca Mountain site, located near Las Vegas, Nevada, may become the repository for spent reactor fuel and a small amount of reprocessing waste (hereinafter called high-level radioactive waste or HLW). The paper was written for readers who have an interest in 40 CFR 191 but do not have the time or inclination to ponder the technical details.

  11. 40 CFR Appendix A to Part 194 - Certification of the Waste Isolation Pilot Plant's Compliance With the 40 CFR Part 191 Disposal...

    Science.gov (United States)

    2010-07-01

    ... Pilot Plant's Compliance With the 40 CFR Part 191 Disposal Regulations and the 40 CFR Part 194... ISOLATION PILOT PLANT'S COMPLIANCE WITH THE 40 CFR PART 191 DISPOSAL REGULATIONS Pt. 194, App. A Appendix A to Part 194—Certification of the Waste Isolation Pilot Plant's Compliance With the 40 CFR Part 191...

  12. Possible detection of an emission feature near 584 A in the direction of G191-B2B

    Science.gov (United States)

    Green, James; Bowyer, Stuart; Jelinsky, Patrick

    1990-01-01

    A possible spectral emission feature is reported in the direction of the nearby hot white dwarf G191-B2B at 581.5 + or - 6 A with a significance of 3.8 sigma. This emission has been identified as He I 584.3 A. The emission cannot be due to local geocoronal emission or interplanetary backscatter of solar He I 584 A emission because the feature is not detected in a nearby sky exposure. Possible sources for this emission are examined, including the photosphere of G191-B2B, the comparison star G191-B2A, and a possible nebulosity near or around G191-B2B. The parameters required to explain the emission are derived for each case. All of these explanations require unexpected physical conditions; hence we believe this result must receive confirming verification despite the statistical likelihood of the detection.

  13. miR-191 regulates mouse erythroblast enucleation by down-regulating Riok3 and Mxi1.

    Science.gov (United States)

    Zhang, Lingbo; Flygare, Johan; Wong, Piu; Lim, Bing; Lodish, Harvey F

    2011-01-15

    Using RNA-seq technology, we found that the majority of microRNAs (miRNAs) present in CFU-E erythroid progenitors are down-regulated during terminal erythroid differentiation. Of the developmentally down-regulated miRNAs, ectopic overexpression of miR-191 blocks erythroid enucleation but has minor effects on proliferation and differentiation. We identified two erythroid-enriched and developmentally up-regulated genes, Riok3 and Mxi1, as direct targets of miR-191. Knockdown of either Riok3 or Mxi1 blocks enucleation, and either physiological overexpression of miR-191 or knockdown of Riok3 or Mxi1 blocks chromatin condensation. Thus, down-regulation of miR-191 is essential for erythroid chromatin condensation and enucleation by allowing up-regulation of Riok3 and Mxi1.

  14. Towards a Standardized Line List for G 191-B2B and other DA Type Objects

    Science.gov (United States)

    Preval, S. P.; Barstow, M. A.; Holberg, J. B.; Dickinson, N. J.

    2013-01-01

    We present a comprehensive analysis of the far UV spectrum of G 191-B2B over the range of 900-1700Å using co-added data from the FUSE and STIS archives. While previous identifications made by Holberg et al. (2003) are reaffirmed in this work, it is found that many previously unidentified lines can now be attributed to Fe, Ni, and a few lighter metals. Future work includes extending this detailed analysis to a wider range of DA objects, in the expectation that a more complete analysis of their atmospheres can be realised.

  15. Excitation function of the 192Os(3He,4n)-reaction for production of 191Pt.

    Science.gov (United States)

    Qaim, S M; Hilgers, K; Sudár, S; Coenen, H H

    2009-06-01

    In search of an alternative production route of the therapeutically and environmentally interesting radionuclide (191)Pt (T(1/2)=2.8 d), excitation function of the (192)Os((3)He,4n)(191)Pt reaction was measured from its threshold up to 36 MeV. Thin samples of enriched (192)Os were prepared by electrodeposition on Ni-foils, and the conventional stacked-foil technique was used for cross-section measurements. The experimental data were compared with the results of theoretical calculations using the codes ALICE-IPPE and TALYS. Good agreement was found with TALYS. The theoretical thick target yield of (191)Pt over the energy range E(3He)=36-->25 MeV amounts to 6.7 MBq/microA h. A comparison of various investigated production methods of (191)Pt is given. The here investigated (192)Os((3)He,4n)-process leads to very high-purity (191)Pt (>99.5%).

  16. Iron abundance in the hot DA white dwarfs Feige 24 and G191 B2B

    Science.gov (United States)

    Vennes, Stephane; Chayer, Pierre; Thorstensen, John R.; Bowyer, Stuart; Shipman, Harry L.

    1992-01-01

    Attention is given to model calculations of the far- and extreme-UV line spectra of highly ionized Fe species (Fe IV, Fe V, and Fe VI) for hot high-gravity H-rich stars. A spectral analysis of 31 hr of exposure of the DA white dwarf Feige 24 with IUE in the echelle mode reveals the presence of Fe with an abundance relative to H by number of (5-10) x 10 exp -6 with an uncertainty dominated by the determination of stellar parameters. An analysis of IUE data from the white dwarf G191 B2B results in a similar Fe abundance if this star shares similar atmospheric parameters (Teff, g) with Feige 24. Fe is thus the second most abundant photospheric element in hot DA white dwarfs.

  17. Non-accidental injuries found in necropsies of domestic cats: a review of 191 cases.

    Science.gov (United States)

    de Siqueira, Adriana; Cassiano, Fabiana Cecília; de Albuquerque Landi, Marina Frota; Marlet, Elza Fernandes; Maiorka, Paulo César

    2012-10-01

    Animal cruelty is defined as a deliberate action that causes pain and suffering to an animal. In Brazil, legislation known as the Environmental Crimes Law states that cruelty toward all animal species is criminal in nature. From 644 domestic cats necropsied between January 1998 and December 2009, 191 (29.66%) presented lesions highly suggestive of animal cruelty. The main necroscopic finding was exogenous carbamate poisoning (75.39%) followed by blunt-force trauma (21.99%). Cats from 7 months to 2 years of age were the most affected (50.79%). In Brazil, violence is a public health problem and there is a high prevalence of domestic violence. Therefore, even if laws provide for animal welfare and protection, animals are common targets for violent acts. Within a context of social violence, cruelty toward animals is an important parameter to be considered, and the non-accidental lesions that were found are evidence of malicious actions.

  18. Overview of the AVT-191 Project to Assess Sensitivity Analysis and Uncertainty Quantification Methods for Military Vehicle Design

    Science.gov (United States)

    Benek, John A.; Luckring, James M.

    2017-01-01

    A NATO symposium held in 2008 identified many promising sensitivity analysis and un-certainty quantification technologies, but the maturity and suitability of these methods for realistic applications was not known. The STO Task Group AVT-191 was established to evaluate the maturity and suitability of various sensitivity analysis and uncertainty quantification methods for application to realistic problems of interest to NATO. The program ran from 2011 to 2015, and the work was organized into four discipline-centric teams: external aerodynamics, internal aerodynamics, aeroelasticity, and hydrodynamics. This paper presents an overview of the AVT-191 program content.

  19. The ubiquitin ligase Ubr2, a recognition E3 component of the N-end rule pathway, stabilizes Tex19.1 during spermatogenesis.

    Directory of Open Access Journals (Sweden)

    Fang Yang

    2010-11-01

    Full Text Available Ubiquitin E3 ligases target their substrates for ubiquitination, leading to proteasome-mediated degradation or altered biochemical properties. The ubiquitin ligase Ubr2, a recognition E3 component of the N-end rule proteolytic pathway, recognizes proteins with N-terminal destabilizing residues and plays an important role in spermatogenesis. Tex19.1 (also known as Tex19 has been previously identified as a germ cell-specific protein in mouse testis. Here we report that Tex19.1 forms a stable protein complex with Ubr2 in mouse testes. The binding of Tex19.1 to Ubr2 is independent of the second position cysteine of Tex19.1, a putative target for arginylation by the N-end rule pathway R-transferase. The Tex19.1-null mouse mutant phenocopies the Ubr2-deficient mutant in three aspects: heterogeneity of spermatogenic defects, meiotic chromosomal asynapsis, and embryonic lethality preferentially affecting females. In Ubr2-deficient germ cells, Tex19.1 is transcribed, but Tex19.1 protein is absent. Our results suggest that the binding of Ubr2 to Tex19.1 metabolically stabilizes Tex19.1 during spermatogenesis, revealing a new function for Ubr2 outside the conventional N-end rule pathway.

  20. CNV-association meta-analysis in 191,161 European adults reveals new loci associated with anthropometric traits

    DEFF Research Database (Denmark)

    Macé, Aurélien; Tuke, Marcus A; Deelen, Patrick

    2017-01-01

    There are few examples of robust associations between rare copy number variants (CNVs) and complex continuous human traits. Here we present a large-scale CNV association meta-analysis on anthropometric traits in up to 191,161 adult samples from 26 cohorts. The study reveals five CNV associations ...

  1. 10 CFR 501.191 - Use of natural gas or petroleum for certain unanticipated equipment outages and emergencies...

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false Use of natural gas or petroleum for certain unanticipated... Natural Gas or Petroleum for Emergency and Unanticipated Equipment Outage Purposes § 501.191 Use of natural gas or petroleum for certain unanticipated equipment outages and emergencies defined in section...

  2. CNV-association meta-analysis in 191,161 European adults reveals new loci associated with anthropometric traits

    NARCIS (Netherlands)

    Macé, Aurélien; Tuke, Marcus A; Deelen, Patrick; Kristiansson, Kati; Mattsson, Hannele; Nõukas, Margit; Sapkota, Yadav; Schick, Ursula; Porcu, Eleonora; Rüeger, Sina; McDaid, Aaron F; Porteous, David; Winkler, Thomas W; Salvi, Erika; Shrine, Nick; Liu, Xueping; Ang, Wei Q; Zhang, Weihua; Feitosa, Mary F; Venturini, Cristina; van der Most, Peter J; Rosengren, Anders; Wood, Andrew R; Beaumont, Robin N; Jones, Samuel E; Ruth, Katherine S; Yaghootkar, Hanieh; Tyrrell, Jessica; Havulinna, Aki S; Boers, Harmen; Mägi, Reedik; Kriebel, Jennifer; Müller-Nurasyid, Martina; Perola, Markus; Nieminen, Markku; Lokki, Marja-Liisa; Kähönen, Mika; Viikari, Jorma S; Geller, Frank; Lahti, Jari; Palotie, Aarno; Koponen, Päivikki; Lundqvist, Annamari; Rissanen, Harri; Bottinger, Erwin P; Afaq, Saima; Wojczynski, Mary K; Lenzini, Petra; Nolte, Ilja M; Sparsø, Thomas; Schupf, Nicole; Christensen, Kaare; Perls, Thomas T; Newman, Anne B; Werge, Thomas; Snieder, Harold; Spector, Timothy D; Chambers, John C; Koskinen, Seppo; Melbye, Mads; Raitakari, Olli T; Lehtimäki, Terho; Tobin, Martin D; Wain, Louise V; Sinisalo, Juha; Peters, Annette; Meitinger, Thomas; Martin, Nicholas G; Wray, Naomi R; Montgomery, Grant W; Medland, Sarah E; Swertz, Morris A; Vartiainen, Erkki; Borodulin, Katja; Männistö, Satu; Murray, Anna; Bochud, Murielle; Jacquemont, Sébastien; Rivadeneira, Fernando; Hansen, Thomas F; Oldehinkel, Albertine J; Mangino, Massimo; Province, Michael A; Deloukas, Panos; Kooner, Jaspal S; Freathy, Rachel M; Pennell, Craig; Feenstra, Bjarke; Strachan, David P; Lettre, Guillaume; Hirschhorn, Joel; Cusi, Daniele; Heid, Iris M; Hayward, Caroline; Männik, Katrin; Beckmann, Jacques S; Loos, Ruth J F; Nyholt, Dale R; Metspalu, Andres; Eriksson, Johan G; Weedon, Michael N; Salomaa, Veikko; Franke, Lude; Reymond, Alexandre; Frayling, Timothy M; Kutalik, Zoltán

    2017-01-01

    There are few examples of robust associations between rare copy number variants (CNVs) and complex continuous human traits. Here we present a large-scale CNV association meta-analysis on anthropometric traits in up to 191,161 adult samples from 26 cohorts. The study reveals five CNV associations at

  3. Clinical usefulness of ultrashort-lived iridium-191m from a carbon-based generator system for the evaluation of the left ventricular function.

    Science.gov (United States)

    Franken, P R; Dobbeleir, A A; Ham, H R; Brihaye, C; Guillaume, M; Knapp, F F; Vandevivere, J

    1989-06-01

    Ultrashort-lived 191mIr (4.96 sec; 63-74 and 129 keV photons) is potentially advantageous for first-pass radionuclide angiocardiography, offering the opportunity to perform repeat studies with very low absorbed radiation dose to the patient. Left ventricular (LV) first-pass studies were performed in 72 patients with 191mIr from a new bedside 1.3 Ci (48.1 GBq) 191Os/191mIr generator system using an activated carbon support that offers high 191mIr yields (15-18%) and consistent low 191Os breakthrough (2-4 x 10(-4)%/bolus). Using a single crystal digital gamma camera, uncorrected end-diastolic counts in the left ventricular representative cycle ranged from 10 up to 30 k counts. The reproducibility of repeated LV ejection fraction (LVEF) determination at 2-min intervals in 50 patients was r = 0.97, mean diff. = 2.08 +/- 1.55 EF units. Comparison between 191mIr (80-120 mCi; 2,960-4,400 MBq) and 99mTc (20-25 mCi; 750-925 MBq) LV count rates indicates a 3 wk useful shelf life of this new generator system for cardiac studies. Iridium-191m determined LVEF correlated closely with 99mTc determined LVEF in 32 patients (r = 0.96, mean diff. = 1.87 +/- 1.23 EF units). Parametric images for LV wall motion analysis were comparable with both isotopes. We conclude that rapid, repeat, and reproducible high count rate first-pass left ventricular studies can be obtained with 191mIr from this new 191Os/191mIr generator system using a single crystal digital gamma camera.

  4. k191yb.m77t and k191yb.h77t: MGD77T data and header files for single-beam bathymetry data for field activity K-1-91-YB in Yakutat Bay, Alaska from 06/22/1991 to 06/28/1991

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry data along with radar and GPS navigation data was collected as part of the U.S. Geological Survey cruise K-1-91-YB. The cruise was conducted...

  5. Pseudomonas Peritonitis in Australia: Predictors, Treatment, and Outcomes in 191 Cases

    Science.gov (United States)

    Siva, Brian; Hawley, Carmel M.; McDonald, Stephen P.; Brown, Fiona G.; Rosman, Johan B.; Wiggins, Kathryn J.; Bannister, Kym M.; Johnson, David W.

    2009-01-01

    Background and objectives: Pseudomonas peritonitis is a serious complication of peritoneal dialysis. To date, there as been no comprehensive, multicenter study of this condition. Design, setting, participants, & measurements: The predictors, treatment, and clinical outcomes of Pseudomonas peritonitis were examined by binary logistic regression and multilevel, multivariate Poisson regression in all Australian PD patients in 66 centers between 2003 and 2006. Results: A total of 191 episodes of Pseudomonas peritonitis (5.3% of all peritonitis episodes) occurred in 171 individuals. Its occurrence was independently predicted by Maori/Pacific Islander race, Aboriginal/Torres Strait Islander race, and absence of baseline peritoneal equilibration test data. Compared with other organisms, Pseudomonas peritonitis was associated with greater frequencies of hospitalization (96 versus 79%; P = 0.006), catheter removal (44 versus 20%; P < 0.001), and permanent hemodialysis transfer (35 versus 17%; P < 0.001) but comparable death rates (3 versus 2%; P = 0.4). Initial empiric antibiotic choice did not influence outcomes, but subsequent use of dual anti-pseudomonal therapy was associated with a lower risk for permanent hemodialysis transfer (10 versus 38%, respectively; P = 0.03). Catheter removal was associated with a lower risk for death than treatment with antibiotics alone (0 versus 6%; P < 0.05). Conclusions: Pseudomonas peritonitis is associated with high rates of catheter removal and permanent hemodialysis transfer. Prompt catheter removal and use of two anti-pseudomonal antibiotics are associated with better outcomes. PMID:19406972

  6. Draft Title 40 CFR 191 compliance certification application for the Waste Isolation Pilot Plant. Volume 1

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-03-31

    The Waste Isolation Pilot Plant (WIPP) is a research and development facility for the demonstration of the permanent isolation of transuranic radioactive wastes in a geologic formation. The facility was constructed in southeastern New Mexico in a manner intended to meet criteria established by the scientific and regulatory community for the safe, long-term disposal of transuranic wastes. The US Department of Energy (DOE) is preparing an application to demonstrate compliance with the requirements outlined in Title 40, Part 191 of the Code of Federal Regulations (CFR) for the permanent disposal of transuranic wastes. As mandated by the Waste Isolation Pilot Plant (WIPP) Land Withdrawal Act of 1992, the US Environmental Protection Agency (EPA) must evaluate this compliance application and provide a determination regarding compliance with the requirements within one year of receiving a complete application. Because the WIPP is a very complex program, the DOE has planned to submit the application as a draft in two parts. This strategy will allow for the DOE and the EPA to begin technical discussions on critical WIPP issues before the one-year compliance determination period begins. This report is the first of these two draft submittals.

  7. Deletion of the pluripotency-associated Tex19.1 gene causes activation of endogenous retroviruses and defective spermatogenesis in mice

    DEFF Research Database (Denmark)

    Ollinger, Rupert; Childs, Andrew J; Burgess, Hannah M

    2008-01-01

    . During male spermatogenesis, Tex19.1 expression is highest in mitotic spermatogonia and diminishes as these cells differentiate and progress through meiosis. In pluripotent stem cells, Tex19.1 expression is also downregulated upon differentiation. However, it is not clear whether Tex19.1 has an essential...... spermatogenesis. Immunostaining and histological analysis revealed defects in meiotic chromosome synapsis, the persistence of DNA double-strand breaks during meiosis, and a loss of post-meiotic germ cells in the testis. Furthermore, expression of a class of endogenous retroviruses is upregulated during meiosis...... in the Tex19.1(-/-) testes. Increased transposition of endogenous retroviruses in the germline of Tex19.1(-/-) mutant mice, and the concomitant increase in DNA damage, may be sufficient to disrupt the normal processes of recombination and chromosome synapsis during meiosis and cause defects...

  8. The mammalian-specific Tex19.1 gene plays an essential role in spermatogenesis and placenta-supported development.

    Science.gov (United States)

    Tarabay, Yara; Kieffer, Emmanuelle; Teletin, Marius; Celebi, Catherine; Van Montfoort, Aafke; Zamudio, Natasha; Achour, Mayada; El Ramy, Rosy; Gazdag, Emese; Tropel, Philippe; Mark, Manuel; Bourc'his, Déborah; Viville, Stéphane

    2013-08-01

    What is the consequence of Tex19.1 gene deletion in mice? The Tex19.1 gene is important in spermatogenesis and placenta-supported development. Tex19.1 is expressed in embryonic stem (ES) cells, primordial germ cells (PGCs), placenta and adult gonads. Its invalidation in mice leads to a variable impairment in spermatogenesis and reduction of perinatal survival. We generated knock-out mice and ES cells and compared them with wild-type counterparts. The phenotype of the Tex19.1 knock-out mouse line was investigated during embryogenesis, fetal development and placentation as well as during adulthood. We used a mouse model system to generate a mutant mouse line in which the Tex19.1 gene was deleted in the germline. We performed an extensive analysis of Tex19.1-deficient ES cells and assessed their in vivo differentiation potential by generating chimeric mice after injection of the ES cells into wild-type blastocysts. For mutant animals, a morphological characterization was performed for testes and ovaries and placenta. Finally, we characterized semen parameters of mutant animals and performed real-time RT-PCR for expression levels of retrotransposons in mutant testes and ES cells. While Tex19.1 is not essential in ES cells, our study points out that it is important for spermatogenesis and for placenta-supported development. Furthermore, we observed an overexpression of the class II LTR-retrotransposon MMERVK10C in Tex19.1-deficient ES cells and testes. The Tex19.1 knock-out phenotype is variable with testis morphology ranging from severely altered (in sterile males) to almost indistinguishable compared with the control counterparts (in fertile males). This variability in the testis phenotype subsequently hampered the molecular analysis of mutant testes. Furthermore, these results were obtained in the mouse, which has a second isoform (i.e. Tex19.2), while other mammals possess only one Tex19 (e.g. in humans). The fact that one gene has a role in both placentation and

  9. VizieR Online Data Catalog: NLTE spectral analysis of white dwarf G191-B2B (Rauch+, 2013)

    Science.gov (United States)

    Rauch, T.; Werner, K.; Bohlin, R.; Kruk, J. W.

    2013-08-01

    In the framework of the Virtual Observatory, the German Astrophysical Virtual Observatory developed the registered service TheoSSA. It provides easy access to stellar spectral energy distributions (SEDs) and is intended to ingest SEDs calculated by any model-atmosphere code. In case of the DA white dwarf G191-B2B, we demonstrate that the model reproduces not only its overall continuum shape but also the numerous metal lines exhibited in its ultraviolet spectrum. (3 data files).

  10. Preliminary comparison with 40 CFR Part 191, Subpart B for the Waste Isolation Pilot Plant, December 1990

    Energy Technology Data Exchange (ETDEWEB)

    Bertram-Howery, S.G.; Marietta, M.G.; Rechard, R.P.; Anderson, D.R. (Sandia National Labs., Albuquerque, NM (USA)); Swift, P.N. (Tech. Reps., Inc., Albuquerque, NM (USA)); Baker, B.L. (Technadyne Engineering Consultants, Inc., Albuquerque, NM (USA)); Bean, J.E. Jr.; McCurley, R.D.; Rudeen, D.K. (New Mexico Engineering Research Inst., Albuquerque, NM (USA)); Beyeler, W.; Brinster, K.F.; Guzowski, R.V.; Sch

    1990-12-01

    The Waste Isolation Pilot Plant (WIPP) is planned as the first mined geologic repository for transuranic (TRU) wastes generated by defense programs of the United States Department of Energy (DOE). Before disposing of waste at the WIPP, the DOE must evaluate compliance with the United states Environmental Protection Agency's (EPA) Standard, Environmental Radiation Protection Standards for Management and Disposal of Spent Nuclear Fuel, High-Level and Transuranic Radioactive Wastes (40 CFR Part 191, US EPA, 1985). Sandia National Laboratories (SNL) is evaluating long-term performance against criteria in Subpart B of the Standard. Performance assessment'' as used in this report includes analyses for the Containment Requirements ({section} 191.13(a)) and the Individual Protection Requirements ({section} 191.15). Because proving predictions about future human actions or natural events is not possible, the EPA expects compliance to be determined on the basis of specified quantitative analyses and informed, qualitative judgment. The goal of the WIPP performance-assessment team at SNL is to provide as detailed and thorough a basis as practical for the quantitative aspects of that decision. This report summarizes SNL's late-1990 understanding of the WIPP Project's ability to evaluate compliance with Subpart B. 245 refs., 88 figs., 23 tabs.

  11. Study of (n,2n reaction on 191,193Ir isotopes and isomeric cross section ratios

    Directory of Open Access Journals (Sweden)

    Vlastou R.

    2017-01-01

    Full Text Available The cross section of 191Ir(n,2n190Irg+m1 and 191Ir(n,2n190Irm2 reactions has been measured at 17.1 and 20.9 MeV neutron energies at the 5.5 MV tandem T11/25 Accelerator Laboratory of NCSR “Demokritos”, using the activation method. The neutron beams were produced by means of the 3H(d,n4He reaction at a flux of the order of 2 × 105 n/cm2s. The neutron flux has been deduced implementing the 27Al(n,α reaction, while the flux variation of the neutron beam was monitored by using a BF3 detector. The 193Ir(n,2n192Ir reaction cross section has also been determined, taking into account the contribution from the contaminant 191Ir(n,γ192Ir reaction. The correction method is based on the existing data in ENDF for the contaminant reaction, convoluted with the neutron spectra which have been extensively studied by means of simulations using the NeusDesc and MCNP codes. Statistical model calculations using the code EMPIRE 3.2.2 and taking into account pre-equilibrium emission, have been performed on the data measured in this work as well as on data reported in literature.

  12. Estrogen mediated-activation of miR-191/425 cluster modulates tumorigenicity of breast cancer cells depending on estrogen receptor status.

    Directory of Open Access Journals (Sweden)

    Gianpiero Di Leva

    Full Text Available MicroRNAs (miRNAs, single-stranded non-coding RNAs, influence myriad biological processes that can contribute to cancer. Although tumor-suppressive and oncogenic functions have been characterized for some miRNAs, the majority of microRNAs have not been investigated for their ability to promote and modulate tumorigenesis. Here, we established that the miR-191/425 cluster is transcriptionally dependent on the host gene, DALRD3, and that the hormone 17β-estradiol (estrogen or E2 controls expression of both miR-191/425 and DALRD3. MiR-191/425 locus characterization revealed that the recruitment of estrogen receptor α (ERα to the regulatory region of the miR-191/425-DALRD3 unit resulted in the accumulation of miR-191 and miR-425 and subsequent decrease in DALRD3 expression levels. We demonstrated that miR-191 protects ERα positive breast cancer cells from hormone starvation-induced apoptosis through the suppression of tumor-suppressor EGR1. Furthermore, enforced expression of the miR-191/425 cluster in aggressive breast cancer cells altered global gene expression profiles and enabled us to identify important tumor promoting genes, including SATB1, CCND2, and FSCN1, as targets of miR-191 and miR-425. Finally, in vitro and in vivo experiments demonstrated that miR-191 and miR-425 reduced proliferation, impaired tumorigenesis and metastasis, and increased expression of epithelial markers in aggressive breast cancer cells. Our data provide compelling evidence for the transcriptional regulation of the miR-191/425 cluster and for its context-specific biological determinants in breast cancers. Importantly, we demonstrated that the miR-191/425 cluster, by reducing the expression of an extensive network of genes, has a fundamental impact on cancer initiation and progression of breast cancer cells.

  13. ROSAT EUV and soft X-ray studies of atmospheric composition and structure in G191-B2B

    Science.gov (United States)

    Barstow, M. A.; Fleming, T. A.; Finley, D. S.; Koester, D.; Diamond, C. J.

    1993-01-01

    Previous studies of the hot DA white dwarf GI91-B2B have been unable to determine whether the observed soft X-ray and EUV opacity arises from a stratified hydrogen and helium atmosphere or from the presence of trace metals in the photosphere. New EUV and soft X-ray photometry of this star, made with the ROSAT observatory, when analyzed in conjunction with the earlier data, shows that the stratified models cannot account for the observed fluxes. Consequently, we conclude that trace metals must be a substantial source of opacity in the photosphere of G191-B2B.

  14. Summary Findings from the AVT-191 Project to Assess Sensitivity Analysis and Uncertainty Quantification Methods for Military Vehicle Design

    Science.gov (United States)

    Benek, John A.; Luckring, James M.

    2017-01-01

    A NATO symposium held in Greece in 2008 identified many promising sensitivity analysis and uncertainty quantification technologies, but the maturity and suitability of these methods for realistic applications was not clear. The NATO Science and Technology Organization, Task Group AVT-191 was established to evaluate the maturity and suitability of various sensitivity analysis and uncertainty quantification methods for application to realistic vehicle development problems. The program ran from 2011 to 2015, and the work was organized into four discipline-centric teams: external aerodynamics, internal aerodynamics, aeroelasticity, and hydrodynamics. This paper summarizes findings and lessons learned from the task group.

  15. Excitation function of the {sup 192}Os({sup 3}He,4n)-reaction for production of {sup 191}Pt

    Energy Technology Data Exchange (ETDEWEB)

    Qaim, S.M. [Institut fuer Neurowissenschaften und Biophysik, INB-4: Nuklearchemie, Forschungszentrum Juelich GmbH, D-52425 Juelich (Germany)], E-mail: s.m.qaim@fz-juelich.de; Hilgers, K.; Sudar, S.; Coenen, H.H. [Institut fuer Neurowissenschaften und Biophysik, INB-4: Nuklearchemie, Forschungszentrum Juelich GmbH, D-52425 Juelich (Germany)

    2009-06-15

    In search of an alternative production route of the therapeutically and environmentally interesting radionuclide {sup 191}Pt (T{sub 1/2}=2.8 d), excitation function of the {sup 192}Os({sup 3}He,4n){sup 191}Pt reaction was measured from its threshold up to 36 MeV. Thin samples of enriched {sup 192}Os were prepared by electrodeposition on Ni-foils, and the conventional stacked-foil technique was used for cross-section measurements. The experimental data were compared with the results of theoretical calculations using the codes ALICE-IPPE and TALYS. Good agreement was found with TALYS. The theoretical thick target yield of {sup 191}Pt over the energy range E{sub 3{sub H}{sub e}}=36{yields}25MeV amounts to 6.7 MBq/{mu}A h. A comparison of various investigated production methods of {sup 191}Pt is given. The here investigated {sup 192}Os({sup 3}He,4n)-process leads to very high-purity {sup 191}Pt (>99.5%)

  16. Derivation of airfoil characteristics for the LM 19.1 blade based on 3D CFD rotor calculations

    Energy Technology Data Exchange (ETDEWEB)

    Bak, C.; Soerensen, N.N.; Madsen, H.A. [Risoe National Lab., Roskilde (Denmark)

    1999-03-01

    Airfoil characteristics for the LM 19.1 blade are derived from 3D CFD computations on a full-scale 41-m rotor. Based on 3D CFD the force distributions on the blades are determined, from which airfoil characteristics are derived using the momentum theory. The final airfoil characteristics are constructed using both wind tunnel measurements and 3D CFD. Compared to 2D wind tunnel measurements they show a low lift in stall for the airfoil sections at the tip. At the airfoil sections at the inner part of the blade, they show a high lift in stall. At about 60% radius the lift agrees well to 2D wind tunnel measurements. Aero-elastic calculations using the final airfoil characteristics show good agreement to measured power and flap moments. Furthermore, a fatigue load analysis shows a reduction of up to 15% of the load compared to commonly used data. (au)

  17. The extreme ultraviolet spectrum of G191 - B2B and the ionization of the local interstellar medium

    Science.gov (United States)

    Green, James; Jelinsky, Patrick; Bowyer, Stuart

    1990-01-01

    The measurement of the extreme ultraviolet spectrum of the nearby hot white dwarf G191 - B2B is reported. The results are used to derive interstellar neutral column densities of 1.6 + or - 0.2 x 10 to the 18th/sq cm and 9.8 + 2.8 or - 2.6 x 10 to the 16th/sq cm for H I and He I, respectively. This ratio of neutral hydrogen to neutral helium indicates that the ionization of hydrogen along the line of sight is less than about 30 percent unless significant helium ionization is present. The scenario in which the hydrogen is highly ionized and the helium is neutral is ruled out by this observation.

  18. LEED STUDY OF Ag(111)-(√ 7×√ 7)R19.1^o-4Ar

    Science.gov (United States)

    Caragiu, Mellita; Diehl, Renee D.; Leatherman, Gerry S.

    2000-03-01

    Recent LEED studies of the adsorption geometries of Xe and Kr on metal surfaces have indicated that, contrary to expectations, the low-coordination adsorption sites are generally preferred, even on relatively corrugated surfaces such as Cu(1\\overline 1 0). This study extends the range of this phenomenon to include Ar. On Ag(111), Ar can form a commensurate structure, Ag(111)-(√ 7×√ 7)R19.1^o-4Ar, if the step sites are first blocked by preadsorbing another species such as CO. A dynamical LEED analysis of this structure at 33K indicates that the structure includes one atom per unit cell on a top site and the remaining three on bridge sites. This structure is clearly preferred over ones in which hollow sites are occupied, providing evidence that the preference of noble gases atoms for low-coordination sites on metals extends to Ar.

  19. Production, purification and application of extracellular chitinase from Cellulosimicrobium cellulans 191 Produção, purificação e aplicação da quitinase extracelular de Cellulosimicrobium cellulans 191

    Directory of Open Access Journals (Sweden)

    Luciana F. Fleuri

    2009-09-01

    Full Text Available This study concerned the production, purification and application of extracellular chitinase from Cellulosimicrobium cellulans strain 191. In shaken flasks the maximum yield of chitinase was 6.9 U/mL after 72 h of cultivation at 25ºC and 200 rpm. In a 5 L fermenter with 1.5 vvm aeration, the highest yield obtained was 4.19 U/mL after 168 h of fermentation at 25ºC and 200 rpm, and using 3 vvm, it was 4.38 U/mL after 144 h of fermentation. The chitinase (61 KDa was purified about 6.65 times by Sepharose CL 4B 200 gel filtration with a yield of 46.61%. The purified enzyme was able to lyse the cell walls of some fungi and to form protoplasts.O presente estudo visou a produção, purificação e aplicação da quitinase extracelular da linhagem Cellulosimicrobium cellulans 191. A maior produção de quitinase em frascos agitados foi 6,9 U/mL após 72 h de fermentação a 25ºC e 200 rpm. Em fermentador de 5 L utilizando aeração de 1,5 vvm, a maior atividade da enzima foi 4,19 U/mL após 168 h de fermentação a 25ºC e 200 rpm; e com 3 vvm, foi obtido 4,38 U/mL após 144 h de fermentação. A quitinase (61 KDa foi purificada cerca de 6,65 vezes em coluna de filtração em gel Sepharose CL 4B 200 com um rendimento de 46,61%. A enzima purificada foi capaz de lisar a parede celular de alguns fungos e formar protoplastos.

  20. MicroRNA-191, acting via the IRS-1/Akt signaling pathway, is involved in the hepatic insulin resistance induced by cigarette smoke extract.

    Science.gov (United States)

    Yang, Qianlei; Cui, Yan; Luo, Fei; Liu, Xinlu; Wang, Qiushi; Bai, Jun; Dong, Faqin; Sun, Qian; Lu, Lu; Xu, Hui; Xue, Junchao; Chen, Chao; Xiang, Quanyong; Liu, Qizhan; Zhang, Qingbi

    2017-09-29

    Cigarette smoke causes insulin resistance, which is associated with type 2 diabetes mellitus (T2DM). However, the mechanism by which this occurs remains poorly understood. Because the involvement of microRNAs (miRNAs) in the development of insulin resistance is largely unknown, we investigated, in hepatocytes, the roles of miR-191 in cigarette smoke extract (CSE)-induced insulin resistance. In L-02 cells, CSE not only decreased glucose uptake and glycogen levels but also reduced levels of insulin receptor substrate-1 (IRS-1) and Akt activation, effects that were blocked by SC79, an activator of Akt. CSE also increased miR-191 levels in L-02 cells. Furthermore, the inhibition of miR-191 blocked the decreases of IRS-1 and p-Akt levels, which antagonized the decreases of glucose uptake and glycogen levels in L-02 cells induced by CSE. These results reveal a mechanism by which miR-191 is involved in CSE-induced hepatic insulin resistance via the IRS-1/Akt signaling pathway, which helps to elucidate the mechanism for cigarette smoke-induced T2DM.

  1. Uncemented custom femoral components in hip arthroplasty. A prospective clinical study of 191 hips followed for at least 7 years.

    Science.gov (United States)

    Benum, Pål; Aamodt, Arild

    2010-08-01

    We have developed an individually designed, uncemented femoral component for achievement of improved strain distribution and fixation to the bone, to make uncemented stems more applicable in femurs of abnormal size and shape, and to improve the joint mechanics. Here we describe the design of the implant and present the results of a prospective clinical study with at least 7 years of follow-up. The prostheses are produced by CAD-CAM technique. The design of the stem is based on CT information, and the neck design is based on the surgeon's planning of the center of rotation, femoral head offset, and leg length correction. The first-generation stem produced before 2001 had a proximal HA coating and a sand-blasted distal part that was down-scaled to avoid contact with compact bone. The second-generation stem had a porous coating beneath the HA layer and the distal part of the stem was polished. The implant was used in 762 hips (614 patients) from 1995 until 2009. 191 of these hips were followed for 7 years and 83 others were followed for 10 years, and these hips are included in the present study. Mean age at surgery was 48 (20-65) years. Congenital dysplasia of the hip was the reason for osteoarthritis in 46% and 57% of the hips in respective groups. Merle d'Aubigné score was recorded in 152 and 75 hips in the two groups. Prostheses followed for 10 years, and almost all in the 7-year group, were first-generation stems. The 7- and 10-year cumulative revision rates were 1.1% and 2.4%, respectively, with stem revision for any reason as endpoint. The clinical results were similar at 7 and 10 years, with Merle d'Aubigné scores of 17. Intraoperative trochanteric fissures occurred in 2 of the 191 operations (1.0%); both healed after wiring. In hips followed for 7 years, 2 periprosthetic fractures occurred; exchange of the stem was necessary in both. One additional fracture occurred between 7 and 10 years, and it was treated successfully with osteosynthesis. The rate of

  2. Deuterium Abundance Toward G191-B2B: Results from the Far Ultraviolet Spectroscopic Explorer (FUSE) Mission

    Science.gov (United States)

    Lemoine, M.; Vidal-Madjar, A.; Hebrard, G.; Desert, J.-M.; Ferlet, R.; LecavelierdesEtangs, A.; Howk, J. C.; Andre, M.; Blair, W. P.; Friedman, S. D.; hide

    2002-01-01

    High-resolution spectra of the hot white dwarf G191-B2B covering the wavelength region 905-1187A were obtained with the Far Ultraviolet Spectroscopic Explorer (FUSE). This data was used in conjunction with existing high-resolution Hubble Space Telescope STIS observations to evaluate the total H(sub I), D(sub I), O(sub I) and N(sub I) column densities along the line of sight. Previous determinations of N(D(sub I)) based upon GHRS (Goddard High Resolution Spectrograph) and STIS (Space Telescope Imaging Spectrograph) observations were controversial due to the saturated strength of the D(sub I) Lyman alpha line. In the present analysis the column density of D(sub I) has been measured using only the unsaturated Lyman beta and Lyman gamma lines observed by FUSE. A careful inspection of possible systematic uncertainties tied to the modeling of the stellar continuum or to the uncertainties in the FUSE instrumental character series has been performed. The column densities derived are: log N(D(sub I)) = 13.40+/-0.07, log N(O(sub I)) = 14.86+/-0.07, and log N(N(sub I)) = 13.87+/-0.07 quoted with 2sigma, uncertainties. The measurement of the H(sub I) column density by profile fitting of the Lyman alpha line has been found to be unsecure. If additional weak hot interstellar components are added to the three detected clouds along the line of sight, the H(sub I)) column density can be reduced quite significantly, even though the signal-to-noise ratio and spectral resolution at Lyman alpha are excellent. The new estimate of N(H(sub I)) toward G191-B2B reads: logN(H (sub I)) = 18.18+/-0.18 (2sigma uncertainty), so that the average (D/H) ratio on the line of sight is: (D/H)= 1.66(+0.9/-0.6) x 10(exp -5) (2sigma uncertainty).

  3. Constitutional rights to health, public health and medical care: the status of health protections in 191 countries.

    Science.gov (United States)

    Heymann, Jody; Cassola, Adèle; Raub, Amy; Mishra, Lipi

    2013-07-01

    United Nations (UN) member states have universally recognised the right to health in international agreements, but protection of this right at the national level remains incomplete. This article examines the level and scope of constitutional protection of specific rights to public health and medical care, as well as the broad right to health. We analysed health rights in the constitutions of 191 UN countries in 2007 and 2011. We examined how rights protections varied across the year of constitutional adoption; national income group and region; and for vulnerable groups within each country. A minority of the countries guaranteed the rights to public health (14%), medical care (38%) and overall health (36%) in their constitutions in 2011. Free medical care was constitutionally protected in 9% of the countries. Thirteen per cent of the constitutions guaranteed children's right to health or medical care, 6% did so for persons with disabilities and 5% for each of the elderly and the socio-economically disadvantaged. Valuable next steps include regular monitoring of the national protection of health rights recognised in international agreements, analyses of the impact of health rights on health outcomes and longitudinal multi-level studies to assess whether specific formulations of the rights have greater impact.

  4. Six Years of Experience in Photodynamic Therapy for Basal Cell Carcinoma: Results and Fluorescence Diagnosis from 191 Lesions

    Directory of Open Access Journals (Sweden)

    M. Fernández-Guarino

    2014-01-01

    Full Text Available Background. Photodynamic therapy (PDT has become a therapeutic option for basal cell carcinoma (BCC in the last decade. Objectives. To study the results and predictors of BCC response to treatment with PDT and to evaluate fluorescence diagnosis of BCC. Methods. A descriptive, retrospective, and observational study was carried out. Patients with biopsy-confirmed BCC who were treated with methyl aminolevulinate and red light according to standard treatment protocols (2 sessions separated by 2 weeks, 630 nm, 37 J/cm2, 8 minutes, Aktilite were selected. Response was scored as clinically complete and incomplete and the patients were followed up every three months. Results. Data from 191 BCC in 181 patients with a mean age of 69.55 years and a mean follow-up period of 34.4 months were collected. The overall response was 74% of the BCC treated, with the best response in superficial BCC with a 95% of complete response. The regression analysis revealed that the superficial histological type was the primary factor predictive of a complete response. Conclusions. In the treatment of BCC with PDT, the most significant factor for predicting response is the histological type.

  5. Detection of 191 Taxifolin Metabolites and Their Distribution in Rats Using HPLC-ESI-IT-TOF-MSn

    Directory of Open Access Journals (Sweden)

    Ping Yang

    2016-09-01

    Full Text Available Taxifolin is a ubiquitous bioactive constituent of foods and herbs. To thoroughly explore its metabolism in vivo, an HPLC-ESI-IT-TOF-MSn method combined with specific metabolite detection strategy was used to detect and identify the metabolites of taxifolin in rats. Of the 191 metabolites tentatively identified, 154 were new metabolites, 69 were new compounds and 32 were dimers. This is the first report of the in vivo biotransformation of a single compound into more than 100 metabolites. Furthermore, acetylamination and pyroglutamic acid conjugation were identified as new metabolic reactions. Seventeen metabolites were found to have various taxifolin-related bioactivities. The potential targets of taxifolin and 63 metabolites were predicted using PharmMapper, with results showing that more than 60 metabolites have the same five targets. Metabolites with the same fragment pattern may have the same pharmacophore. Thus these metabolites may exert the same pharmacological effects as taxifolin through an additive effect on the same drug targets. This observation indicates that taxifolin is bioactive not only in the parent form, but also through its metabolites. These findings enhance understanding of the metabolism and effective forms of taxifolin and may provide further insight of the beneficial effects of taxifolin and its derivatives.

  6. A comprehensive near- and far-ultraviolet spectroscopic study of the hot DA white dwarf G191-B2B

    Science.gov (United States)

    Preval, S. P.; Barstow, M. A.; Holberg, J. B.; Dickinson, N. J.

    2013-11-01

    We present a detailed spectroscopic analysis of the hot DA white dwarf G191-B2B, using the best signal-to-noise ratio, high-resolution near- and far-UV spectrum obtained to date. This is constructed from co-added Hubble Space Telescope (HST) Space Telescope Imaging Spectrometer (STIS) E140H, E230H and FUSE observations, covering the spectral ranges of 1150-3145 Å and 910-1185 Å, respectively. With the aid of recently published atomic data, we have been able to identify previously undetected absorption features down to equivalent widths of only a few mÅ. In total, 976 absorption features have been detected to 3σ confidence or greater, with 947 of these lines now possessing an identification, the majority of which are attributed to Fe and Ni transitions. In our survey, we have also potentially identified an additional source of circumstellar material originating from Si III. While we confirm the presence of Ge detected by Vennes et al., we do not detect any other species. Furthermore, we have calculated updated abundances for C, N, O, Si, P, S, Fe and Ni, while also calculating, for the first time, a non-local thermodynamic equilibrium abundance for Al, deriving Al III/H=1.60_{-0.08}^{+0.07}× {10}^{-7}. Our analysis constitutes what is the most complete spectroscopic survey of any white dwarf. All observed absorption features in the FUSE spectrum have now been identified, and relatively few remain elusive in the STIS spectrum.

  7. Draft forecast of the final report for the comparison to 40 CFR Part 191, Subpart B, for the Waste Isolation Pilot Plant

    Energy Technology Data Exchange (ETDEWEB)

    Bertram-Howery, S.G.; Marietta, M.G.; Anderson, D.R.; Gomez, L.S.; Rechard, R.P. (Sandia National Labs., Albuquerque, NM (USA)); Brinster, K.F.; Guzowski, R.V. (Science Applications International Corp., Albuquerque, NM (USA))

    1989-12-01

    The United States Department of Energy is planning to dispose of transuranic wastes, which have been generated by defense programs, at the Waste Isolation Pilot Plant. The WIPP Project will assess compliance with the requirements of the United States Environmental Protection Agency. This report forecasts the planned 1992 document, Comparison to 40 CFR, Part 191, Subpart B, for the Waste Isolation Pilot Plant (WIPP). 130 refs., 36 figs., 11 tabs.

  8. Sweet Taste Receptor TAS1R2 Polymorphism (Val191Val) Is Associated with a Higher Carbohydrate Intake and Hypertriglyceridemia among the Population of West Mexico

    OpenAIRE

    Omar Ramos-Lopez; Arturo Panduro; Erika Martinez-Lopez; Sonia Roman

    2016-01-01

    Some high-carbohydrate diets may lead to obesity and multiple metabolic disorders, including hypertriglyceridemia (HTG). This lipid abnormality is considered an important risk factor for cardiovascular disease and type 2 diabetes. The sweet taste receptor TAS1R2 polymorphism (Ile191Val) has been reported to be associated with carbohydrate intake. The aim of this study was to analyze the association of the TAS1R2 gene polymorphism with carbohydrate intake and HTG among the population of West M...

  9. Implementation of the Resource Disincentive in 40 CFR part 191.14 (e) at the Waste Isolation Pilot Plant. Revision 1

    Energy Technology Data Exchange (ETDEWEB)

    1993-06-01

    In 1986, the US Department of Energy (DOE) Waste Isolation Pilot Plant (WIPP) Project Office (WPO) (DOE-WPO) prepared a strategy for complying with the Environmental Protection Agency`s (EPA`s) Standards for the management of transuranic (TRU) waste. Section 3.2.2.2 of the DOE`s report addressed compliance with the Assurance Requirements found in 40 CFR {section} 191.14. One of the Assurance Requirements addresses the selection of repository sites that contain recoverable natural resources. This report documents that the site selection process for the WIPP facility did indeed comply with the natural resource disincentive requirement in 40 CFR {section} 191,14(e) at the time selected and therefore complies with the standard at this time. Thus, it shall be shown that it is reasonably certain that the WIPP site provides better overall protection than practical alternatives that were available when the site was selected. It is important to point out here, and it will be discussed later in the report, that the resource disincentive requirement is a preliminary siting criterion that requires further evaluation of sites that have resources (i.e, hydrocarbons, minerals and groundwater) in the vicinity or on the site. This further evaluation requires that for sites that do have resources, a qualitative determination must be made that the site will provide better overall protection than practical alternatives. The purpose of this report is not to provide a quantitative evaluation for selection of the WIPP site. A further discussion on the difference between the qualitative analysis required under 40 CFR {section} 191.14(e) and the quantitative analysis under other sections of 40 CFR 191 is provided in {section}2.1 of this report.

  10. The phenotype of polycythemia due to Croatian homozygous VHL (571C>G:H191D) mutation is different from that of Chuvash polycythemia (VHL 598C>T:R200W).

    Science.gov (United States)

    Tomasic, Nikica Ljubas; Piterkova, Lucie; Huff, Chad; Bilic, Ernest; Yoon, Donghoon; Miasnikova, Galina Y; Sergueeva, Adelina I; Niu, Xiaomei; Nekhai, Sergei; Gordeuk, Victor; Prchal, Josef T

    2013-04-01

    Mutations of VHL (a negative regulator of hypoxia-inducible factors) have position-dependent distinct cancer phenotypes. Only two known inherited homozygous VHL mutations exist and they cause polycythemia: Chuvash R200W and Croatian H191D. We report a second polycythemic Croatian H191D homozygote distantly related to the first propositus. Three generations of both families were genotyped for analysis of shared ancestry. Biochemical and molecular tests were performed to better define their phenotypes, with an emphasis on a comparison with Chuvash polycythemia. The VHL H191D mutation did not segregate in the family defined by the known common ancestors of the two subjects, suggesting a high prevalence in Croatians, but haplotype analysis indicated an undocumented common ancestor ∼six generations ago as the founder of this mutation. We show that erythropoietin levels in homozygous VHL H191D individuals are higher than in VHL R200W patients of similar ages, and their native erythroid progenitors, unlike Chuvash R200W, are not hypersensitive to erythropoietin. This observation contrasts with a report suggesting that polycythemia in VHL R200W and H191D homozygotes is due to the loss of JAK2 regulation from VHL R200W and H191D binding to SOCS1. In conclusion, our studies further define the hematologic phenotype of VHL H191D and provide additional evidence for phenotypic heterogeneity associated with the positional effects of VHL mutations.

  11. Preliminary performance assessment for the Waste Isolation Pilot Plant, December 1992. Volume 4: Uncertainty and sensitivity analyses for 40 CFR 191, Subpart B

    Energy Technology Data Exchange (ETDEWEB)

    1993-08-01

    Before disposing of transuranic radioactive waste in the Waste Isolation Pilot Plant (WIPP), the United States Department of Energy (DOE) must evaluate compliance with applicable long-term regulations of the United States Environmental Protection Agency (EPA). Sandia National Laboratories is conducting iterative performance assessments (PAs) of the WIPP for the DOE to provide interim guidance while preparing for a final compliance evaluation. This volume of the 1992 PA contains results of uncertainty and sensitivity analyses with respect to the EPA`s Environmental Protection Standards for Management and Disposal of Spent Nuclear Fuel, High-Level and Transuranic Radioactive Wastes (40 CFR 191, Subpart B). Additional information about the 1992 PA is provided in other volumes. Results of the 1992 uncertainty and sensitivity analyses indicate that, conditional on the modeling assumptions, the choice of parameters selected for sampling, and the assigned parameter-value distributions, the most important parameters for which uncertainty has the potential to affect compliance with 40 CFR 191B are: drilling intensity, intrusion borehole permeability, halite and anhydrite permeabilities, radionuclide solubilities and distribution coefficients, fracture spacing in the Culebra Dolomite Member of the Rustler Formation, porosity of the Culebra, and spatial variability of Culebra transmissivity. Performance with respect to 40 CFR 191B is insensitive to uncertainty in other parameters; however, additional data are needed to confirm that reality lies within the assigned distributions.

  12. Preliminary performance assessment for the Waste Isolation Pilot Plant, December 1992. Volume 1, Third comparison with 40 CFR 191, Subpart B

    Energy Technology Data Exchange (ETDEWEB)

    1992-12-01

    Before disposing of transuranic radioactive wastes in the Waste Isolation Pilot Plant (WIPP), the United States Department of Energy (DOE) must evaluate compliance with applicable long-term regulations of the United States Environmental Protection Agency (EPA). Sandia National Laboratories is conducting iterative performance assessments of the WIPP for the DOE to provide interim guidance while preparing for final compliance evaluations. This volume contains an overview of WIPP performance assessment and a preliminary comparison with the long-term requirements of the Environmental Radiation Protection Standards for Management and Disposal of Spent Nuclear Fuel, High-Level and Transuranic Radioactive Wastes (40 CFR 191, Subpart B).

  13. Chain yields from 19.1 MeV neutron-induced fission of sup 2 sup 3 sup 5 U

    CERN Document Server

    Bao Jie; Feng Jing; Guo Jing Ru; Li Ze; LiuYongHui; Sun Hong Qing; Yang Yi; Zhang Sheng Dong

    2001-01-01

    Chain yields for 35 mass chains were determined for the fission of sup 2 sup 3 sup 5 U induced by 19.1 MeV neutrons for the first time. Absolute fission rate was monitored with a double fission chamber; fission product activities were measured by HPGe gamma-ray spectrometry. Threshold detector method was used to measured the neutron spectrum in order to estimate the fission events induced by break-up neutrons and scattering neutrons from the environment. A mass distribution curve has been obtained

  14. ECHELLE SPECTROSCOPY OF THE NUCLEI OF THE HIGHLY COLLIMATED BIPOLAR PLANETARY NEBULAE M 2-9 AND M 1-91

    OpenAIRE

    S. Torres-Peimbert; Arrieta, A; Bautista, M.

    2010-01-01

    Presentamos espectroscopía echelle del núcleo sin resolver de las nebulosas bipolares M 2-9 and M 1-91. Los espectros están dominados por líneas de emisión emitidas en un amplio intervalo de condiciones físicas. De las observaciones identificamos las líneas de emisión, las condiciones físicas y los movimientos relativos de las diferentes especies ionizadas en la región circunestelar de ambos objetos. Proponemos que las líneas prohibidas observadas se originan en la parte interior del toro ext...

  15. The p.T191M mutation of the CBS gene is highly prevalent among homocystinuric patients from Spain, Portugal and South America

    OpenAIRE

    Urreizti, Roser; Asteggiano, Carla; Bermudez, Marta; Cordoba, Alfonso; Szlago, Marina; Grosso, Carola; de Kremer, Raquel Dodelson; D'Almeida, Vânia; Martinez-Pardo, Mercedes; Pena-Quintana, Luis; Dalmau, Jaime; Rodes, Marta; Vilaseca, Maria Antonia; Balcells, Susana; Grinberg, Daniel

    2006-01-01

    Classical homocystinuria is due to cystathionine beta-synthase (CBS) deficiency. More than 130 mutations, which differ in prevalence and severity, have been described at the CBS gene. Mutation p.I278T is very prevalent, has been found in all European countries where it has been looked for with the exception of the Iberian peninsula, and is known to respond to vitamin B-6. On the other hand, mutation p.T191M is prevalent in Spain and Portugal and does not respond to B-6. We analysed 30 pedigre...

  16. A comparison of the V/STOL handling qualities of the VAK-191B with the requirements of AGARD report 577 and MIL-F-83300

    Science.gov (United States)

    Anderson, S. B.

    1979-01-01

    The handling qualities of the VAK-191B VTOL aircraft are compared with current V/STOL handling qualities requirements. The aircraft handling qualities were superior to other V/STOL fighter aircraft. Several deficiencies which would seriously affect shipboard V/STOL operation includes: (1) poor hovering precision; (2) inadequate mechanical control characteristics; (3) nonlinear pitch and roll response; (4) an uncommanded movement of the height control lever; (5) low pitch control sensitivity; (6) excessive dihedral effect; and (7) inadequate overall thrust response. The attitude command control system resulted on reduced pilot workload during hover and low speed flight.

  17. The discovery of Ni V in the photospheres of the hot DA white dwarfs RE 2214-492 and G191-B2B

    Science.gov (United States)

    Holberg, J. B.; Hubeny, I.; Barstow, M. A.; Lanz, T.; Sion, E. M.; Tweedy, R. W.

    1994-01-01

    We have co-added six recently obtained International Ultraviolet Explorer (IUE) echelle spectra of the hot DA white dwarf RE 2214-492 and 10 existing archive spectra of the well-known hot DA, G191-B2B. We find that both stars contain numerous weak features due to Ni V. Nickel is thus the second iron-group element to be found in the spectra of the very hottest DA white dwarfs. In addition to Ni V, we also observe Al III in both stars and present evidence for the possible presence of Ni IV and Fe IV in RE 2214-492. The presence of Ni and Al, together with previously reported elements, will contribute significantly to both the EUV opacity and to the apparent complexity of the UV spectra of these stars. Using Non-Local Thermodynamic Equilibrium (NLTE) model atmospheres we estimate the Ni abundances in RE 2214-492 the G191-B2B to be log(Ni/H) = -5.5 +/- 0.3 and -6.0 +/- 0.3, respectively.

  18. Mass distribution in 19.1 MeV neutron-induced fission of sup 2 sup 3 sup 5 U

    CERN Document Server

    Bao Jie; Yang Yi; Feng Jing; Li Ze; Cui An Zhi; Sun Hong Qing; Zhang Sheng Dong; Guo Jing Ru

    2002-01-01

    35 chain yields are determined for the fission of sup 2 sup 3 sup 5 U induced by 19.1 MeV neutrons by HPGe gamma-ray spectrometry. Absolute fission rate is monitored with a double-fission chamber. The efficiency of the fission chamber is checked with absolute determination of sup 1 sup 9 sup 8 Au activity from sup 1 sup 9 sup 7 Au (n, gamma) sup 1 sup 9 sup 8 Au reaction for the first time. Fission product activities of irradiated sup 2 sup 3 sup 5 U foils are measured by HPGe gamma-ray spectrometry without chemical separation. Threshold detector method is used to estimate the fission events induced by neutrons of other energies

  19. X-ray structures of two proteins belonging to Pfam DUF178 revealed unexpected structural similarity to the DUF191 Pfam family

    Directory of Open Access Journals (Sweden)

    Burley Stephen K

    2007-10-01

    Full Text Available Abstract Background Pfam is a comprehensive collection of protein domains and families, with a range of well-established information including genome annotation. Pfam has two large series of functionally uncharacterized families, known as Domains of Unknown Function (DUFs and Uncharacterized Protein Families (UPFs. Results Crystal structures of two proteins from Deinococcus radiodurans and Streptomyces coelicolor belonging to Pfam protein family DUF178 (ID: PF02621 have been determined using Selenium-Single-wavelength Anomalous Dispersion (Se-SAD. Based on the structure, we have identified the putative function for this family of protein. Conclusion Unexpectedly, we found that DUF178 Pfam is remarkably similar to Pfam family DUF191 suggesting that the sequence-based classification alone may not be sufficient to classify proteins into Pfam families.

  20. Searches for neutral Higgs bosons in $e^+ e^-$ collisions from $\\sqrt{s}$ = 191.6 to 201.7 GeV

    CERN Document Server

    Abdallah, J.; Adam, W.; Adzic, P.; Albrecht, Z.; Alderweireld, T.; Alemany-Fernandez, R.; Allmendinger, T.; Allport, P.P.; Almehed, S.; Amaldi, U.; Amapane, N.; Amato, S.; Anashkin, E.; Andreazza, A.; Andringa, S.; Anjos, N.; Antilogus, P.; Apel, W.D.; Arnoud, Y.; Ask, S.; Asman, B.; Augustin, J.E.; Augustinus, A.; Baillon, P.; Ballestrero, A.; Bambade, P.; Barbier, R.; Bardin, D.; Barker, G.J.; Baroncelli, A.; Battaglia, M.; Baubillier, M.; Becks, K.H.; Begalli, M.; Behrmann, A.; Bellunato, T.; Benekos, N.; Benvenuti, A.; Berat, C.; Berggren, M.; Berntzon, L.; Bertrand, D.; Besancon, M.; Besson, N.; Bloch, D.; Blom, M.; Bonesini, M.; Boonekamp, M.; Booth, P.S.L.; Borisov, G.; Botner, O.; Bouquet, B.; Bowcock, T.J.V.; Boyko, I.; Bracko, M.; Brenner, R.; Brodet, E.; Brodzicka, J.; Bruckman, P.; Brunet, J.M.; Bugge, L.; Buschmann, P.; Calvi, M.; Camporesi, T.; Canale, V.; Carena, F.; Carimalo, C.; Castro, Nuno Filipe; Cavallo, F.; Chapkin, M.; Charpentier, P.; Checchia, P.; Chierici, R.; Shlyapnikov, P.; Chung, S.U.; Cieslik, K.; Collins, P.; Contri, R.; Cosme, G.; Cossutti, F.; Costa, M.J.; Crawley, H.B.; Crennell, D.; Cuevas, J.; D'Hondt, J.; Dalmau, J.; da Silva, T.; Da Silva, W.; Della Ricca, G.; De Angelis, A.; De Boer, W.; De Clercq, C.; De Lotto, B.; De Maria, N.; De Min, A.; De Paula, L.; Di Ciaccio, L.; Di Simone, A.; Doroba, K.; Drees, J.; Dris, M.; Eigen, G.; Ekelof, T.; Ellert, M.; Elsing, M.; Espirito Santo, M.C.; Fanourakis, G.; Fassouliotis, D.; Feindt, M.; Fernandez, J.; Ferrer, A.; Ferro, F.; Flagmeyer, U.; Foeth, H.; Fokitis, E.; Fulda-Quenzer, F.; Fuster, J.; Gandelman, M.; Garcia, C.; Gavillet, P.; Gazis, Evangelos; Gele, D.; Geralis, T.; Gokieli, R.; Golob, B.; Gomez-Ceballos, G.; Goncalves, P.; Graziani, E.; Grosdidier, G.; Grzelak, K.; Guy, J.; Haag, C.; Hahn, F.; Hahn, S.; Hallgren, A.; Hamacher, K.; Hamilton, K.; Hansen, J.; Haug, S.; Hauler, F.; Hedberg, V.; Hennecke, M.; Herr, H.; Holmgren, S.O.; Holt, P.J.; Houlden, M.A.; Hultqvist, K.; Jackson, John Neil; Jalocha, P.; Jarlskog, C.; Jarlskog, G.; Jarry, P.; Jeans, D.; Johansson, Erik Karl; Johansson, P.D.; Jonsson, P.; Joram, C.; Jungermann, L.; Kapusta, Frederic; Katsanevas, S.; Katsoufis, E.; Keranen, R.; Kernel, G.; Kersevan, B.P.; Kiiskinen, A.; King, B.T.; Kjaer, N.J.; Kluit, P.; Kokkinias, P.; Kourkoumelis, C.; Kuznetsov, O.; Krumshtein, Z.; Kucharczyk, M.; Kurowska, J.; Laforge, B.; Lamsa, J.; Leder, G.; Ledroit, Fabienne; Leinonen, L.; Leitner, R.; Lemonne, J.; Lenzen, G.; Lepeltier, V.; Lesiak, T.; Liebig, W.; Liko, D.; Lipniacka, A.; Lopes, J.H.; Lopez, J.M.; Loukas, D.; Lutz, P.; Lyons, L.; MacNaughton, J.; Malek, A.; Maltezos, S.; Mandl, F.; Marco, J.; Marco, R.; Marechal, B.; Margoni, M.; Marin, J.C.; Mariotti, C.; Markou, A.; Martinez-Rivero, C.; Masik, J.; Mastroyiannopoulos, N.; Matorras, F.; Matteuzzi, C.; Mazzucato, F.; Mazzucato, M.; McNulty, R.; Meroni, C.; Meyer, W.T.; Migliore, E.; Mitaroff, W.; Mjornmark, U.; Moa, T.; Moch, M.; Monig, Klaus; Monge, R.; Montenegro, J.; Moraes, D.; Moreno, S.; Morettini, P.; Muller, U.; Munich, K.; Mulders, M.; Mundim, L.; Murray, W.; Muryn, B.; Myatt, G.; Myklebust, T.; Nassiakou, M.; Navarria, F.; Nawrocki, K.; Nemecek, S.; Nicolaidou, R.; Niezurawski, P.; Nikolenko, M.; Nygren, A.; Oblakowska-Mucha, A.; Obraztsov, V.; Olshevsky, A.; Onofre, A.; Orava, R.; Osterberg, K.; Ouraou, A.; Oyanguren, A.; Paganoni, M.; Paiano, S.; Palacios, J.P.; Palka, H.; Papadopoulou, T.D.; Pape, L.; Parkes, C.; Parodi, F.; Parzefall, U.; Passeri, A.; Passon, O.; Peralta, L.; Perepelitsa, V.; Perrotta, A.; Petrolini, A.; Piedra, J.; Pieri, L.; Pierre, F.; Pimenta, M.; Piotto, E.; Podobnik, T.; Poireau, V.; Pol, M.E.; Polok, G.; Poropat, P.; Pozdnyakov, V.; Privitera, P.; Pukhaeva, N.; Pullia, A.; Rames, J.; Ramler, L.; Read, Alexander L.; Rebecchi, P.; Rehn, J.; Reid, D.; Reinhardt, R.; Renton, P.; Richard, F.; Ridky, J.; Ripp-Baudot, Isabelle; Rodriguez, D.; Romero, A.; Ronchese, P.; Rosenberg, E.; Roudeau, P.; Rovelli, T.; Ruhlmann-Kleider, V.; Ryabchikov, D.; Sadovsky, A.; Salmi, L.; Salt, J.; Savoy-Navarro, A.; Schwanda, C.; Schwering, B.; Schwickerath, U.; Segar, A.; Sekulin, R.; Siebel, M.; Sisakian, A.; Smadja, G.; Smirnova, O.; Sokolov, A.; Sopczak, A.; Sosnowski, R.; Spassoff, T.; Stanitzki, M.; Stocchi, A.; Strauss, J.; Stugu, B.; Szczekowski, M.; Szeptycka, M.; Szumlak, T.; Tabarelli, T.; Taffard, A.C.; Tegenfeldt, F.; Terranova, F.; Timmermans, Jan; Tinti, N.; Tkachev, L.; Tobin, M.; Todorova, S.; Tome, B.; Tonazzo, A.; Tortosa, P.; Travnicek, P.; Treille, D.; Tristram, G.; Trochimczuk, M.; Troncon, C.; Tyapkin, I.A.; Tyapkin, P.; Tzamarias, S.; Ullaland, O.; Uvarov, V.; Valenti, G.; Van Dam, Piet; Van Eldik, J.; Van Lysebetten, A.; Van Remortel, N.; Van Vulpen, I.; Vegni, G.; Veloso, F.; Venus, W.; Verbeure, F.; Verdier, P.; Verzi, V.; Vilanova, D.; Vitale, L.; Vrba, V.; Wahlen, H.; Washbrook, A.J.; Weiser, C.; Wicke, D.; Wickens, J.; Wilkinson, G.; Winter, M.; Witek, M.; Yushchenko, O.; Zalewska, A.; Zalewski, P.; Zavrtanik, D.; Zimine, N.I.; Zinchenko, A.; Zoller, P.; Zupan, M.

    2002-01-01

    Neutral Higgs bosons of the Standard Model ({\\sc SM}) and the Minimal Supersymmetric Standard Model ({\\sc MSSM}) were searched for in the data collected in 1999 by the DELPHI experiment at centre-of-mass energies between 191.6 and 201.7~GeV with a total integrated luminosity of 228 pb$^{-1}$. These analyses, in combination with our results at lower energies, set 95\\% confidence level lower mass bounds on the Standard Model Higgs boson (107.3~GeV/$c^2$) and on the lightest neutral scalar (85.9~GeV/$c^2$) and neutral pseudoscalar (86.5~GeV/$c^2$) Higgs bosons in representative scans of the {\\sc MSSM} parameter space. % excluding $\\tan\\beta$ in the range [0.9-1.6] An extended scan of the {\\sc MSSM} parameter space was also performed to test the robustness of these limits.

  1. Produção de B-1, 3-glucanase de Cellulosimicrobium cellulans 191 para lise enzimatica da levedura Kluyveromyces marxianus var. bulgaricus e obtenção de B-galactosidade

    OpenAIRE

    Giselle de Arruda Rodrigues

    2008-01-01

    Resumo: A enzima ß-1,3-glucanase da bactéria Cellulosimicrobium cellulans 191 é capaz de lisar a parede celular de diversas leveduras dentre elas as linhagens de Kluyveromyces sp., produtoras da enzima intracelular ß-galactosidase. Este trabalho visou a produção de ß-1,3-glucanase lítica de Cellulosimicrobium cellulans 191 para obtenção das preparações enzimáticas bruta concentrada e purificada com alta atividade lítica para aplicação na obtenção de protoplastos de leveduras e lise das célula...

  2. Fast neutron capture cross sections of /sup 169/Tm, /sup 191/Ir, /sup 193/Ir, and /sup 175/Lu for 3 less than or equal to E/sub n/ less than or equal to 2000 keV

    Energy Technology Data Exchange (ETDEWEB)

    Macklin, R.L.; Drake, D.M.; Malanify, J.J.

    1977-11-01

    Fast neutron capture cross sections of /sup 169/Tm, /sup 191/Ir, /sup 193/Ir, and /sup 175/Lu, and the /sup 6/Li(n,..cap alpha..)/sup 3/H cross sections to which they are normalized are presented in tabular form for neutron energies between 3 and 2000 keV.

  3. Stellar Laboratories . [VI. New Mo IV - VII Oscillator Strengths and the Molybdenum Abundance in the Hot White Dwarfs G191-B2B and RE 0503-289

    Science.gov (United States)

    Rauch, T.; Quinet, T.; Hoyer, D.; Werner, K.; Demleitner, M.; Kruk, J. W.

    2016-01-01

    For the spectral analysis of high-resolution and high signal-to-noise (SN) spectra of hot stars, state-of-the-art non-local thermodynamic equilibrium (NLTE) model atmospheres are mandatory. These are strongly dependent on the reliability of the atomic data that is used for their calculation. Aims: To identify molybdenum lines in the ultraviolet (UV) spectra of the DA-type white dwarf G191B2B and the DO-type white dwarf RE 0503289 and, to determine their photospheric Mo abundances, reliable Mo iv-vii oscillator strengths are used. Methods: We newly calculated Mo iv-vii oscillator strengths to consider their radiative and collisional bound-bound transitions indetail in our NLTE stellar-atmosphere models for the analysis of Mo lines exhibited in high-resolution and high SN UV observations of RE 0503289.Results. We identified 12 Mo v and nine Mo vi lines in the UV spectrum of RE 0503289 and measured a photospheric Mo abundance of 1.2 3.0 104(mass fraction, 22 500 56 400 times the solar abundance). In addition, from the As v and Sn iv resonance lines,we measured mass fractions of arsenic (0.51.3 105, about 300 1200 times solar) and tin (1.33.2 104, about 14 300 35 200 times solar). For G191B2B, upper limits were determined for the abundances of Mo (5.3 107, 100 times solar) and, in addition, for Kr (1.1106, 10 times solar) and Xe (1.7107, 10 times solar). The arsenic abundance was determined (2.35.9 107, about 21 53 times solar). A new, registered German Astrophysical Virtual Observatory (GAVO) service, TOSS, has been constructed to provide weighted oscillator strengths and transition probabilities.Conclusions. Reliable measurements and calculations of atomic data are a prerequisite for stellar-atmosphere modeling. Observed Mo v-vi line profiles in the UV spectrum of the white dwarf RE 0503289 were well reproduced with our newly calculated oscillator strengths. For the first time, this allowed the photospheric Mo abundance in a white dwarf to be determined.

  4. The interstellar medium and the highly ionized species observed in the spectrum of the nearby white dwarf G191-B2B

    Science.gov (United States)

    Bruhweiler, F. C.; Kondo, Y.

    1981-01-01

    High-resolution spectra of the nearby (48 pc) white dwarf G191-B2B, obtained with the International Ultraviolet Explorer, reveal sharp resonance lines of N V, C IV, and Si IV. The origin of these features is most likely linked to the white dwarf, possibly being formed in an expanding halo around the star. Interstellar lines of C II, N I, Mg II, Si II, and Fe II are also seen in the spectrum. Analysis of these features indicates an average neutral hydrogen number density of 0.064 for this line of sight. In combination with the recent EUV and soft X-ray results, this is interpreted to mean that the interstellar medium in the most immediate solar vicinity is of the normal density n approximately equal to 0.1/cu cm of lower ionization, while just beyond it, at least in some directions, is a hot lower density plasma. These results are apparently in conflict with the model of the interstellar medium by McKee and Ostriker (1977) in its present form.

  5. High-resolution extreme ultraviolet spectroscopy of G191-B2B: structure of the stellar photosphere and the surrounding interstellar medium

    Science.gov (United States)

    Barstow, M. A.; Cruddace, R. G.; Kowalski, M. P.; Bannister, N. P.; Yentis, D.; Lapington, J. S.; Tandy, J. A.; Hubeny, I.; Schuh, S.; Dreizler, S.; Barbee, T. W.

    2005-10-01

    We have continued our detailed analysis of the high-resolution (R= 4000) spectroscopic observation of the DA white dwarf G191-B2B, obtained by the Joint Astrophysical Plasmadynamic Experiment (J-PEX) normal incidence sounding rocket-borne telescope, comparing the observed data with theoretical predictions for both homogeneous and stratified atmosphere structures. We find that the former models give the best agreement over the narrow waveband covered by J-PEX, in conflict with what is expected from previous studies of the lower resolution but broader wavelength coverage Extreme Ultraviolet Explorer spectra. We discuss the possible limitations of the atomic data and our understanding of the stellar atmospheres that might give rise to this inconsistency. In our earlier study, we obtained an unusually high ionization fraction for the ionized HeII present along the line of sight to the star. In the present paper, we obtain a better fit when we assume, as suggested by Space Telescope Imaging Spectrograph results, that this HeII resides in two separate components. When one of these is assigned to the local interstellar cloud, the implied He ionization fraction is consistent with measurements along other lines of sight. However, the resolving power and signal-to-noise available from the instrument configuration used in this first successful J-PEX flight are not sufficient to clearly identify and prove the existence of the two components.

  6. Odd and Even Partial Waves of $\\eta\\pi^-$ and $\\eta'\\pi^-$ in 191 GeV/c $\\pi^{-}p$

    CERN Document Server

    Schlüter, T

    2014-01-01

    In the year 2008 COMPASS recorded diffractive events of the signature \\pi^-(191 GeV) p --> X_fast p. We present results of the analysis of the subsystems X = \\eta(')\\pi^-. Besides the known resonances a_2(1320), a_4(2040), we study the properties of the spin-exotic P+ wave, and all other natural-exchange partial waves up to spin J = 6. We find a striking difference between the two final states: whereas the even partial waves J = 2, 4, 6 in the two systems are related by phase-space factors, the odd partial waves are relatively suppressed in the \\eta\\pi^- system. The relative phases between the even waves appear identical whereas the phase between the D and P waves behave quite differently, suggesting different resonant and non-resonant contributions in the two odd-angular-momentum systems. Branching ratios and parameters of the well-known resonances a_2 and a_4 are measured.

  7. SOLVENT HOLD TANK SAMPLE RESULTS FOR MCU-13-189, MCU-13-190, AND MCU-13-191: QUARTERLY SAMPLE FROM SEPTEMBER 2013

    Energy Technology Data Exchange (ETDEWEB)

    Fondeur, F.; Taylor-Pashow, K.

    2013-10-31

    Savannah River National Laboratory (SRNL) analyzed solvent samples from Modular Caustic-Side Solvent Extraction Unit (MCU) in support of continuing operations. A quarterly analysis of the solvent is required to maintain solvent composition within specifications. Analytical results of the analyses of Solvent Hold Tank (SHT) samples MCU-13-189, MCU-13-190, and MCU-13-191 received on September 4, 2013 are reported. The results show that the solvent (remaining heel in the SHT tank) at MCU contains excess Isopar L and a deficit concentration of modifier and trioctylamine when compared to the standard MCU solvent. As with the previous solvent sample results, these analyses indicate that the solvent does not require Isopar L trimming at this time. Since MCU is switching to NGS, there is no need to add TOA nor modifier. SRNL also analyzed the SHT sample for {{sup 137}Cs content and determined the measured value is within tolerance and the value has returned to levels observed in 2011.

  8. The adsorption geometry of Ag(1 1 1)-(√7×√7) R19.1°-4Ar studied by LEED

    Science.gov (United States)

    Caragiu, M.; Leatherman, G. S.; Seyller, Th.; Diehl, R. D.

    2001-03-01

    The adsorption geometry of Ag(1 1 1)-(√7×√7) R19.1°-4Ar was studied using low-energy electron diffraction (LEED). This higher-order commensurate phase was produced by preadsorbing a small amount of CO in order to block the close-packed steps, which pin the rotation angle of the overlayer. The dynamical LEED data were taken at a sample temperature of 31 K, and the results of the LEED analysis indicate that one Ar atom per unit cell occupies the top of a Ag substrate atom, while the other three Ar atoms occupy bridge sites. There is little, if any, distortion of the Ar lattice from hexagonal symmetry. The average Ar-Ag perpendicular spacing in this structure is 3.22±0.07 Å. The Ar-Ag nearest-neighbor distances are 3.22 and 3.52 Å for top-site and bridge-site Ar atoms, respectively.

  9. 191 - 196 _Olurukooba et al.,

    African Journals Online (AJOL)

    User

    of the ethyl acetate fraction in mice study showed that the ethyl acetate fra activity. Key words: Acute toxicity, Antiplasmodial,. INTRODUCTION. Malaria is an infectious disease that has contin cause mortality and morbidity in the tropics an tropics (Igweet al., 2012).Malaria is transmit people through the bites of infected female ...

  10. Pre-1.91 Ga deformation and metamorphism in the Palaeoproterozoic Vammala Migmatite Belt, southern Finland, and implications for Svecofennian tectonics

    Directory of Open Access Journals (Sweden)

    R. W. Roye Rutland

    2004-01-01

    Full Text Available A metamorphic event in the Vammala Migmatite Belt (VMB at ~1.92 Ga, revealed by SHRIMP U-Pb analyses of both zircon overgrowths and monazite, is interpreted as post-depositional and is correlated with the development of the early high-grade schistosity. Neither this Early Svecofennian deformation and metamorphism, nor the associatedcomplex folding, is present in the overlying Tampere Schist Belt (TSB sequence, consistent with the VMB being part of a pre-1.91 Ga basement complex. The ~1.92 Ga event provides a maximum deposition age for the TSB, confirming earlier age estimates. Earlier stratigraphic correlations between parts of the VMB and TSB, and associated tectonic interpretations, can no longer be sustained. The crustal thickening seen in the VMB, and previously attributed to arc accretion at ~1.89 Ga, is now attributed to accretion of a large Svionian marginal basin during the ‘Early Svecofennian’ orogenicphase at ~1.92 Ga. This is of similar age to the deformation and metamorphism associated with collision in the Lapland-Kola Orogen to the north of the Karelian Province. The well-known post-TSB orogenic phase was also identified in the VMB by a monazite age of 1881±6 Ma. A granitoid intrusion gave an emplacement age of 1888±5 Ma,comparable to the age of granitoid clasts in the upper part of the TSB succession. The detrital zircon data are interpreted to suggest that deposition of the precursor VMB sediments probably took place soon after an earlier pre-depositional metamorphism at ~1.98 Ga, which affected igneous source complexes dated at ~1.99 Ga and ~2.01 Ga. Mafic rocks in the southern part of the VMB, and probably also the Haveri basalts, represent a renewed episode of extensional magmatism, which might correlate with the 1.96–1.95 Ga Jormua and Outokumpu ophiolites. A pre-1.96 Ga older stage basin has an expression in Sweden and complexes of similar age occur in theconcealed Palaeoproterozoic basement south of the Gulf of

  11. Gene Flow Across Genus Barriers - Conjugation of Dinoroseobacter shibae's 191-kb Killer Plasmid into Phaeobacter inhibens and AHL-mediated Expression of Type IV Secretion Systems.

    Science.gov (United States)

    Patzelt, Diana; Michael, Victoria; Päuker, Orsola; Ebert, Matthias; Tielen, Petra; Jahn, Dieter; Tomasch, Jürgen; Petersen, Jörn; Wagner-Döbler, Irene

    2016-01-01

    Rhodobacteraceae harbor a conspicuous wealth of extrachromosomal replicons (ECRs) and therefore the exchange of genetic material via horizontal transfer has been supposed to be a major evolutionary driving force. Many plasmids in this group encode type IV secretion systems (T4SS) that are expected to mediate transfer of proteins and/or DNA into host cells, but no experimental evidence of either has yet been provided. Dinoroseobacter shibae, a species of the Roseobacter group within the Rhodobacteraceae family, contains five ECRs that are crucial for anaerobic growth, survival under starvation and the pathogenicity of this model organism. Here we tagged two syntenous but compatible RepABC-type plasmids of 191 and 126-kb size, each encoding a T4SS, with antibiotic resistance genes and demonstrated their conjugational transfer into a distantly related Roseobacter species, namely Phaeobacter inhibens. Pulsed field gel electrophoresis showed transfer of those replicons into the recipient both individually but also together documenting the efficiency of conjugation. We then studied the influence of externally added quorum sensing (QS) signals on the expression of the T4SS located on the sister plasmids. A QS deficient D. shibae null mutant (ΔluxI1 ) lacking synthesis of N-acyl-homoserine lactones (AHLs) was cultivated with a wide spectrum of chemically diverse long-chain AHLs. All AHLs with lengths of the acid side-chain ≥14 reverted the ΔluxI1 phenotype to wild-type. Expression of the T4SS was induced up to log2 ∼3fold above wild-type level. We hypothesize that conjugation in roseobacters is QS-controlled and that the QS system may detect a wide array of long-chain AHLs at the cell surface.

  12. Sweet Taste Receptor TAS1R2 Polymorphism (Val191Val) Is Associated with a Higher Carbohydrate Intake and Hypertriglyceridemia among the Population of West Mexico.

    Science.gov (United States)

    Ramos-Lopez, Omar; Panduro, Arturo; Martinez-Lopez, Erika; Roman, Sonia

    2016-02-19

    Some high-carbohydrate diets may lead to obesity and multiple metabolic disorders, including hypertriglyceridemia (HTG). This lipid abnormality is considered an important risk factor for cardiovascular disease and type 2 diabetes. The sweet taste receptor TAS1R2 polymorphism (Ile191Val) has been reported to be associated with carbohydrate intake. The aim of this study was to analyze the association of the TAS1R2 gene polymorphism with carbohydrate intake and HTG among the population of West Mexico. In a cross-sectional study, 441 unrelated subjects were analyzed for TAS1R2 genotypes (Ile/Ile, Ile/Val and Val/Val) by an allelic discrimination assay. Biochemical tests and a three-day food record were assessed. The Val/Val genotype carriers had a higher intake of total carbohydrates, fiber and servings of cereals and vegetables than the other genotype carriers. The Val/Val genotype conferred a higher risk for HTG than the Ile/Val and Ile/Ile genotypes (OR = 3.26, 95%CI 1.35-7.86, p = 0.006 and OR = 2.61, 95%CI 1.12-6.07, p = 0.02, respectively). Furthermore, the Val/Val genotype was associated with approximately 30% higher triglycerides compared with Ile/Val and Ile/Ile genotypes (β = 44.09, 95%CI 9.94-78.25, p = 0.01 and β = 45.7, 95%CI 10.85-80.54, p = 0.01, respectively). In conclusion, the Val/Val genotype of TAS1R2 was associated with a higher carbohydrate intake and HTG.

  13. Sweet Taste Receptor TAS1R2 Polymorphism (Val191Val Is Associated with a Higher Carbohydrate Intake and Hypertriglyceridemia among the Population of West Mexico

    Directory of Open Access Journals (Sweden)

    Omar Ramos-Lopez

    2016-02-01

    Full Text Available Some high-carbohydrate diets may lead to obesity and multiple metabolic disorders, including hypertriglyceridemia (HTG. This lipid abnormality is considered an important risk factor for cardiovascular disease and type 2 diabetes. The sweet taste receptor TAS1R2 polymorphism (Ile191Val has been reported to be associated with carbohydrate intake. The aim of this study was to analyze the association of the TAS1R2 gene polymorphism with carbohydrate intake and HTG among the population of West Mexico. In a cross-sectional study, 441 unrelated subjects were analyzed for TAS1R2 genotypes (Ile/Ile, Ile/Val and Val/Val by an allelic discrimination assay. Biochemical tests and a three-day food record were assessed. The Val/Val genotype carriers had a higher intake of total carbohydrates, fiber and servings of cereals and vegetables than the other genotype carriers. The Val/Val genotype conferred a higher risk for HTG than the Ile/Val and Ile/Ile genotypes (OR = 3.26, 95%CI 1.35–7.86, p = 0.006 and OR = 2.61, 95%CI 1.12–6.07, p = 0.02, respectively. Furthermore, the Val/Val genotype was associated with approximately 30% higher triglycerides compared with Ile/Val and Ile/Ile genotypes (β = 44.09, 95%CI 9.94–78.25, p = 0.01 and β = 45.7, 95%CI 10.85–80.54, p = 0.01, respectively. In conclusion, the Val/Val genotype of TAS1R2 was associated with a higher carbohydrate intake and HTG.

  14. Odd and even partial waves of ηπ− and η′π− in π−p→η(′)π−p at 191 GeV/c

    NARCIS (Netherlands)

    Adolph, C.; Akhunzyanov, R.; Alexeev, M. G.; Alexeev, G. D.; Amoroso, A.; Andrieux, V.; Anosov, V.; Austregesilo, A.; Badelek, B.; Balestra, F.; Barth, J.; Baum, G.; Beck, R.; Bedfer, Y.; Berlin, A.; Bernhard, J.; Bicker, K.; Bielert, E. R.; Bieling, J.; Birsa, R.; Bisplinghoff, J.; Bodlak, M.; Boer, M.; Bordalo, P.; Bradamante, F.; Braun, C.; Bressan, A.; Buechele, M.; Burtin, E.; Capozza, L.; Chiosso, M.; Chung, S. U.; Cicuttin, A.; Crespo, M. L.; Curiel, Q.; Torre, S. Dalla; Dasgupta, S. S.; Dasgupta, S.; Denisov, O. Yu; Donskov, S. V.; Doshita, N.; Duic, V.; Duennweber, W.; Dziewiecki, M.; Efremov, A.; Elia, C.; Eversheim, P. D.; Eyrich, W.; Faessler, M.; Ferrero, A.; Filin, A.; Finger, M.; jr, M. Finger; Fischer, H.; Franco, C.; Hohenesche, N. du Fresne von; Friedrich, J. M.; Frolov, V.; Gautheron, F.; Gavrichtchouk, O. P.; Gerassimov, S.; Geyer, R.; Gnesi, I.; Gobbo, B.; Goertz, S.; Gorzellik, M.; Grabmueller, S.; Grasso, A.; Grube, B.; Grussenmeyer, T.; Guskov, A.; Haas, F.; Harrach, D. von; Hahne, D.; Hashimoto, R.; Heinsius, F. H.; Herrmann, F.; Hinterberger, F.; Hoeppner, Ch; Horikawa, N.; d'Hose, N.; Huber, S.; Ishimoto, S.; Ivanov, A.; Ivanshin, Yu; Iwata, T.; Jahn, R.; Jary, V.; Jasinski, P.; Joerg, P.; Joosten, R.; Kabuss, E.; Ketzer, B.; Khaustov, G. V.; Khokhlov, Yu A.; Kisselev, Yu; Klein, F.; Klimaszewski, K.; Koivuniemi, J. H.; Kolosov, V. N.; Kondo, K.; Koenigsmann, K.; Konorov, I.; Konstantinov, V. F.; Kotzinian, A. M.; Kouznetsov, O.; Kraemer, M.; Kroumchtein, Z. V.; Kuchinski, N.; Kunne, F.; Kurek, K.; Kurjata, R. P.; Lednev, A. A.; Lehmann, A.; Levillain, M.; Levorato, S.; Lichtenstadt, J.; Maggiora, A.; Magnon, A.; Makke, N.; Mallot, G. K.; Marchand, C.; Martin, A.; Marzec, J.; Matousek, J.; Matsuda, H.; Matsuda, T.; Meshcheryakov, G.; Meyer, W.; Michigami, T.; Mikhailov, Yu V.; Miyachi, Y.; Nagaytsev, A.; Nagel, T.; Nerling, F.; Neubert, S.; Neyret, D.; Nikolaenko, V. I.; Novy, J.; Nowak, W. -D.; Nunes, A. S.; Olshevsky, A. G.; Orlov, I.; Ostrick, M.; Panknin, R.; Panzieri, D.; Parsamyan, B.; Paul, S.; Peshekhonov, D. V.; Platchkov, S.; Pochodzalla, J.; Polyakov, V. A.; Pretz, J.; Quaresma, M.; Quintans, C.; Ramos, S.; Regali, C.; Reicherz, G.; Rocco, E.; Rossiyskaya, N. S.; Ryabchikov, D. I.; Rychter, A.; Samoylenko, V. D.; Sandacz, A.; Sarkar, S.; Savin, I. A.; Sbrizzai, G.; Schiavon, P.; Schill, C.; Schlueter, T.; Schmidt, K.; Schmieden, H.; Schoenning, K.; Schopferer, S.; Schott, M.; Shevchenko, O. Yu; Silva, L.; Sinha, L.; Sirtl, S.; Slunecka, M.; Sosio, S.; Sozzi, F.; Srnka, A.; Steiger, L.; Stolarski, M.; Sulc, M.; Sulej, R.; Suzuki, H.; Szabelski, A.; Szameitat, T.; Sznajder, P.; Takekawa, S.; Wolbeek, J. ter; Tessaro, S.; Tessarotto, F.; Thibaud, F.; Uhl, S.; Uman, I.; Virius, M.; Wang, L.; Weisrock, T.; Wilfert, M.; Windmolders, R.; Wollny, H.; Zaremba, K.; Zavertyaev, M.; Zemlyanichkina, E.; Ziembicki, M.; Zink, A.

    2015-01-01

    Exclusive production of ηπ− and η′π− has been studied with a 191 GeV/cπ− beam impinging on a hydrogen target at COMPASS (CERN). Partial-wave analyses reveal different odd/even angular momentum (L ) characteristics in the inspected invariant mass range up to 3 GeV/c2. A striking similarity between

  15. Stellar Laboratories II. New Zn Iv and Zn v Oscillator Strengths and Their Validation in the Hot White Dwarfs G191-B2B and RE0503-289

    Science.gov (United States)

    Rauch, T.; Werner, K.; Quinet, P.; Kruk, J. W.

    2014-01-01

    Context. For the spectral analysis of high-resolution and high-signal-to-noise (SN) spectra of hot stars, state-of-the-art non-local thermodynamic equilibrium (NLTE) model atmospheres are mandatory. These are strongly dependent on the reliability of the atomic data that is used for their calculation. In a recent analysis of the ultraviolet (UV) spectrum of the DA-type white dwarf G191B2B,21 Zn iv lines were newly identified. Because of the lack of Zn iv data, transition probabilities of the isoelectronic Ge vi were adapted for a first, coarse determination of the photospheric Zn abundance.Aims. Reliable Zn iv and Zn v oscillator strengths are used to improve the Zn abundance determination and to identify more Zn lines in the spectra of G191B2B and the DO-type white dwarf RE 0503289. Methods. We performed new calculations of Zn iv and Zn v oscillator strengths to consider their radiative and collisional bound-bound transitions in detail in our NLTE stellar-atmosphere models for the analysis of the Zn iv v spectrum exhibited in high-resolution and high-SN UV observations of G191B2B and RE 0503289. Results. In the UV spectrum of G191B2B, we identify 31 Zn iv and 16 Zn v lines. Most of these are identified for the first time in any star. We can reproduce well almost all of them at log Zn 5.52 0.2 (mass fraction, about 1.7 times solar). In particular, the Zn iv Zn v ionization equilibrium, which is a very sensitive Teff indicator, is well reproduced with the previously determined Teff 60 000 2000 K and log g 7.60 0.05. In the spectrum of RE 0503289, we identified 128 Zn v lines for the first time and determined log Zn 3.57 0.2 (155 times solar). Conclusions. Reliable measurements and calculations of atomic data are a pre-requisite for stellar-atmosphere modeling. Observed Zn iv and Zn v line profiles in two white dwarf (G191B2B and RE 0503289) ultraviolet spectra were well reproduced with our newly calculated oscillator strengths. This allowed us to determine the

  16. Chemonuclear studies for identification for new production routes for the therapeutically useful radionuclides {sup 140}Nd, {sup 192}Ir, {sup 191}Pt, {sup 193m}Pt, und {sup 195m}Pt; Kernchemische Studien zur Entwicklung neuerer Produktionsverfahren fuer die therapierelevanten Radionuklide {sup 140}Nd, {sup 192}Ir, {sup 191}Pt, {sup 193m}Pt, und {sup 195m}Pt

    Energy Technology Data Exchange (ETDEWEB)

    Hilgers, K.

    2005-12-15

    New production routes for the therapeutically useful radionuclides {sup 140}Nd, {sup 192}Ir, {sup 191}Pt, {sup 193m}Pt and {sup 195m}Pt were investigated. Cross section data were measured using the stacked-foil technique and compared with theoretical calculations. A production method for the platinum nuclides was developed. The {sup 141}Pr(p, 2n){sup 140}Nd and {sup nat}Ce({sup 3}He, xn){sup 140}Nd reactions were investigated for production of {sup 140}Nd. Cross section data of nuclear reactions leading to the side products {sup 141}Nd, {sup 139}Nd and {sup 139}Ce could also be achieved. The experimental data were compared with theoretical calculations using the code ALICE-IPPE. A comparison of the calculated thick target yields showed that the {sup 141}Pr(p, 2n){sup 140}Nd reaction gives a higher yield. The {sup 192}Os(p, n){sup 192}Ir reaction was examined in the context of the production of {sup 192}Ir. Cross section data were determined and compared with theoretical calculations using the codes ALICE-IPPE and EMPIRE II. The yield of this reaction was compared with the yield of the reactor production of this nuclide. The reactor production seems to be more suitable because of a higher purity and yield. Cross section data were measured for the {sup 192}Os({alpha}, n){sup 195m}Pt, {sup 192}Os({alpha}, 3n){sup 193m}Pt and {sup 192}Os({sup 3}He, 4n){sup 191}Pt reactions. The activity of {sup 193m}Pt and {sup 195m}Pt was determined by X-ray spectroscopy after a chemical separation procedure. The ALICE-IPPE code was found to be inappropriate to reproduce the experimental values. The calculated yields were compared with the yields of other reactions, especially the reactor production of {sup 195m}Pt. The yield of the {sup 192}Os({alpha}, n){sup 195m}Pt reaction is lower compared to the yield of the reactor production, but offers lower target costs and higher specific activity. A production method for {sup 193m}Pt and {sup 195m}Pt was developed. Batch yields of 0.9 MBq

  17. Efficacy of double-stranded RNA against white spot syndrome virus (WSSV non-structural (orf89, wsv191 and structural (vp28, vp26 genes in the Pacific white shrimp Litopenaeus vannamei

    Directory of Open Access Journals (Sweden)

    César M. Escobedo-Bonilla

    2015-04-01

    Full Text Available White spot syndrome virus (WSSV is a major pathogen in shrimp aquaculture. RNA interference (RNAi is a promising tool against viral infections. Previous works with RNAi showed different antiviral efficacies depending on the silenced gene. This work evaluated the antiviral efficacy of double-stranded (ds RNA against two non-structural (orf89, wsv191 WSSV genes compared to structural (vp26, vp28 genes to inhibit an experimental WSSV infection. Gene orf89 encodes a putative regulatory protein and gene white spot virus (wsv191 encodes a nonspecific nuclease; whereas genes vp26 and vp28 encode envelope proteins, respectively. Molecules of dsRNA against each of the WSSV genes were intramuscularly injected (4 μg per shrimp into a group of shrimp 48 h before a WSSV challenge. The highest antiviral activity occurred with dsRNA against orf89, vp28 and vp26 (cumulative mortalities 10%, 10% and 21%, respectively. In contrast, the least effective treatment was wsv191 dsRNA (cumulative mortality 83%. All dead animals were WSSV-positive by one-step PCR, whereas reverse-transcription PCR of all surviving shrimp confirmed inhibition of virus replication. This study showed that dsRNA against WSSV genes orf89, vp28 and vp26 were highly effective to inhibit virus replication and suggest an essential role in WSSV infection. Non-structural WSSV genes such as orf89 can be used as novel targets to design therapeutic RNAi molecules against WSSV infection.

  18. Final Report for grant entitled "Production of Astatine-211 for U.S. Investigators"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott

    2012-12-12

    Alpha-particle emitting radionuclides hold great promise in the therapy of cancer, but few alpha-emitters are available to investigators to evaluate. Of the alpha-emitters that have properties amenable for use in humans, 211At is of particular interest as it does not have alpha-emitting daughter radionuclides. Thus, there is a high interest in having a source of 211At for sale to investigators in the US. Production of 211At is accomplished on a cyclotron using an alpha-particle beam irradiation of bismuth metal. Unfortunately, there are few cyclotrons available that can produce an alpha particle beam for that production. The University of Washington has a cyclotron, one of three in the U.S., that is currently producing 211At. In the proposed studies, the things necessary for production and shipment of 211At to other investigators will be put into place at UW. Of major importance is the efficient production and isolation of 211At in a form that can be readily used by other investigators. In the studies, production of 211At on the UW cyclotron will be optimized by determining the best beam energy and the highest beam current to maximize 211At production. As it would be very difficult for most investigators to isolate the 211At from the irradiated target, the 211At-isolation process will be optimized and automated to more safely and efficiently obtain the 211At for shipment. Additional tasks to make the 211At available for distribution include obtaining appropriate shipping vials and containers, putting into place the requisite standard operating procedures for Radiation Safety compliance at the levels of 211At activity to be produced / shipped, and working with the Department of Energy, Isotope Development and Production for Research and Applications Program, to take orders, make shipments and be reimbursed for costs of production and shipment.

  19. Production of Astatine-211 at the Duke University Medical Center for its regional distribution

    Energy Technology Data Exchange (ETDEWEB)

    Zalutsky, Michael [Duke University Medical Center, Durham, NC (United States)

    2016-01-01

    Systemic targeted radiation therapy and radioimmunotherapy continue to be important tools in the treatment of certain cancers. Because of their high energy and short path length, alpha particle emitters such as 211At are more effective than either external beam x- ray or in vivo beta radiation in delivering potentially curative doses of radiation. The limited clinical trials that have been conducted to date have yielded encouraging responses in some patients, e.g., malignant brain tumors. In order to escalate the additional necessary research and development in radiochemistry, radiobiology and efficacy evaluation of alpha particle radiotherapeutics, it is universally agreed that access to an affordable, reliable supply of 211At is warranted. In conjunction with the Department of Energy's intent to enhance stable and radioactive isotope availability for research applications, it is the primary objective of this project to improve 211At production and purification capabilities at Duke so that this radionuclide can be supplied to researchers at other institutions throughout the US.The most widely used 211At production method involves the α,2n reaction on Bismuth using a cyclotron with beams ≤ 28 MeV. Yields can be enhanced with use of an internal target that allows for a higher alpha fluence plus efficient heat dissipation in the target. Both of these items are in place at Duke; however, in order to support production for multi-institutional use, irradiation campaigns in excess of 50 µAp and four hours duration will be needed. Further, post-irradiation processing equipment is lacking that will enable the distribution process. Financial support is sought for i) a shielded, ventilated processing/containment hood; ii) development of a post-irradiation target retrieval system; iii) fabrication of a 211At distillation and recovery module and iv) a performance review and, where needed, an enhancement of seven major subsystems that comprise the CS-30 Cyclotron. With these modifications in place, routine production of ≥200 mCi of At-211 should be readily achievable, given our methodological development of At-211 target preparation, internal target irradiation and dry distillation to recover the radionuclide.

  20. Stellar Laboratories: 3. New Ba 5, Ba 6, and Ba 7 Oscillator Strengths and the Barium Abundance in the Hot White Dwarfs G191-B2B and RE 0503-289

    Science.gov (United States)

    Rauch, T.; Werner, K.; Quinet, P.; Kruk, Jeffrey Walter

    2014-01-01

    Context. For the spectral analysis of high-resolution and high-signal-to-noise (S/N) spectra of hot stars, state-of-the-art non-local thermodynamic equilibrium (NLTE) model atmospheres are mandatory. These are strongly dependent on the reliability of the atomic data that is used for their calculation. Aims. Reliable Ba 5-7 oscillator strengths are used to identify Ba lines in the spectra of the DA-type white dwarf G191-B2B and the DO-type white dwarf RE 0503-289 and to determine their photospheric Ba abundances. Methods. We newly calculated Ba v-vii oscillator strengths to consider their radiative and collisional bound-bound transitions in detail in our NLTE stellar-atmosphere models for the analysis of Ba lines exhibited in high-resolution and high-S/N UV observations of G191-B2B and RE 0503-289. Results. For the first time, we identified highly ionized Ba in the spectra of hot white dwarfs. We detected Ba vi and Ba vii lines in the Far Ultraviolet Spectroscopic Explorer (FUSE) spectrum of RE 0503-289. The Ba vi/Ba vii ionization equilibrium is well reproduced with the previously determined effective temperature of 70 000 K and surface gravity of log g=7.5. The Ba abundance is 3.5 +/- 0.5 × 10(exp-4) (mass fraction, about 23 000 times the solar value). In the FUSE spectrum of G191-B2B, we identified the strongest Ba vii line (at 993.41 Å) only, and determined a Ba abundance of 4.0 +/- 0.5 × 10(exp-6) (about 265 times solar). Conclusions. Reliable measurements and calculations of atomic data are a pre-requisite for stellar-atmosphere modeling. Observed Ba vi-vii line profiles in two white dwarfs' (G191-B2B and RE 0503-289) far-ultraviolet spectra were well reproduced with our newly calculated oscillator strengths. This allowed to determine the photospheric Ba abundance of these two stars precisely.

  1. Alterações leucocitárias como factor de prognóstico na evolução clínica da parvovirose canina: 191 casos

    OpenAIRE

    Frazão, Pedro Saraiva Gonçalves dos Santos

    2008-01-01

    Dissertação de Mestrado Integrado em Medicina Veterinária O objectivo deste trabalho foi o de caracterizar a frequência da raça, sexo e idade, assim como a sazonalidade na parvovirose canina, e investigar se existe alguma associação entre o número total de leucócitos, o leucograma e o prognóstico da parvovirose canina (alta vs. óbito). Num estudo retrospectivo observacional, em 191 canídeos com diagnóstico clínico de parvovirose canina confirmado através de teste ELISA, obte...

  2. Measurement of the Ir-191,193(n,2n)Ir-190,192 Reaction Cross Section Between 9.0 and 16.5 MeV

    Science.gov (United States)

    Wildenhain, Elizabeth; Finch, Sean; Tornow, Werner; Krishichayan, F.

    2017-09-01

    Iridium is one of the elements prioritized by Nonproliferation and Homeland Security agencies. In addition, Ir-192 is being used in various medical treatments. Improved data and corresponding evaluations of neutron-induced reactions on the iridium isotopes are required to meet the demands of several applications of societal interest. This study measured the cross section of the Ir-191,193(n, 2n)Ir-190,192 reactions at energies from 9.0 to 16.5 MeV using the activation technique. Natural Ir samples [Ir-191 37.3%, Ir-193 62.7%] were sandwiched between Au-197 monitor foils and irradiated with monoenergetic neutron beams at the tandem facility of the Triangle Universities Nuclear Laboratory (TUNL). Gamma rays from the irradiated samples were counted in TUNL's low background facility using high-efficient HPGe detectors. Measured cross-section data are compared to previous data and to predictions from nuclear data libraries (e.g. ENDF). Research at TUNL funded by the NSF.

  3. Stellar laboratories. II. New Zn iv and Zn v oscillator strengths and their validation in the hot white dwarfs G191-B2B and RE 0503-289

    Science.gov (United States)

    Rauch, T.; Werner, K.; Quinet, P.; Kruk, J. W.

    2014-04-01

    Context. For the spectral analysis of high-resolution and high-signal-to-noise (S/N) spectra of hot stars, state-of-the-art non-local thermodynamic equilibrium (NLTE) model atmospheres are mandatory. These are strongly dependent on the reliability of the atomic data that is used for their calculation. In a recent analysis of the ultraviolet (UV) spectrum of the DA-type white dwarf G191-B2B, 21 Zn iv lines were newly identified. Because of the lack of Zn iv data, transition probabilities of the isoelectronic Ge vi were adapted for a first, coarse determination of the photospheric Zn abundance. Aims: Reliable Zn iv and Zn v oscillator strengths are used to improve the Zn abundance determination and to identify more Zn lines in the spectra of G191-B2B and the DO-type white dwarf RE 0503-289. Methods: We performed new calculations of Zn iv and Zn v oscillator strengths to consider their radiative and collisional bound-bound transitions in detail in our NLTE stellar-atmosphere models for the analysis of the Zn iv - v spectrum exhibited in high-resolution and high-S/N UV observations of G191-B2B and RE 0503-289. Results: In the UV spectrum of G191-B2B, we identify 31 Zn iv and 16 Zn v lines. Most of these are identified for the first time in any star. We can reproduce well almost all of them at log Zn = -5.52 ± 0.2 (mass fraction, about 1.7 times solar). In particular, the Zn iv / Zn v ionization equilibrium, which is a very sensitive Teff indicator, is well reproduced with the previously determined and log g = 7.60 ± 0.05. In the spectrum of RE 0503-289, we identified 128 Zn v lines for the first time and determined log Zn = -3.57 ± 0.2 (155 times solar). Conclusions: Reliable measurements and calculations of atomic data are a pre-requisite for stellar-atmosphere modeling. Observed Zn iv and Zn v line profiles in two white dwarf (G191-B2B and RE 0503-289) ultraviolet spectra were well reproduced with our newly calculated oscillator strengths. This allowed us to

  4. Stellar laboratories . VIII. New Zr iv-vii, Xe iv-v, and Xe vii oscillator strengths and the Al, Zr, and Xe abundances in the hot white dwarfs G191-B2B and RE 0503-289

    Science.gov (United States)

    Rauch, T.; Gamrath, S.; Quinet, P.; Löbling, L.; Hoyer, D.; Werner, K.; Kruk, J. W.; Demleitner, M.

    2017-03-01

    Context. For the spectral analysis of high-resolution and high-signal-to-noise spectra of hot stars, state-of-the-art non-local thermodynamic equilibrium (NLTE) model atmospheres are mandatory. These are strongly dependent on the reliability of the atomic data that is used for their calculation. Aims: To search for zirconium and xenon lines in the ultraviolet (UV) spectra of G191-B2B and RE 0503-289, new Zr iv-vii, Xe iv-v, and Xe vii oscillator strengths were calculated. This allows, for the first time, determination of the Zr abundance in white dwarf (WD) stars and improvement of the Xe abundance determinations. Methods: We calculated Zr iv-vii, Xe iv-v, and Xe vii oscillator strengths to consider radiative and collisional bound-bound transitions of Zr and Xe in our NLTE stellar-atmosphere models for the analysis of their lines exhibited in UV observations of the hot WDs G191-B2B and RE 0503-289. Results: We identified one new Zr iv, 14 new Zr v, and ten new Zr vi lines in the spectrum of RE 0503-289. Zr was detected for the first time in a WD. We measured a Zr abundance of -3.5 ± 0.2 (logarithmic mass fraction, approx. 11 500 times solar). We identified five new Xe vi lines and determined a Xe abundance of -3.9 ± 0.2 (approx. 7500 times solar). We determined a preliminary photospheric Al abundance of -4.3 ± 0.2 (solar) in RE 0503-289. In the spectra of G191-B2B, no Zr line was identified. The strongest Zr iv line (1598.948 Å) in our model gave an upper limit of -5.6 ± 0.3 (approx. 100 times solar). No Xe line was identified in the UV spectrum of G191-B2B and we confirmed the previously determined upper limit of -6.8 ± 0.3 (ten times solar). Conclusions: Precise measurements and calculations of atomic data are a prerequisite for advanced NLTE stellar-atmosphere modeling. Observed Zr iv-vi and Xe vi-vii line profiles in the UV spectrum of RE 0503-289 were simultaneously well reproduced with our newly calculated oscillator strengths. Based on observations

  5. Stellar laboratories. IV. New Ga iv, Ga v, and Ga vi oscillator strengths and the gallium abundance in the hot white dwarfs G191-B2B and RE 0503-289

    Science.gov (United States)

    Rauch, T.; Werner, K.; Quinet, P.; Kruk, J. W.

    2015-05-01

    Context. For the spectral analysis of high-resolution and high-signal-to-noise (S/N) spectra of hot stars, advanced non-local thermodynamic equilibrium (NLTE) model atmospheres are mandatory. These atmospheres are strongly dependent on the reliability of the atomic data that are used to calculate them. Aims: Reliable Ga iv-vi oscillator strengths are used to identify Ga lines in the spectra of the DA-type white dwarf G191-B2B and the DO-type white dwarf RE 0503-289 and to determine their photospheric Ga abundances. Methods: We newly calculated Ga iv-vi oscillator strengths to consider their radiative and collisional bound-bound transitions in detail in our NLTE stellar-atmosphere models for analyzing of Ga lines exhibited in high-resolution and high-S/N UV observations of G191-B2B and RE 0503-289. Results: We unambiguously detected 20 isolated and 6 blended (with lines of other species) Ga v lines in the Far Ultraviolet Spectroscopic Explorer (FUSE) spectrum of RE 0503-289. The identification of Ga iv and Ga vi lines is uncertain because they are weak and partly blended by other lines. The determined Ga abundance is 3.5 ± 0.5 × 10-5 (mass fraction, about 625 times the solar value). The Ga iv/Ga v ionization equilibrium, which is a very sensitive indicator for the effective temperature, is well reproduced in RE 0503-289. We identified the strongest Ga iv lines (at 1258.801, 1338.129 Å) in the HST/STIS spectrum of G191-B2B and measured a Ga abundance of 2.0 ± 0.5 × 10-6 (about 22 times solar). Conclusions: Reliable measurements and calculations of atomic data are a prerequisite for stellar-atmosphere modeling. The observed Ga iv-v line profiles in two white dwarf (G191-B2B and RE 0503-289) ultraviolet spectra were well reproduced with our newly calculated oscillator strengths. For the first time, this allowed us to determine the photospheric Ga abundance in white dwarfs. Based on observations with the NASA/ESA Hubble Space Telescope, obtained at the Space

  6. Stellar laboratories. III. New Ba v, Ba vi, and Ba vii oscillator strengths and the barium abundance in the hot white dwarfs G191-B2B and RE 0503-289

    Science.gov (United States)

    Rauch, T.; Werner, K.; Quinet, P.; Kruk, J. W.

    2014-06-01

    Context. For the spectral analysis of high-resolution and high-signal-to-noise (S/N) spectra of hot stars, state-of-the-art non-local thermodynamic equilibrium (NLTE) model atmospheres are mandatory. These are strongly dependent on the reliability of the atomic data that is used for their calculation. Aims: Reliable Ba v-vii oscillator strengths are used to identify Ba lines in the spectra of the DA-type white dwarf G191-B2B and the DO-type white dwarf RE 0503-289 and to determine their photospheric Ba abundances. Methods: We newly calculated Ba v-vii oscillator strengths to consider their radiative and collisional bound-bound transitions in detail in our NLTE stellar-atmosphere models for the analysis of Ba lines exhibited in high-resolution and high-S/N UV observations of G191-B2B and RE 0503-289. Results: For the first time, we identified highly ionized Ba in the spectra of hot white dwarfs. We detected Ba vi and Ba vii lines in the Far Ultraviolet Spectroscopic Explorer (FUSE) spectrum of RE 0503-289. The Ba vi/Ba vii ionization equilibrium is well reproduced with the previously determined effective temperature of 70 000 K and surface gravity of log g = 7.5. The Ba abundance is 3.5 ± 0.5 × 10-4 (mass fraction, about 23 000 times the solar value). In the FUSE spectrum of G191-B2B, we identified the strongest Ba vii line (at 993.41 Å) only, and determined a Ba abundance of 4.0 ± 0.5 × 10-6 (about 265 times solar). Conclusions: Reliable measurements and calculations of atomic data are a pre-requisite for stellar-atmosphere modeling. Observed Ba vi-vii line profiles in two white dwarfs' (G191-B2B and RE 0503-289) far-ultraviolet spectra were well reproduced with our newly calculated oscillator strengths. This allowed to determine the photospheric Ba abundance of these two stars precisely. Based on observations with the NASA/ESA Hubble Space Telescope, obtained at the Space Telescope Science Institute, which is operated by the Association of Universities for

  7. Exposure Time Calculations for Calibrating of Vega and G191-B2B in the Optical and Near-Infrared: Ground-based, Airborne, Balloon-based, and Rocket-borne Experiments

    Science.gov (United States)

    Allam, S.; Bohlin, R. C.; Deustua, S. E.; Kent, S. M.; Lampton, M. L.; Mostek, N.; Mufson, S. L.; Richmond, M. W.; Smith, J. A.; Tucker, D. L.; Woodgate, B. E.; SNAP

    2004-12-01

    For SNAP to succeed the science program requires an accuracy in supernova color determination over the wavelength range 0.35-1.7 microns of 2% in the optical and 3% in the near infrared. We explore the possibility of the spectrophotometric calibration of standard stars for SNAP mission in the optical and near infrared using 5 different programs. It is important to understand the impact of different calibration programs in the estimated exposure time calculation and the estimated signal to noise (SNR). We have calculated the exposure time required for imaging and spectroscopic observations of spectrophotometric standard stars (Vega and HST standard G191-B2B) using SNAP detectors and filters at specified seeing, airmass, and sky conditions at either ground/space bases.

  8. The Virtual Observatory Service TheoSSA: Establishing a Database of Synthetic Stellar Flux Standards I. NLTE Spectral Analysis of the DA-Type White Dwarf G191-B2B *,**,***,****

    Science.gov (United States)

    Rauch, T.; Werner, K.; Bohlin, R.; Kruk, J. W.

    2013-01-01

    Hydrogen-rich, DA-type white dwarfs are particularly suited as primary standard stars for flux calibration. State-of-the-art NLTE models consider opacities of species up to trans-iron elements and provide reliable synthetic stellar-atmosphere spectra to compare with observations. Aims. We will establish a database of theoretical spectra of stellar flux standards that are easily accessible via a web interface. Methods. In the framework of the Virtual Observatory, the German Astrophysical Virtual Observatory developed the registered service TheoSSA. It provides easy access to stellar spectral energy distributions (SEDs) and is intended to ingest SEDs calculated by any model-atmosphere code. In case of the DA white dwarf G191-B2B, we demonstrate that the model reproduces not only its overall continuum shape but also the numerous metal lines exhibited in its ultraviolet spectrum. Results. TheoSSA is in operation and contains presently a variety of SEDs for DA-type white dwarfs. It will be extended in the near future and can host SEDs of all primary and secondary flux standards. The spectral analysis of G191-B2B has shown that our hydrostatic models reproduce the observations best at Teff =60 000 +/- 2000K and log g=7.60 +/- 0.05.We newly identified Fe vi, Ni vi, and Zn iv lines. For the first time, we determined the photospheric zinc abundance with a logarithmic mass fraction of -4.89 (7.5 × solar). The abundances of He (upper limit), C, N, O, Al, Si, O, P, S, Fe, Ni, Ge, and Sn were precisely determined. Upper abundance limits of about 10% solar were derived for Ti, Cr, Mn, and Co. Conclusions. The TheoSSA database of theoretical SEDs of stellar flux standards guarantees that the flux calibration of all astronomical data and cross-calibration between different instruments can be based on the same models and SEDs calculated with different model-atmosphere codes and are easy to compare.

  9. Basic residues in the 74-83 and 191-198 segments of protein kinase CK2 catalytic subunit are implicated in negative but not in positive regulation by the beta-subunit

    DEFF Research Database (Denmark)

    Sarno, S; Vaglio, P; Marin, O

    1997-01-01

    by the beta-subunit many fold more than that of alpha wild type, while extrastimulation by beta mutant D55L56E57A, observable with alpha wild type, is abolished with these mutants. These data support the conclusion that down regulation by the acidic residues clustered in the N-terminal moiety of beta......Protein kinase CK2 is a ubiquitous pleiotropic serine/threonine protein kinase whose holoenzyme is comprised of two catalytic (alpha and/or alpha') and two non-catalytic, beta-subunits. The beta-subunit possesses antagonist functions that can be physically dissected by generating synthetic...... fragments encompassing its N-terminal and C-terminal domains. Here we show that by mutating basic residues in the 74-77 and in the 191-198 regions of the alpha-subunit, the negative regulation by the beta-subunit and by its N-terminal synthetic fragment CK2beta-(1-77), which is observable using calmodulin...

  10. Odd and even partial waves of ηπ− and η′π− in π−p→η(′π−p at 191 GeV/c

    Directory of Open Access Journals (Sweden)

    C. Adolph

    2015-01-01

    Full Text Available Exclusive production of ηπ− and η′π− has been studied with a 191 GeV/c π− beam impinging on a hydrogen target at COMPASS (CERN. Partial-wave analyses reveal different odd/even angular momentum (L characteristics in the inspected invariant mass range up to 3 GeV/c2. A striking similarity between the two systems is observed for the L=2,4,6 intensities (scaled by kinematical factors and the relative phases. The known resonances a2(1320 and a4(2040 are in line with this similarity. In contrast, a strong enhancement of η′π− over ηπ− is found for the L=1,3,5 waves, which carry non-qq¯ quantum numbers. The L=1 intensity peaks at 1.7 GeV/c2 in η′π− and at 1.4 GeV/c2 in ηπ−, the corresponding phase motions with respect to L=2 are different.

  11. Odd and Even Partial Waves of $\\eta\\pi^-$ and $\\eta'\\pi^-$ in $\\pi^-p\\to\\eta^{(\\prime)}\\pi^-p$ at $191\\,\\textrm{GeV}/c$

    CERN Document Server

    Adolph, C.; Alexeev, M.G.; Alexeev, G.D.; Amoroso, A.; Andrieux, V.; Anosov, V.; Austregesilo, A.; Badelek, B.; Balestra, F.; Barth, J.; Baum, G.; Beck, R.; Bedfer, Y.; Berlin, A.; Bernhard, J.; Bicker, K.; Bielert, E.R.; Bieling, J.; Birsa, R.; Bisplinghoff, J.; Bodlak, M.; Boer, M.; Bordalo, P.; Bradamante, F.; Braun, C.; Bressan, A.; Buchele, M.; Burtin, E.; Capozza, L.; Chiosso, M.; Chung, S.U.; Cicuttin, A.; Crespo, M.L.; Curiel, Q.; Dalla Torre, S.; Dasgupta, S.S.; Dasgupta, S.; Denisov, O.Yu.; Donskov, S.V.; Doshita, N.; Duic, V.; Dunnweber, W.; Dziewiecki, M.; Efremov, A.; Elia, C.; Eversheim, P.D.; Eyrich, W.; Faessler, M.; Ferrero, A.; Finger, M.; M. Finger jr; Fischer, H.; Franco, C.; von Hohenesche, N. du Fresne; Friedrich, J.M.; Frolov, V.; Gautheron, F.; Gavrichtchouk, O.P.; Gerassimov, S.; Geyer, R.; Gnesi, I.; Gobbo, B.; Goertz, S.; Gorzellik, M.; Grabmuller, S.; Grasso, A.; Grube, B.; Grussenmeyer, T.; Guskov, A.; Haas, F.; von Harrach, D.; Hahne, D.; Hashimoto, R.; Heinsius, F.H.; Herrmann, F.; Hinterberger, F.; Hoppner, Ch.; Horikawa, N.; d'Hose, N.; Huber, S.; Ishimoto, S.; Ivanov, A.; Ivanshin, Yu.; Iwata, T.; Jahn, R.; Jary, V.; Jasinski, P.; Jorg, P.; Joosten, R.; Kabuss, E.; Ketzer, B.; Khaustov, G.V.; Khokhlov, Yu. A.; Kisselev, Yu.; Klein, F.; Klimaszewski, K.; Koivuniemi, J.H.; Kolosov, V.N.; Kondo, K.; Konigsmann, K.; Konorov, I.; Konstantinov, V.F.; Kotzinian, A.M.; Kouznetsov, O.; Kramer, M.; Kroumchtein, Z.V.; Kuchinski, N.; Kunne, F.; Kurek, K.; Kurjata, R.P.; Lednev, A.A.; Lehmann, A.; Levillain, M.; Levorato, S.; Lichtenstadt, J.; Maggiora, A.; Magnon, A.; Makke, N.; Mallot, G.K.; Marchand, C.; Martin, A.; Marzec, J.; Matousek, J.; Matsuda, H.; Matsuda, T.; Meshcheryakov, G.; Meyer, W.; Michigami, T.; Mikhailov, Yu. V.; Miyachi, Y.; Nagaytsev, A.; Nagel, T.; Nerling, F.; Neubert, S.; Neyret, D.; Novy, J.; Nowak, W.D.; Nunes, A.S.; Olshevsky, A.G.; Orlov, I.; Ostrick, M.; Panknin, R.; Panzieri, D.; Parsamyan, B.; Paul, S.; Peshekhonov, D.V.; Platchkov, S.; Pochodzalla, J.; Polyakov, V.A.; Pretz, J.; Quaresma, M.; Quintans, C.; Ramos, S.; Regali, C.; Reicherz, G.; Rocco, E.; Rossiyskaya, N.S.; Ryabchikov, D.I.; Rychter, A.; Samoylenko, V.D.; Sandacz, A.; Sarkar, S.; Savin, I.A.; Sbrizzai, G.; Schiavon, P.; Schill, C.; Schluter, T.; Schmidt, K.; Schmieden, H.; Schonning, K.; Schopferer, S.; Schott, M.; Shevchenko, O.Yu.; Silva, L.; Sinha, L.; Sirtl, S.; Slunecka, M.; Sosio, S.; Sozzi, F.; Srnka, A.; Steiger, L.; Stolarski, M.; Sulc, M.; Sulej, R.; Suzuki, H.; Szabelski, A.; Szameitat, T.; Sznajder, P.; Takekawa, S.; Wolbeek, J. ter; Tessaro, S.; Tessarotto, F.; Thibaud, F.; Uhl, S.; Uman, I.; Virius, M.; Wang, L.; Weisrock, T.; Wilfert, M.; Windmolders, R.; Wollny, H.; Zaremba, K.; Zavertyaev, M.; Zemlyanichkina, E.; Ziembicki, M.; Zink, A.

    2015-01-01

    Exclusive production of $\\eta\\pi^-$ and $\\eta'\\pi^-$ has been studied with a $191\\,\\textrm{GeV}/c$ $\\pi^-$ beam impinging on a hydrogen target at COMPASS (CERN). Partial-wave analyses reveal different odd/even angular momentum ($L$) characteristics in the inspected invariant mass range up to $3\\,\\textrm{GeV}/c^2$. A striking similarity between the two systems is observed for the $L=2,4,6$ intensities (scaled by kinematical factors) and the relative phases. The known resonances $a_2(1320)$ and $a_4(2040)$ are in line with this similarity. In contrast, a strong enhancement of $\\eta'\\pi^-$ over $\\eta\\pi^-$ is found for the $L=1,3,5$ waves, which carry non-$q\\bar q$ quantum numbers. The $L=1$ intensity peaks at $1.7\\,\\textrm{GeV}/c^2$ in $\\eta'\\pi^-$ and at $1.4\\,\\textrm{GeV}/c^2$ in $\\eta\\pi^-$, the corresponding phase motions with respect to $L=2$ are different.

  12. Reference: 191 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available T2 and 3 synthesized in recombinant bacteria and yeast possessed in vitro enzyme activity higher...acteria or yeast, the microbial extract did not contain LPAT activity higher than the endogenous LPAT activi

  13. GPCR Interaction: 191 [GRIPDB[Archive

    Lifescience Database Archive (English)

    Full Text Available hetero oligomer between corticotropin releasing hormone receptor (CRHR) and VT2 vasotocin receptor (VT2R)...and interfaces of CRHR B Corticotropin releasing hormone ... CRHR A Vasotocin VT2 VT2R Experiment TM IV of

  14. 32 CFR 191.3 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... major life activities only as a result of the attitude of others toward such impairment; or (3) None of..., such as mental retardation, organic brain syndrome, emotional or mental illness, and specific learning..., walking, seeing, hearing, speaking, breathing, learning, and working. (c) Has a record of such impairment...

  15. 14 CFR Sec. 19-1 - Applicability.

    Science.gov (United States)

    2010-01-01

    ... by Nonstop Segment and On-flight Market.” The “Instructions to Foreign Air Carriers for Reporting... Capacity Data By Nonstop Segment and On-flight Market,” and summary data as prescribed in this section and... forms or submit data via e-mail. (d) On-flight market and nonstop segment detail data by carrier shall...

  16. 40 CFR 63.191 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... coating of drug particles, or solvent recovery or waste management operations. Polybutadiene production... bactericidal protection of plastics. The process uses chloroform as a solvent. Pharmaceutical production... management of flow rates or volumes is needed to assist in production of a product. Symmetrical...

  17. Publications | Page 191 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    While many of these projects have documented adaptations and coping strategies currently being utilized, few examine their effectiveness,... Exploring how the ... In this region, the supply of houses in rural and urban areas has failed to keep up with demand, leading to severe shortages of safe and affordable housing.

  18. 49 CFR 191.3 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... of the United States that is in direct contact with the open seas and beyond the line marking the... attached to pipe, compressor units, metering stations, regulator stations, delivery stations, holders, and... pipeline, or the storage of gas in or affecting interstate or foreign commerce. [35 FR 320, Jan. 8, 1970...

  19. 19 CFR 191.2 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... law because of its importation, and the refund of internal revenue taxes paid on domestic alcohol as... the manufacturing or production process. Market value is generally measured by the selling price, not...

  20. Estrabismo sensorial: estudo de 191 casos

    OpenAIRE

    Oliveira,Bráulio Folco Telles de; Bigolin, Silvane; SOUZA, Murilo Barreto; Polati,Mariza

    2006-01-01

    OBJETIVO: Avaliar os prontuários dos pacientes com estrabismo sensorial em aspectos variados, como etiologia, tipo e medida do desvio, correlação do tipo do desvio com a idade de aparecimento da doença de base, e resultado cirúrgico dos casos operados. MÉTODOS: Avaliação dos prontuários médicos dos pacientes com estrabismo sensorial atendidos no Hospital das Clínicas da Faculdade de Medicina da Universidade de São Paulo - USP - no setor de Motilidade Ocular Extrínseca, no período de setembro ...

  1. BDML Metadata: 191 [SSBD[Archive

    Lifescience Database Archive (English)

    Full Text Available NC-SA 0.180 d800e60b-630a-4560-a005-80e673a1d25d 0.105 x 0.105 x 0.5 (micrometer), 40 (second) http://ssbd.qbic.riken.jp/data.../source/Ce_KK_P002/RNAi_T07C4.7_040831_02.zip http://ssbd.qbic.riken.jp/data.../bdml/Ce_KK_P002/RNAi_T07C4.7_040831_02.bdml0.18.xml http://ssbd.qbic.riken.jp/data/pdpml/Ce_KK_...P002.pdpml0.06.xml http://ssbd.qbic.riken.jp/search/d800e60b-630a-4560-a005-80e673a1d25d/ http://ssbd.qbic.riken.jp/omero/webclient/?show=dataset-96 ...

  2. 19 CFR 191.112 - Procedure.

    Science.gov (United States)

    2010-04-01

    ... engaged in a class of business or trade which makes it eligible for drawback. (i) Articles laden or... Customs Form 7514 may be filed either before or after the lading of the articles. If filed after lading, the notice shall be filed within 3 years after exportation of the articles. (d) Contents of notice...

  3. 40 CFR 191.12 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... comment on performance assessment reports of the Waste Isolation Pilot Plant; and (vi) Concurrence by the... behavior of a disposal system, including consideration of the uncertainties in predicted behavior, if the...

  4. Publications | Page 191 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Mobile phone adoption and usage is increasingly gaining in importance among users at the bottom of the economic pyramid (BOP). This paper investigates the phenomenon of information obtained ... Climate change is reframing Africa''s food security debate. Farmers have long adapted to recurrent droughts through ...

  5. 14 CFR 21.191 - Experimental certificates.

    Science.gov (United States)

    2010-01-01

    ... compliance for issuance of type and supplemental type certificates, flights to substantiate major design....184(a). (i) Operating light-sport aircraft. Operating a light-sport aircraft that— (1) Has not been... certificate in the light-sport category under § 21.190. ...

  6. 19 CFR 10.191 - General.

    Science.gov (United States)

    2010-04-01

    ... proclaim duty-free treatment for all eligible articles from any beneficiary country. (b) Definitions—(1... manufacture of a beneficiary country” refers both to any article which has been entirely grown, produced, or... an article which have been entirely grown, produced, or manufactured in any beneficiary country or...

  7. 32 CFR 191.6 - Procedures.

    Science.gov (United States)

    2010-07-01

    ... of this part are fully implemented and are in compliance with the spirit and intent of the DoD Human... candidates for employment at all levels. (6) Develop procedures for and implement all SEPs established under this part at the Component level. These SEPs shall be integral parts of the Civilian EEO Program and...

  8. 19 CFR 191.92 - Accelerated payment.

    Science.gov (United States)

    2010-04-01

    ... of the claimant are transferred by written agreement, merger, or corporate resolution to a successor...) Identity (by name and title) of the person in claimant's organization who will be responsible for the... payments of drawback (see paragraph (d) of this section), including: (A) Identity of the surety to be used...

  9. Publications | Page 191 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    In Cuba, researchers from the University of Ottawa and the Instituto Superior de Tecnologías y Ciencias Aplicadas determined that mercury-tainted fish were a leading cause of health problems. ENACQKT-ing : Caribbean nurses enhancing care, quality and knowledge through technology; final technical report (open access).

  10. The virtual observatory service TheoSSA: Establishing a database of synthetic stellar flux standards. I. NLTE spectral analysis of the DA-type white dwarf G191-B2B

    Science.gov (United States)

    Rauch, T.; Werner, K.; Bohlin, R.; Kruk, J. W.

    2013-12-01

    Context. Hydrogen-rich, DA-type white dwarfs are particularly suited as primary standard stars for flux calibration. State-of-the-art NLTE models consider opacities of species up to trans-iron elements and provide reliable synthetic stellar-atmosphere spectra to compare with observations. Aims: We will establish a database of theoretical spectra of stellar flux standards that are easily accessible via a web interface. Methods: In the framework of the Virtual Observatory, the German Astrophysical Virtual Observatory developed the registered service TheoSSA. It provides easy access to stellar spectral energy distributions (SEDs) and is intended to ingest SEDs calculated by any model-atmosphere code. In case of the DA white dwarf G191-B2B, we demonstrate that the model reproduces not only its overall continuum shape but also the numerous metal lines exhibited in its ultraviolet spectrum. Results: TheoSSA is in operation and contains presently a variety of SEDs for DA-type white dwarfs. It will be extended in the near future and can host SEDs of all primary and secondary flux standards. The spectral analysis of G191-B2B has shown that our hydrostatic models reproduce the observations best at and log g = 7.60 ± 0.05. We newly identified Fe vi, Ni vi, and Zn iv lines. For the first time, we determined the photospheric zinc abundance with a logarithmic mass fraction of -4.89 (7.5 × solar). The abundances of He (upper limit), C, N, O, Al, Si, O, P, S, Fe, Ni, Ge, and Sn were precisely determined. Upper abundance limits of about 10% solar were derived for Ti, Cr, Mn, and Co. Conclusions: The TheoSSA database of theoretical SEDs of stellar flux standards guarantees that the flux calibration of all astronomical data and cross-calibration between different instruments can be based on the same models and SEDs calculated with different model-atmosphere codes and are easy to compare. Based on observations with the NASA/ESA Hubble Space Telescope, obtained at the Space Telescope

  11. Stellar laboratories. VI. New Mo iv-vii oscillator strengths and the molybdenum abundance in the hot white dwarfs G191-B2B and RE 0503-289

    Science.gov (United States)

    Rauch, T.; Quinet, P.; Hoyer, D.; Werner, K.; Demleitner, M.; Kruk, J. W.

    2016-03-01

    Context. For the spectral analysis of high-resolution and high signal-to-noise (S/N) spectra of hot stars, state-of-the-art non-local thermodynamic equilibrium (NLTE) model atmospheres are mandatory. These are strongly dependent on the reliability of the atomic data that is used for their calculation. Aims: To identify molybdenum lines in the ultraviolet (UV) spectra of the DA-type white dwarf G191-B2B and the DO-type white dwarf RE 0503-289 and, to determine their photospheric Mo abundances, reliable Mo iv-vii oscillator strengths are used. Methods: We newly calculated Mo iv-vii oscillator strengths to consider their radiative and collisional bound-bound transitions in detail in our NLTE stellar-atmosphere models for the analysis of Mo lines exhibited in high-resolution and high S/N UV observations of RE 0503-289. Results: We identified 12 Mo v and 9 Mo vi lines in the UV spectrum of RE 0503-289 and measured a photospheric Mo abundance of 1.2-3.0 × 10-4 (mass fraction, 22 500-56 400 times the solar abundance). In addition, from the As v and Sn iv resonance lines, we measured mass fractions of arsenic (0.5-1.3 × 10-5, about 300-1200 times solar) and tin (1.3-3.2 × 10-4, about 14 300-35 200 times solar). For G191-B2B, upper limits were determined for the abundances of Mo (5.3 × 10-7, 100 times solar) and, in addition, for Kr (1.1 × 10-6, 10 times solar) and Xe (1.7 × 10-7, 10 times solar). The arsenic abundance was determined (2.3-5.9 × 10-7, about 21-53 times solar). A new, registered German Astrophysical Virtual Observatory (GAVO) service, TOSS, has been constructed to provide weighted oscillator strengths and transition probabilities. Conclusions: Reliable measurements and calculations of atomic data are a prerequisite for stellar-atmosphere modeling. Observed Mo v-vi line profiles in the UV spectrum of the white dwarf RE 0503-289 were well reproduced with our newly calculated oscillator strengths. For the first time, this allowed the photospheric Mo

  12. Gene flow across genus barriers – Conjugation of Dinoroseobacter shibae´s 191-kb killer plasmid into Phaeobacter inhibens and AHL-mediated expression of type IV secretion systems

    Directory of Open Access Journals (Sweden)

    Diana ePatzelt

    2016-05-01

    Full Text Available Rhodobacteraceae harbor a conspicuous wealth of extrachromosomal replicons (ECRs and therefore the exchange of genetic material via horizontal transfer has been supposed to be a major evolutionary driving force. Many plasmids in the roseobacter group encode type IV secretion systems (T4SS that generally mediate transfer of proteins and/or DNA into host cells, but no experimental evidence of either has yet been provided. Dinoroseobacter shibae contains five ECRs that are crucial for anaerobic growth, survival under starvation and the pathogenicity of this model organism. Here we tagged two syntenous but compatible RepABC-type plasmids of 191 kb and 126-kb size, each harboring a T4SS, with antibiotic resistance genes and demonstrated their conjugational transfer into a distantly related roseo-bacter species, namely Phaeobacter inhibens. Pulsed field gel electrophoresis showed transfer of those replicons into the recipient both individually but also together documenting the efficiency of conjugation. We then studied the influence of externally added quorum sensing (QS signals on the expression of the T4SS located on the sister plasmids. A QS deficient D. shibae null mutant (ΔluxI1 lacking synthesis of N-acyl-homoserine lactones (AHLs was cultivated with a wide spectrum of chemically diverse long-chain AHLs. All AHLs with lengths of the acid side-chain >14 reverted the ΔluxI1 phenotype to wild-type. Expression of the T4SS was induced above wild-type level. We hypothesize that conjugation in roseobacters is QS-controlled and that the QS system may detect a wide array of long-chain AHLs at the cell surface.

  13. Stellar laboratories . IX. New Se v, Sr iv-vii, Te vi, and I vi oscillator strengths and the Se, Sr, Te, and I abundances in the hot white dwarfs G191-B2B and RE 0503-289

    Science.gov (United States)

    Rauch, T.; Quinet, P.; Knörzer, M.; Hoyer, D.; Werner, K.; Kruk, J. W.; Demleitner, M.

    2017-10-01

    Context. To analyze spectra of hot stars, advanced non-local thermodynamic equilibrium (NLTE) model-atmosphere techniques are mandatory. Reliable atomic data is crucial for the calculation of such model atmospheres. Aims: We aim to calculate new Sr iv-vii oscillator strengths to identify for the first time Sr spectral lines in hot white dwarf (WD) stars and to determine the photospheric Sr abundances. To measure the abundances of Se, Te, and I in hot WDs, we aim to compute new Se v, Te vi, and I vi oscillator strengths. Methods: To consider radiative and collisional bound-bound transitions of Se v, Sr iv - vii, Te vi, and I vi in our NLTE atmosphere models, we calculated oscillator strengths for these ions. Results: We newly identified four Se v, 23 Sr v, 1 Te vi, and three I vi lines in the ultraviolet (UV) spectrum of RE 0503-289. We measured a photospheric Sr abundance of 6.5+ 3.8-2.4× 10-4 (mass fraction, 9500-23 800 times solar). We determined the abundances of Se (1.6+ 0.9-0.6× 10-3, 8000-20 000), Te (2.5+ 1.5-0.9× 10-4, 11 000-28 000), and I (1.4+ 0.8-0.5× 10-5, 2700-6700). No Se, Sr, Te, and I line was found in the UV spectra of G191-B2B and we could determine only upper abundance limits of approximately 100 times solar. Conclusions: All identified Se v, Sr v, Te vi, and I vi lines in the UV spectrum of RE 0503-289 were simultaneously well reproduced with our newly calculated oscillator strengths. Based on observations with the NASA/ESA Hubble Space Telescope, obtained at the Space Telescope Science Institute, which is operated by the Association of Universities for Research in Astronomy, Inc., under NASA contract NAS5-26666. Based on observations made with the NASA-CNES-CSA Far Ultraviolet Spectroscopic Explorer. Full Tables A.15 to A.21 are only available via the German Astrophysical Virtual Observatory (GAVO) service TOSS (http://dc.g-vo.org/TOSS).

  14. Evaluation of Novel Wet Chemistry Separation and Purification Methods to Facilitate Automation of Astatine-­211 Isolation

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott [Univ. of Washington, Seattle, WA (United States)

    2016-07-19

    This research is a collaborative effort between the research groups of the PIs, Dr. D. Scott Wilbur in the Department of Radiation Oncology at the University of Washington (UW) and Matthew O’Hara at the Pacific Northwest National Laboratory (PNNL). In this report only those studies conducted at UW and the budget information from UW will be reported. A separate progress and financial report will be provided by PNNL. This final report outlines the experiments (Tasks) conducted and results obtained at UW from July 1, 2013 thru June 30, 2016 (2-­year project with 1 year no-­cost extension). The report divides the information on the experiments and results obtained into the 5 specific objectives of the research efforts and the Tasks within those objectives. This format is used so that it is easy to see what has been accomplished in each area. A brief summary of the major findings from the studies is provided below. Summary of Major Findings from Research/Training Activities at UW: Anion and cation exchange columns did not provide adequate 211At capture and/or extraction results under conditions studied to warrant further evaluation; PEG-­Merrifield resins containing mPEG350, mPEG750, mPEG2000 and mPEG5000 were synthesized and evaluated; All of the mPEG resins with different sized mPEG moieties conjugated gave similar 211At capture (>95%) from 8M HCl solutions and release with conc. NH4OH (~50-­80%), but very low quantities were released when NaOH was used as an eluent; Capture and release of 211At when loading [211At]astatate appeared to be similar to that of [211At]astatide on PEG columns, but further studies need to be conducted to confirm that; Capture of 211At on PEG columns was lower (e.g. 80-­90%) from solutions of 8M HNO3, but higher capture rates (e.g. 99%) can be obtained when 10M HNO3 is mixed with an equal quantity of 8M HCl; Addition of reductants to the 211At solutions did not appear to change the percent capture, but may have an effect on the % extracted; There was some indication that the PEG-­Merrifield resins could be saturated (perhaps with Bi) resulting in lower capture percentages, but more studies need to be done to confirm that; A target dissolution chamber, designed and built at PNNL, works well with syringe pumps so it can be used in an automated system; Preliminary semi-­automated 211At isolation studies have been conducted with full-scale target dissolution and 211At isolation using a PEG column on the Hamilton automated system gave low overall recoveries, but HNO3 was used (rather than HCl) for loading the 211At and flow rates were not optimized; Results obtained using PEG columns are high enough to warrant further development on a fully automated system; Results obtained also indicate that additional studies are warranted to evaluate other types of columns for 211At separation from bismuth, which allow use of HNO3/HCl mixtures for loading and NaOH for eluting 211At. Such a column could greatly simplify the overall isolation process and make it easier to automate.

  15. Estrabismo sensorial: estudo de 191 casos Sensorial strabismus: a study of 191 cases

    OpenAIRE

    Bráulio Folco Telles de Oliveira; Silvane Bigolin; Murilo Barreto Souza; Mariza Polati

    2006-01-01

    OBJETIVO: Avaliar os prontuários dos pacientes com estrabismo sensorial em aspectos variados, como etiologia, tipo e medida do desvio, correlação do tipo do desvio com a idade de aparecimento da doença de base, e resultado cirúrgico dos casos operados. MÉTODOS: Avaliação dos prontuários médicos dos pacientes com estrabismo sensorial atendidos no Hospital das Clínicas da Faculdade de Medicina da Universidade de São Paulo - USP - no setor de Motilidade Ocular Extrínseca, no período de setembro ...

  16. LaNi5-Assisted Hydrogenation of MgNi2 in the Hybrid Structures of La1.09Mg1.91Ni9D9.5 and La0.91Mg2.09Ni9D9.4

    Directory of Open Access Journals (Sweden)

    Roman V. Denys

    2015-04-01

    Full Text Available This work focused on the high pressure PCT and in situ neutron powder diffraction studies of the LaMg2Ni9-H2 (D2 system at pressures up to 1,000 bar. LaMg2Ni9 alloy was prepared by a powder metallurgy route from the LaNi9 alloy precursor and Mg powder. Two La3−xMgxNi9 samples with slightly different La/Mg ratios were studied, La1.1Mg1.9Ni9 (sample 1 and La0.9Mg2.1Ni9 (sample 2. In situ neutron powder diffraction studies of the La1.09Mg1.91Ni9D9.5 (1 and La0.91Mg2.09Ni9D9.4 (2 deuterides were performed at 25 bar D2 (1 and 918 bar D2 (2. The hydrogenation properties of the (1 and (2 are dramatically different from those for LaNi3. The Mg-containing intermetallics reversibly form hydrides with DHdes = 24.0 kJ/molH2 and an equilibrium pressure of H2 desorption of 18 bar at 20 °C (La1.09Mg1.91Ni9. A pronounced hysteresis of H2 absorption and desorption, ~100 bar, is observed. The studies showed that LaNi5-assisted hydrogenation of MgNi2 in the LaMg2Ni9 hybrid structure takes place. In the La1.09Mg1.91Ni9D9.5 (1 and La0.91Mg2.09Ni9D9.4 (2 (a = 5.263/5.212; c = 25.803/25.71 Å D atoms are accommodated in both Laves and CaCu5-type slabs. In the LaNi5 CaCu5-type layer, D atoms fill three types of interstices; a deformed octahedron [La2Ni4], and [La(Mg2Ni2] and [Ni4] tetrahedra. The overall chemical compositions can be presented as LaNi5H5.6/5.0 + 2*MgNi2H1.95/2.2 showing that the hydrogenation of the MgNi2 slab proceeds at mild H2/D2 pressure of just 20 bar. A partial filling by D of the four types of the tetrahedral interstices in the MgNi2 slab takes place, including [MgNi3] and [Mg2Ni2] tetrahedra.

  17. 22 CFR 191.12 - Description of benefits.

    Science.gov (United States)

    2010-04-01

    ... writing. (b) Written agreements. Section 107 (50 U.S.C. App. 517) provides that nothing contained in the... obligations, but requires that such arrangements be in writing. (c) Protection in court. Section 200 (50 U.S.C... taking advantage of the Act. (k) Further relief. Section 700 (50 U.S.C. App. 590) provides that a person...

  18. Dicty_cDB: CHN191 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2002.10.25 Translated Amino Acid sequence rk*lll*KMAIEEESSNSGVSTSIDNLGSSIDGKGSSKGKQGDMEGIDNEVFVYGGDENH F...---xixxx*ml*xkkiyxffxiqlliixtiiitxpwvi Frame C: rk*lll*KMAIEEESSNSGVSTSIDNLGSSIDGKGSSKGKQGDMEGIDNEVFVYGGDENH F

  19. 19 CFR 191.8 - Specific manufacturing drawback ruling.

    Science.gov (United States)

    2010-04-01

    ... Headquarters (Attention: Director, Entry Process and Duty Refunds Branch, Regulations and Rulings, Office of... for such a ruling to CBP Headquarters (Attention: Entry Process and Duty Refunds Branch, Regulations... drawback office(s) where claims are filed (with a copy to CBP Headquarters, Attention, Entry Process and...

  20. 47 CFR 0.191 - Functions of the Bureau.

    Science.gov (United States)

    2010-10-01

    ... on waivers of rules; acting on applications for service and facility authorizations; compliance and... international monitoring, fixed and mobile direction-finding and interference resolution; and oversees... during non-business hours when the other Offices and Bureaus of the Commission are closed. Such actions...

  1. Dicty_cDB: SFL191 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TLSLNNEKGKKKIQSKTLLRQILGNLKDGD SPKETIIIYGLPFHFSGWRKYIQLEGLRKLVGNAMMAQWQNPLIQKQFGIEIPEGNRLRE AKYQLKRS...TLSLNNEKGKKKIQSKTLLRQILGNLKDGD SPKETIIIYGLPFHFSGWRKYIQLEGLRKLVGNAMMAQWQNPLIQKQFGIEIPEGNRLRE AKYQLKRS

  2. 22 CFR 191.5 - Relationships among agencies.

    Science.gov (United States)

    2010-04-01

    ... head of any agency whenever an employee (including a member of the Armed Forces) in that agency, or Family Member of such employee, is determined to be eligible for benefits under this subchapter. (b) In... the costs attributable to Principals (and Family Members) in or acting on behalf of the agency plus a...

  3. Dicty_cDB: CFE191 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TYAEEGSKTTTSGFKYFDFTKHYY NDKFFPVDSLGFGNNGLDHNYKWCARLHFVSFFPPDNPPMNFYASHSDDLFIFIDGVSVY SYIGITDKSEISLDFKKI---...TYAEEGSKTTTSGFKYFDFTKHYY NDKFFPVDSLGFGNNGLDHNYKWCARLHFVSFFPPDNPPMNFYASHSDDLFIFIDGVSVY SYIGITDKSEISLDFKKI---

  4. 191 Weaning Practices and Nutritional Status of Infants in Isoko ...

    African Journals Online (AJOL)

    Nekky Umera

    It was observed that some of the infants had normal nutritional status. Others were malnourished. It was recommended among others that the mothers should be encouraged to wean their babies with legumes, green leafy vegetables, soymilk, fish and fruits to enhance their nutritional status. Introduction. The first few years of ...

  5. Dicty_cDB: SSB191 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available EST340090 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD8K1 5'...EST338521 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD2E1 5'...EST339369 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD4B20 5'

  6. Dicty_cDB: AFB191 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ive cysteine proteinase 1; ... 115 4e-25 AY336797_1( AY336797 |pid:none) Rhipicephalus haemaphysaloides hae...... 115 4e-25 AY336798_1( AY336798 |pid:none) Rhipicephalus haemaphysaloides hae..

  7. Dicty_cDB: SSA191 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VTDKLNLHSLRSRKWYIQST CATSGDGLYEGLDWLSNTLTSSSK*mt*evnliefirffnylii*lnycclilk*kkkkp clyk*** Translated Amino A...PNAMSVAEVTDKLNLHSLRSRKWYIQST CATSGDGLYEGLDWLSNTLTSSSK*mt*evnliefirffnylii*lnycclilk*kkkkp clyk*** Frame B: f

  8. Dicty_cDB: SHC191 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available mRNA sequence. 56 0.001 1 CV682907 |CV682907.1 service43_H06_sjs2-16-2B11-T3 SJS Schistosoma japonicum cDNA,... mRNA sequence. 56 0.001 1 CV682854 |CV682854.1 service30_G09_sjs2-14-10C09-T3 SJ

  9. Dicty_cDB: SHJ191 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sequence. 56 0.001 1 CV682907 |CV682907.1 service43_H06_sjs2-16-2B11-T3 SJS Schistosoma japonicum cDNA, mRNA... sequence. 56 0.001 1 CV682854 |CV682854.1 service30_G09_sjs2-14-10C09-T3 SJS Schistosoma japonicum cDNA, mR

  10. Dicty_cDB: SHE191 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available strand read from insert in 3'HPRT insertion targeting and chromosome engineering clone MHPP186g09. 50 0.063 ...sert in 3'HPRT insertion targeting and chromosome engineering clone MHPP47e19. 50 0.063 1 CR034434 |CR034434....1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering clone MHPP47e19....ion targeting and chromosome engineering clone MHPP142o16. 50 0.063 1 dna update 2006. 2.10 Homology vs Prot...1 CR023465 |CR023465.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engine

  11. Bull. Chem. Soc. Ethiop. 2005, 19(1)

    African Journals Online (AJOL)

    oxygenated methine protons. The interpretation of these ]H and [3C spectral data by means of. 'H-'H cosy, HMQC and HMBC experiments allowed full assignment of all the NMR signals and led to structure 1. In fact, the examination of the 'H NMR spectrum of compound 1' (Table 1) revealed the presence of four signals at 6 ...

  12. All projects related to | Page 191 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2017-10-06

    Assessment of Physical Activity and Active Transport Among School Children in Kenya, Nigeria, and Mozambique. Project. Non-communicable diseases (NCDs) are a major global public health crisis. End Date: October 6, 2017. Topic: PUBLIC HEALTH, HEALTH PROGRAMMES, AFRICA SOUTH OF SAHARA, YOUTH, ...

  13. The UV attenuation in JWST target VV 191

    Science.gov (United States)

    Holwerda, Benne

    2017-08-01

    We aim to map the UV-near-IR attenuation curve along many sightlines within nearby disk galaxies to resolve a large fundamental uncertainty in galaxy evolution studies: the variance in the attenuation curve within an indivual galaxy disk on linear scales beautifully backlights the outer disk of a foreground face-on spiral galaxy.Dither strategy:We opt for a 2-point dither in the case of the F336W observations (1 orbit) and a 3pt dither strategy for the F225W observations. The 9 orbits for the F225W observations are broken into three groupings of 3 orbits in the 3 dither pattern. This is to ensure correction of cosmics and detector artifacts. Our secondary aim is an HST/JWST image with good public outreach potential and our aim is to maximize image quality for this reason as well.

  14. EUREKA EU 191 - an inspection toolkit for an advanced ROV

    Energy Technology Data Exchange (ETDEWEB)

    Smith, B.J. (AEA Petroleum Services, Harwell (United Kingdom)); Wedgwood, F.A.; Siva, K.

    1992-01-01

    This paper is concerned specifically with a Work and Inspection Robot (WIR) which is an intelligent ROV intended to carry out remote inspection, maintenance and repair of underwater structures. (author).

  15. Dicty_cDB: SSC191 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |AC126303.4 Rattus norvegicus clone CH230-208A16, WORKING DRAFT SEQUENCE, 1 ordered piece. 46 0.29 1 AC108777...AC108777 |AC108777.3 Mus musculus clone RP23-368H22, WORKING DRAFT SEQUENCE, 32 ordered pieces. 46 0.29 1 AC007555...|AC007555.2 Homo sapiens chromosome 7 clone RP5-925B6, WORKING DRAFT SEQUENCE, 2 unordered pieces. 40 0.30 2 AC120953...|AC120953.4 Rattus norvegicus clone CH230-433F7, WORKING DRAFT SEQUENCE, 1 ordered piece. 40 0.97 3 AC111961...|AC111961.4 Rattus norvegicus clone CH230-115B20, WORKING DRAFT SEQUENCE, 2 unordered pieces. 44 1.2 1 AC118593

  16. Dicty_cDB: AFI191 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VI*tf*fiylfislfiyffislfiylfiylltnqqhtpl*ilkfkdvriscrk*f*l**n ckfnkrlfrfrfkgim*ksfnaf...l**n ckfnkrlfrfrfkgim*ksfnafyeipt*nr*yi* Translated Amino Acid sequence (All Frames) Frame A: ---LVIDNSMLDSK...LRRLPKRIKVDLPDKDQRKHILQI VI*tf*fiylfislfiyffislfiylfiylltnqqhtpl*ilkfkdvriscrk*f*

  17. 191-IJBCS-Article-Dr A D V Ayansina

    African Journals Online (AJOL)

    RHUMSIKI

    Studies were carried out on the impact of organic amendments on microflora of soils treated with 2,4- dichlorophenoxy-acetic acid, atrazine, atrazine + metolachlor and paraquat herbicides applied at one and half doses of the recommended rates. Poultry manure-0.05%, urea-0.1 M and glucose–0.1 M of herbicide-treated.

  18. Oral pyogenic granuloma: a epidemiologic study of 191 cases

    Directory of Open Access Journals (Sweden)

    Thiago de Santana SANTOS

    2008-01-01

    Full Text Available Objectives: To evaluate the prevalence of pyogenic granuloma and compare the data obtained with those of other reports in the worldliterature. Methods: The study material was surveyed from the records of patients with diagnosis of oral pyogenic granuloma, at the Oral Pathology Laboratory of the School of Dentistry of the University of Pernambuco, in the period from January 1992 to March 2007 (15 years. The following indicators were analyzed: gender, age group, race, anatomic location, diameter of lesions and presence of symptomatology.Results: Among the 5007 records in the laboratory, 3.81% corresponded to lesions diagnosed as oral pyogenic granuloma, in which 19.9% of the patients were in the second decade of life, 40.1% were white, the gingiva was the most affected location (77.9% and lesion of smaller diameter (0.1 to 2 cm were those most observed at the initial diagnosis. Conclusion: The clinical-pathological characteristics of oral pyogenic granuloma in the studied population are similar to those of other studies in the literature

  19. 49 CFR 191.23 - Reporting safety-related conditions.

    Science.gov (United States)

    2010-10-01

    ... result. (2) Unintended movement or abnormal loading by environmental causes, such as an earthquake, landslide, or flood, that impairs the serviceability of a pipeline or the structural integrity or... strength. (5) Any malfunction or operating error that causes the pressure of a pipeline or LNG facility...

  20. 19 CFR 191.193 - Application procedure for compliance program.

    Science.gov (United States)

    2010-04-01

    ... office where the claims will be filed. (c) Letter of application; contents. A party requesting..., along with the number estimated to be filed over the next 12-month period, and the estimated amount of... the records that will be maintained, including at least sample import documents, sample export...

  1. 27 CFR 26.191 - Notice of shipment.

    Science.gov (United States)

    2010-04-01

    ... OF THE TREASURY LIQUORS LIQUORS AND ARTICLES FROM PUERTO RICO AND THE VIRGIN ISLANDS Shipment of... Notice of shipment. At least 5 business days before shipment, each proprietor of a distilled spirits... Puerto Rico of the intent to ship. (Approved by the Office of Management and Budget under control number...

  2. 42 CFR 84.191 - Chemical cartridge respirators; required components.

    Science.gov (United States)

    2010-10-01

    ... OCCUPATIONAL SAFETY AND HEALTH RESEARCH AND RELATED ACTIVITIES APPROVAL OF RESPIRATORY PROTECTIVE DEVICES... filter; (4) Harness; (5) Breathing tube; and (6) Attached blower. (b) The components of each chemical cartridge respirator shall meet the minimum construction requirements set forth in subpart G of this part. ...

  3. Dicty_cDB: SSD191 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AY898627_29( AY898627 |pid:none) Phytophthora infestans haplotype ... 33 5.5 DQ832717_23( DQ832717 |pid:none) Phytophthora...AY894835_22( AY894835 |pid:none) Phytophthora infestans haplotype ... 33 5.5 AE017143_17( AE017143 |pid:none) Haemophilus

  4. Publications | Page 191 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le CRDI collabore avec les chercheurs et les établissements des pays en développement au renforcement des capacités locales par le truchement du financement, de la mise en commun des connaissances et de la formation. Avec nos livres, nos articles, nos publications de recherche et nos études, nous visons à ...

  5. 191-IJBCS-Article-Dr A D V Ayansina

    African Journals Online (AJOL)

    RHUMSIKI

    restricted on health grounds in the developed countries are still used in many third world countries (Repetto and Boliga, 1996). Moreover, pesticide regulations are weak and local farmers lack ..... mental Biogeochemistry. Vol. 6. Elsevier. Science Publ.: Amsterdam; 89-96. Boyle M. 1989. The environmental microbiology of ...

  6. Astatine-211 conjugated to an anti-CD20 monoclonal antibody eradicates disseminated B-cell lymphoma in a mouse model

    Energy Technology Data Exchange (ETDEWEB)

    Green, Damian J.; Shadman, Mazyar; Jones, Jon C.; Frayo, Shani; Kenoyer, Aimee L.; Hylarides, Mark; Hamlin, Donald K.; Wilbur, D. Scott; Balkan, Ethan R.; Lin, Yukang; Miller, Brian W.; Frost, Sophia; Gopal, Ajay K.; Orozco, Johnnie J.; Gooley, Ted; Laird, Kelley L.; Till, B. G.; Back, Tom; Sandmaier, B. M.; Pagel, John M.; Press, Oliver W.

    2015-03-26

    Alpha emitting radionuclides release a large amount of energy within a few cell diameters and may be particularly effective for radioimmunotherapy targeting minimal residual disease (MRD) conditions in which micrometastatic disease satellites are broadly distributed. To evaluate this hypothesis, 211At conjugated 1F5 mAb (anti-CD20) was studied in both bulky lymphoma tumor xenograft and MRD animal models. Superior treatment responses to 211At conjugated 1F5 mAb were evident in the MRD setting. Lymphoma xenograft tumor bearing animals treated with doses of up to 48µCi of anti-CD20 211At-decaborate [211At-B10-1F5] experienced modest responses (0% cures but 2-3-fold prolongation of survival compared to negative controls). In contrast, 70% of animals in the MRD lymphoma model demonstrated complete eradication of disease when treated with 211At-B10-1F5 at a radiation dose that was less than one-third (15 µCi) of the highest dose given to xenograft animals. Tumor progression among untreated control animals in both models was uniformly lethal. After 130 days, no significant renal or hepatic toxicity is observed in the cured animals receiving 15 µCi of 211At-B10-1F5. These findings suggest that in a MRD lymphoma model, where isolated cells and tumor microclusters prevail, α-emitters may be uniquely efficacious.

  7. Tropical Freshwater Biology, 19(1) (2010) 11 - 18 11 www.ajol.info ...

    African Journals Online (AJOL)

    Dr Ndome

    PROXIMATE COMPOSITION AND NUTRITIONAL VALUES OF SOME. COMMONLY CONSUMED ... Nutritional value of fishes caught in the open sea and oceans is greatly dependent on proper shipping, storage and ... the absence of collagenous fibres and tendons in fish muscle, which is characteristic of land animals ...

  8. http://www.economistascoruna.org/eawp/eawp.asp?qsa=ES&qsb=1&qsc=191&qsd=199

    Directory of Open Access Journals (Sweden)

    Martín Montalva Paredes

    2007-04-01

    Full Text Available Las Tecnologías de Información y Comunicaciones (TIC´s están redefiniendo parte de los patrones conductuales que regulan la interacción social. El tiempo y el espacio han dejado de ser un límite en el accionar tanto de las personas, empresas y gobiernos. A nivel mundial la brecha entre los países desarrollados y en vías de desarrollo se ha ampliado en los últimos años, debido en gran parte a la masificación del uso de tecnologías. En empresas TIC´s, específicamente empresas desarrolladoras de software, tanto chilenas como canadienses, se verificó el uso que hacen éstas del Marketing Estratégico como una herramienta competitiva, a la hora de planificar la operación y continuidad.

  9. 191 Students' Self-Concept and Their Achievement in Basic Science ...

    African Journals Online (AJOL)

    User

    2011-07-21

    Jul 21, 2011 ... relationship between the secondary school student's self-concept and their ... lead to greater happiness and academic achievement (Purkey, 1988). ..... Integrated Science Students. Unpublished PhD Thesis. University of. Ibadan. M. O. Afuwape & D. Oludipe (2008). Gender Difference in Integrated. Science ...

  10. Observando Nuestro Entorno Local: Exploraciones Escolares. Pág. 191-204

    Directory of Open Access Journals (Sweden)

    César Piñones Cañete

    2013-03-01

    Full Text Available El presente trabajo es una síntesis de dos procesos de indagación naturalista, desarrollados con jóvenes de enseñanza secundaria, en el marco del currículum de estudio de la asignatura de biología definidos para Chile. Se diseñó e implementó un conjunto de actividades que propiciaron la participación activa de los estudiantes, siendo ellos protagonistas de sus propios aprendizajes, por medio de la exploración de los espacios naturales cercanos a sus colegios. Se busca con este escrito: a describir las características del programa científico escolar ejecutado, b documentar las acciones de indagación desarrolladas por los estudiantes y c sintetizar los principales resultados pedagógicos de las experiencias

  11. SU-E-J-191: Motion Prediction Using Extreme Learning Machine in Image Guided Radiotherapy

    Energy Technology Data Exchange (ETDEWEB)

    Jia, J; Cao, R; Pei, X; Wang, H; Hu, L [Key Laboratory of Neutronics and Radiation Safety, Institute of Nuclear Energy Safety Technology, Chinese Academy of Sciences, Hefei, Anhui, 230031 (China); Engineering Technology Research Center of Accurate Radiotherapy of Anhui Province, Hefei 230031 (China); Collaborative Innovation Center of Radiation Medicine of Jiangsu Higher Education Institutions, SuZhou (China)

    2015-06-15

    Purpose: Real-time motion tracking is a critical issue in image guided radiotherapy due to the time latency caused by image processing and system response. It is of great necessity to fast and accurately predict the future position of the respiratory motion and the tumor location. Methods: The prediction of respiratory position was done based on the positioning and tracking module in ARTS-IGRT system which was developed by FDS Team (www.fds.org.cn). An approach involving with the extreme learning machine (ELM) was adopted to predict the future respiratory position as well as the tumor’s location by training the past trajectories. For the training process, a feed-forward neural network with one single hidden layer was used for the learning. First, the number of hidden nodes was figured out for the single layered feed forward network (SLFN). Then the input weights and hidden layer biases of the SLFN were randomly assigned to calculate the hidden neuron output matrix. Finally, the predicted movement were obtained by applying the output weights and compared with the actual movement. Breathing movement acquired from the external infrared markers was used to test the prediction accuracy. And the implanted marker movement for the prostate cancer was used to test the implementation of the tumor motion prediction. Results: The accuracy of the predicted motion and the actual motion was tested. Five volunteers with different breathing patterns were tested. The average prediction time was 0.281s. And the standard deviation of prediction accuracy was 0.002 for the respiratory motion and 0.001 for the tumor motion. Conclusion: The extreme learning machine method can provide an accurate and fast prediction of the respiratory motion and the tumor location and therefore can meet the requirements of real-time tumor-tracking in image guided radiotherapy.

  12. : tous les projets | Page 191 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Si l'on produit au Cambodge suffisamment de riz pour nourrir la population, la sous-alimentation maternelle et infantile y demeure quand même élevée en raison de la faible diversification des cultures et du manque d'aliments à haute teneur en éléments nutritifs. Date de début : 1 mars 2012. End Date: 1 septembre 2014.

  13. From the Ground Up: Growing Entrepreneurship in the North Central Region. RRD 191

    Science.gov (United States)

    Emery, Mary

    2008-01-01

    More than 300 people in the North Central region added their voices to a discussion on the importance of entrepreneurship to rural community vitality, often traveling long distances to attend one of 11 listening sessions held throughout the region. Among those attending were local leaders, service providers, entrepreneurs, and educators. The…

  14. 20 CFR 1002.191 - What position is the employee entitled to upon reemployment?

    Science.gov (United States)

    2010-04-01

    ... entitled to reemployment in the job position that he or she would have attained with reasonable certainty... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false What position is the employee entitled to... EMPLOYMENT AND REEMPLOYMENT RIGHTS ACT OF 1994 Reemployment Rights and Benefits Reemployment Position § 1002...

  15. Tropical Freshwater Biology, 19(1) (2010) 1- 10 1 www.ajol.info ...

    African Journals Online (AJOL)

    Dr Osondu

    that conductivity, total hardness, nitrate and ammonium were remarkably high in the subsurface water sourced ponds while temperature, turbidity, chloride, dissolved oxygen concentration and nitrite were high in the surface water sourced ponds. Higher turbidity in the ponds with water replenishment from surface water did ...

  16. 191 Analyse de la répartition spatiale des places publiques dans la ...

    African Journals Online (AJOL)

    TOHOZIN

    polygone de Thiessen a été généré pour mieux appréhender la couverture spatiale des places publiques dans cette ville. .... La grande particularité réside sur le plan des infrastructures comme les lampadaires, ... public amène les gens à considérer la ville comme un « marketing urbain » dans lequel l'imaginaire devient.

  17. EUR-L3P-NAR_AVHRR_NOAA_19:1

    Data.gov (United States)

    National Aeronautics and Space Administration — A Group for HIgh Resolution Sea Surface Temperature (GHRSST) dataset for the North Atlantic Region (NAR) from the Advanced Very High Resolution Radiometer (AVHRR) on...

  18. 191 bacterial agents of otitis media and their sensitivity to some ...

    African Journals Online (AJOL)

    DR. AMINU

    2010-06-01

    Jun 1, 2010 ... meaning inflammation of the ear while media meaning middle. Bacterial ... culture in patients who are immunocompromised. (Mackie and Mc ... incubated at 35-37°C for 48hrs. This was followed by the addition of 0.5ml Kovac's reagent. Red color on the surface layer within 10 minutes indicated positive.

  19. 40 CFR Appendix C to Part 191 - Guidance for Implementation of Subpart B

    Science.gov (United States)

    2010-07-01

    ...) RADIATION PROTECTION PROGRAMS ENVIRONMENTAL RADIATION PROTECTION STANDARDS FOR MANAGEMENT AND DISPOSAL OF..., analytical theories, and prevalent expert judgment relevant to the numerical predictions. Substantial...

  20. 15 CFR 19.1 - What definitions apply to the regulations in this Part?

    Science.gov (United States)

    2010-01-01

    ... process by which the Treasury Department's Financial Management Service offsets Federal payments through... bureaus currently include the Bureau of Industry and Security, the Economics and Statistics Administration... Treasury and Justice and codified at 31 CFR Parts 900-904. Financial Management Service means the Financial...

  1. 19 CFR Appendix B to Part 191 - Sample Formats for Applications for Specific Manufacturing Drawback Rulings

    Science.gov (United States)

    2010-04-01

    ... processes result in the separation of the merchandise used in the same operation into two or more products... processing operation; e.g., trim pieces from a cast article. The effect of stock in process on a drawback... a flow chart in addition to the description showing the manufacturing process is an excellent means...

  2. http://www.economistascoruna.org/eawp/eawp.asp?qsa=ES&qsb=1&qsc=191&qsd=199

    OpenAIRE

    Martín Montalva Paredes

    2007-01-01

    Las Tecnologías de Información y Comunicaciones (TIC´s) están redefiniendo parte de los patrones conductuales que regulan la interacción social. El tiempo y el espacio han dejado de ser un límite en el accionar tanto de las personas, empresas y gobiernos. A nivel mundial la brecha entre los países desarrollados y en vías de desarrollo se ha ampliado en los últimos años, debido en gran parte a la masificación del uso de tecnologías. En empresas TIC´s, específicamente empresas desarrolladoras d...

  3. 26 CFR 1.501(c)(19)-1 - War veterans organizations.

    Science.gov (United States)

    2010-04-01

    ... members of the United States Armed Forces, (iii) Cadets (including only students in college or university... auxiliary unit or society described in paragraph (d) of this section of such a veterans post or organization... activities for their members. (d) Auxiliary units or societies for war veterans organizations. A unit or...

  4. Stratospheric Determination of Effective Photodissociation Cross Sections for Molecular Oxygen: 191-204 nm

    Science.gov (United States)

    1983-10-20

    near 200 nm, is greater than expected, indicating that the recoin- mended 6 02 Herzberg continuum cross sections may be too large. Photo- -~ chemical...ToT(A) convolved with altitude-dependent effective absorption cross sections, t’eff(ZAX)9󈧎 (Allen & Frederick , 1982, ref. 10, will subsequently be 1...The preliminary data from that flight will be used to augment this study and tighten the error estimates. IV. Theory: As Allen and Frederick 10

  5. Kolasani et al., Afr J Tradit Complement Altern Med. (2011) 8(S):191 ...

    African Journals Online (AJOL)

    AJTCAM

    Traditional Chinese herbal formulae Liu wei di huang (LW) (six-ingredient pill with Rehmannia) and Jin gui shen qi wan (JG) ... Ancient. Chinese scholars noted that all natural phenomena could be categorised into Yin and Yang (two opposite, complementary ..... Multi-element analysis of tea beverages by inductively ...

  6. 19 CFR 191.91 - Waiver of prior notice of intent to export.

    Science.gov (United States)

    2010-04-01

    ... under this section. (2) Contents of application. An applicant for a waiver of prior notice under this... by this application; (D) Commodity/product lines of imported and exported merchandise covered by this application; (E) Origin of merchandise covered by this application; (F) Estimated number of export...

  7. FCJ-191 Mirroring the Videos of Anonymous: Cloud Activism, Living Networks, and Political Mimesis

    Directory of Open Access Journals (Sweden)

    Adam Fish

    2015-06-01

    Full Text Available Mirrors describe the multiplication of data across a network. In this article, I examine the politics of mirroring as practiced on videos by the hacktivist network Anonymous. Mirrors are designed to retain visibility on social media platforms and motivate viewers towards activism. They emerge from a particular social structure and propagate a specific symbolic system. Furthermore, mirrors are not exact replicas nor postmodern representations. Rather, mirroring maps a contestation over visibility that entangles both cloud activists and platform firms.

  8. Yeast Interacting Proteins Database: YBL045C, YPR191W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available phosphorylated; transcription is regulated by Hap1p, Hap2p/Hap3p, and heme Rows with this prey as prey (2) Rows with...phosphorylated; transcription is regulated by Hap1p, Hap2p/Hap3p, and heme Rows with this prey as prey Rows with this

  9. Identification of protein-damaging mutations in 10 swine taste receptors and 191 appetite-reward genes

    DEFF Research Database (Denmark)

    Clop, Alex; Sharaf, Abdoallah; Castelló, Anna

    2016-01-01

    BACKGROUND: Taste receptors (TASRs) are essential for the body's recognition of chemical compounds. In the tongue, TASRs sense the sweet and umami and the toxin-related bitter taste thus promoting a particular eating behaviour. Moreover, their relevance in other organs is now becoming evident...

  10. The Content, Predictive Power, and Potential Bias in Five Widely Used Teacher Observation Instruments. REL 2017-191

    Science.gov (United States)

    Gill, Brian; Shoji, Megan; Coen, Thomas; Place, Kate

    2016-01-01

    School districts and states across the Regional Educational Laboratory Mid-Atlantic Region and the country as a whole have been modifying their teacher evaluation systems to identify more effective and less effective teachers and provide better feedback to improve instructional practice. The new systems typically include components related to…

  11. [Analysis of influence factors on G-CSF-mobilized hematopoietic stem cells of 191 healthy donors in a mono center].

    Science.gov (United States)

    Wang, Qian; Yuan, Lei; Li, Hong-Hua; Zhao, Yu; Huang, Wen-Rong; Bo, Jian; Wang, Shu-Hong; Zhu, Hai-Yan; Dou, Li-Ping; Wang, Quan-Shun; Yu, Li; Jing, Yu

    2013-02-01

    This study was aimed to investigate the factors influencing mobilization efficiency of peripheral hematopoietic stem cells with granulocyte colony stimulating factor (G-CSF) and their impact on healthy donors. 181 donors were mobilized subcutaneously with G-CSF at 5 - 10 µg/(kg·d), and 10 donors were mobilized with G-CSF at 3.3 - 4.9 µg/(kg·d), once 12 h, for 4 - 5 d. Peripheral blood mononuclear cell (MNC) and CD34(+) cell counts were analyzed by flow cytometry. Mobilization-related side effects were also monitored. The results showed that white blood cell counts increased by 6 times averaged after mobilization (P donors were superior to female ones in cell harvest (P Donor body weight played positive role in cell yield, while impact of age on harvest was not remarkable. Neither MNC nor CD34(+) cell count showed a linear relationship with G-CSF dose. Only slight side effects were observed on the donors in this study. It is concluded that mobilization with G-CSF is sufficient in healthy donors without remarkable side effects.

  12. Extreme ultraviolet observations of G191-B2B and the local interstellar medium with the Hopkins Ultraviolet Telescope

    Science.gov (United States)

    Kimble, Randy A.; Davidsen, Arthur F.; Blair, William P.; Bowers, Charles W.; Van Dyke Dixon, W.; Durrance, Samuel T.; Feldman, Paul D.; Ferguson, Henry C.; Henry, Richard C.; Kriss, Gerard A.

    1993-01-01

    During the Astro-l mission in 1990 December, the Hopkins Ultraviolet Telescope (HUT) was used to observe the extreme ultraviolet spectrum (415-912 A) of the hot DA white dwarf GI91-B2B. Absorption by neutral helium shortward of the 504 A He I absorption edge is clearly detected in the raw spectrum. Model fits to the observed spectrum require interstellar neutral helium and neutral hydrogen column densities of 1.45 +/- 0.065 x 10 exp 17/sq cm and 1.69 +/- 0.12 x 10 exp 18/sq cm, respectively. Comparison of the neutral columns yields a direct assessment of the ionization state of the local interstellar cloud surrounding the Sun. The neutral hydrogen to helium ratio of 11.6 +/- 1.0 observed by HUT strongly contradicts the widespread view that hydrogen is much more ionized than helium in the local interstellar medium, a view which has motivated some exotic theoretical explanations for the supposed high ionization.

  13. 40 CFR 267.191 - What are the required design and construction standards for new tank systems or components?

    Science.gov (United States)

    2010-07-01

    ... as insulating joints, flanges, etc. (d) Design considerations to ensure that: (1) Tank foundations... dislodgment where the tank system is placed in a saturated zone, or is located within a seismic fault zone...

  14. Draft Title 40 CFR 191 compliance certification application for the Waste Isolation Pilot Plant. Volume 4: Appendix BIR Volume 2

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-03-31

    This report consists of the waste stream profile for the WIPP transuranic waste baseline inventory at Lawrence Livermore National Laboratory. The following assumptions/modifications were made by the WTWBIR team in developing the LL waste stream profiles: since only current volumes were provided by LL, the final form volumes were assumed to be the same as the current volumes; the WTWBIR team had to assign identification numbers (IDs) to those LL waste streams not given an identifier by the site, the assigned identification numbers are consistent with the site reported numbers; LL Final Waste Form Groups were modified to be consistent with the nomenclature used in the WTWBID, these changes included word and spelling changes, the assigned Final Waste Form Groups are consistent with the information provided by LL; the volumes for the year 1993 were changed from an annual rate of generation (m{sup 3}/year) to a cumulative value (m{sup 3}).

  15. 49 CFR 40.191 - What is a refusal to take a DOT drug test, and what are the consequences?

    Science.gov (United States)

    2010-10-01

    ... hands after being directed to do so by the collector). (9) For an observed collection, fail to follow... to turn around to permit the observer to determine if you have any type of prosthetic or other device that could be used to interfere with the collection process. (10) Possess or wear a prosthetic or other...

  16. SU-E-T-191: Commissioning and Dosimetric Characteristics of Elekta Agility for Total Skin Electron Beam (TSEB) Therapy

    Energy Technology Data Exchange (ETDEWEB)

    Sayler, E; Charpentier, P; Micaily, B; Miyamoto, C; Li, S [Temple University Hospital, Phila., PA (United States)

    2015-06-15

    Purpose The purpose of this work is to publish beam data from Elekta Synergy(R) linear accelerators with Agility(TM) MLC for total skin electron beam (TSEB) therapy using the HDRE1 (High Dose Rate Electron 6MeV) energy. Method & Materials The optimal gantry angles for TSEB were determined using ion chamber measurements along a vertical profile at 450cm SSD. After gantry angles were chosen, field uniformity was measured over the entire treatment area. Uniformity was measured with and without the patient support device, allowing the dosimetric effect of the support device to be determined. Beam output and PDD were measured at the calibration point (450cm SSD) for a dual beam using a parallel plate chamber in solid water. These measurements were repeated with the chamber and phantom rotated about the patient isocenter at various angles, in order to measure the contribution from oblique beams. This technique provides a precise measurement of the treatment skin dose (TSD). Lastly, ion chamber measurements were verified by film and diodes. Results The optimal gantry angle for 450 cm SSD was determined to be 90±16°. This achieved uniformity better than 96% on the vertical axis, and 92% along the horizontal axis. HDRE1 was calibrated to deliver 10 cGy/MU at standard geometry (100 cm SSD, 1.2 cm depth). Thus at TSEB geometry (450 cm SSD, 0.1 cm depth) the output of the AP dual field was measured to be 0.35 cGy/MU. The TSD of a 20 cm radius cylinder for six (equally, 60° spaced) dual fields was measured to be 1.19 cGy/MU. Percent Depth Dose data for the AP dual field and TSD are shown in Figure 2. Conclusion This paper provides a modern procedure for commissioning TSEB therapy on a linear accelerator, and clinical beam data for the Elekta Synergy(R) with Agility(TM) MLC.

  17. Draft Title 40 CFR 191 compliance certification application for the Waste Isolation Pilot Plant. Volume 3: Appendix BIR Volume 1

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-03-31

    The Waste Isolation Pilot Plant (WIPP) Transuranic Waste Baseline Inventory Report (WTWBIR) establishes a methodology for grouping wastes of similar physical and chemical properties, from across the US Department of Energy (DOE) transuranic (TRU) waste system, into a series of ``waste profiles`` that can be used as the basis for waste form discussions with regulatory agencies. The majority of this document reports TRU waste inventories of DOE defense sites. An appendix is included which provides estimates of commercial TRU waste from the West Valley Demonstration Project. The WIPP baseline inventory is estimated using waste streams identified by the DOE TRU waste generator/storage sites, supplemented by information from the Mixed Waste Inventory Report (MWIR) and the 1994 Integrated Data Base (IDB). The sites provided and/or authorized all information in the Waste Stream Profiles except the EPA (hazardous waste) codes for the mixed inventories. These codes were taken from the MWIR (if a WTWBIR mixed waste stream was not in MWIR, the sites were consulted). The IDB was used to generate the WIPP radionuclide inventory. Each waste stream is defined in a waste stream profile and has been assigned a waste matrix code (WMC) by the DOE TRU waste generator/storage site. Waste stream profiles with WMCs that have similar physical and chemical properties can be combined into a waste matrix code group (WMCG), which is then documented in a site-specific waste profile for each TRU waste generator/storage site that contains waste streams in that particular WMCG.

  18. CNV-association meta-analysis in 191,161 European adults reveals new loci associated with anthropometric traits

    DEFF Research Database (Denmark)

    Macé, Aurélien; Tuke, Marcus A; Deelen, Patrick

    2017-01-01

    )). Burden analysis shows a 0.41 cm decrease in height, a 0.003 increase in waist-to-hip ratio and increase in BMI by 0.14 kg/m(2) for each Mb of total deletion burden (P = 2.5 × 10(-10), 6.0 × 10(-5), and 2.9 × 10(-3)). Our study provides evidence that the same genes (e.g., MC4R, FIBIN, and FMO5) harbor...

  19. Draft Title 40 CFR 191 compliance certification application for the Waste Isolation Pilot Plant. Volume 7: Appendix GCR Volume 2

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-03-31

    This report contains the second part of the geological characterization report for the Waste Isolation Pilot Plant. Both hydrology and geochemistry are evaluated. The following aspects of hydrology are discussed: surface hydrology; ground water hydrology; and hydrology drilling and testing. Hydrologic studies at the site and adjacent site areas have concentrated on defining the hydrogeology and associated salt dissolution phenomena. The geochemical aspects include a description of chemical properties of geologic media presently found in the surface and subsurface environments of southeastern New Mexico in general, and of the proposed WIPP withdrawal area in particular. The characterization does not consider any aspect of artificially-introduced material, temperature, pressure, or any other physico-chemical condition not native to the rocks of southeastern New Mexico.

  20. Environmental Radiation Protection Standards for Management and Disposal of Spent Nuclear Fuel and Transuranic Radioactive Wastes (40 CFR Part 191)

    Science.gov (United States)

    This regulation sets environmental standards for public protection from the management and disposal of spent nuclear fuel, high-level wastes and wastes that contain elements with atomic numbers higher than uranium (transuranic wastes).

  1. Periglacial evidence for a 1.91–1.89 Ga old glacial period at low latitude, Central Sweden

    NARCIS (Netherlands)

    Kuipers, G.; Beunk, F.F.

    2013-01-01

    Cryoturbation and slump fold-like sedimentary structures in ca. 1.9 Ga old dacitic metavolcanic sediments in West Bergslagen, Central Sweden, are recognized as a lowland periglacial environment. This type of environment is comparable with present day tundra in Siberia. Ice-wedge casts and

  2. Draft Title 40 CFR 191 compliance certification application for the Waste Isolation Pilot Plant. Volume 6: Appendix GCR Volume 1

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-03-31

    The Geological Characterization Report (GCR) for the WIPP site presents, in one document, a compilation of geologic information available to August, 1978, which is judged to be relevant to studies for the WIPP. The Geological Characterization Report for the WIPP site is neither a preliminary safety analysis report nor an environmental impact statement; these documents, when prepared, should be consulted for appropriate discussion of safety analysis and environmental impact. The Geological Characterization Report of the WIPP site is a unique document and at this time is not required by regulatory process. An overview is presented of the purpose of the WIPP, the purpose of the Geological Characterization Report, the site selection criteria, the events leading to studies in New Mexico, status of studies, and the techniques employed during geological characterization.

  3. Draft Title 40 CFR 191 compliance certification application for the Waste Isolation Pilot Plant. Volume 2: Appendices, AAC, BECR, BH

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-03-31

    This report describes the conceptual design of a system the Department of Energy (DOE) may implement for compliance with the requirement to control access to the disposal site. In addition, this report addresses the scheduling process for control of inspection, maintenance, and periodic reporting related to Long Term Monitoring which addresses the monitoring of disposal system performance, environmental monitoring in accordance with the Consultation and Cooperation Agreement between the DOE and the state of New Mexico, and evaluation of testing activities related to the Permanent Marker System design. In addition to access control addressed by this report, the controlling or cleaning up of releases from the site is addressed in the Conceptual Decontamination and Decommissioning Plan. The monitoring of parameters related to disposal system performance is addressed in the Long Term Monitoring Design Concept Description. Together, these three documents address the full range of active institutional controls planned after disposal of the TRU waste in the WIPP repository.

  4. Teoría y Técnicas en la Investigación Educacional. Lima: Ave, 1987; 191 p.

    Directory of Open Access Journals (Sweden)

    Teresa Cisneros

    1992-06-01

    Full Text Available El libro de la Dra. Irma Encinas constituye una lectura obligada para los estudiantes de educación y para los docentes que se inician en el campo de la investigación. Como su título lo indica, el libro está centrado en la presentación de la teoría y técnicas para la investigación educacional, constituyendo una herramienta eficaz para los que nos desempeñamos en el ámbito educativo. El documento, sin descuidar el aspecto científico, presenta de manera sistemáticamente didáctica los diversos pasos y procesos necesarios para la investigación educativa.

  5. Effect of Prior Aging on Fatigue Behavior of IM7/BMI 5250-4 Composite at 191 C

    National Research Council Canada - National Science Library

    Ladrido, Christine G

    2007-01-01

    .... The weight loss was analyzed during the aging process. Tension to failure tests were performed on both the unaged and aged specimens to establish a baseline for the Ultimate Tensile Strengths and Young's Modulus...

  6. Derivation of Soil Screening Guidelines for Gross Alpha/Beta Radioactivity for United States Air Force Deployment Sites

    Science.gov (United States)

    2007-04-19

    the emission of 7 alpha particles and 4 beta particles. Three radionuclides ( francium -223, astatine-215, and polonium-211) are not listed below...no no Uranium-233 159,200 y alpha yes no Thorium-229 7,300 y alpha yes no Radium-225 14.9 d beta no no Actinium-225 10.0 d alpha no no Francium

  7. δ37Cl : the geochemistry of chlorine isotopes

    NARCIS (Netherlands)

    Eggenkamp, H.G.M.

    1994-01-01

    In this thesis the geochemistry of the stable isotopes of chlorine will be examined. Chlorine is one of the halogens, the seventh group in the periodic system of elements. This group consists of five elements, fluorine, chlorine, bromine, iodine, and astatine.

  8. δ³⁷Cl : the geochemistry of chlorine isotopes

    NARCIS (Netherlands)

    Eggenkamp, H.G.M.

    1994-01-01

    In this thesis the geochemistry of the stable isotopes of chlorine will be examined. Chlorine is one of the halogens, the seventh group in the periodic system of elements. This group consists of five elements, fluorine, chlorine, bromine, iodine, and astatine. This thesis presents the first chlorine

  9. SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

    Energy Technology Data Exchange (ETDEWEB)

    Jaszczak, R.J.

    1995-12-01

    Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons.

  10. Draft Title 40 CFR 191 compliance certification application for the Waste Isolation Pilot Plant. Volume 8: Appendices HYDRO, IRD, LTM, NUTS, PAR, PMR, QAPD, RBP

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-03-31

    Geohydrologic data have been collected in the Los Medanos area at the US Department of Energy`s proposed Waste Isolation Pilot Plant (WIPP) site in southeastern New Mexico since 1975 as part of a study evaluating the feasibility of storing defense-associated nuclear wastes within the bedded salt of the Salado Formation of Permian age. Drilling and hydrologic testing have identified three principal water-bearing zones above the Salado Formation and one below that could potentially transport wastes to the biosphere if the proposed facility were breached. The zones above the Salado are the contact between the Rustler and Salado Formations and the Culebra and Magenta Dolomite Members of the Rustler Formation of Permian age. The zone below the Salado Formation consists of channel sandstones in the Bell Canyon Formation of the Permian Delaware Mountain Group. Determinations of hydraulic gradients, directions of flow, and hydraulic properties were hindered because of the negligible permeability of the water-bearing zones. Special techniques in drilling, well completion, and hydraulic testing have been developed to determine the hydrologic characteristics of these water-producing zones.

  11. Expression of aromatase in radial glial cells in the brain of the Japanese eel provides insight into the evolution of the cyp191a gene in Actinopterygians.

    Directory of Open Access Journals (Sweden)

    Shan-Ru Jeng

    Full Text Available The cyp19a1 gene that encodes aromatase, the only enzyme permitting conversion of C19 aromatizable androgens into estrogens, is present as a single copy in the genome of most vertebrate species, except in teleosts in which it has been duplicated. This study aimed at investigating the brain expression of a cyp19a1 gene expressed in both gonad and brain of Japanese eel, a basal teleost. By means of immunohistochemistry and in situ hybridization, we show that cyp19a1 is expressed only in radial glial cells of the brain and in pituitary cells. Treatments with salmon pituitary homogenates (female or human chorionic gonadotrophin (male, known to turn on steroid production in immature eels, strongly stimulated cyp19a1 messenger and protein expression in radial glial cells and pituitary cells. Using double staining studies, we also showed that aromatase-expressing radial glial cells exhibit proliferative activity in both the brain and the pituitary. Altogether, these data indicate that brain and pituitary expression of Japanese eel cyp19a1 exhibits characteristics similar to those reported for the brain specific cyp19a1b gene in teleosts having duplicated cyp19a1 genes. This supports the hypothesis that, despite the fact that eels also underwent the teleost specific genome duplication, they have a single cyp19a1 expressed in both brain and gonad. Such data also suggest that the intriguing features of brain aromatase expression in teleost fishes were not gained after the whole genome duplication and may reflect properties of the cyp19a1 gene of ancestral Actinopterygians.

  12. Xavier SALMON, Versailles : les chasses exotiques de Louis XV, Paris, Réunion des musées nationaux, 1995, 191 p.

    OpenAIRE

    Baratay, Éric

    2009-01-01

    L'ouvrage a été réalisé dans le cadre de l'exposition consacrée aux neuf tableaux de chasses exotiques commandés par Louis XV entre 1735 et 1739 pour la Petite Galerie de ses petits appartements de Versailles, et présentée au musée de Picardie à Amiens, puis à Versailles en 1995-1996. Une première partie — " Des animaux exotiques chez le roi " — évoque la place, assez réduite, de la peinture à Versailles sous Louis XV, puis la fonction et la décoration, choisie par le souverain, des petits ap...

  13. Worldwide trends in blood pressure from 1975 to 2015 : a pooled analysis of 1479 population-based measurement studies with 19.1 million participants

    NARCIS (Netherlands)

    Zhou, Bin; Bentham, James; Di Cesare, Mariachiara; Bixby, Honor; Danaei, Goodarz; Cowan, Melanie J.; Paciorek, Christopher J.; Singh, Gitanjali M; Hajifathalian, Kaveh; Bennett, James E.; Taddei, Cristina; Bilano, Ver; Carrillo-Larco, Rodrigo M.; Djalalinia, Shirin; Khatibzadeh, Shahab; Lugero, Charles; Peykari, Niloofar; Zhang, Wan Zhu; Lu, Yuan; Stevens, Gretchen A.; Riley, Leanne M.; Bovet, Pascal; Elliott, Paul; Gu, Dongfeng; Ikeda, Nayu; Jackson, Rod T.; Joffres, Michel; Kengne, Andre-Pascal; Laatikainen, Tiina; Lam, Tai Hing; Laxmaiah, Avula; Liu, Jing; Miranda, J. Jaime; Mondo, Charles K.; Neuhauser, Hannelore K.; Sundstrom, Johan; Smeeth, Liam; Soric, Maroje; Woodward, Mark; Ezzati, Majid; Abarca-Gomez, Leandra; Abdeen, Ziad A.; Rahim, Hanan Abdul; Abu-Rmeileh, Niveen Me; Acosta-Cazares, Benjamin; Adams, Robert; Aekplakorn, Wichai; Afsana, Kaosar; Aguilar-Salinas, Carlos A; Agyemang, Charles; Ahmadvand, Alireza; Ahrens, Wolfgang; Al-Raddadi, Rajaa; Al Woyatan, Rihab; Karamat Ali, Mohamed Hanief; Alkerwi, Ala'a; Aly, Eman; Amouyel, Philippe; Amuzu, Antoinette; Andersen, Lars Bo; Anderssen, Sigmund A.; Angquist, Lars; Anjana, Ranjit Mohan; Ansong, Daniel; Aounallah-Skhiri, Hajer; Araujo, Joana; Ariansen, Inger; Aris, Tahir; Arlappa, Nimmathota; Aryal, Krishna; Arveiler, Dominique; Assah, Felix K.; Assuncao, Maria Cecilia F.; Avdicova, Maria; Azevedo, Ana; Azizi, Fereidoun; Babu, Bontha V.; Bahijri, Suhad; Balakrishna, Nagalla; Bandosz, Piotr; Banegas, Jose R.; Barbagallo, Carlo M.; Barcelo, Alberto; Barkat, Amina; Barros, Aluisio J. D.; Barros, Mauro V.; Bata, Iqbal; Batieha, Anwar M.; Baur, Louise A.; Beaglehole, Robert; Ben Romdhane, Habiba; Benet, Mikhail; Benson, Lowell S.; Bernabe-Ortiz, Antonio; Bernotiene, Gailute; Bettiol, Heloisa; Bhagyalaxmi, Aroor; Bharadwaj, Sumit; Bhargava, Santosh K.; Bi, Yufang; Bikbov, Mukharram; Bjerregaard, Peter; Bjertness, Espen; Bjokelund, Cecilia; Blokstra, Anneke; Bo, Simona; Bobak, Martin; Boeing, Heiner; Boggia, Jose G.; Boissonnet, Carlos P.; Bongard, Vanina; Bovet, Pascal; Braeckman, Lutgart; Brajkovich, Imperia; Branca, Francesco; Breckenkamp, Juergen; Brenner, Hermann; Brewster, Lizzy M.; Bruno, Graziella; Bueno-de-Mesquita, H. B(as).; Bugge, Anna; Burns, Con; Bursztyn, Michael; de Leon, Antonio Cabrera; Cameron, Christine; Can, Gunay; Candido, Ana Paula C.; Capuano, Vincenzo; Cardoso, Viviane C.; Carlsson, Axel C.; Carvalho, Maria J.; Casanueva, Felipe F.; Casanueva, Felipe F.; Casas, Juan Pablo; Caserta, Carmelo A.; Chamukuttan, Snehalatha; Chan, Angelique W.; Chan, Queenie; Chaturvedi, Himanshu K.; Chaturvedi, Nishi; Chen, Chien-Jen; Chen, Fangfang; Chen, Huashuai; Chen, Shuohua; Chen, Zhengming; Cheng, Yu-Ching; Dekkaki, Imane Cherkaoui; Chetrit, Angela; Chiolero, Arnaud; Chiou, Shu-Ti; Chirita-Emandi, Adela; Cho, Belong; Cho, Yumi; Chudek, Jerzy; Cifkova, Renata; Claessens, Frank; Clays, Els; Concin, Hans; Cooper, Cyrus; Cooper, Rachel; Coppinger, Tara C.; Costanzo, Simona; Cottel, Dominique; Cowell, Chris T.; Craig, Cora L.; Crujeiras, Ana B.; Cruz Moreno, Juan; D'Arrigo, Graziella; d'Orsi, Eleonora; Dallongeville, Jean; Damasceno, Albertino; Danaei, Goodarz; Dankner, Rachel; Dantoft, Thomas M.; Dauchet, Luc; De Backer, Guy; de Gaetano, Giovanni; De Henauw, Stefaan; De Smedt, Delphine; Deepa, Mohan; Dehghan, Abbas; Delisle, Helene; Deschamps, Valerie; Dhana, Klodian; Di Castelnuovo, Augusto F.; Dias-da-Costa, Juvenal Soares; Diaz, Alejandro; Dickerson, Ty T.; Djalalinia, Shirin; Do, Ha T. P.; Dobson, Annette J.; Donfrancesco, Chiara; Donoso, Silvana P.; Doering, Angela; Doua, Kouamelan; Drygas, Wojciech; Dulskiene, Virginija; Dzakula, Aleksandar; Dzerve, Vilnis; Dziankowska-Zaborszczyk, Elzbieta; Eggertsen, Robert; Ekelund, Ulf; El Ati, Jalila; Ellert, Ute; Elliott, Paul; Elosua, Roberto; Erasmus, Rajiv T.; Erem, Cihangir; Eriksen, Louise; Escobedo-de la Pena, Jorge; Evans, Alun; Faeh, David; Fall, Caroline H.; Farzadfar, Farshad; Felix-Redondo, Francisco J.; Ferguson, Trevor S.; Fernandez-Berges, Daniel; Ferrante, Daniel; Ferrari, Marika; Ferreccio, Catterina; Ferrieres, Jean; Finn, Joseph D.; Fischer, Krista; Foeger, Bernhard; Foo, Leng Huat; Forslund, Ann-Sofie; Forsner, Maria; Fortmann, Stephen P.; Fouad, Heba M.; Francis, Damian K.; Franco, Maria do Carmo; Franco, Oscar H.; Frontera, Guillermo; Fuchs, Flavio D.; Fuchs, Sandra C.; Fujita, Yuki; Furusawa, Takuro; Gaciong, Zbigniew; Gareta, Dickman; Garnett, Sarah P.; Gaspoz, Jean-Michel; Gasull, Magda; Gates, Louise; Gavrila, Diana; Geleijnse, Johanna M.; Ghasemian, Anoosheh; Ghimire, Anup; Giampaoli, Simona; Gianfagna, Francesco; Giovannelli, Jonathan; Goldsmith, Rebecca A.; Goncalves, Helen; Gonzalez Gross, Marcela; Gonzalez Rivas, Juan P.; Gottrand, Frederic; Graff-Iversen, Sidsel; Grafnetter, Dusan; Grajda, Aneta; Gregor, Ronald D.; Grodzicki, Tomasz; Grontved, Anders; Gruden, Grabriella; Grujic, Vera; Gu, Dongfeng; Guan, Ong Peng; Gudnason, Vilmundur; Guerrero, Ramiro; Guessous, Idris; Guimaraes, Andre L.; Gulliford, Martin C.; Gunnlaugsdottir, Johanna; Gunter, Marc; Gupta, Prakash C.; Gureje, Oye; Gurzkowska, Beata; Gutierrez, Laura; Gutzwiller, Felix; Hadaegh, Farzad; Halkjaer, Jytte; Hambleton, Ian R.; Hardy, Rebecca; Harikumar, Rachakulla; Hata, Jun; Hayes, Alison J.; He, Jiang; Hendriks, Marleen Elisabeth; Henriques, Ana; Hernandez Cadena, Leticia; Herqutanto,; Herrala, Sauli; Heshmat, Ramin; Hihtaniemi, Ilpo Tapani; Ho, Sai Yin; Ho, Suzanne C.; Hobbs, Michael; Hofman, Albert; Dinc, Gonul Horasan; Hormiga, Claudia M.; Horta, Bernardo Lessa; Houti, Leila; Howitt, Christina; Htay, Thein Thein; Htet, Aung Soe; Hu, Yonghua; Maria Huerta, Jose; Husseini, Abdullatif S.; Huybrechts, Inge; Hwalla, Nahla; Iacoviello, Licia; Iannone, Anna G.; Ibrahim, M. Mohsen; Ikram, M. Arfan; Irazola, Vilma E.; Islam, Muhammad; Ivkovic, Vanja; Iwasaki, Masanori; Jackson, Rod T.; Jacobs, Jeremy M.; Jafar, Tazeen H.; Jamrozik, Konrad; Janszky, Imre; Jasienska, Grazyna; Jelakovic, Bojan; Jiang, Chao Qiang; Johansson, Mattias; Jonas, Jost B; Jorgensen, Torben; Joshi, Pradeep; Juolevi, Anne; Jurak, Gregor; Juresa, Vesna; Kaaks, Rudolf; Kafatos, Anthony; Kalter-Leibovici, Ofra; Kamaruddin, Nor Azmi; Kasaeian, Amir; Katz, Joanne; Kauhanen, Jussi; Kaur, Prabhdeep; Kavousi, Maryam; Kazakbaeva, Gyulli; Keil, Ulrich; Boker, Lital Keinan; Keinanen-Kiukaanniemi, Sirkka; Kelishadi, Roya; Kemper, Han C. G.; Kengne, Andre-Pascal; Kersting, Mathilde; Key, Timothy; Khader, Yousef Saleh; Khalili, Davood; Khang, Young-Ho; Khaw, Kay Tee; Kiechl, Stefan; Killewo, Japhet; Kim, Jeongseon; Klumbiene, Jurate; Kolle, Elin; Kolsteren, Patrick; Korrovits, Paul; Koskinen, Seppo; Kouda, Katsuyasu; Koziel, Slawomir; Kristensen, Peter Lund; Krokstad, Steinar; Kromhout, Daan; Kruger, Herculina S.; Kubinova, Ruzena; Kuciene, Renata; Kuh, Diana; Kujala, Urho M.; Kula, Krzysztof; Kulaga, Zbigniew; Kumar, R. Krishna; Kurjata, Pawel; Kusuma, Yadlapalli S.; Kuulasmaa, Kari; Kyobutungi, Catherine; Laatikainen, Tiina; Lachat, Carl; Landrove, Orlando; Lanska, Vera; Lappas, Georg; Larijani, Bagher; Laugsand, Lars E.; Laxmaiah, Avula; Khanh Le Nguyen Bao,; Le, Tuyen D.; Leclercq, Catherine; Lee, Jeannette Jen-Mai; Lee, Jeonghee; Lehtimaki, Terho; Lekhraj, Rampal; Leon-Munoz, Luz M.; Levitt, Naomi S.; Li, Yanping; Lilly, Christa L.; Lim, Wei-Yen; Fernanda Lima-Costa, M.; Lin, Hsien-Ho; Lin, Xu; Linneberg, Allan; Lissner, Lauren; Litwin, Mieczyslaw; Liu, Jing; Lorbeer, Roberto; Lotufo, Paulo A.; Eugenio Lozano, Jose; Luksiene, Dalia; Lundqvist, Annamari; Lunet, Nuno; Lytsy, Per; Ma, Guansheng; Ma, Jun; Machado-Coelho, George L. L.; Machi, Suka; Maggi, Stefania; Magliano, Dianna J.; Majer, Marjeta; Makdisse, Marcia; Malekzadeh, Reza; Malhotra, Rahul; Rao, Kodavanti Mallikharjuna; Malyutina, Sofia; Manios, Yannis; Mann, Jim I.; Manzato, Enzo; Margozzini, Paula; Marques-Vidal, Pedro; Marrugat, Jaume; Martorell, Reynaldo; Mathiesen, Ellisiv B.; Matijasevich, Alicia; Matsha, Tandi E.; Mbanya, Jean Claude N.; Posso, Anselmo J. Mc Donald; McFarlane, Shelly R.; McFarlane, Shelly R.; McGarvey, Stephen Theodore; McLachlan, Stela; McLean, Rachael M.; McNulty, Breige A.; Khir, Amir Sharifuddin Md; Mediene-Benchekor, Sounnia; Medzioniene, Jurate; Meirhaeghe, Aline; Meisinger, Christa; Menezes, Ana Maria B.; Menon, Geetha R.; Meshram, Indrapal I.; Metspalu, Andres; Mi, Jie; Mikkel, Kairit; Miller, Jody C.; Francisco Miquel, Juan; Jaime Miranda, J.; Misigoj-Durakovic, Marjeta; Mohamed, Mostafa K.; Mohammad, Kazem; Mohammadifard, Noushin; Mohan, Viswanathan; Yusoff, Muhammad Fadhli Mohd; Moller, Niels C.; Molnar, Denes; Momenan, Amirabbas; Mondo, Charles K.; Monyeki, Kotsedi Daniel K.; Moreira, Leila B.; Morejon, Alain; Moreno, Luis A.; Morgan, Karen; Moschonis, George; Mossakowska, Malgorzata; Mostafa, Aya; Mota, Jorge; Motlagh, Mohammad Esmaeel; Motta, Jorge; Muiesan, Maria L.; Mueller-Nurasyid, Martina; Murphy, Neil; Mursu, Jaakko; Musil, Vera; Nagel, Gabriele; Naidu, Balkish M.; Nakamura, Harunobu; Namsna, Jana; Nang, Ei Ei K.; Nangia, Vinay B.; Narake, Sameer; Maria Navarrete-Munoz, Eva; Ndiaye, Ndeye Coumba; Neal, William A.; Nenko, Ilona; Nervi, Flavio; Neuhauser, Hannelore K.; Nguyen, Nguyen D.; Quang Ngoc Nguyen,; Nieto-Martinez, Ramfis E.; Niiranen, Teemu J.; Ning, Guang; Ninomiya, Toshiharu; Nishtar, Sania; Noale, Marianna; Noboa, Oscar A.; Noorbala, Ahmad Ali; Norat, Teresa; Noto, Davide; Al Nsour, Mohannad; O'Reilly, Dermot; Oh, Kyungwon; Olinto, Maria Teresa A.; Oliveira, Isabel O.; Omar, Mohd Azahadi; Onat, Altan; Ordunez, Pedro; Osmond, Clive; Ostojic, Sergej M.; Otero, Johanna A.; Overvad, Kim; Owusu-Dabo, Ellis; Paccaud, Fred Michel; Padez, Cristina; Pahomova, Elena; Pajak, Andrzej; Palli, Domenico; Palmieri, Luigi; Panda-Jonas, Songhomitra; Panza, Francesco; Papandreou, Dimitrios; Parnell, Winsome R.; Parsaeian, Mahboubeh; Pecin, Ivan; Pednekar, Mangesh S.; Peer, Nasheeta; Peeters, Petra H.; Peixoto, Sergio Viana; Pelletier, Catherine; Peltonen, Markku; Pereira, Alexandre C.; Marina Perez, Rosa; Peters, Annette; Petkeviciene, Janina; Peykari, Niloofar; Son Thai Pham,; Pigeot, Iris; Pikhart, Hynek; Pilav, Aida; Pilotto, Lorenza; Pitakaka, Freda; Plans-Rubio, Pedro; Polakowska, Maria; Polasek, Ozren; Porta, Miquel; Portegies, Marileen L. P.; Pourshams, Akram; Pradeepa, Rajendra; Prashant, Mathur; Price, Jacqueline F.; Puiu, Maria; Punab, Margus; Qasrawi, Radwan F.; Qorbani, Mostafa; Radic, Ivana; Radisauskas, Ricardas; Rahman, Mahfuzar; Raitakari, Olli; Raj, Manu; Rao, Sudha Ramachandra; Ramos, Elisabete; Rampal, Sanjay; Rangel Reina, Daniel A.; Rasmussen, Finn; Redon, Josep; Reganit, Paul Ferdinand M.; Ribeiro, Robespierre; Riboli, Elio; Rigo, Fernando; de Wit, Tobias F. Rinke; Ritti-Dias, Raphael M.; Robinson, Sian M.; Robitaille, Cynthia; Rodriguez-Artalejo, Fernando; Rodriguez-Villamizar, Laura A.; Rojas-Martinez, Rosalba; Rosengren, Annika; Rubinstein, Adolfo; Rui, Ornelas; Sandra Ruiz-Betancourt, Blanca; Russo Horimoto, Andrea R. V.; Rutkowski, Marcin; Sabanayagam, Charumathi; Sachdev, Harshpal S.; Saidi, Olfa; Sakarya, Sibel; Salanave, Benoit; Salazar Martinez, Eduardo; Salmeron, Diego; Salomaa, Veikko; Salonen, Jukka T.; Salvetti, Massimo; Sanchez-Abanto, Jose; Sans, Susana; Santos, Diana; Santos, Ina S.; dos Santos, Renata Nunes; Santos, Rute; Saramies, Jouko L.; Sardinha, Luis B.; Margolis, Giselle Sarganas; Sarrafzadegan, Nizal; Saum, Kai-Uwe; Savva, Savvas C.; Scazufca, Marcia; Schargrodsky, Herman; Schneider, Ione J. C.; Schultsz, Constance; Schutte, Aletta E.; Sen, Abhijit; Senbanjo, Idowu O.; Sepanlou, Sadaf G.; Sharma, Sanjib K.; Shaw, Jonathan E.; Shibuya, Kenji; Shin, Dong Wook; Shin, Youchan; Siantar, Rosalynn; Sibai, Abla M.; Santos Silva, Diego Augusto; Simon, Mary; Simons, Judith; Simons, Leon A.; Sjotrom, Michael; Skovbjerg, Sine; Slowikowska-Hilczer, Jolanta; Slusarczyk, Przemyslaw; Smeeth, Liam; Smith, Margaret C. M.; Snijder, Marieke B.; So, Hung-Kwan; Sobngwi, Eugene; Soderberg, Stefan; Solfrizzi, Vincenzo; Sonestedt, Emily; Song, Yi; Sorensen, Thorkild I. A.; Soric, Maroje; Jerome, Charles Sossa; Soumare, Aicha; Staessen, Jan A.; Starc, Gregor; Stathopoulou, Maria G.; Stavreski, Bill; Steene-Johannessen, Jostein; Stehle, Peter; Stein, Aryeh D.; Stergiou, George S.; Stessman, Jochanan; Stieber, Jutta; Stoeckl, Doris; Stocks, Tanja; Stokwiszewski, Jakub; Stronks, Karien; Strufaldi, Maria Wany; Sun, Chien-An; Sundstrom, Johan; Sung, Yn-Tz; Suriyawongpaisal, Paibul; Sy, Rody G.; Tai, E-Shyong; Tammesoo, Mari-Liis; Tamosiunas, Abdonas; Tang, Line; Tang, Xun; Tanser, Frank; Tao, Yong; Tarawneh, Mohammed Rasoul; Tarqui-Mamani, Carolina B.; Taylor, Anne W.; Theobald, Holger; Thijs, Lutgarde; Thuesen, Betina H.; Tjonneland, Anne; Tolonen, Hanna K.; Topbas, Murat; Topor-Madry, Roman; Jose Tormo, Maria; Torrent, Maties; Traissac, Pierre; Trichopoulos, Dimitrios; Trichopoulou, Antonia; Trinh, Oanh T. H.; Trivedi, Atul; Tshepo, Lechaba; Tulloch-Reid, Marshall K.; Tuomainen, Tomi-Pekka; Turley, Maria L.; Tynelius, Per; Tzourio, Christophe; Ueda, Peter; Ugel, Eunice; Ulmer, Hanno; Uusitalo, Hannu M. T.; Valdivia, Gonzalo; Valvi, Damaskini; van der Schouw, Yvonne T.; Van Herck, Koen; van Rossem, Lenie; van Valkengoed, Irene G. M.; Vanderschueren, Dirk; Vanuzzo, Diego; Vatten, Lars; Vega, Tomas; Velasquez-Melendez, Gustavo; Veronesi, Giovanni; Verschuren, W. Monique; Verstraeten, Roosmarijn; Victora, Cesar G.; Viet, Lucie; Viikari-Juntura, Eira; Vineis, Paolo; Vioque, Jesus; Virtanen, Jyrki K.; Visvikis-Siest, Sophie; Viswanathan, Bharathi; Vollenweider, Peter; Vrdoljak, Ana; Vrijheid, Martine; Wade, Alisha N.; Wagner, Aline; Walton, Janette; Mohamud, Wan Nazaimoon Wan; Wang, Ming-Dong; Wang, Qian; Wang, Ya Xing; Wannamethee, S. Goya; Wareham, Nicholas; Wederkopp, Niels; Weerasekera, Deepa; Whincup, Peter H.; Widhalm, Kurt; Widyahening, Indah S.; Wiecek, Andrzej; Wijga, Alet H.; Wilks, Rainford J.; Willeit, Peter; Williams, Emmanuel A.; Wilsgaard, Tom; Wojtyniak, Bogdan J.; Wong, Tien-Yin; Wong-McClure, Roy A.; Woo, Jean; Woodward, Mark; Wu, Aleksander Giwercman; Wu, Frederick C.; Wu, Shou Ling; Xu, Haiquan; Yan, Weili; Yang, Xiaoguang; Ye, Xingwang; Yiallouros, Panayiotis K.; Yoshihara, Akihiro; Younger-Coleman, Novie O.; Yusoff, Ahmad F.; Zambon, Sabina; Zdrojewski, Tomasz; Zeng, Yi; Zhao, Dong; Zhao, Wenhua; Zheng, Yingffeng; Zhu, Dan; Zimmermann, Esther; Zuniga Cisneros, Julio

    2017-01-01

    Background Raised blood pressure is an important risk factor for cardiovascular diseases and chronic kidney disease. We estimated worldwide trends in mean systolic and mean diastolic blood pressure, and the prevalence of, and number of people with, raised blood pressure, defined as systolic blood

  14. Worldwide trends in blood pressure from 1975 to 2015: a pooled analysis of 1479 population-based measurement studies with 19.1 million participants

    NARCIS (Netherlands)

    Zhou, Bin; Bentham, James; Di Cesare, Mariachiara; Bixby, Honor; Danaei, Goodarz; Cowan, Melanie J.; Paciorek, Christopher J.; Singh, Gitanjali; Hajifathalian, Kaveh; Bennett, James E.; Taddei, Cristina; Bilano, Ver; Carrillo-Larco, Rodrigo M.; Djalalinia, Shirin; Khatibzadeh, Shahab; Lugero, Charles; Peykari, Niloofar; Zhang, Wan Zhu; Lu, Yuan; Stevens, Gretchen A.; Riley, Leanne M.; Bovet, Pascal; Elliott, Paul; Gu, Dongfeng; Ikeda, Nayu; Jackson, Rod T.; Joffres, Michel; Kengne, Andre Pascal; Laatikainen, Tiina; Lam, Tai Hing; Laxmaiah, Avula; Liu, Jing; Miranda, J. Jaime; Mondo, Charles K.; Neuhauser, Hannelore K.; Sundstrom, Johan; Smeeth, Liam; Soric, Maroje; Woodward, Mark; Ezzati, Majid; Abarca-Gomez, Leandra; Abdeen, Ziad A.; Rahim, Hanan Abdul; Abu-Rmeileh, Niveen M.; Acosta-Cazares, Benjamin; Adams, Robert; Aekplakorn, Wichai; Afsana, Kaosar; Aguilar-Salinas, Carlos A.; Agyemang, Charles; Ahmadvand, Alireza; Ahrens, Wolfgang; Al Raddadi, Rajaa; Al Woyatan, Rihab; Ali, Mohamed M.; Alkerwi, Ala'a; Aly, Eman; Amouyel, Philippe; Amuzu, Antoinette; Andersen, Lars Bo; Anderssen, Sigmund A.; Angquist, Lars; Anjana, Ranjit Mohan; Ansong, Daniel; Aounallah-Skhiri, Hajer; Araujo, Joana; Ariansen, Inger; Aris, Tahir; Arlappa, Nimmathota; Aryal, Krishna; Arveiler, Dominique; Assah, Felix K.; Assuncao, Maria Cecilia F.; Avdicova, Maria; Azevedo, Ana; Azizi, Fereidoun; Babu, Bontha V.; Bahijri, Suhad; Balakrishna, Nagalla; Bandosz, Piotr; Banegas, Jose R.; Barbagallo, Carlo M.; Barcelo, Alberto; Barkat, Amina; Barros, Aluisio J. D.; Barros, Mauro V.; Bata, Iqbal; Batieha, Anwar M.; Baur, Louise A.; Beaglehole, Robert; Ben Romdhane, Habiba; Benet, Mikhail; Benson, Lowell S.; Bernabe-Ortiz, Antonio; Bernotiene, Gailute; Bettiol, Heloisa; Bhagyalaxmi, Aroor; Bharadwaj, Sumit; Bhargava, Santosh K.; Bi, Yufang; Bikbov, Mukharram; Bjerregaard, Peter; Bjertness, Espen; Bjokelund, Cecilia; Blokstra, Anneke; Bo, Simona; Bobak, Martin; Boeing, Heiner; Boggia, Jose G.; Boissonnet, Carlos P.; Bongard, Vanina; Braeckman, Lutgart; Brajkovich, Imperia; Branca, Francesco; Breckenkamp, Juergen; Brenner, Hermann; Brewster, Lizzy M.; Bruno, Graziella; Bueno-de-Mesquita, H. B. (as); Bugge, Anna; Burns, Con; Bursztyn, Michael; de Leon, Antonio Cabrera; Cameron, Christine; Can, Gunay; Candido, Ana Paula C.; Capuano, Vincenzo; Cardoso, Viviane C.; Carlsson, Axel C.; Carvalho, Maria J.; Casanueva, Felipe F.; Casas, Juan-Pablo; Caserta, Carmelo A.; Chamukuttan, Snehalatha; Chan, Angelique W.; Chan, Queenie; Chaturvedi, Himanshu K.; Chaturvedi, Nishi; Chen, Chien-Jen; Chen, Fangfang; Chen, Huashuai; Chen, Shuohua; Chen, Zhengming; Cheng, Ching-Yu; Dekkaki, Imane Cherkaoui; Chetrit, Angela; Chiolero, Arnaud; Chiou, Shu-Ti; Chirita-Emandi, Adela; Cho, Belong; Cho, Yumi; Chudek, Jerzy; Cifkova, Renata; Claessens, Frank; Clays, Els; Concin, Hans; Cooper, Cyrus; Cooper, Rachel; Coppinger, Tara C.; Costanzo, Simona; Cottel, Dominique; Cowell, Chris; Craig, Cora L.; Crujeiras, Ana B.; Cruz, Juan J.; D'Arrigo, Graziella; d'Orsi, Eleonora; Dallongeville, Jean; Damasceno, Albertino; Dankner, Rachel; Dantoft, Thomas M.; Dauchet, Luc; de Backer, Guy; de Gaetano, Giovanni; de Henauw, Stefaan; de Smedt, Delphine; Deepa, Mohan; Dehghan, Abbas; Delisle, Helene; Deschamps, Valerie; Dhana, Klodian; Di Castelnuovo, Augusto F.; Dias-da-Costa, Juvenal Soares; Diaz, Alejandro; Dickerson, Ty T.; Do, Ha T. P.; Dobson, Annette J.; Donfrancesco, Chiara; Donoso, Silvana P.; Doering, Angela; Doua, Kouamelan; Drygas, Wojciech; Dulskiene, Virginija; Dzakula, Aleksandar; Dzerve, Vilnis; Dziankowska-Zaborszczyk, Elzbieta; Eggertsen, Robert; Ekelund, Ulf; El Ati, Jalila; Ellert, Ute; Elosua, Roberto; Erasmus, Rajiv T.; Erem, Cihangir; Eriksen, Louise; Escobedo-de la Pena, Jorge; Evans, Alun; Faeh, David; Fall, Caroline H.; Farzadfar, Farshad; Felix-Redondo, Francisco J.; Ferguson, Trevor S.; Fernandez-Berges, Daniel; Ferrante, Daniel; Ferrari, Marika; Ferreccio, Catterina; Ferrieres, Jean; Finn, Joseph D.; Fischer, Krista; Foeger, Bernhard; Foo, Leng Huat; Forslund, Ann-Sofie; Forsner, Maria; Fortmann, Stephen P.; Fouad, Heba M.; Francis, Damian K.; Franco, Maria do Carmo; Franco, Oscar H.; Frontera, Guillermo; Fuchs, Flavio D.; Fuchs, Sandra C.; Fujita, Yuki; Furusawa, Takuro; Gaciong, Zbigniew; Gareta, Dickman; Garnett, Sarah P.; Gaspoz, Jean-Michel; Gasull, Magda; Gates, Louise; Gavrila, Diana; Geleijnse, Johanna M.; Ghasemian, Anoosheh; Ghimire, Anup; Giampaoli, Simona; Gianfagna, Francesco; Giovannelli, Jonathan; Goldsmith, Rebecca A.; Goncalves, Helen; Gonzalez Gross, Marcela; Gonzalez Rivas, Juan P.; Gottrand, Frederic; Graff-Iversen, Sidsel; Grafnetter, Dusan; Grajda, Aneta; Gregor, Ronald D.; Grodzicki, Tomasz; Grontved, Anders; Gruden, Grabriella; Grujic, Vera; Guan, Ong Peng; Gudnason, Vilmundur; Guerrero, Ramiro; Guessous, Idris; Guimaraes, Andre L.; Gulliford, Martin C.; Gunnlaugsdottir, Johanna; Gunter, Marc; Gupta, Prakash C.; Gureje, Oye; Gurzkowska, Beata; Gutierrez, Laura; Gutzwiller, Felix; Hadaegh, Farzad; Halkjaer, Jytte; Hambleton, Ian R.; Hardy, Rebecca; Harikumar, Rachakulla; Hata, Jun; Hayes, Alison J.; He, Jiang; Hendriks, Marleen Elisabeth; Henriques, Ana; Hernandez Cadena, Leticia; Herqutanto, N. N.; Herrala, Sauli; Heshmat, Ramin; Hihtaniemi, Ilpo Tapani; Ho, Sai Yin; Ho, Suzanne C.; Hobbs, Michael; Hofman, Albert; Dinc, Gonul Horasan; Hormiga, Claudia M.; Horta, Bernardo L.; Houti, Leila; Howitt, Christina; Htay, Thein Thein; Htet, Aung Soe; Hu, Yonghua; Maria Huerta, Jose; Husseini, Abdullatif S.; Huybrechts, Inge; Hwalla, Nahla; Iacoviello, Licia; Iannone, Anna G.; Ibrahim, M. Mohsen; Ikram, M. Arfan; Irazola, Vilma E.; Islam, Muhammad; Ivkovic, Vanja; Iwasaki, Masanori; Jacobs, Jeremy M.; Jafar, Tazeen; Jamrozik, Konrad; Janszky, Imre; Jasienska, Grazyna; Jelakovic, Bojan; Jiang, Chao Qiang; Johansson, Mattias; Jonas, Jost B.; Jorgensen, Torben; Joshi, Pradeep; Juolevi, Anne; Jurak, Gregor; Juresa, Vesna; Kaaks, Rudolf; Kafatos, Anthony; Kalter-Leibovici, Ofra; Kamaruddin, Nor Azmi; Kasaeian, Amir; Katz, Joanne; Kauhanen, Jussi; Kaur, Prabhdeep; Kavousi, Maryam; Kazakbaeva, Gyulli; Keil, Ulrich; Boker, Lital Keinan; Keinanen-Kiukaanniemi, Sirkka; Kelishadi, Roya; Kemper, Han C. G.; Kersting, Mathilde; Key, Timothy; Khader, Yousef Saleh; Khalili, Davood; Khang, Young-Ho; Khaw, Kay-Tee; Kiechl, Stefan; Killewo, Japhet; Kim, Jeongseon; Klumbiene, Jurate; Kolle, Elin; Kolsteren, Patrick; Korrovits, Paul; Koskinen, Seppo; Kouda, Katsuyasu; Koziel, Slawomir; Kristensen, Peter Lund; Krokstad, Steinar; Kromhout, Daan; Kruger, Herculina S.; Kubinova, Ruzena; Kuciene, Renata; Kuh, Diana; Kujala, Urho M.; Kula, Krzysztof; Kulaga, Zbigniew; Kumar, R. Krishna; Kurjata, Pawel; Kusuma, Yadlapalli S.; Kuulasmaa, Kari; Kyobutungi, Catherine; Lachat, Carl; Landrove, Orlando; Lanska, Vera; Lappas, Georg; Larijani, Bagher; Laugsand, Lars E.; Le, Nguyen Bao Khanh; Le, Tuyen D.; Leclercq, Catherine; Lee, Jeannette; Lee, Jeonghee; Lehtimaki, Terho; Lekhraj, Rampal; Leon-Munoz, Luz M.; Levitt, Naomi S.; Li, Yanping; Lilly, Christa L.; Lim, Wei-Yen; Fernanda Lima-Costa, M.; Lin, Hsien-Ho; Lin, Xu; Linneberg, Allan; Lissner, Lauren; Litwin, Mieczyslaw; Lorbeer, Roberto; Lotufo, Paulo A.; Eugenio Lozano, Jose; Luksiene, Dalia; Lundqvist, Annamari; Lunet, Nuno; Lytsy, Per; Ma, Guansheng; Ma, Jun; Machado-Coelho, George L. L.; Machi, Suka; Maggi, Stefania; Magliano, Dianna J.; Majer, Marjeta; Makdisse, Marcia; Malekzadeh, Reza; Malhotra, Rahul; Rao, Kodavanti Mallikharjuna; Malyutina, Sofia; Manios, Yannis; Mann, Jim I.; Manzato, Enzo; Margozzini, Paula; Marques-Vidal, Pedro; Marrugat, Jaume; Martorell, Reynaldo; Mathiesen, Ellisiv B.; Matijasevich, Alicia; Matsha, Tandi E.; Mbanya, Jean Claude N.; Posso, Anselmo J. Mc Donald; McFarlane, Shelly R.; McGarvey, Stephen T.; McLachlan, Stela; McLean, Rachael M.; McNulty, Breige A.; Khir, Amir Sharifuddin Md; Mediene-Benchekor, Sounnia; Medzioniene, Jurate; Meirhaeghe, Aline; Meisinger, Christa; Menezes, Ana Maria B.; Menon, Geetha R.; Meshram, Indrapal I.; Metspalu, Andres; Mi, Jie; Mikkel, Kairit; Miller, Jody C.; Francisco Miquel, Juan; Jaime Miranda, J.; Misigoj-Durakovic, Marjeta; Mohamed, Mostafa K.; Mohammad, Kazem; Mohammadifard, Noushin; Mohan, Viswanathan; Yusoff, Muhammad Fadhli Mohd; Moller, Niels C.; Molnar, Denes; Momenan, Amirabbas; Monyeki, Kotsedi Daniel K.; Moreira, Leila B.; Morejon, Alain; Moreno, Luis A.; Morgan, Karen; Moschonis, George; Mossakowska, Malgorzata; Mostafa, Aya; Mota, Jorge; Motlagh, Mohammad Esmaeel; Motta, Jorge; Muiesan, Maria L.; Mueller-Nurasyid, Martina; Murphy, Neil; Mursu, Jaakko; Musil, Vera; Nagel, Gabriele; Naidu, Balkish M.; Nakamura, Harunobu; Namsna, Jana; Nang, Ei Ei K.; Nangia, Vinay B.; Narake, Sameer; Maria Navarrete-Munoz, Eva; Ndiaye, Ndeye Coumba; Neal, William A.; Nenko, Ilona; Nervi, Flavio; Nguyen, Nguyen D.; Nguyen, Quang Ngoc; Nieto-Martinez, Ramfis E.; Niiranen, Teemu J.; Ning, Guang; Ninomiya, Toshiharu; Nishtar, Sania; Noale, Marianna; Noboa, Oscar A.; Noorbala, Ahmad Ali; Norat, Teresa; Noto, Davide; Al Nsour, Mohannad; O'Reilly, Dermot; Oh, Kyungwon; Olinto, Maria Teresa A.; Oliveira, Isabel O.; Omar, Mohd Azahadi; Onat, Altan; Ordunez, Pedro; Osmond, Clive; Ostojic, Sergej M.; Otero, Johanna A.; Overvad, Kim; Owusu-Dabo, Ellis; Paccaud, Fred Michel; Padez, Cristina; Pahomova, Elena; Pajak, Andrzej; Palli, Domenico; Palmieri, Luigi; Panda-Jonas, Songhomitra; Panza, Francesco; Papandreou, Dimitrios; Parnell, Winsome R.; Parsaeian, Mahboubeh; Pecin, Ivan; Pednekar, Mangesh S.; Peer, Nasheeta; Peeters, Petra H.; Peixoto, Sergio Viana; Pelletier, Catherine; Peltonen, Markku; Pereira, Alexandre C.; Marina Perez, Rosa; Peters, Annette; Petkeviciene, Janina; Pham, Son Thai; Pigeot, Iris; Pikhart, Hynek; Pilav, Aida; Pilotto, Lorenza; Pitakaka, Freda; Plans-Rubio, Pedro; Polakowska, Maria; Polasek, Ozren; Porta, Miquel; Portegies, Marileen L. P.; Pourshams, Akram; Pradeepa, Rajendra; Prashant, Mathur; Price, Jacqueline F.; Puiu, Maria; Punab, Margus; Qasrawi, Radwan F.; Qorbani, Mostafa; Radic, Ivana; Radisauskas, Ricardas; Rahman, Mahfuzar; Raitakari, Olli; Raj, Manu; Rao, Sudha Ramachandra; Ramos, Elisabete; Rampal, Sanjay; Rangel Reina, Daniel A.; Rasmussen, Finn; Redon, Josep; Reganit, Paul Ferdinand M.; Ribeiro, Robespierre; Riboli, Elio; Rigo, Fernando; de Wit, Tobias F. Rinke; Ritti-Dias, Raphael M.; Robinson, Sian M.; Robitaille, Cynthia; Rodriguez-Artalejo, Fernando; Rodriguez-Villamizar, Laura A.; Rojas-Martinez, Rosalba; Rosengren, Annika; Rubinstein, Adolfo; Rui, Ornelas; Sandra Ruiz-Betancourt, Blanca; Russo Horimoto, Andrea R. V.; Rutkowski, Marcin; Sabanayagam, Charumathi; Sachdev, Harshpal S.; Saidi, Olfa; Sakarya, Sibel; Salanave, Benoit; Salazar Martinez, Eduardo; Salmeron, Diego; Salomaa, Veikko; Salonen, Jukka T.; Salvetti, Massimo; Sanchez-Abanto, Jose; Sans, Susana; Santos, Diana; Santos, Ina S.; dos Santos, Renata Nunes; Santos, Rute; Saramies, Jouko L.; Sardinha, Luis B.; Margolis, Giselle Sarganas; Sarrafzadegan, Nizal; Saum, Kai-Uwe; Savva, Savvas C.; Scazufca, Marcia; Schargrodsky, Herman; Schneider, Ione J.; Schultsz, Constance; Schutte, Aletta E.; Sen, Abhijit; Senbanjo, Idowu O.; Sepanlou, Sadaf G.; Sharma, Sanjib K.; Shaw, Jonathan E.; Shibuya, Kenji; Shin, Dong Wook; Shin, Youchan; Siantar, Rosalynn; Sibai, Abla M.; Santos Silva, Diego Augusto; Simon, Mary; Simons, Judith; Simons, Leon A.; Sjotrom, Michael; Skovbjerg, Sine; Slowikowska-Hilczer, Jolanta; Slusarczyk, Przemyslaw; Smith, Margaret C.; Snijder, Marieke B.; So, Hung-Kwan; Sobngwi, Eugene; Soderberg, Stefan; Solfrizzi, Vincenzo; Sonestedt, Emily; Song, Yi; Sorensen, Thorkild I. A.; Jerome, Charles Sossa; Soumare, Aicha; Staessen, Jan A.; Starc, Gregor; Stathopoulou, Maria G.; Stavreski, Bill; Steene-Johannessen, Jostein; Stehle, Peter; Stein, Aryeh D.; Stergiou, George S.; Stessman, Jochanan; Stieber, Jutta; Stoeckl, Doris; Stocks, Tanja; Stokwiszewski, Jakub; Stronks, Karien; Strufaldi, Maria Wany; Sun, Chien-An; Sung, Yn-Tz; Suriyawongpaisal, Paibul; Sy, Rody G.; Tai, E. Shyong; Tammesoo, Mari-Liis; Tamosiunas, Abdonas; Tang, Line; Tang, Xun; Tanser, Frank; Tao, Yong; Tarawneh, Mohammed Rasoul; Tarqui-Mamani, Carolina B.; Taylor, Anne; Theobald, Holger; Thijs, Lutgarde; Thuesen, Betina H.; Tjonneland, Anne; Tolonen, Hanna K.; Topbas, Murat; Topor-Madry, Roman; Jose Tormo, Maria; Torrent, Maties; Traissac, Pierre; Trichopoulos, Dimitrios; Trichopoulou, Antonia; Trinh, Oanh T. H.; Trivedi, Atul; Tshepo, Lechaba; Tulloch-Reid, Marshall K.; Tuomainen, Tomi-Pekka; Turley, Maria L.; Tynelius, Per; Tzourio, Christophe; Ueda, Peter; Ugel, Eunice; Ulmer, Hanno; Uusitalo, Hannu M. T.; Valdivia, Gonzalo; Valvi, Damaskini; van der Schouw, Yvonne T.; van Herck, Koen; van Rossem, Lenie; van Valkengoed, Irene G. M.; Vanderschueren, Dirk; Vanuzzo, Diego; Vatten, Lars; Vega, Tomas; Velasquez-Melendez, Gustavo; Veronesi, Giovanni; Verschuren, W. M. Monique; Verstraeten, Roosmarijn; Victora, Cesar G.; Viet, Lucie; Viikari-Juntura, Eira; Vineis, Paolo; Vioque, Jesus; Virtanen, Jyrki K.; Visvikis-Siest, Sophie; Viswanathan, Bharathi; Vollenweider, Peter; Vrdoljak, Ana; Vrijheid, Martine; Wade, Alisha N.; Wagner, Aline; Walton, Janette; Mohamud, Wan Nazaimoon Wan; Wang, Ming-Dong; Wang, Qian; Wang, Ya Xing; Wannamethee, S. Goya; Wareham, Nicholas; Wederkopp, Niels; Weerasekera, Deepa; Whincup, Peter H.; Widhalm, Kurt; Widyahening, Indah S.; Wiecek, Andrzej; Wijga, Alet H.; Wilks, Rainford J.; Willeit, Peter; Williams, Emmanuel A.; Wilsgaard, Tom; Wojtyniak, Bogdan; Wong, Tien Yin; Wong-McClure, Roy A.; Woo, Jean; Wu, Aleksander Giwercman; Wu, Frederick C.; Wu, Shou Ling; Xu, Haiquan; Yan, Weili; Yang, Xiaoguang; Ye, Xingwang; Yiallouros, Panayiotis K.; Yoshihara, Akihiro; Younger-Coleman, Novie O.; Yusoff, Ahmad F.; Zambon, Sabina; Zdrojewski, Tomasz; Zeng, Yi; Zhao, Dong; Zhao, Wenhua; Zheng, Yingffeng; Zhu, Dan; Zimmermann, Esther; Zuniga Cisneros, Julio

    2017-01-01

    Background Raised blood pressure is an important risk factor for cardiovascular diseases and chronic kidney disease. We estimated worldwide trends in mean systolic and mean diastolic blood pressure, and the prevalence of, and number of people with, raised blood pressure, defined as systolic blood

  15. 75 FR 24504 - Proposed Modification of VOR Federal Airways V-82, V-175, V-191, and V-430 in the Vicinity of...

    Science.gov (United States)

    2010-05-05

    ...- 430 in the vicinity of Bemidji, MN. The Bemidji (BJI) VOR, navigation aid that forms a segment of... interference problems and is planned for decommissioning. An airway intersection reporting point is being... aircraft reaches a useable segment of the airways. To restore the navigable airway structure in the...

  16. 75 FR 43813 - Modification of VOR Federal Airways V-82, V-175, V-191, and V-430 in the Vicinity of Bemidji, MN

    Science.gov (United States)

    2010-07-27

    ... (BJI) VOR, that forms a segment of these airways, has been out of service for over two years due to... intersection reporting point is being established in the same location as the BJI VOR to restore a navigable... ROUTES; AND REPORTING POINTS 0 1. The authority citation for part 71 continues to read as follows...

  17. (Unsettlement: political parody and the Northern Irish peace processDOI:10.5007/2175-8026.2010n58p191

    Directory of Open Access Journals (Sweden)

    Mark Phelan

    2010-01-01

    Full Text Available This essay examines Tim Loane's political comedies, Caught Red-Handed and To Be Sure, and their critique of the Northern Irish peace process. As "parodies of esteem", both plays challenge the ultimate electoral victors of the peace process (the Democratic Unionist Party and Sinn Féin as well as critiquing the cant, chicanery and cynicism that have characterised their political rhetoric and the peace process as a whole. This essay argues that Loane's transformation of these comedic pantomime horses into Trojan ones loaded with a ruthless polemical critique of our ruling political elites is all the more important in the context of a self-censoring media that has stifled dissent and debate by protecting the peace process from inconvenient truths. From these close and contextual readings of Loane's plays, wider issues relating to the political efficacy of comedy and its canonical relegation below 'higher forms' in Irish theatre historiography will also be considered.

  18. Development of Optical Fiber Technology in Poland, International Journal of Electronics and Telecommunication, vol. 57, no 2, pp.191-197, July 2011

    CERN Document Server

    Dorosz, J

    2011-01-01

    In this paper, the authors, chairmen of the 13th Conference on Optical Fibers and Their Applications OFA2011, and editors of the conference proceedings summarize the development of optical fiber technology in Poland (during the period of 2009- 2011) on the basis of papers presented there and consecutively published in this volume. The digest is thus not full but covers the periodically presented material every 18 months during the meetings on optical fibers in Białystok-Białowie˙za and Lublin- Krasnobród. OFC systems are developed for HEP experiments and accelerators. OFC systems are also developed for virtual atomic clocks. EuCARD information presentation was organized during this meeting. Keywords— optical fibers, optical communication systems, photonic sources and detectors, photonic sensors, integrated optics, photonics applications, photonic materials.

  19. Rapid needle-out patient-rollover approach after cone beam CT-guided lung biopsy: effect on pneumothorax rate in 1,191 consecutive patients

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Jung Im [Seoul National University College of Medicine, Department of Radiology, Jongno-gu, Seoul (Korea, Republic of); Seoul National University Medical Research Center, Institute of Radiation Medicine, Seoul (Korea, Republic of); Kyung Hee University Hospital at Gangdong, Kyung Hee University College of Medicine, Department of Radiology, Seoul (Korea, Republic of); Park, Chang Min; Goo, Jin Mo [Seoul National University College of Medicine, Department of Radiology, Jongno-gu, Seoul (Korea, Republic of); Seoul National University, Cancer Research Institute, Seoul (Korea, Republic of); Lee, Sang Min [Seoul National University College of Medicine, Department of Radiology, Jongno-gu, Seoul (Korea, Republic of)

    2015-07-15

    To investigate the effect of rapid needle-out patient-rollover approach on the incidence of pneumothorax and drainage catheter placement due to pneumothorax in C-arm Cone-beam CT (CBCT)-guided percutaneous transthoracic needle biopsy (PTNB) of lung lesions. From May 2011 to December 2012, 1227 PTNBs were performed in 1191 patients with a 17-gauge coaxial needle. 617 biopsies were performed without (conventional-group) and 610 with rapid-rollover approach (rapid-rollover-group). Overall pneumothorax rates and incidences of pneumothorax requiring drainage catheter placement were compared between two groups. There were no significant differences in overall pneumothorax rates between conventional and rapid-rollover groups (19.8 % vs. 23.1 %, p = 0.164). However, pneumothorax rate requiring drainage catheter placement was significantly lower in rapid-rollover-group (1.6 %) than conventional-group (4.2 %) (p = 0.010). Multivariate analysis revealed male, age > 60, bulla crossed, fissure crossed, pleura to target distance > 1.3 cm, emphysema along needle tract, and pleural punctures ≥ 2 were significant risk factors of pneumothorax (p < 0.05). Regarding pneumothorax requiring drainage catheter placement, fissure crossed, bulla crossed, and emphysema along needle tract were significant risk factors (p < 0.05), whereas rapid-rollover approach was an independent protective factor (p = 0.002). The rapid needle-out patient-rollover approach significantly reduced the rate of pneumothorax requiring drainage catheter placement after CBCT-guided PTNB. (orig.)

  20. Draft Title 40 CFR 191 compliance certification application for the Waste Isolation Pilot Plant. Volume 5: Appendices D and D, DEF, FAC

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-03-31

    This plan serves to describe the objectives of decommissioning for the Waste Isolation Pilot Plant (WIPP), identifies the elements necessary to accomplish the decommissioning, and defines the steps to execute those elements in a safe and environmentally sound manner. The plan provides a strategy for progressing from the final actions of the Disposal Phase, through the Decontamination and Decommissioning Phase, and into the initiation of the Long-Term Monitoring Phase. This plan describes a sequence of events for decontamination of the WIPP facilities and structures used to manage and contain TRU and TRU mixed waste during the receipt and emplacement operations. Alternative methods of decontamination are provided where practical. The methods for packaging and disposal of the waste generated (derived waste) during this process are discussed. The best available technology at the time of this plan`s development, may become outmoded by future technology and alternative strategies. If alternative technologies are identified the affected stakeholder(s), the Secretary of the Interior and the State will be consulted prior to implementation.

  1. Multibeam collection for KN191: Multibeam data collected aboard Knorr from 2007-08-28 to 2007-09-14, Woods Hole, MA to Woods Hole, MA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  2. Editor's Choice - Factors Associated with Long-Term Outcome in 191 Patients with Ilio-Femoral DVT Treated With Catheter-Directed Thrombolysis

    DEFF Research Database (Denmark)

    Foegh, P; Jensen, L P; Klitfod, L

    2017-01-01

    consecutive patients (203 limbs) attending a tertiary vascular centre at Gentofte University Hospital, Denmark underwent CDT. All patients had ultrasonically verified acute ilio-femoral DVT with open distal popliteal vein and calf veins. Patients were seen in the outpatient clinic 6 weeks, 3, 6, and 12 months...

  3. Mapping of the Faded (fe) Gene to a Region between D10mit191 and D10mit44 on Mouse Chromosome 10

    OpenAIRE

    Oh, Seung-Hun; Nam, Yoonyi; Suh, Jun-Gyo

    2011-01-01

    The faded mouse is a coat color mutant that shows faded coat color and age-related loss of pigmentation. This mutation is transmitted by an autosomal recessive gene with 100% penetrance. In the present study, we carried out linkage analysis of the faded (fe) gene using intra-specific backcross panels. Affected faded mice were carefully confirmed by their faded coat color at about 4 weeks of age. In the intra-specific backcross between faded and CBA mice (n=198), the fe gene was mapped to a re...

  4. Criteria for the Certification and Recertification of the Waste Isolation Pilot Plant's Compliance with the 40 CFR Part 191 Disposal Regulations (40 CFR Part 194)

    Science.gov (United States)

    EPA is responsible for certifying that DOE’s Waste Isolation Pilot Plant (WIPP) remains in compliance with environmental standards for the disposal of transuranic waste. 40 CFR Part 194 specifies criteria for certification or recertification of WIPP.

  5. SU-F-J-191: Dosimetric Evaluation of a Left Chestwall Patient Treated with a Compact Proton Pencil Beam Gantry Utilizing Daily Setup CBCT

    Energy Technology Data Exchange (ETDEWEB)

    Maynard, M; Chen, K; Rosen, L; Wu, H [Willis-Knighton Medical Center, Shreveport, LA (United States)

    2016-06-15

    Purpose: To evaluate the robustness of the gradient technique for treating a multi-isocenter left chest wall patient with a compact proton pencil beam gantry. Both CBCT and stereoscopic imaging are used to facilitate daily treatment setup. Methods: To treat the elongated chest wall planning target volume (PTV) with the compact PBS system, a 28 fraction (5040 CcGE) treatment plan was created using two fields with gradient matching technique. Daily table shifts between treatment field isocenters were obtained from the record and verify system for each treatment fraction. Copies of the initial treatment plan were made for each fraction and the field isocenter coordinates for each plan copy were adjusted to reflect daily table shifts. Doses were re-calculated for each fraction, summed, and compared against the initial plan. Results: The table shifts (average and range) were 2.2 (−5.1–+3.9), 3.0 (−6.0–+4.0) and 3.0 (−10.1–+1.9) millimeters in the anterior-posterior, superior-inferior and right-left directions, respectively. Dose difference to the PTV, heart and ipsilateral lung were evaluated. The percentage of the PTV receiving the prescription dose decreased from 94.6% to 89.1%. The D95 of the PTV increased from 99.6% to 99.9%. The maximum dose in PTV increased from 106.6% to 109.2% and V105 increased from 1.0% to 16.5%. The V20 of the ipsilateral lung increased from 18.5% to 21.0%. The mean heart dose difference was negligible. Conclusion: Observed dose differences to lung and heart tissues due to daily setup variations remained acceptably low while maintaining sufficient dose coverage to the PTV. This initial case study demonstrates the robustness of the gradient technique to treat a large target, multi-isocenter plan with a compact proton pencil beam gantry equipped with CBCT and stereoscopic imaging modalities.

  6. Draft Title 40 CFR 191 compliance certification application for the Waste Isolation Pilot Plant. Volume 9: Appendices RM, SCR, SER, SUM, WRAC

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-03-31

    The Rock Mechanics Program is important to the establishment of a radioactive waste repository in salt because rock mechanics deals with the prediction of creep closure and eventual encapsulation of the waste. The intent of this paper is to give the current status of the program. This program consists of three major modeling efforts: continuum creep, fracture, and the disturbed rock zone. These models, together with laboratory material parameters, plastic flow potentials, initial and boundary input data, and other peripheral information forms the predictive technology. The extent to which the predictive technology is validated against in situ test data adds certainty to the method. Application of the technology is through simulations of the test results, design, or performance using numerical codes. In summary, the predictive capabilities are technically sound and reasonable. The current status of the program is that which would be advanced for compliance.

  7. $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with radioactive At beams

    CERN Multimedia

    We propose to study the $\\beta$-delayed fission, laser spectroscopy and radioactive decay of the newly available pure beams of neutron-deficient and neutron-rich astatine (Z=85) isotopes. The fission probability and the fission fragment distribution of the even-even isotopes $^{194,196}$Po following the $\\beta$-decay of the isotopes $^{194,196}$At will be studied with the Windmill setup. In-source laser spectroscopy will be performed on the entire astatine isotopic chain, using a combination of the Windmill setup, ISOLTRAP MR-ToF and ISOLDE Faraday. Radioactive decay data will be acquired at the Windmill setup throughout those studies and contribute to the global understanding of the phenomenon of shape coexistence in the neutron-deficient lead region.

  8. Production cross section of At radionuclides from $^{7}$Li+$^{\\textrm{nat}}$Pb and $^{9}$Be+$^{\\textrm{nat}}$Tl reactions

    CERN Document Server

    Maiti, Moumita

    2011-01-01

    Earlier we reported theoretical studies on the probable production of astatine radionuclides from $^{6,7}$Li and $^{9}$Be-induced reactions on natural lead and thalliun targets, respectively. For the first time, in this report, production of astatine radionuclides has been investigated experimentally with two heavy ion induced reactions: $^{9}$Be+$^{\\textrm{nat}}$Tl and $^{7}$Li+$^{\\textrm{nat}}$Pb. Formation cross sections of the evaporation residues, $^{207,208,209,210}$At, produced in (HI, xn) channel, have been measured by the stacked-foil technique followed by the off-line $\\gamma$-spectrometry at the low incident energies ($<$50 MeV). Measured excitation functions have been explained in terms of compound nuclear reaction mechanism using Weisskopf-Ewing and Hauser-Feshbach model. Absolute cross section values are lower than the respective theoretical predictions.

  9. Production cross section of At radionuclides from 7Li+natPb and 9Be+natTl reactions

    Science.gov (United States)

    Maiti, Moumita; Lahiri, Susanta

    2011-12-01

    Earlier we reported theoretical studies on the probable production of astatine radionuclides from 6,7Li- and 9Be-induced reactions on natural lead and thallium targets, respectively. The production of astatine radionuclides were investigated experimentally with two heavy-ion-induced reactions: 9Be + natTl and 7Li + natPb. Formation cross sections of the evaporation residues, 207,208,209,210At, produced in the (HI,xn) channel, were measured by the stacked-foil technique followed by off-line γ spectrometry at low incident energies (<50 MeV). Measured excitation functions were interpreted in terms of a compound nuclear reaction mechanism using Weisskopf-Ewing and Hauser-Feshbach models. Measured cross-section values are lower than the respective theoretical predictions.

  10. Radiohalogenation of biomolecules. An experimental study on radiohalogen preparation, precursor synthesis, radiolabeling and biodistribution

    Energy Technology Data Exchange (ETDEWEB)

    Koziorowski, J

    1998-10-01

    Radiohalogens are widely used in nuclear medicine, both as tool for diagnostic in vivo imaging, and in radionuclide therapy. This study deals with the use of radiohalogens; separation, precursor synthesis, labeling and biological behavior. The focus is on {sup 211}At and {sup 124}I, the former being a candidate for nuclide therapy and the latter potentially useful for diagnostic imaging and Auger-electron based radiotherapy. For astatine the separation, labeling and some biological behavior is described, and for iodine the latter two. Astatine was separated from an irradiated bismuth target by dry distillation. A novel cryotrap was developed for the isolation of astatine and subsequent synthesis of radiolabeled compounds. 5-[{sup 211}At]astato-2`-deoxyuridine (AUdR) and N-succinimidyl-4-[{sup 211}At]astatobenzoate (SAB) were synthesized in 95% respectively 90% radiochemical yields. The former is incorporated into DNA of proliferating cells and can therefore be used as an endoradiotherapeutic agent. The latter is a conjugate for the astatination of proteins. Human epidermal growth factor (hEGF) was tagged with astatine using three approaches: a) direct labeling of native hEGF, b) conjugation with SAB, and c) direct labeling of an hEGF - 7-(3-aminopropyl)-7,8-dicarba-nido-undecaborate(1-) conjugate. The overall labeling yields were 3.5% for direct labeling, 44% for SAB and 70% for the hEGF-nido-carborane conjugate. A new route to N-succinimidyl 3- and 4- [{sup 124}I]iodobenzoate, two reagents for radioiodination of proteins is described affording 90% radiochemical yield. Three radioiodinated analogs of PK11195, 1-(2-chlorophenyl)-N-methyl-N-(1-methylpropyl)isoquinoline-3-carboxyam ide, a peripheral-type benzodiazepine receptor antagonist, were synthesized. All three analogs were obtained in >90% radiochemical yield. Synthesis and application of 5-[{sup 124}I]iodo-2`-deoxyuridine (IUdR) is presented. The closo-dodecaborate anion was evaluated as prosthetic group for

  11. Enhanced 1-m Composite Grayscale GeoTIFF Image of the Sidescan-Sonar Data From NOAA Survey H11076 of the Sea Floor in Quicks Hole, MA (H11076_UTM19_1MRSSS.TIF, UTM Zone 19)

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — The U.S. Geological Survey (USGS), in cooperation with the National Oceanic and Atmospheric Administration (NOAA) and the Massachusetts Office of Coastal Zone...

  12. Physical trajectory profile data from glider unit_191 deployed by University of Alaska - Fairbanks in the Southern Oceans from 2015-01-05 to 2015-02-26 (NCEI Accession 0145717)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The purpose of this glider mission is to do along canyon transects of Palmer Deep within the operating CODAR fields off of Anvers Island. This multi-platform field...

  13. The Autism Spectrum Screening Questionnaire (ASSQ)-Revised Extended Version (ASSQ-REV): An Instrument for Better Capturing the Autism Phenotype in Girls? A Preliminary Study Involving 191 Clinical Cases and Community Controls

    Science.gov (United States)

    Kopp, Svenny; Gillberg, Christopher

    2011-01-01

    We wanted to develop and validate an extension of the Autism Spectrum Screening Questionnaire (ASSQ)-the ASSQ Revised Extended Version (ASSQ-REV)--for better capturing the female phenotype of autism spectrum disorders (ASD). Clinic girls and Clinic boys, most of whom with ASD and/or attention-deficit/hyperactivity disorder (ADHD), and Community…

  14. Catherine Halpern, Michèle Bitton, Lilith, l’épouse de Satan, Paris, Larousse, coll. « Dieux, Mythes et Héros », 2010, 191 p.

    Directory of Open Access Journals (Sweden)

    Guillaume Roucoux

    2011-10-01

    Full Text Available Lilith, l’épouse de Satan est la quatrième figure féminine à s’inscrire dans la collection de « Dieux, Mythes & Héros » qui ne cache pas « le caractère profondément masculin de la mythologique en général » (p. 167, pour mieux lui résister. Ce portrait en six chapitres, dressé par la journaliste Catherine Halpern et la sociologue Michèle Bitton à partir de textes théologiques judéo-chrétiens et d’analyses scientifiques, nous donne à voir une Lilith plurielle mais dont « la plus grande partie ...

  15. Alain Caillé, Marc Humbert, Serge Latouche et Patrick Viveret, 2011, de la convivialité. Dialogues sur la société conviviale à venir, Paris : La Découverte, 191 p.

    Directory of Open Access Journals (Sweden)

    Igor Martinache

    2011-03-01

    Full Text Available Souvent, les ouvrages collectifs se limitent à la juxtaposition de contributions où chaque auteur expose ses propres recherches sans réellement dialoguer avec ses voisins. Au lecteur d'établir les ponts qui se logent fréquemment dans les subtilités d'un jargon dont l'accessibilité est inversement proportionnelle à la volonté de paraître « scientifique ». Ou, pire encore, les désaccords entre les co-auteurs y sont pudiquement cachés sous le tapis pour laisser place à une espèce de consensus au...

  16. Human Papillomavirus (HPV) Genotypes in Condylomas, Intraepithelial Neoplasia, and Invasive Carcinoma of the Penis Using Laser Capture Microdissection (LCM)-PCR: A Study of 191 Lesions in 43 Patients.

    Science.gov (United States)

    Fernández-Nestosa, María J; Guimerà, Nuria; Sanchez, Diego F; Cañete-Portillo, Sofía; Velazquez, Elsa F; Jenkins, David; Quint, Wim; Cubilla, Antonio L

    2017-06-13

    Laser capture microdissection-polymerase chain reaction (LCM-PCR) supported by p16 was used for the first time to demonstrate human papillomavirus (HPV) DNA in histologically specific penile lesions, which were as follows: squamous hyperplasia (12 lesions, 10 patients), flat lesions (12 lesions, 5 patients), condylomas (26 lesions, 7 patients), penile intraepithelial neoplasia (PeIN) (115 lesions, 43 patients), and invasive squamous cell carcinomas (26 lesions, 26 patients). HPV was detected by whole-tissue section and LCM-PCR. LCM proved to be more precise than whole-tissue section in assigning individual genotypes to specific lesions. HPV was negative or very infrequent in squamous hyperplasia, differentiated PeIN, and low-grade keratinizing variants of carcinomas. HPV was strongly associated with condylomas, warty/basaloid PeIN, adjacent flat lesions, and warty/basaloid carcinomas. A single HPV genotype was found in each lesion. Some condylomas and flat lesions, especially those with atypia, were preferentially associated with high-risk HPV. Unlike invasive carcinoma, in which few genotypes of HPV were involved, there were 18 HPV genotypes in PeIN, usually HPV 16 in basaloid PeIN but marked HPV heterogeneity in warty PeIN (11 different genotypes). Variable and multiple HPV genotypes were found in multicentric PeIN, whereas unicentric PeIN was usually related to a single genotype. There was a correspondence among HPV genotypes in invasive and associated PeIN. p16 was positive in the majority of HPV-positive lesions except condylomas containing LR-HPV. p16 was usually negative in squamous hyperplasia, differentiated PeIN, and low-grade keratinizing variants of squamous cell carcinomas. In summary, we demonstrated that LCM-PCR was a superior research technique for investigating HPV genotypes in intraepithelial lesions. A significant finding was the heterogeneity of HPV genotypes in PeIN and the differential association of HPV genotypes with subtypes of PeIN. The presence of atypia and high-risk HPV in condylomas and adjacent flat lesions suggests a precursor role, and the correspondence of HPV genotypes in invasive carcinomas and associated PeIN indicates a causal relation. Data presented support the bimodal hypothesis of penile cancer carcinogenesis in HPV-driven and non-HPV-driven carcinomas and justify the current WHO pathologic classification of PeIN in special subtypes.

  17. A summary of the models used for the mechanical response of disposal rooms in the Waste Isolation Pilot Plant with regard to compliance with 40 CFR 191, Subpart B

    Energy Technology Data Exchange (ETDEWEB)

    Butcher, B.M.; Mendenhall, F.T.

    1993-08-01

    A summary is presented of the results of a number of studies conducted prior to March 1992 that have led to a conceptual model describing how the porosity (and therefore the permeability) of waste and backfill in a Waste Isolation Pilot Plant disposal room changes with time and also describes how results from calculations involving mathematical models of these processes are used to provide input into performance assessment of the repository. Included in the report are descriptions of essential material response or constitutive models that include the influence of gas generation and the response of simple gas-pressurized cracks and fractures in salt, marker beds, and clay seams. Two-dimensional versus three-dimensional disposal room configurations and descriptions of the differences between numerical codes are also discussed. Calculational results using the mathematical models for disposal room response are described, beginning with closure of empty rooms and becoming progressively more complex. More recent results address some of the effects of gas generation in a room containing waste and backfill and intersected by a gas permeable marker bed. Developments currently in progress to improve the evaluation of the disposal room performance are addressing the coupling between brine flow and closure and the two-dimensional capability for analyzing a complete panel of rooms. Next, a method is described for including disposal room closure results into performance assessment analyses that determine if the repository is in compliance with regulatory standards. The coupling is accomplished using closure surfaces that describe the relationship among porosity, total amount of gas in the repository, and time. A number of conclusions about room response and recommendations for further work are included throughout the report.

  18. Estudo comparativo do desenvolvimento sensório-motor de recém-nascidos prematuros da unidade de terapia intensiva neonatal e do método canguru - doi:10.5020/18061230.2005.p191

    Directory of Open Access Journals (Sweden)

    Luciana Andrade da Mota

    2012-01-01

    Full Text Available O Método Canguru é uma alternativa ao método tradicional de assistência a bebês prematuros de baixo peso, que preconiza o contato pele a pele precoce, entre mãe e filho, 24 horas por dia, garantindo-lhes estímulos sensoriais e motores e maior participação dos pais no cuidado de seu bebê. A Unidade de Terapia Intensiva (UTI Neonatal é destinada ao tratamento de recém-nascidos prematuros com algum problema ao nascer. Objetivou-se comparar o desenvolvimento sensório-motor de recém-nascidos prematuros (RNPt da UTI Neonatal e do Método Canguru. Realizou-se um estudo comparativo, prospectivo e observacional, no Hospital Geral Dr. César Cals, em Fortaleza – CE, de agosto a outubro de 2004, com 14 RNPt, sendo 07 de cada grupo, com peso inferior a 2000g e idade gestacional entre 30 e 37 semanas. A avaliação foi semanal até a alta hospitalar ou até completarem a idade corrigida de 40 semanas, pelo método Dubowitz e Amiel-Tison, com análise de tônus muscular, respostas sensório-motoras, ganho de peso e tempo de internação. Como resultado, observou-se que os bebês do Método Canguru apresentaram melhores respostas sensório-motoras, comprovadas a partir da constatação de um menor grau de estresse, melhores respostas reflexas, movimentação espontânea e tônus muscular, e menor tempo de internação, permanecendo mais tempo em estado de alerta e interagindo bem com o ambiente e a mãe. Conclui-se que o Método Canguru mostrou-se uma alternativa mais eficaz de assistência a RNPt de baixo peso, pois proporcionou melhores resultados quanto às atividades sensório-motor dos bebês, se comparados à UTI Neonatal.

  19. Alpha particle induced DNA damage and repair in normal cultured thyrocytes of different proliferation status

    DEFF Research Database (Denmark)

    Lyckesvärd, Madeleine Nordén; Delle, Ulla; Kahu, Helena

    2014-01-01

    Childhood exposure to ionizing radiation increases the risk of developing thyroid cancer later in life and this is suggested to be due to higher proliferation of the young thyroid. The interest of using high-LET alpha particles from Astatine-211 ((211)At), concentrated in the thyroid by the same...... mechanism as (131)I [1], in cancer treatment has increased during recent years because of its high efficiency in inducing biological damage and beneficial dose distribution when compared to low-LET radiation. Most knowledge of the DNA damage response in thyroid is from studies using low-LET irradiation...

  20. ORF Alignment: NC_006300 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available LNLPKIMLGTWSWGAGMYGGDQVFGNSIEAKDVKEVFDLAVKNGLNAFDTATAYGLGASE 60 ... Query: 132 ERWTSGLIPLLKAGKVKAVGISNHNLAQIKR...VNEILGAEGYKLDAVQNHFSLLYRASEEA 191 ... ERWTSGLIPLLKAGKVKAVGISNHNLAQIKRVNEILGAEGYKLDAVQNHFSLLYRASEEA Sbjct: 121 ERWTSGLI

  1. ORF Alignment: NC_002932 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available PPAPELA 60 ... Query: 132 IVHRLDKDTSGLIIVAKNPVALHKLATQFARRQVEKVYKAIVWGVPNPPSGTIKTNIGRS 191 ... IVHRLDKDTSGLI...IVAKNPVALHKLATQFARRQVEKVYKAIVWGVPNPPSGTIKTNIGRS Sbjct: 121 IVHRLDKDTSGLIIVAKN

  2. Dicty_cDB: VFK276 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available californicus haplotype S... 191 6e-47 DQ901654_1( DQ901654 |pid:none) Tigriopus californicus haplotype A... 191...californicus haplotype A... 191 6e-47 DQ901691_1( DQ901691 |pid:none) Tigriopus californicus haplotype S... 191...californicus haplotype S... 191 6e-47 DQ901657_1( DQ901657 |pid:none) Tigriopus californicus haplotype A... 191...DQ901666_1( DQ901666 |pid:none) Tigriopus californicus haplotype S... 191 6e-47 AY149910_1( AY149910 |pid:none)

  3. 78 FR 23543 - Procurement List Deletions

    Science.gov (United States)

    2013-04-19

    .... The major factors considered for this certification were: 1. The action will not result in additional..., Ground Ambulance NSN: 6545-01-191-8972--Medical Equipment Set, Trauma, Field NSN: 6545-01-191-8971...

  4. DMPD: Heterogeneity of TLR-induced responses in dendritic cells: from innate toadaptive immunity. [Dynamic Macrophage Pathway CSML Database

    Lifescience Database Archive (English)

    Full Text Available daptive immunity. Re F, Strominger JL. Immunobiology. 2004;209(1-2):191-8. (.png) (.svg) (.html) (.csml) Sho...toadaptive immunity. Authors Re F, Strominger JL. Publication Immunobiology. 2004;209(1-2):191-8. Pathway -

  5. 10 CFR Appendix L to Part 110 - Illustrative List of Byproduct Materials Under NRC Export/Import Licensing Authority a

    Science.gov (United States)

    2010-01-01

    ... 149 (Nd 149) Neptunium 235 (Np 235) Neptunium 237 (Np 237) Nickel 59 (Ni 59) Nickel 63 (Ni 63) Nickel...) Palladium 109 (Pd 109) Phosphorus 32 (P 32) Phosphorus 33 (P 33) Platinum 191 (Pt 191) Platinum 193m (Pt...

  6. EFFECT OF MECHANICAL PROPERTIES OF MARTENSITE AND LOADING RATE ON DUAL PHASE STEELS

    Directory of Open Access Journals (Sweden)

    Ali BAYRAM

    1998-03-01

    Full Text Available In this study, steel sheet materials were used in order to obtain dual-phase steel. Specimens for this purpose have been annealed in ferrite + astatine regions at the temperatures of 740, 760, 800 and 820 °C. The specimens were annealed at the different temperatures with corresponding times 20, 40 and 60 minutes and quenched into water. As a result of this dual-phase steels at different ferrite + martensite ratio were produced. Sheet specimens were tested at the range of loading rates of 10, 50 and 259 mm/min. Strength properties of dual-phase steels were investigated depending on annealing temperature, ratio of martensite and loading rate.

  7. New developments of the in-source spectroscopy method at RILIS/ISOLDE

    CERN Document Server

    Marsh, B A; Imai, N; Seliverstov, M D; Rothe, S; Sels, S; Capponi, L; Rossel, R E; Franchoo, S; Wendt, K; Focker, G J; Kalaninova, Z; Sjoedin, A M; Popescu, L; Nicol, T; Huyse, M; Radulov, D; Atanasov, D; Kesteloot, N; Borgmann, Ch; Cocolios, T E; Lecesne, N; Ghys, L; Pauwels, D; Rapisarda, E; Kreim, S; Liberati, V; Wolf, R N; Andel, B; Schweikhard, L; Lane, J; Derkx, X; Kudryavtsev, Yu; Zemlyanoy, S G; Fedosseev, V N; Lynch, K M; Rosenbusch, M; Van Duppen, P; Lunney, D; Manea, V; Barzakh, A E; Andreyev, A N; Truesdale, V; Flanagan, K T; Molkanov, P L; Koester, U; Van Beveren, C; Wienholtz, F; Goodacre, T Day; Antalic, S; Bastin, B; De Witte, H; Fink, D A; Fedorov, D V

    2013-01-01

    At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar fr...

  8. Nuclear and in-source laser spectroscopy with the ISAC yield station

    Energy Technology Data Exchange (ETDEWEB)

    Kunz, Peter, E-mail: pkunz@triumf.ca; Bricault, Pierre; Dombsky, Marik; Lassen, Jens; Teigelhöfer, Andrea; Heggen, Henning [TRIUMF, 4004 Wesbrook Mall, Vancouver, British Columbia V6T 2A3 (Canada); Andreoiu, Corina; Wong, Fiona [Department of Chemistry, Simon Fraser University, Burnaby, British Columbia V5A 1S6 (Canada)

    2014-05-15

    A new decay station has been built for the ISAC facility at TRIUMF for the rapid and reliable characterization of radioactive ion beam (RIB) compositions and intensities with the capability of simultaneously collecting α, β, and γ decay data from RIB with intensities between a few and ≈10{sup 11} ions per second. It features user-friendly control, data acquisition, and analysis software. The analysis of individual decay time structures allows the unambiguous assignment of α and γ lines even with substantial isobaric contamination present. The capability for accurate half-life measurements is demonstrated with the example of {sup 46}K. The coupling of the yield station to the laser ion source, TRILIS, allows the correlation of radiometric data with automated laser frequency scans. First results of in-source laser spectroscopy measurements on astatine are discussed.

  9. Nuclear and in-source laser spectroscopy with the ISAC yield station.

    Science.gov (United States)

    Kunz, Peter; Andreoiu, Corina; Bricault, Pierre; Dombsky, Marik; Lassen, Jens; Teigelhöfer, Andrea; Heggen, Henning; Wong, Fiona

    2014-05-01

    A new decay station has been built for the ISAC facility at TRIUMF for the rapid and reliable characterization of radioactive ion beam (RIB) compositions and intensities with the capability of simultaneously collecting α, β, and γ decay data from RIB with intensities between a few and ≈10(11) ions per second. It features user-friendly control, data acquisition, and analysis software. The analysis of individual decay time structures allows the unambiguous assignment of α and γ lines even with substantial isobaric contamination present. The capability for accurate half-life measurements is demonstrated with the example of (46)K. The coupling of the yield station to the laser ion source, TRILIS, allows the correlation of radiometric data with automated laser frequency scans. First results of in-source laser spectroscopy measurements on astatine are discussed.

  10. Radiopharmaceutical chemistry of targeted radiotherapeutics, part 4: Strategies for211At labeling at high activities and radiation doses of211At α-particles.

    Science.gov (United States)

    Pozzi, Oscar R; Zalutsky, Michael R

    2017-03-01

    Alpha particles are radiation of high energy and short range, properties that can lead to radiolysis-mediated complications in labeling chemistry at the high radioactivity levels required for clinical application. In previous papers in this series, we have shown that radiation dose has a profound effect on the astatine species that are present in the labeling reaction and their suitability for the synthesis of N-succinimidyl 3-[ 211 At]astatobenzoate. The purpose of this study was to evaluate the effects of adding N-chlorosuccinimide (NCS) to the methanol solution used for initial isolation of 211 At after distillation, a process referred to as 211 At stabilization, on 211 At chemistry after exposure to high radiation doses. High performance liquid chromatography was used to evaluate the distribution of 211 At species present in methanol in the 500-65,000Gy radiation dose range and the synthesis of SAB from N-succinimidyl 3-(tri-n-butylstannyl)benzoate in the 500-120,000Gy radiation dose range using different 211 At timeactivity combinations under conditions with/without 211 At stabilization. In the absence of NCS stabilization, a reduced form of astatine, At(2), increased with increasing radiation dose, accounting for about half the total activity by about 15,000Gy, while with stabilization, At(2) accounted for 60,000Gy. SAB yields without stabilization rapidly declined with increasing dose, falling to ~20% at about 5000Gy while with stabilization, yields >80% were obtained with 211 At solutions stored for more than 23h and receiving radiation doses >100,000Gy. Adding NCS to the methanol solution used for initial isolation of 211 At is a promising strategy for countering the deleterious effects of radiolysis on 211 At chemistry. This strategy could facilitate the ability to perform 211 At labeling at sites remote from its production and at the high activity levels required for clinical applications. Copyright © 2016 Elsevier Inc. All rights reserved.

  11. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC191 (Link to dictyBase) - - - Contig-U16281-1 VFC191F (Link... to Original site) VFC191F 350 - - - - - - Show VFC191 Library VF (Link to library) Clone ID VFC191 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16281-1 Original site URL http://dict...ts) Value N AC116305 |AC116305.2 Dictyostelium discoideum chromosome 2 map 1005175-1418323 strain AX4, compl... 186 3e-46 AC116305_8( AC116305 |pid:none) Dictyostelium discoideum chromosom...

  12. Interaction of the mechanism-based inactivator acetylene with ammonia monooxygenase of Nitrosomonas europaea.

    Science.gov (United States)

    Gilch, Stefan; Vogel, Manja; Lorenz, Matthias W; Meyer, Ortwin; Schmidt, Ingo

    2009-01-01

    The ammonia monooxygenase (AMO) of Nitrosomonas europaea is a metalloenzyme that catalyses the oxidation of ammonia to hydroxylamine. We have identified histidine 191 of AmoA as the binding site for the oxidized mechanism-based inactivator acetylene. Binding of acetylene changed the molecular mass of His-191 from 155.15 to 197.2 Da (+42.05), providing evidence that acetylene was oxidized to ketene (CH2CO; 42.04 Da) which binds specifically to His-191. It must be assumed that His-191 is part of the acetylene-activating site in AMO or at least directly neighbours this site.

  13. ORF Alignment: NC_003071 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available KLSSKYGHLLHLRIFNVPVILVSSASVAYEIFRAHDVNVSSRGV 71 ... Query: 172 KARMTESVEISTEAMKLVNNTLCRMSMGRSFSEENGEAEKIRGLVGES...YALTKKMFLASL 231 ... KARMTESVEISTEAMKLVNNTLCRMSMGRSFSEENGEAEKIRGLVGESYALTK...KMFLASL Sbjct: 132 KARMTESVEISTEAMKLVNNTLCRMSMGRSFSEENGEAEKIRGLVGESYALTKKMFLASL 191 ... Query: 292 AEYNITRNHIKS

  14. ORF Alignment: NC_004578 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... tomato str. DC3000] ... Length = 115 ... Query: 132 IELNSSLLFVSGDAMPSDKAFTIIEKVSGIVKRFDNPIHV...EGFTDDQPISTAQFPTNWEL 191 ... IELNSSLLFVSGDAMPSDKAFTIIEKVSGIVKRFDNPIHVEGFTD...DQPISTAQFPTNWEL Sbjct: 1 ... IELNSSLLFVSGDAMPSDKAFTIIEKVSGIVKRFDNPIHVEGFTDDQPISTAQFPTNWEL 60 ...

  15. EST Table: FY008611 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FY008611 bmov25c17 11/11/04 98 %/191 aa ref|NP_001040385.1| pelota-like protein [Bo...mbyx mori] gb|ABF51295.1| pelota-like protein [Bombyx mori] 11/11/04 68 %/191 aa FBpp0169228|DmojGI20011-PA ...AGAP008269 11/11/04 64 %/191 aa gnl|Amel|GB10750-PA 11/11/04 63 %/191 aa gi|91095145|ref|XP_967126.1| PREDICTED: similar to pelota [Tribolium castaneum] FS917768 bmov ...

  16. Dicty_cDB: Contig-U12363-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available *ILKMKFISFFITLILISILNNFVLSSGTTVSDVTLIVNL NNNNSYPVNGSCGSSTQLTCNNINDAINYFNTIAVNVNRSSSQIIYQQLNLLLDDGNYST...*ILKMKFISFFITLILISILNNFVLSSGTTVSDVTLIVNL NNNNSYPVNGSCGSSTQLTCNNINDAINYFNTIAVNVNRSSSQIIYQQLNLLLDDGNYST...22/191 (11%) Frame = +1 Query: 154 SDVTLIVXXXXXXS---YPVNGSCGSSTQLTCNNINDAINYFNTIAVNVNRSSSQIIYQQ 324 + +TLIV

  17. Domain Modeling: NP_005215.1 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_005215.1 chr19 Structure of an acetylated Rsc4 tandem bromodomain Histone Chimer...a p2r0sa_ chr19/NP_005215.1/NP_005215.1_apo_32-191.pdb p2r10a_ chr19/NP_005215.1/NP_005215.1_holo_32-191.pdb

  18. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 22; Issue 2. \\it{Viburnum punctatum} Buch.-Ham. Flowering Trees Volume 22 Issue 2 February 2017 pp 191-191. Fulltext. Click here to view fulltext PDF. Permanent link: http://www.ias.ac.in/article/fulltext/reso/022/02/0191-0191. Abstract. Resonance ...

  19. Quartz and feldspar distribution in continental shelf sediments of east coast of India

    Digital Repository Service at National Institute of Oceanography (India)

    Rao, V.P.; VijayKumar, B

    stream_size 5 stream_content_type text/plain stream_name Indian_J_Mar_Sci_19_191.pdf.txt stream_source_info Indian_J_Mar_Sci_19_191.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  20. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 22; Issue 3. Issue front cover thumbnail Issue back cover thumbnail. Volume 22, Issue 3. March 2017, pages 191-333. pp 191-192 Editorial. Editorial · More Details Abstract Fulltext PDF. pp 193-197 Article-in-a-Box. Lise Meitner (1878–1968): A Physicist ...

  1. Gender differentials in Facebook use among undergraduates of ...

    African Journals Online (AJOL)

    This study examined the gender differentials in Facebook use among undergraduates of selected tertiary institutions in Enugu State. A total of 382 undergraduates (male-191, female-191, M age 19, M years of Facebook use 7 years) selected through a multi-stage technique provided data for the study on their Facebook use.

  2. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. Our Readers Write. Articles in Resonance – Journal of Science Education. Volume 19 Issue 2 February 2014 pp 191-191 Our Readers Write. Our Readers Write... More Details Fulltext PDF. Volume 19 Issue 11 November 2014 pp 1062-1065 Our Readers Write.

  3. Digital Load Control Applied to Full-Scale Airframe Fatigue Tests

    Science.gov (United States)

    1979-05-01

    294. , -87. ,-278. -183. ,-263. ,-1t8. , 8 55692. ,-191. ,-45681. , -135360. +-64956. , -64956. 8 27538. ,27538., 17573., - 8239 ., -16442., -16442., 8...64956. 8 27538. , 27530. , 17573. - 8239 ., -16442., -6442., 8 -115232.,-115232.,-45681.,-141338.,-233281., -233281., 8 -263., -118. 55692. , -191. , 8

  4. Seven years of radionuclide laboratory at IMC – important achievements

    Czech Academy of Sciences Publication Activity Database

    Hrubý, Martin; Kučka, Jan; Pánek, Jiří; Štěpánek, Petr

    2016-01-01

    Roč. 65, Suppl. 2 (2016), S191-S201 ISSN 0862-8408 R&D Projects: GA MŠk(CZ) LO1507 Institutional support: RVO:61389013 Keywords : radionuclide * radiopharmaceutical * polymer Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.461, year: 2016 http://www.biomed.cas.cz/physiolres/pdf/65%20Suppl%202/65_S191.pdf

  5. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 191 of 191 ... Vol 14, No 1 (2003), Proximate chemical analysis of Zonocerus variegatus (Giant grasshopper), Abstract PDF. Olushola Ladeji, Mariam Solomon, Hugh Maduka. Vol 32 (2017), Purification and Characterization of Lipase from Aspergillus flavus PW2961 using Magnetic Nanoparticles. Abstract PDF.

  6. AcEST: DK952012 [AcEST

    Lifescience Database Archive (English)

    Full Text Available s thaliana PE=2 SV=1 192 1e-47 tr|Q1LY48|Q1LY48_DANRE Novel protein similar to vertebrate Wolf...-... 191 2e-47 tr|Q06ZW5|Q06ZW5_DANRE Wolf-Hirschhorn syndrome candidate 1 prot... 191 2e-47 tr...|B8JIA4|B8JIA4_DANRE Novel protein OS=Danio rerio GN=CH211-233... 191 2e-47 tr|B7ZVT1|B7ZVT1_DANRE Wolf-Hirs..... 191 4e-47 tr|A2A2T3|A2A2T3_HUMAN Wolf-Hirschhorn syndrome candidate 1 OS=H... 191 4e-47 tr|A2A2T2|A2A2T2_HUMAN Wolf

  7. Alpha particle emitters in medicine

    Energy Technology Data Exchange (ETDEWEB)

    Fisher, D.R.

    1989-09-01

    Radiation-induced cancer of bone, liver and lung has been a prominent harmful side-effect of medical applications of alpha emitters. In recent years, however, the potential use of antibodies labeled with alpha emitting radionuclides against cancer has seemed promising because alpha particles are highly effective in cell killing. High dose rates at high LET, effectiveness under hypoxic conditions, and minimal expectancy of repair are additional advantages of alpha emitters over antibodies labeled with beta emitting radionuclides for cancer therapy. Cyclotron-produced astatine-211 ({sup 211}At) and natural bismuth-212 ({sup 212}Bi) have been proposed and are under extensive study in the United States and Europe. Radium-223 ({sup 223}Ra) also has favorable properties as a potential alpha emitting label, including a short-lived daughter chain with four alpha emissions. The radiation dosimetry of internal alpha emitters is complex due to nonuniformly distributed sources, short particle tracks, and high relative specific ionization. The variations in dose at the cellular level may be extreme. Alpha-particle radiation dosimetry, therefore, must involve analysis of statistical energy deposition probabilities for cellular level targets. It must also account fully for nonuniform distributions of sources in tissues, source-target geometries, and particle-track physics. 18 refs., 4 figs.

  8. α decay of the very neutron-deficient isotopes 197-199Fr

    Science.gov (United States)

    Kalaninová, Z.; Andreyev, A. N.; Antalic, S.; Heßberger, F. P.; Ackermann, D.; Andel, B.; Drummond, M. C.; Hofmann, S.; Huyse, M.; Kindler, B.; Lane, J. F. W.; Liberati, V.; Lommel, B.; Page, R. D.; Rapisarda, E.; Sandhu, K.; Šáro, Š.; Thornthwaite, A.; Van Duppen, P.

    2013-04-01

    Decay properties of the very neutron-deficient isotopes 197-199Fr were studied at the velocity filter Separator for Heavy Ion reaction Products (SHIP) at GSI in Darmstadt. The isotopes were produced in the 2n-4n evaporation channels of the fusion-evaporation reaction 60Ni+141Pr → 201Fr*. Improved α-decay properties of 199Fr were determined and the possible existence of two α-decaying states in this nucleus is discussed. For the isotope 198Fr a broad α-decay energy distribution was detected in the range of (7470-7930) keV and two α-decaying states were observed with half-lives of 1.1(7) and 15(3) ms. The new isotope 197Fr was identified based on the observation of one α-decay chain yielding Eα=7728(15) keV and T1/2=0.6-0.3+3.0 ms. The systematics of reduced α-decay widths are presented for neutron-deficient francium, radon, and astatine isotopes.

  9. Nuclear Data Evaluation for Mass Chain A=217:Odd-Proton Nuclei.

    Directory of Open Access Journals (Sweden)

    Sherif S Nafee

    Full Text Available Thallium (81(217Tl, Bismuth (83(217Bi, Astatine (85(217At, Francium (87(217Fr, Actinium (89(217Ac and Protactinium (91(217Pa are of odd-proton numbers among the mass chain A = 217. In the present work, the half-lives and gamma transitions for the six nuclei have been studied and adopted based on the recently published interactions or unevaluated nuclear data sets XUNDL. The Q (α has been updated based on the recent published work of the Atomic Mass Evaluation AME2012 as well. Moreover, the total conversion electrons as well as the K-Shell to L-Shell, L-Shell to M-Shell and L-Shell to N-Shell Conversion Electron Ratios have been calculated using BrIcc code v2.3. An updated skeleton decay scheme for each of the above nuclei has been presented here. The decay hindrance factors (HF calculated using the ALPHAD program, which is available from Brookhaven National Laboratory's website, have been calculated for the α- decay data sets for (221Fr-, (221Ac- and (221Pa-α-decays.

  10. Nuclear Data Evaluation for Mass Chain A=217:Odd-Proton Nuclei.

    Science.gov (United States)

    Nafee, Sherif S; Shaheen, Salem A; Al-Ramady, Amir M

    2016-01-01

    Thallium (81(217)Tl, Bismuth (83(217)Bi), Astatine (85(217)At), Francium (87(217)Fr), Actinium (89(217)Ac) and Protactinium (91(217)Pa) are of odd-proton numbers among the mass chain A = 217. In the present work, the half-lives and gamma transitions for the six nuclei have been studied and adopted based on the recently published interactions or unevaluated nuclear data sets XUNDL. The Q (α) has been updated based on the recent published work of the Atomic Mass Evaluation AME2012 as well. Moreover, the total conversion electrons as well as the K-Shell to L-Shell, L-Shell to M-Shell and L-Shell to N-Shell Conversion Electron Ratios have been calculated using BrIcc code v2.3. An updated skeleton decay scheme for each of the above nuclei has been presented here. The decay hindrance factors (HF) calculated using the ALPHAD program, which is available from Brookhaven National Laboratory's website, have been calculated for the α- decay data sets for (221)Fr-, (221)Ac- and (221)Pa-α-decays.

  11. On the theory of time dilation in chemical kinetics

    Science.gov (United States)

    Baig, Mirza Wasif

    2017-10-01

    The rates of chemical reactions are not absolute but their magnitude depends upon the relative speeds of the moving observers. This has been proved by unifying basic theories of chemical kinetics, which are transition state theory, collision theory, RRKM and Marcus theory, with the special theory of relativity. Boltzmann constant and energy spacing between permitted quantum levels of molecules are quantum mechanically proved to be Lorentz variant. The relativistic statistical thermodynamics has been developed to explain quasi-equilibrium existing between reactants and activated complex. The newly formulated Lorentz transformation of the rate constant from Arrhenius equation, of the collision frequency and of the Eyring and Marcus equations renders the rate of reaction to be Lorentz variant. For a moving observer moving at fractions of the speed of light along the reaction coordinate, the transition state possess less kinetic energy to sweep translation over it. This results in the slower transformation of reactants into products and in a stretched time frame for the chemical reaction to complete. Lorentz transformation of the half-life equation explains time dilation of the half-life period of chemical reactions and proves special theory of relativity and presents theory in accord with each other. To demonstrate the effectiveness of the present theory, the enzymatic reaction of methylamine dehydrogenase and radioactive disintegration of Astatine into Bismuth are considered as numerical examples.

  12. SPECT assay of radiolabeled monoclonal antibodies. Progress report, September 1, 1992--August 24, 1993

    Energy Technology Data Exchange (ETDEWEB)

    Jaszczak, R.J.

    1993-08-20

    The overall goal of this project is to improve the effectiveness of single photon emission computed tomography (SPECT) to image and quantify radiolabeled monoclonal antibodies. During the past year, we have made significant progress toward this goal, and this report summarizes that work. Our efforts have been mainly directed along three fronts. First, we have developed and tested new reconstruction methods including three-dimensional iterative algorithms that model non-uniform attenuation and distance-dependent detector response. Both fan beam and parallel beam collimator geometries have been modeled and novel ways of improving the efficiency of the computationally intensive methods have been introduced. Second, an ultra-high resolution, small field-of-view pinhole collimator has been constructed and evaluated. Reconstructed spatial resolution of 1 to 3 mm (FWHM) has been achieved in phantom scans with a useful field-of-view of 9 to 10 cm. Finally, we have investigated the ability of SPECT to image and quantify astatine-211 distributions. Reconstructed images of phantom data demonstrated quantitative accuracy to within 10% with proper attenuation and scatter compensation.

  13. New developments of the in-source spectroscopy method at RILIS/ISOLDE

    Science.gov (United States)

    Marsh, B. A.; Andel, B.; Andreyev, A. N.; Antalic, S.; Atanasov, D.; Barzakh, A. E.; Bastin, B.; Borgmann, Ch.; Capponi, L.; Cocolios, T. E.; Day Goodacre, T.; Dehairs, M.; Derkx, X.; De Witte, H.; Fedorov, D. V.; Fedosseev, V. N.; Focker, G. J.; Fink, D. A.; Flanagan, K. T.; Franchoo, S.; Ghys, L.; Huyse, M.; Imai, N.; Kalaninova, Z.; Köster, U.; Kreim, S.; Kesteloot, N.; Kudryavtsev, Yu.; Lane, J.; Lecesne, N.; Liberati, V.; Lunney, D.; Lynch, K. M.; Manea, V.; Molkanov, P. L.; Nicol, T.; Pauwels, D.; Popescu, L.; Radulov, D.; Rapisarda, E.; Rosenbusch, M.; Rossel, R. E.; Rothe, S.; Schweikhard, L.; Seliverstov, M. D.; Sels, S.; Sjödin, A. M.; Truesdale, V.; Van Beveren, C.; Van Duppen, P.; Wendt, K.; Wienholtz, F.; Wolf, R. N.; Zemlyanoy, S. G.

    2013-12-01

    At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar free ionization using the Laser Ion Source Trap, LIST (Po); isobar selective particle identification using the multi-reflection time-of-flight mass separator (MR-ToF MS) of ISOLTRAP (Au, At). These are summarized as part of an overview of the current status of the in-source resonance ionization spectroscopy setup at ISOLDE.

  14. Studies of Stable Octupole Deformations in the Radium Region

    CERN Multimedia

    2002-01-01

    The purpose of the present project is to locate and identify states in the atomic nuclei possessing stable pearshaped octupole deformation. Such states, formally related to the structures known in molecular physics, manifest themselves as families of parity doublets in odd nuclei.\\\\ \\\\ The best possibilities for observing stable octupole deformations are offered in the Ra-region. Both theoretical calculations and experimental indications support such expectations. Such indications are the non-observation of two-phonon octupole vibrational states in the ISOLDE studies of the even-even radium nuclei, and the reversed sign of the decoupling factor of the ground state band in |2|2|5Ra observed in the single-neutron transfer reactions. In order to establish the predicted strong E1 and E3-transitions between the parity doublets in odd nuclei with stable octupole deformations it is proposed to study conversion electrons in odd-mass francium radium and radon isotopes following the @b-decay of francium and astatine. \\...

  15. Tumor Immunotargeting Using Innovative Radionuclides

    Directory of Open Access Journals (Sweden)

    Françoise Kraeber-Bodéré

    2015-02-01

    Full Text Available This paper reviews some aspects and recent developments in the use of antibodies to target radionuclides for tumor imaging and therapy. While radiolabeled antibodies have been considered for many years in this context, only a few have reached the level of routine clinical use. However, alternative radionuclides, with more appropriate physical properties, such as lutetium-177 or copper-67, as well as alpha-emitting radionuclides, including astatine-211, bismuth-213, actinium-225, and others are currently reviving hopes in cancer treatments, both in hematological diseases and solid tumors. At the same time, PET imaging, with short-lived radionuclides, such as gallium-68, fluorine-18 or copper-64, or long half-life ones, particularly iodine-124 and zirconium-89 now offers new perspectives in immuno-specific phenotype tumor imaging. New antibody analogues and pretargeting strategies have also considerably improved the performances of tumor immunotargeting and completely renewed the interest in these approaches for imaging and therapy by providing theranostics, companion diagnostics and news tools to make personalized medicine a reality.

  16. Evaluating 99mTc Auger electrons for targeted tumor radiotherapy by computational methods.

    Science.gov (United States)

    Tavares, Adriana Alexandre S; Tavares, João Manuel R S

    2010-07-01

    Technetium-99m (99mTc) has been widely used as an imaging agent but only recently has been considered for therapeutic applications. This study aims to analyze the potential use of 99mTc Auger electrons for targeted tumor radiotherapy by evaluating the DNA damage and its probability of correct repair and by studying the cellular kinetics, following 99mTc Auger electron irradiation in comparison to iodine-131 (131I) beta minus particles and astatine-211 (211At) alpha particle irradiation. Computational models were used to estimate the yield of DNA damage (fast Monte Carlo damage algorithm), the probability of correct repair (Monte Carlo excision repair algorithm), and cell kinetic effects (virtual cell radiobiology algorithm) after irradiation with the selected particles. The results obtained with the algorithms used suggested that 99mTc CKMMX (all M-shell Coster-Kroning--CK--and super-CK transitions) electrons and Auger MXY (all M-shell Auger transitions) have a therapeutic potential comparable to high linear energy transfer 211At alpha particles and higher than 131I beta minus particles. All the other 99mTc electrons had a therapeutic potential similar to 131I beta minus particles. 99mTc CKMMX electrons and Auger MXY presented a higher probability to induce apoptosis than 131I beta minus particles and a probability similar to 211At alpha particles. Based on the results here, 99mTc CKMMX electrons and Auger MXY are useful electrons for targeted tumor radiotherapy.

  17. Radiobromination of humanized anti-HER2 monoclonal antibody trastuzumab using N-succinimidyl 5-bromo-3-pyridinecarboxylate, a potential label for immunoPET

    Energy Technology Data Exchange (ETDEWEB)

    Mume, Eskender [Organic Chemistry, Department of Chemistry, Uppsala University, S-751 24 Uppsala (Sweden); Orlova, Anna [Affibody AB, S-161 02 Bromma (Sweden); Malmstroem, Per-Uno [Division of Urology, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Lundqvist, Hans [Unit of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala University, S-751 85 Uppsala (Sweden); Sjoeberg, Stefan [Organic Chemistry, Department of Chemistry, Uppsala University, S-751 24 Uppsala (Sweden); Tolmachev, Vladimir [Unit of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala University, S-751 85 Uppsala (Sweden)]. E-mail: vladimir.tolmachev@bms.uu.se

    2005-08-01

    Combining the specificity of radioimmunoscintigraphy and the high sensitivity of PET in an in vivo detection technique could improve the quality of nuclear diagnostics. Positron-emitting nuclide {sup 76}Br (T {sub 1/2}=16.2 h) might be a possible candidate for labeling monoclonal antibodies (mAbs) and their fragments, provided that the appropriate labeling chemistry has been established. For internalizing antibodies, such as the humanized anti-HER2 monoclonal antibody, trastuzumab, radiobromine label should be residualizing, i.e., ensuring that radiocatabolites are trapped intracellularly after the proteolytic degradation of antibody. This study evaluated the chemistry of indirect radiobromination of trastuzumab using N-succinimidyl 5-(tributylstannyl)-3-pyridinecarboxylate. Literature data indicated that the use of this method provided residualizing properties for iodine and astatine labels on some antibodies. An optimized 'one-pot' procedure produced an overall labeling efficiency of 45.5{+-}1.2% over 15 min. The bromine label was stable under physiological and denaturing conditions. The labeled trastuzumab retained its capacity to bind specifically to HER2-expressing SKOV-3 ovarian carcinoma cells in vitro (immunoreactivity more than 75%). However, in vitro cell test did not demonstrate that the radiobromination of trastuzumab using N-succinimidyl 5-bromo-3-pyridinecarboxylate improves cellular retention of radioactivity in comparison with the use of N-succinimidyl 4-bromobenzoate.

  18. Development and radiotherapeutic application of /sup 211/At-labeled radiopharmaceuticals. Progress report, March 1, 1981-February 28, 1982

    Energy Technology Data Exchange (ETDEWEB)

    Adelstein, S.J.; Zalutsky, M.; Bloomer, W.

    1981-01-01

    This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Alpha-emitters seem ideally suited for his application because their high linear energy transfer and short range permit the deposition of considerable energy in a very small volume of tissue. Unlike the beta particles of /sup 131/I which have a range of about 1 to 2 mm in tissue, 5 to 7 MeV alpha particles would traverse only a few cell diameters. Among the available alpha-emitters, /sup 211/At appears most promising for therapeutic applications because, (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides, (2) it has a half-life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells due to degradation of the label over time, (3) it can be produced conveniently using a cyclotron, and (4) alpha emission is associated with 100% of its decays with no accompanying beta emission. In the past year the evaluation of an astatine-tellurium colloid as an agent for the destruction of malignant ascites has been completed. The therapeutic efficacy of /sup 211/At-tellurium colloid has been compared with that of several beta-emitting radiocolloids. Studies on the application of monoclonal antibodies as carriers for selective delineation and destruction of malignant cell populations have also been initiated.

  19. Silver impregnated nanoparticles of titanium dioxide as carriers for {sup 211}At

    Energy Technology Data Exchange (ETDEWEB)

    Cedrowska, Edyta; Lyczko, Monika; Piotrowska, Agata; Bilewicz, Aleksander [Institute of Nuclear Chemistry and Technology, Warsaw (Poland); Stolarz, Anna; Trcinska, Agnieszka [Warsaw Univ. (Poland). Heavy Ion Lab.; Szkliniarz, Katarzyna [Silesia Univ. Katowice (Poland). Inst. of Physics; Was, Bogdan [Polish Academy of Science, Cracow (Poland). Inst. of Nuclear Physics

    2016-08-01

    The {sup 211}At radioisotope exhibits very attractive nuclear properties for application in radionuclide therapy. Unfortunately use of {sup 211}At is limited, because astatine as the heaviest halogen forms weak bond with carbon atoms in the biomolecules which makes {sup 211}At bioconjugates unstable in physiological conditions. In our work we propose a new solution for binding of {sup 211}At which consists of using nanoparticles of titanium dioxide modified with silver atoms as carriers for {sup 211}At. Ag{sup +} cations have been absorbed on the nanometer-sized TiO{sub 2} particles (15 and 32 nm) through ion exchange process and were reduced in Tollens' reaction. The obtained TiO{sub 2}-Ag nanoparticles were labeled with {sup 211}At. It was found that labeling yields were almost quantitative under reducing conditions, while under oxidizing conditions they dropped to about 80%. The labeled nanoparticles exhibited very high stability in physiological salt, PBS buffer, solutions of peptides (0.001 M cysteine, 0.001 M glutathione) and in human blood serum. To make TiO{sub 2}/Ag nanoparticles well dispersed in water and biocompatible their surface was modified with a silane coupling agent containing poly(ethyleneglycol) molecules. The developed functionalization approach will allow us to attach biomolecules to the TiO{sub 2}/Ag surface.

  20. Study of Neutron-Deficient $^{202-205}$Fr Isotopes with Collinear Resonance Ionization Spectroscopy

    CERN Document Server

    De Schepper, Stijn; Cocolios, Thomas; Budincevic, Ivan

    The scope of this master’s thesis is the study of neutron-deficient $^{202−205}$Fr isotopes. These isotopes are inside the neutron-deficient lead region, a region that has shown evidence of shape coexistence. For this thesis, this discussion is limited to the phenomenon where a low lying excited state has a different shape than the ground state. Shape coexistence is caused by intruder states. These are single-particle Shell Model states that are perturbed in energy due to the interaction with a deformed core. In the neutron-deficient lead region the main proton intruder orbit is the 3s$_{1/2}$orbit. When going towards more neutron-deficient isotopes, deformation increases. The $\\pi3s_{1/2}$orbit will rise in energy and will eventually become the ground state in odd- A bismuth (Z=83) isotopes. It is also observed in odd-A astatine (Z=85) isotopes, already in less neutron-deficient nuclei. The same phenomenon is expected to be present francium (Z=87) isotopes already at $^{199}$Fr. Although it is currently ...

  1. The Rhizobium etli rpoN Locus: DNA Sequence Analysis and Phenotypical Characterization of rpoN, ptsN, and ptsA Mutants

    OpenAIRE

    Michiels, Jan; Van Soom, Tom; D’hooghe, Inge; Dombrecht, Bruno; Benhassine, Traki; de Wilde, Petra; Vanderleyden, Jos

    1998-01-01

    The rpoN region of Rhizobium etli was isolated by using the Bradyrhizobium japonicum rpoN1 gene as a probe. Nucleotide sequence analysis of a 5,600-bp DNA fragment of this region revealed the presence of four complete open reading frames (ORFs), ORF258, rpoN, ORF191, and ptsN, coding for proteins of 258, 520, 191, and 154 amino acids, respectively. The gene product of ORF258 is homologous to members of the ATP-binding cassette-type permeases. ORF191 and ptsN are homologous to conserved ORFs f...

  2. Gclust Server: 19234 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 19234 TET_191.m00062 Cluster Sequences Related Sequences(374) 1221 ATPase, histidine kinase-, DNA gyrase...28 0.0 11.11 0.0 0.0 0.0 0.0 Show 19234 Cluster ID 19234 Sequence ID TET_191.m00062 Link to cluster sequences Cluster Se...quences Link to related sequences Related Sequences(374) Sequence length 1221 Represe...ntative annotation ATPase, histidine kinase-, DNA gyrase B-, and HSP90-like domain containin...g protein chr_0_8254167_191; no annotation Number of Sequences 5 Homologs 5 Clustering threshold 1.00e-28 Pl

  3. Doktoritöö eesti värvinimetustest / Lembit Vaba

    Index Scriptorium Estoniae

    Vaba, Lembit

    2001-01-01

    Rets.: Oja, Vilja. Linguistic studies of Estonian colour terminology. Tartu : Tartu University Press, 2001. 191, [1] lk. : ill. (Dissertationes philologiae estonicae Universitatis Tartuensis. 1406-1325 ; 9). ISBN 9985565827

  4. 76 FR 39069 - Foreign-Trade Zone 29-Louisville, KY; Application for Expansion

    Science.gov (United States)

    2011-07-05

    ... Park, on Highway 480, near Interstate 65, Shepherdsville, Bullitt County; Site 7 (191 acres... Zappos Blvd., Shepherdsville, Bullitt County; and, Site 13 (6 acres)--Custom Quality Services located at...

  5. 75 FR 71079 - Site Renumbering Notice; Foreign-Trade Zone 29-Louisville, KY

    Science.gov (United States)

    2010-11-22

    ..., Shepherdsville, Bullitt County; Site 7 (191 acres)--Henderson County Riverport Authority facilities, 6200...)--Salt River Business Park, 376 Zappos Blvd., Shepherdsville, Bullitt County ; and, Site 13 (6 acres...

  6. Gclust Server: 97342 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available Eco_b1711=btuC Cluster Sequences Related Sequences(191) 326 vitamin B12 transporter subunit: membrane component of...Sequence length 326 Representative annotation vitamin B12 transporter subunit: membrane component of

  7. The sixgill shark Hexanchus griseus is one of the most common ...

    African Journals Online (AJOL)

    denise

    2002-11-01

    . Baltimore; John Hopkins Press: 149–174. SPRINGER, S. and R. A. WALLER 1969 — Hexanchus vitulus, a new sixgill shark from the Bahamas. Bull. Mar. Sci. 19(1):. 159–174. Ebert: Reproductive Biology of Sixgill Sharks.

  8. Approaches for enhancement of N2 fixation efficiency of chickpea (Cicer arietinum L.) under limiting nitrogen conditions

    National Research Council Canada - National Science Library

    Nasr Esfahani, Maryam; Sulieman, Saad; Schulze, Joachim; Yamaguchi‐Shinozaki, Kazuko; Shinozaki, Kazuo; Tran, Lam‐Son

    2014-01-01

    ...‐15 strain manifested the most efficient N 2 fixation in comparison with Ch‐191 or CP ‐36. This finding was supported by higher plant productivity and expression levels of the nif HDK genes in C...

  9. Article 6 of the UNESCO Universal Declaration of Bioethics and ...

    African Journals Online (AJOL)

    s Universal Declaration on Bioethics and Human Rights (UDBHR) was accepted unanimously in 2005 by the world community, consisting of 191 member nations. This means that the declaration is currently the first and only bioethical text to ...

  10. Feasibility study for the redesign of MDOT's pavement management systems software.

    Science.gov (United States)

    2011-04-01

    In August of 2006 the Mississippi Department of Transportation (MDOT) initiated State Study No. 191, entitled Feasibility : Study for the Redesign of MDOTs Pavement Management System (PMS) Software. At the initiation of this study, the : Dep...

  11. The partner as source of social support in problem and non-problem situations

    NARCIS (Netherlands)

    de Jong-Gierveld, J.; van Tilburg, T.G.; Hojat, M.; Crandell, R.

    1989-01-01

    Reprinted from: De Jong Gierveld, J., & Van Tilburg, T.G. (1987). The partner as source of social support in problem and non-problem situations. Journal of Social Behavior and Personality, 2, 191-200.

  12. ORF Alignment: NC_002947 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available s ... putida KT2440] ... Length = 122 ... Query: 132 IELNSSLLFGSGDAMPSDKAFAIIEKVASILKPFANPVHVEGFT...DNLPIRTAQYPTNWEL 191 ... IELNSSLLFGSGDAMPSDKAFAIIEKVASILKPFANPVHVEGFTDNLPI...RTAQYPTNWEL Sbjct: 1 ... IELNSSLLFGSGDAMPSDKAFAIIEKVASILKPFANPVHVEGFTDNLPIRTAQYPTNWEL 60 ... Query: 252 SL 253 ... SL Sbjct: 121 SL 122

  13. Teresa Zweifel, Medir lo inconmensurable. Los cambios en los procedimientos para relevar la pampa anterior (1796-1895

    Directory of Open Access Journals (Sweden)

    Sandra Szir

    2015-09-01

    Full Text Available Reseña bibliográfica del libro de Teresa Zweifel, Medir lo inconmensurable. Los cambios en los procedimientos para relevar la pampa anterior (1796-1895, Rosario, Prohistoria Ediciones, 2014, 191 pp.

  14. Journal de la Recherche Scientifique de l'Université de Lomé - Vol ...

    African Journals Online (AJOL)

    un Cas · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. MA Soedje, DH Sama, A Bagny, B Kpassagou, EK Gumedezoe, S Salifou, L Sonhahe, M Kolou, M Belo, SK Dassa, 191-194 ...

  15. Browse Title Index

    African Journals Online (AJOL)

    Items 51 - 100 of 191 ... African Safety Promotion: A Journal of Injury and Violence Prevention. ... related child restraint seat injuries in British Columbia: 1997-2002, Abstract ... Vol 5, No 1 (2007), Costing national road accidents with partially ...

  16. Rethinking technologies

    National Research Council Canada - National Science Library

    Conley, Verena Andermatt

    1993-01-01

    .... Katherine Hayles 11. The Leap and the Lapse: Hacking a Private Site in Cyberspace Alberto Moreiras 12. Telefigures and Cyberspace Patrick Clancy 173 191 207 Works Cited 233 Contributors 241 Index 24...

  17. Field Plot Points for Voyageurs National Park Vegetation Mapping Project

    Data.gov (United States)

    National Park Service, Department of the Interior — A total of 191 vegetation field plot samples were collected at Voyageurs National Park and environs to support vegetation classification development. Teams of...

  18. Increased risks of cardiovascular diseases and insulin resistance among the Orang Asli in Peninsular Malaysia

    National Research Council Canada - National Science Library

    Tuan Azlin Tuan Abdul Aziz; Lay Kek Teh; Muhd Hanis Md Idris; Zakaria Bannur; Lydiatul Shima Ashari; Adzrool Idzwan Ismail; Aminuddin Ahmad; Kamarudzaman Md Isa; Fadzilah Mohd Nor; Thuhairah Hasrah Abdul Rahman; Syahrul Azlin Binti Shaari; Hamid Jan Jan Mohamed; Nornazliya Mohamad; Mohd Zaki Salleh

    2016-01-01

    ... measures to prevent further reduction in the numbers of the Orang Asli. Methods A total of 191 Orang Asli from different villages in Peninsular Malaysia and 115 healthy urban Malays were recruited...

  19. AcEST: DK949581 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ISLTP ++ WKW +T+ F K P + + Sbjct: 144 PLSLNFMHSAAPITAMGQV--VDQGISLTPAIEGEWKWATER...+ P+ A+ + V+ ISLTP ++ WKW +T+ F K P + + Sbjct: 132 PLSLNFMHSAAPITAMGQV--VDQGISLTPAIEGEWKWATERTLVFTPKKAWPMGANYQI 189 Query: 630 SV 635 ++ Sbjct: 190 TI 191 ...

  20. Explanation of plate 2

    NARCIS (Netherlands)

    Ritsema Cz., C.

    1893-01-01

    Fig. 1. Prosopocoelus Pasteuri Rits. ♂, from West-Java: Mt. Poentjak (Notes Leyden Museum, Vol. XIV (1892), p. 31). Fig. 2. Prosopocoelus tarsalis Rits. ♂, from Central-Java: Magelang (Notes Leyden Museum, Vol. XIV (1892), p. 191).

  1. African Zoology - Vol 47, No 1 (2012)

    African Journals Online (AJOL)

    Rediscovery of Boulengerula denhardti Nieden 1912 (Amphibia: Gymnophiona: Caeciliidae) in Meru County, Kenya · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. G. John Measey, Vincent Muchai, Stephen Spawls, 187-191 ...

  2. Abstract Introduction Our findings

    Indian Academy of Sciences (India)

    Avrion Mitchison

    2017-02-14

    AD). 0. 0. Becker muscular dystrophy. 0. 0. Chronic pancreatitis. 0. 19.1. Congenital cataract. 0. 13.8. Congenital hereditary endothelial dystrophy. 100. 57.1. Cystic fibrosis. 100. 34.4. Duchenne muscular dystrophy (all XLR). 0.

  3. Dicty_cDB: Contig-U12766-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available = 280/280 (100%) Strand = Plus / Plus Query: 11 tgatttngatccnaaaccnttnntttgnaaaactgntgctgntgnttcanttggngntgc... 70 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 11 tgatttngatccna...aancnanncaaggngntncnanggccccntcaaangccnatcc 190 ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||... Sbjct: 131 aggttntgnctactggaaancnanncaaggngntncnanggccccntcaaangccnatcc 190 Query: 191 cctttangaaancnatccntcnggnggngaaaanccna...tttntnctagccccnattancn 250 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sb

  4. Dicty_cDB: Contig-U14141-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available tities = 257/263 (97%) Strand = Plus / Plus Query: 11 aatccnaaacctggnccccaatattatccccnancnactttnccnntatttgaa...tccccn 70 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 11 aatccna...aacctggnccccaatattatccccnancnactttnccnntatttgaatccccn 70 Query: 71 aangnttttganaaatttganatnganaccntgn...| Sbjct: 131 anttatcnacaanatcnagcagntaaannattaaanaaacaaggntggagntntnataaa 190 Query: 191 aaanatntcncctggnttanaanacatgaagnaccna...aanaaatnccnaangaatttgaa 250 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| S

  5. Prehistoric dark soils/sediments of Central Sudan; case study from the Mesolithic landscape at the Sixth Nile Cataract

    Czech Academy of Sciences Publication Activity Database

    Lisá, Lenka; Bajer, A.; Pacina, J.; McCool, J-P.; Cílek, Václav; Rohovec, Jan; Matoušková, Šárka; Kallistová, Anna; Gottvald, Z.

    2017-01-01

    Roč. 149, č. 1 (2017), s. 273-282 ISSN 0341-8162 Institutional support: RVO:67985831 Keywords : climate change * micromorphology * sahel * saprolite * soil chemistry Subject RIV: DB - Geology ; Mineralogy Impact factor: 3.191, year: 2016

  6. Precision measurement: Sensing past the quantum limit

    Science.gov (United States)

    Baker, Christopher G.; Bowen, Warwick P.

    2017-07-01

    Quantum physics ultimately constrains how well sensors of position, speed and acceleration can perform. A hybrid quantum system that avoids these constraints could give rise to improved sensor technologies. See Letter p.191

  7. 78 FR 67386 - Announcement of Funding Awards; Indian Community Development Block Grant Program Fiscal Year 2013

    Science.gov (United States)

    2013-11-12

    ... ferry Chairperson, P.O. Box 1976, Havasu Lake boat marina and 92363, 760-858-4219. maintenance facility... Indians, 344,191 HR Installation of solar Judy Fink, Chairperson, P.O. Box 929, photovoltaic systems in 16...

  8. Guide to Camouflage for Developers. Volume 2

    Science.gov (United States)

    1989-09-01

    Test organism is growth aspergillus niger ; FTNS 191, Method 5750 Tear Strength 5 pounds Modified FTMS 191, Method 5134 Each property is tested initially...The reasoning process selects the next appropriate heuristic or algorithm for refining the current set of hypotheses concerning the optimal camouflage...needed. Results should provide preferred (even optimal ) bases for enhancing false target synthesis and detection, inducing identification/classification

  9. Gclust Server: 204442 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 204442 PFA_MAL7P1.91 Cluster Sequences - 2695 exported serine/threonine protein kinase 1 1.00e+00 0.0...0 11.11 0.0 0.0 0.0 0.0 Show 204442 Cluster ID 204442 Sequence ID PFA_MAL7P1.91 Link to cluster sequences

  10. Prospects of using the second-order perturbation theory of the MP2 type in the theory of electron scattering by polyatomic molecules

    Czech Academy of Sciences Publication Activity Database

    Čársky, Petr

    2015-01-01

    Roč. 191, č. 2015 (2015), s. 191-192 ISSN 1551-7616 R&D Projects: GA MŠk OC09079; GA MŠk(CZ) OC10046; GA ČR GA202/08/0631 Grant - others:COST(XE) CM0805; COST(XE) CM0601 Institutional support: RVO:61388955 Keywords : electron-scattering * calculation of cross sections * second-order perturbation theory Subject RIV: CF - Physical ; Theoretical Chemistry

  11. Treponema pallidum Strain Types and Association with Macrolide Resistance in Sydney, Australia: New TP0548 Gene Types Identified.

    Science.gov (United States)

    Read, Phillip; Tagg, Kaitlin A; Jeoffreys, Neisha; Guy, Rebecca J; Gilbert, Gwendolyn L; Donovan, Basil

    2016-08-01

    Strain typing of Treponema pallidum, using the three-target enhanced classification scheme, was performed with 191 samples obtained between 2004 and 2011 in Sydney, Australia. The most common strain type was 14d/g (92/191 samples [48%]). Two new TP0548 gene types were detected (m and n). Strain type was associated with macrolide resistance and possible acquisition outside Australia. Copyright © 2016, American Society for Microbiology. All Rights Reserved.

  12. Review: Donald Seekins: Burma and Japan since 1940. From ‘Co-Prosperity’ to ‘Quiet Dialogue’ (2008 Buchbesprechung: Donald Seekins: Burma and Japan since 1940. From ‘Co-Prosperity’ to ‘Quiet Dialogue’ (2008

    Directory of Open Access Journals (Sweden)

    Hans-Bernd Zöllner

    2009-04-01

    Full Text Available Review of the monograph: Donald Seekins: Burma and Japan since 1940. From ‘Co-Prosperity’ to ‘Quiet Dialogue’ Copenhagen: NIAS Press, 2008, ISBN 978 87 7694 017 1, 191 pages Besprechung der Monographie: Donald Seekins: Burma and Japan since 1940. From ‘Co-Prosperity’ to ‘Quiet Dialogue’ Kopenhagen: NIAS Press, 2008, ISBN 978 87 7694 017 1, 191 Seiten

  13. Genetic characterization of Chinese measles vaccines by analysis of complete genomic sequences.

    Science.gov (United States)

    Zhang, Yan; Zhou, Jianhui; Bellini, William J; Xu, Wenbo; Rota, Paul A

    2009-08-01

    The complete genomic sequences of two Chinese measles vaccine viruses, Shanghai-191 (S-191) and Changchun-47 (C-47), were determined and compared to the sequences of other measles vaccine strains as well as the prototype measles strain, Edmonston wild-type (Edwt). Compared to Edwt, S-191 and C-47 had 49 and 43 nucleotide changes, respectively. These differences were found at 52 nucleotide positions that were not found in other vaccine strains. Phylogenetic analysis of the all of the available genomic sequences for measles vaccines showed that S-191 and C-47 were most closely related to the Leningrad-4 strain. S-191 and C-47 shared conserved vaccine virus-specific amino acid changes in the phosphoprotein (P), V, C, matrix (M), and hemagglutinin (H) that could represent important targets for future studies aimed at understanding the molecular basis of attenuation. In addition, S-191 and C-47 had several unique amino acid changes including 13 positions that differed from Edwt. This is the first comparison of the complete genomic sequences of Chinese measles vaccines to the sequences of other vaccine strains. 2009 Wiley-Liss, Inc.

  14. Optimizing MIBG therapy of neuroendocrine tumors: preclinical evidence of dose maximization and synergy

    Energy Technology Data Exchange (ETDEWEB)

    Mairs, Rob J. [Department of Radiation Oncology, University of Glasgow, Glasgow (United Kingdom)], E-mail: r.mairs@beatson.gla.ac.uk; Boyd, Marie [Department of Radiation Oncology, University of Glasgow, Glasgow (United Kingdom)

    2008-08-15

    [{sup 131}I]meta-Iodobenzylguanidine ([{sup 131}I]MIBG) has been used for the therapy of tumors of neuroectodermal origin since the 1980s. Its role in the management of these malignancies remains controversial because of the large variation in response rates. Appreciation of the mode of conveyance of [{sup 131}I]MIBG via the noradrenaline transporter into malignant cells and of factors that influence the activity of the uptake mechanism has indicated various ways in which the effectiveness of this type of targeted radiotherapy may be improved. Experimental observations indicate that radiolabeling of MIBG to high specific activity reduced the amount of cold competitor, thereby increasing tumor dose and minimizing pressor effects. We observed supra-additive tumor cell kill and inhibition of tumor growth following combined topotecan and [{sup 131}I]MIBG treatment. The improved efficacy is related to topotecan's increased disruption of DNA repair. Radiation damage to targeted tumors may also be enhanced by the use of the {alpha}-particle emitter [{sup 211}At]astatine rather than {sup 131}I as radiolabel. Furthermore, recent experimental findings indicate that [{sup 123}I]MIBG may have therapeutic potential over and above its utility as an imaging agent. It has recently been demonstrated that potent cytotoxic bystander effects were induced by the intracellular concentration of [{sup 131}I]MIBG, [{sup 123}I]MIBG or meta-[{sup 211}At]astatobenzylguanidine. Identification of the nature of bystander factors could be exploited to maximize the specificity and potency of MIBG-targeted radiotherapy. By employing a range of strategies, there are good prospects for the improvement of the [{sup 131}I]MIBG therapy of neuroectodermal tumors.

  15. Immuno-vectorization of radioelements emitters of alpha particles: a new therapy in cancerology; Immunovectorisation de radioelements emetteurs de particules alpha: une nouvelle voie therapeutique en cancerologie

    Energy Technology Data Exchange (ETDEWEB)

    Bourgeois, M

    2007-05-15

    The radio-immunotherapy is an anti cancerous therapy which consists in vectorising with immuno-specific agents very radio toxic radioelements on tumors or in their environment to destroy them. The first part of this report presents the different characteristics of antibodies as well as their means of production under monoclonal shapes specifically steered against a tumoral antigen of interest. The second part of this report replaces the importance of the immunological vectors in the context of the nuclear medicine. It is notably described that the different methods which allow to radio-label the vector, as well as the different ways of optimization which were envisaged to improve the targeting of radioelements on a tumor. These different developments allow to define the potential place of the alpha radio-immunotherapy in treatments and so re-place the interest of the experimental part. If the radio-immunotherapy, using beta emitters isotopes as the {sup 131}iodine or the{sup 90}yttrium, is today current in anti cancerous therapy, it finds limits because of the disintegration characteristics of the isotopes it uses. Indeed, compared with alpha particles, the beta particles deposit less energy by unit of length in the crossed material.The experimental part of this report aims at studying the feasibility of the coupling between an immunological vector and an alpha emitter isotope.The different tests led on the bismuth 213, the bismuth 212, the lead 212 and the astatine 211 demonstrated that the fixation of these radionuclides was possible. This research theme is strengthened by the construction in Nantes of a cyclotron with high energy ( A.R.R.O.N.A.X.) and the optimization of the obtained promising results should allow a therapeutic use in oncology of the alpha radio-immunotherapy. (N.C.)

  16. Locoregional therapy with α-emitting trastuzumab against peritoneal metastasis of human epidermal growth factor receptor 2-positive gastric cancer in mice.

    Science.gov (United States)

    Li, Huizi Keiko; Morokoshi, Yukie; Nagatsu, Kotaro; Kamada, Tadashi; Hasegawa, Sumitaka

    2017-08-01

    Peritoneal metastasis of gastric cancer (PMGC) is incurable and thus has an extremely poor prognosis. We have found, however, that locoregionally administered trastuzumab armed with astatine-211 ((211) At-trastuzumab) is effective against human epidermal growth factor receptor 2 (HER2)-positive PMGC in a xenograft mouse model. We first observed that (211) At-trastuzumab can specifically bind and effectively kill NCI-N87 (N87) cells, which are HER2-positive human metastatic GC cells, both in vitro and in s.c. tumors. We established a PMGC mouse model using N87 xenografts stably expressing luciferase to test α-particle radioimmunotherapy with (211) At-trastuzumab against PMGC. Biodistribution analysis in this PMGC mouse model revealed that the i.p. administration of (211) At-trastuzumab (1 MBq) was a more efficient means of delivery of (211) At into metastatic tumors than i.v. injection; the maximum tumor uptake with i.p. administration was over 60% injected dose per gram of tissue (%ID/g) compared to approximately 18%ID/g with i.v. injection. Surprisingly, a single i.p. injection of (211) At-trastuzumab (1 MBq) was sufficient to completely eradicate intraperitoneally disseminated HER2-positive GC xenografts in two of six treated mice by inducing DNA double-strand breaks, and to drastically reduce the tumor burden in another three mice. No bodyweight loss, leukocytopenia, or significant biochemical changes in liver or kidney function were observed in the treatment group. Accordingly, locoregionally administered (211) At-trastuzumab significantly prolonged the survival time of HER2-positive PMGC mice compared with control treatments. Our results provide a proof-of-concept demonstration that locoregional therapy with (211) At-trastuzumab may offer a new treatment option for HER2-positive PMGC. © 2017 The Authors. Cancer Science published by John Wiley & Sons Australia, Ltd on behalf of Japanese Cancer Association.

  17. Interaction of Cupidin/Homer2 with two actin cytoskeletal regulators, Cdc42 small GTPase and Drebrin, in dendritic spines

    Directory of Open Access Journals (Sweden)

    Mori Nozomu

    2009-03-01

    Full Text Available Abstract Background Homer is a postsynaptic scaffold protein that links various synaptic signaling proteins, including the type I metabotropic glutamate receptor subunits 1α and 5, the inositol 1,4,5-trisphosphate receptor, Shank and Cdc42 small GTPase. Overexpression of Homer induces changes in dendritic spine morphology in cultured hippocampal neurons. However, the molecular basis underpinning Homer-mediated spine morphogenesis remains unclear. In this study, we aimed to elucidate the structural and functional properties of the interaction between Cupidin/Homer2 and two actin-cytoskeletal regulators, Cdc42 small GTPase and Drebrin. Results Cupidin/Homer2 interacted with activated Cdc42 small GTPase via the Cdc42-binding domain that resides around amino acid residues 191–283, within the C-terminal coiled-coil domain. We generated a Cupidin deletion mutant lacking amino acids 191–230 (CPDΔ191–230, which showed decrease Cdc42-binding ability but maintained self-multimerization ability. Cupidin suppressed Cdc42-induced filopodia-like protrusion formation in HeLa cells, whereas CPDΔ191–230 failed to do so. In cultured hippocampal neurons, Cupidin was targeted to dendritic spines, whereas CPDΔ191–230 was distributed in dendritic shafts as well as spines. Overexpression of CPDΔ191–230 decreased the number of synapses and reduced the amplitudes of miniature excitatory postsynaptic currents in hippocampal neurons. Cupidin interacted with a dendritic spine F-actin-binding protein, Drebrin, which possesses two Homer ligand motifs, via the N-terminal EVH-1 domain. CPDΔ191–230 overexpression decreased Drebrin clustering in the dendritic spines of hippocampal neurons. Conclusion These results indicate that Cupidin/Homer2 interacts with the dendritic spine actin regulators Cdc42 and Drebrin via its C-terminal and N-terminal domains, respectively, and that it may be involved in spine morphology and synaptic properties.

  18. Probing interaction of a fluorescent ligand with HIV TAR RNA

    Science.gov (United States)

    Qi, Liang; Zhang, Jing; He, Tian; Huo, Yuan; Zhang, Zhi-Qi

    2017-02-01

    Trans-activator of Transcription (Tat) antagonists could block the interaction between Tat protein and its target, trans-activation responsive region (TAR) RNA, to inhibit Tat function and prevent human immunodeficiency virus type 1 (HIV-1) replication. For the first time, a small fluorescence ligand, ICR 191, was found to interact with TAR RNA at the Tat binding site and compete with Tat. It was also observed that the fluorescence of ICR 191 could be quenched when binding to TAR RNA and recovered when discharged via competition with Tat peptide or a well-known Tat inhibitor, neomycin B. The binding parameters of ICR 191 to TAR RNA were determined through theoretical calculations. Mass spectrometry, circular dichroism and molecular docking were used to further confirm the interaction of ICR 191 with TAR RNA. Inspired by these discoveries, a primary fluorescence model for the discovery of Tat antagonists was built using ICR 191 as a fluorescence indicator and the feasibility of this model was evaluated. This ligand-RNA interaction could provide a new strategy for research aimed at discovering Tat antagonists.

  19. Performance of a single crystal digital gamma camera for first pass cardiac studies.

    Science.gov (United States)

    Dobbeleir, A; Franken, P R; Ham, H R; Brihaye, C; Guillaume, M; Knapp, F F; Vandevivere, J

    1991-01-01

    First pass radionuclide angiocardiography (FPRNA) has gained increasing interest because of the development of new 99Tcm-labelled perfusion agents and of new 191Os/191Irm generator systems. The aim of the study was to evaluate the performance capacities of a small field of view single crystal digital gamma camera for 99Tcm and 191Irm at high count rates. The camera dead time for 99Tcm (window 30%) was well corrected up to 300 kcps in fast acquisition mode using the relative decrease of a small shielded reference source. Using the decaying activity method for 191Irm the non-linearity response of the gamma camera was corrected by an 191Os reference soruce up to 210 kcps at 70 keV, 75 kcps at 129 keV and 320 kcps including both peaks. Saturation count rates were respectively 270 kcps, 150 kcps and 420 kcps and high count rate resolution (FWHM) 9.0, 7.3 and 10.3 mm. Since the accuracy of first pass measurements is more sensitive to count rate than to spatial resolution the 50-150 keV window was chosen for clinical studies. In data obtained from 32 ECG gated FPRNA patient studies, the whole field of view count rate during the left ventricular phase ranged from 100 to 250 kcps with 80 to 120 mCi (2960-4400 MBq) of 191Irm and 100 to 180 kcps with 20 to 25 mCi (750-925 MBq) of 99Tcm red blood cells permitting for both tracers accurate non-linearity correction.

  20. Air Force Operational Medicine: Using the Enterprise Estimating Supplies Program to Develop Materiel Solutions for the Medical Neurosurgical Team (FFNEU)

    Science.gov (United States)

    2010-11-18

    6515011562603 CLIP HEMOSTATIC SMALL 2.5MM LG OPEN 3MM CLOSED STEAM STER 36S 1 1 0.29 0.05 191.40 0.29 0.05 191.40 C 6515009310708 CLIP HEMOSTATIC TANTALUM...GELATIN SPONGE 6X2X.7CM PEEL -OPEN 12S 1 0 0.10 0.10 76.22 0.00 0.00 0.00 D 6510000802054 GELATIN SPONGE ABSORBABLE GELFOAM 1X3IN 6S 1 0 1.00 1.00

  1. Problems Related to Use of Some Terms in System Reliability Analysis

    Directory of Open Access Journals (Sweden)

    Nadezda Hanusova

    2004-01-01

    Full Text Available The paper deals with problems of using dependability terms, defined in actual standard STN IEC 50 (191: International electrotechnical dictionary, chap. 191: Dependability and quality of service (1993, in a technical systems dependability analysis. The goal of the paper is to find a relation between terms introduced in the mentioned standard and used in the technical systems dependability analysis and rules and practices used in a system analysis of the system theory. Description of a part of the system life cycle related to reliability is used as a starting point. The part of a system life cycle is described by the state diagram and reliability relevant therms are assigned.

  2. A randomized trial comparing balloon kyphoplasty and vertebroplasty for vertebral compression fractures due to osteoporosis.

    Science.gov (United States)

    Dohm, M; Black, C M; Dacre, A; Tillman, J B; Fueredi, G

    2014-12-01

    Several trials have compared vertebral augmentation with nonsurgical treatment for vertebral compression fractures. This trial compares the efficacy and safety of balloon kyphoplasty and vertebroplasty. Patients with osteoporosis with 1-3 acute fractures (T5-L5) were randomized and treated with kyphoplasty (n = 191) or vertebroplasty (n = 190) and were not blinded to the treatment assignment. Twelve- and 24-month subsequent radiographic fracture incidence was the primary end point. Due to low enrollment and early withdrawals, the study was terminated with 404/1234 (32.7%) patients enrolled. The average age of patients was 75.6 years (77.4% female). Mean procedure duration was longer for kyphoplasty (40.0 versus 31.8 minutes, P kyphoplasty (50/140 versus 57/131) had subsequent radiographic fracture, and there were 8.6% fewer at 24 months (54/110 versus 64/111). The results were not statistically significant (P > .21). When we used time to event for new clinical fractures, kyphoplasty approached statistical significance in longer fracture-free survival (Wilcoxon, P = .0596). Similar pain and function improvements were observed. CT demonstrated lower cement extravasation for kyphoplasty (157/214 versus 164/201 levels treated, P = .047). For kyphoplasty versus vertebroplasty, common adverse events within 30 postoperative days were procedural pain (12/191, 9/190), back pain (14/191, 28/190), and new vertebral fractures (9/191, 17/190); similar 2-year occurrence of device-related cement embolism (1/191, 1/190), procedural pain (3/191, 3/190), back pain (2/191, 3/190), and new vertebral fracture (2/191, 2/190) was observed. Kyphoplasty and vertebroplasty had similar long-term improvement in pain and disability with similar safety profiles and few device-related complications. Procedure duration was shorter with vertebroplasty. Kyphoplasty had fewer cement leakages and a trend toward longer fracture-free survival. © 2014 by American Journal of Neuroradiology.

  3. Dicty_cDB: CHG749 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ngth of query: 191 length of database: 80,480,566 effective HSP length: 17 effective... length of query: 174 effective length of database: 78,821,179 effective search space: 13714885146 effective...6986 Number of sequences better than 10.0: 0 length of query: 191 length of database: Z,915,520,312 effective HSP length: 22 effectiv...e length of query: 169 effective length of database: Z,063,426,916 effective... search space: 7108719148804 effective search space used: 7108719148804 T: 0 A: 0 X1: 6

  4. AcEST: BP914975 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TNQEDLLIL 191 >sp|Q8QPL1|HEMA_I00A0 Hemagglutinin OS=Influenza A virus (strain A/Duck/Hong Kong/2986.1/2000 ...ACPYQGKSSFFRNVVWLIEKNSTYPTIKRSYNNTNQEDLLVL 191 >tr|Q8JSY9|Q8JSY9_9INFA Hemagglutinin H5 OS=Influenza A virus (A/Duck...LIKKNNAYPTIKISYNNTNQEDLLVL 190 >tr|Q4FBA6|Q4FBA6_9INFA Hemagglutinin (Fragment) OS=Influenza A virus (A/Duck

  5. AcEST: BP917841 [AcEST

    Lifescience Database Archive (English)

    Full Text Available >sp|Q8QPL1|HEMA_I00A0 Hemagglutinin OS=Influenza A virus (strain A/Duck/Hong Kon...bjct: 148 SSACPYQGKSSFFRNVVWLIEKNSTYPTIKRSYNNTNQEDLLVL 191 >tr|Q8JSY9|Q8JSY9_9INFA Hemagglutinin H5 OS=Influenza A virus (A/Duck...(Fragment) OS=Influenza A virus (A/Duck/Hunan/191/05(H5N1)) GN=HA PE=3 SV=1 Length = 564 Score = 34.3 bits (

  6. Sensitive detection of nucleic acids by PNA hybridization directed co-localization of fluorescent beads

    DEFF Research Database (Denmark)

    Shiraishi, Takehiko; Deborggraeve, Stijn; Büscher, Philippe

    2011-01-01

    We have designed a pair of biotinylated peptide nucleic acid (PNA) probes targeting two sequences in 18S rRNA (from the parasite Trypanosoma brucei) at a distance of 191 nt (corresponding to maximum distance of ca. 60 nm) from each other. The PNA probes were individually bound to (strept)avidin-c......We have designed a pair of biotinylated peptide nucleic acid (PNA) probes targeting two sequences in 18S rRNA (from the parasite Trypanosoma brucei) at a distance of 191 nt (corresponding to maximum distance of ca. 60 nm) from each other. The PNA probes were individually bound to (strept...

  7. Targeting histone abnormality in triple negative breast cancer

    Science.gov (United States)

    2017-08-01

    antibody, and bound LSD1 was examined by IB using anti-LSD1 antibody. IB with anti-FLAG was used to detect the levels of FLAG- tagged HDAC5 full-length...HDAC5 cells were cultured for 7 months in medium containing 500 ng/ml ICR191. ICR191 generates genomic instability and genetic variability, and has...Reagents and cell culture conditions MDA-MB-231, MDA-MB-468, MCF-7, T47D, HCC-202 and SK-BR-3 cell lines were obtained from the ATCC/NCI Breast

  8. Mr. Ansar Shamsi, Member Finance, Mr. Malik Adalat Khan, Director Finance, Pakistan Atomic Energy Commission

    CERN Multimedia

    Patrice Loïez

    2003-01-01

    Photo 01: Mr Ansar Shamsi, Member Finance, Pakistan Atomic Energy Commission (centre), visiting the ATLAS Tile Calorimeter in building 191 with, from left to right, Mr Syed Shaukat Hussain, Pakistan Mission in Geneva and Dr Peter Jenni, ATLAS Spokesperson. Photo 02: Mr Ansar Shamsi, Member Finance, Pakistan Atomic Energy Commission (2nd form left), visiting the ATLAS Tile Calorimeter in building 191 with, from left to right, Mr Syed Shaukat Hussain, Pakistan Mission in Geneva; Dr Peter Jenni, ATLAS Spokesperson; Dr David Jacobs and Dr Philip Bryant, Joint Pakistan-CERN Committee.

  9. EST Table: FY019446 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FY019446 rbmov25c17 11/11/04 97 %/207 aa ref|NP_001040385.1| pelota-like protein [B...ombyx mori] gb|ABF51295.1| pelota-like protein [Bombyx mori] 11/11/04 75 %/191 aa FBpp0280251|DpseGA17805-PA...:AGAP008269 11/11/04 71 %/191 aa gnl|Amel|GB10750-PA 11/11/04 77 %/188 aa gi|91095145|ref|XP_967126.1| PREDICTED: similar to pelota [Tribolium castaneum] FS866549 bmov ...

  10. Quantitative Single-Particle Digital Autoradiography with α-Particle Emitters for Targeted Radionuclide Therapy using the iQID Camera

    Energy Technology Data Exchange (ETDEWEB)

    Miller, Brian W.; Frost, Sophia; Frayo, Shani; Kenoyer, Aimee L.; Santos, E. B.; Jones, Jon C.; Green, Damian J.; Hamlin, Donald K.; Wilbur, D. Scott; Fisher, Darrell R.; Orozco, Johnnie J.; Press, Oliver W.; Pagel, John M.; Sandmaier, B. M.

    2015-07-01

    Abstract Alpha emitting radionuclides exhibit a potential advantage for cancer treatments because they release large amounts of ionizing energy over a few cell diameters (50–80 μm) causing localized, irreparable double-strand DNA breaks that lead to cell death. Radioimmunotherapy (RIT) approaches using monoclonal antibodies labeled with alpha emitters may inactivate targeted cells with minimal radiation damage to surrounding tissues. For accurate dosimetry in alpha-RIT, tools are needed to visualize and quantify the radioactivity distribution and absorbed dose to targeted and non-targeted cells, especially for organs and tumors with heterogeneous radionuclide distributions. The aim of this study was to evaluate and characterize a novel single-particle digital autoradiography imager, iQID (ionizing-radiation Quantum Imaging Detector), for use in alpha-RIT experiments. Methods: The iQID camera is a scintillator-based radiation detection technology that images and identifies charged-particle and gamma-ray/X-ray emissions spatially and temporally on an event-by-event basis. It employs recent advances in CCD/CMOS cameras and computing hardware for real-time imaging and activity quantification of tissue sections, approaching cellular resolutions. In this work, we evaluated this system’s characteristics for alpha particle imaging including measurements of spatial resolution and background count rates at various detector configurations and quantification of activity distributions. The technique was assessed for quantitative imaging of astatine-211 (211At) activity distributions in cryosections of murine and canine tissue samples. Results: The highest spatial resolution was measured at ~20 μm full width at half maximum (FWHM) and the alpha particle background was measured at a rate of (2.6 ± 0.5) × 10–4 cpm/cm2 (40 mm diameter detector area). Simultaneous imaging of multiple tissue sections was performed using a large-area iQID configuration (ø 11.5 cm

  11. Quantitative single-particle digital autoradiography with α-particle emitters for targeted radionuclide therapy using the iQID camera

    Energy Technology Data Exchange (ETDEWEB)

    Miller, Brian W., E-mail: brian.miller@pnnl.gov [Pacific Northwest National Laboratory, Richland, Washington 99354 and College of Optical Sciences, The University of Arizona, Tucson, Arizona 85719 (United States); Frost, Sofia H. L.; Frayo, Shani L.; Kenoyer, Aimee L.; Santos, Erlinda; Jones, Jon C.; Orozco, Johnnie J. [Fred Hutchinson Cancer Research Center, Seattle, Washington 98109 (United States); Green, Damian J.; Press, Oliver W.; Pagel, John M.; Sandmaier, Brenda M. [Fred Hutchinson Cancer Research Center, Seattle, Washington 98109 and Department of Medicine, University of Washington, Seattle, Washington 98195 (United States); Hamlin, Donald K.; Wilbur, D. Scott [Department of Radiation Oncology, University of Washington, Seattle, Washington 98195 (United States); Fisher, Darrell R. [Dade Moeller Health Group, Richland, Washington 99354 (United States)

    2015-07-15

    Purpose: Alpha-emitting radionuclides exhibit a potential advantage for cancer treatments because they release large amounts of ionizing energy over a few cell diameters (50–80 μm), causing localized, irreparable double-strand DNA breaks that lead to cell death. Radioimmunotherapy (RIT) approaches using monoclonal antibodies labeled with α emitters may thus inactivate targeted cells with minimal radiation damage to surrounding tissues. Tools are needed to visualize and quantify the radioactivity distribution and absorbed doses to targeted and nontargeted cells for accurate dosimetry of all treatment regimens utilizing α particles, including RIT and others (e.g., Ra-223), especially for organs and tumors with heterogeneous radionuclide distributions. The aim of this study was to evaluate and characterize a novel single-particle digital autoradiography imager, the ionizing-radiation quantum imaging detector (iQID) camera, for use in α-RIT experiments. Methods: The iQID camera is a scintillator-based radiation detection system that images and identifies charged-particle and gamma-ray/x-ray emissions spatially and temporally on an event-by-event basis. It employs CCD-CMOS cameras and high-performance computing hardware for real-time imaging and activity quantification of tissue sections, approaching cellular resolutions. In this work, the authors evaluated its characteristics for α-particle imaging, including measurements of intrinsic detector spatial resolutions and background count rates at various detector configurations and quantification of activity distributions. The technique was assessed for quantitative imaging of astatine-211 ({sup 211}At) activity distributions in cryosections of murine and canine tissue samples. Results: The highest spatial resolution was measured at ∼20 μm full width at half maximum and the α-particle background was measured at a rate as low as (2.6 ± 0.5) × 10{sup −4} cpm/cm{sup 2} (40 mm diameter detector area

  12. α-Imaging Confirmed Efficient Targeting of CD₄₅-Positive Cells After ²¹¹At-Radioimmunotherapy for Hematopoietic Cell Transplantation

    Energy Technology Data Exchange (ETDEWEB)

    Frost, Sophia; Miller, Brian W.; Back, Tom; Santos, E. B.; Hamlin, Donald K.; Knoblaugh, E.; Frayo, Shani; Kenoyer, Aimee L.; Storb, Rainer; Press, O. W.; Wilbur, D. Scott; Pagel, John M.; Sandmaier, B. M.

    2015-09-03

    Alpha-radioimmunotherapy (α-RIT) targeting CD45 may substitute for total body irradiation in hematopoietic cell transplantation (HCT) preparative regimens for lymphoma. Our goal was to optimize the anti-CD45 monoclonal antibody (MAb; CA12.10C12) protein dose for astatine-²¹¹(²¹¹At)-RIT, extending the analysis to include intra-organ ²¹¹At activity distribution and α-imaging-based small-scale dosimetry, along with imunohistochemical staining. Methods: Eight normal dogs were injected with either 0.75 (n=5) or 1.00 mg/kg (n=3) of ²¹¹At-B10-CA12.10C12 (11.5–27.6 MBq/kg). Two were euthanized and necropsied 19–22 hours postinjection (p.i.), and six received autologous HCT three days after ²¹¹At-RIT, following lymph node and bone marrow biopsies at 2–4 and/or 19 hours p.i. Blood was sampled to study toxicity and clearance; CD45 targeting was evaluated by flow cytometry. ²¹¹At localization and small scale dosimetry were assessed using two α-imaging : α-camera and iQID. Results: Uptake of ²¹¹At was highest in spleen (0.31–0.61 %IA/g), lymph nodes (0.02–0.16 %IA/g), liver (0.11–0.12 %IA/g), and marrow (0.06–0.08 %IA/g). Lymphocytes in blood and marrow were efficiently targeted using either MAb dose. Lymph nodes remained unsaturated, but displayed targeted ²¹¹At localization in T lymphocyte-rich areas. Absorbed doses to blood, marrow, and lymph nodes were estimated at 3.9, 3.0, and 4.2 Gy/210 MBq, respectively. All transplanted dogs experienced transient hepatic toxicity. Liver enzyme levels were temporarily elevated in 5 of 6 dogs; 1 treated with 1.00 mg MAb/kg developed ascites and was euthanized 136 days after HCT. Conclusion: ²¹¹At-anti-CD45 RIT with 0.75 mg MAb/kg efficiently targeted blood and marrow without severe toxicity. Dosimetry calculations and observed radiation-induced effects indicated that sufficient ²¹¹At-B10-CA12.10C12 localization was achieved for efficient conditioning for HCT.

  13. The role of alpha therapy for local and systemic treatment of cancer

    Energy Technology Data Exchange (ETDEWEB)

    Allen, B.J. [St George Hospital, Kogarah, NSW (Australia)

    1998-03-01

    Major problems in the management of cancer relate to the inability to control some primary lesions, e.g. glioblastoma multiforme (GBM), and the inability to deal with metastatic cancer arising from malignant cancers such as melanoma, breast and other cancers. Binary alpha therapy using neutron capture in boron-10 offers the potential for improved prognosis for high grade brain tumours such as GBM and melanoma metastases to the brain. Metastatic cancer proceeds through a number of quite separate stages in the development of lethal disease, i e. cells in transit, preangiogenic lesions, subclinical and clinical lesions. Early stages offer the potential for control if targeted alpha therapy is applied. However, the dose must be localised to the cancer cell and this requirement rules out beta-emitting radionuclides, which are more suited for clinical lesions. Alpha-emitting radionuclides are the most appropriate toxins, as their efficacy depends on the linear energy transfer (LET) and range of the alpha particles. After matching the cancer stage, radiolabel and carrier, we find that {sup 149}Tb is the radionuclide of choice for systemic therapy in all aspects except production. The production of {sup 149}Tb in {mu}Ci (kBq) quantities has been achieved using the heavy ion reaction at the ANU tandem accelerator at Canberra and in multi-mCi (MBq) quantities using the spallation reaction in combination with on-line isotope separation technology of ISOLDE at CERN. Terbium is ideally suited for chelation to monoclonal antibodies to produce stable radio-immunoconjugates (RIC). Astatine-211 is a halide and has potential for the elimination of early stage melanoma metastases as At-MTB. However, the availability of the alpha generators {sup 228}Th-{sup 212}Bi and {sup 225}Ac-{sup 213}Bi facilitates the use of Bi-RIC in clinical trials for acute myeloid leukaemia and cystic glioma. Alpha therapy has the potential to control refractory cancers when treated at the minimum residual

  14. Systematics of Alpha-Radioactivity

    Energy Technology Data Exchange (ETDEWEB)

    Perlman, I.; Ghiorso, A.; Seaborg, G.T.

    1949-09-12

    Correlations of alpha-decay energies in terms of mass number and atomic number have been made for all of the alpha-emitting species now numbering over 100. For each element isotopes show increase in alpha-energy with decrease in mass number except in the region of 126 neutrons where there is an explainable reversal. This reversal has the effect of creating a region of relatively low alpha-energy and long half-life at low mass numbers for such elements as astatine, emanation, francium, and possibly higher elements as had been noted already for bismuth and polonium. Methods and examples of using alpha-decay data to define the energy surface in the heavy element region are discussed. The regularities in alpha-decay are used for predictions of nuclear properties including prediction of the beta-stable nuclides among the heavy elements. The half-life vs. energy correlations show that the even-even nuclides conform well with existing alpha-decay theory, but all nuclear types with odd nucleons show prohibited decay. The reason for this prohibition is not found in spin changes in the alpha-emission but in the assembly of the components of the alpha particle, and this theory is discussed further in terms of observations made on nuclides having two or more alpha-groups. Using most of the even-even nuclei to define 'normal nuclear radius' calculations are now able to show the shrinkage in the regions of lead and of 126 neutrons to amount to about 10%. The much greater change in 'effective radius' for bismuth isotopes can be dissociated into the effects of odd nucleons superimposed on the actual decrease in nuclear radius. The simple expression r = 1.48 A{sup 1/3} {center_dot} 10{sup -13} cm seems to fit the data for the even-even nuclei outside of the region of 126 neutrons better than more complex functions.

  15. Small-scale Magnetic Field Diagnostics outside Sunspots ...

    Indian Academy of Sciences (India)

    ... Ludmany, A., Mezo, Gy. 1999,. Proc. 9th Europ. Meeting on Solar Physics. Florence, Italy: ESA Sp-448, 853. Lozitsky, V. G., Baranovsky, E. A., Lozitska, N. I., Leiko, U. M. 2000, Solar Phys., 191, 171. Lozitsky, V. G., Lozitsky, V. V. 2002, Izv. Krimsk. Astrofiz. Obs., 98, 202. Lozitsky, V. G., Tsap, T. T. 1989, Kinematika i Fizika ...

  16. Domain Modeling: NP_597715.2 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_597715.2 chr16 CRYSTAL STRUCTURE OF A DESIGNED ZINC FINGER PROTEIN BOUND TO DNA c1meyf_ chr16/NP_597715....2/NP_597715.2_holo_181-277.pdb blast 181R,185C,187T,188L,189G,190S,191N,192L,194H,19

  17. ORF Alignment: NC_006834 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006834 gi|58583037 >1o08A 5 191 6 187 1e-21 ... ref|YP_202053.1| indigoidine synth...esis-like protein [Xanthomonas oryzae pv. oryzae ... KACC10331] gb|AAW76668.1| indigoidine synthesis-

  18. Author Details

    African Journals Online (AJOL)

    Bekker, J F. Vol 23, No 2 (2007) - Articles A procurement decision model for a video rental store — A case study. Abstract PDF. ISSN: 0529-191-X. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's Partners · Terms and Conditions of Use ...

  19. Does the Czech tax and benefit system contribute to one of Europe’s lowest levels of relative income poverty and inequality?

    Czech Academy of Sciences Publication Activity Database

    Janský, Petr; Kalíšková, Klára; Münich, Daniel

    2016-01-01

    Roč. 54, č. 3 (2016), s. 191-207 ISSN 0012-8775 R&D Projects: GA TA ČR(CZ) TD020188 Institutional support: RVO:67985998 Keywords : Czech Republic * expenditures * income Subject RIV: AH - Economics Impact factor: 0.288, year: 2016

  20. Hierarchy of Needs; Building a Path to Peace

    Science.gov (United States)

    2010-03-01

    observations of man’s cruelty and viciousness during multiple, devastating wars, yet still focuses on the healthy individual. Self interest, whether it is...8,27,31,35-36. 26 Ibid., 35-36, 191. 27 Ibid., 39-40. 23 28 Ibid., 244-245. 29Robert Wright, The Moral Animal ; The New Science of Evolutionary

  1. full development of pseudqpotentials that work for all elements

    African Journals Online (AJOL)

    Nigerian Journal of Physics, 19(1), (2007). FULL DEVELOPMENT OF PSEUDQPOTENTIALS THAT ..... Application in Solid State Physics (liquid metal resistivity). The electrical resistivity of liquid transition metals is ... obtaining any result for quantum numberEIP=§. 2. The problem has to do With obtaining a. negatiVe at the ...

  2. Governance challenges in Tanzania's environmental impact ...

    African Journals Online (AJOL)

    EJIRO

    Cap 191. This Act promotes Environmental Assessment, gives it the legal support and defines the institutional set up for the management of the environment. However, Tanzania still grapples with EIA ineffectiveness in guiding development decisions and environmental management arising from various projects. Numerous ...

  3. Foster Parents' Involvement in Authoritative Parenting and Interest in Future Parenting Training

    Science.gov (United States)

    King, Keith A.; Kraemer, Linda K.; Bernard, Amy L.; Vidourek, Rebecca A.

    2007-01-01

    We surveyed 191 Southwest Ohio foster parents regarding their involvement in authoritative parenting and interest for additional parenting education. Our results showed that most respondents reported using an authoritative parenting style and were interested in receiving future training. Involvement in authoritative parenting differed…

  4. Máme se vzdát dichotomického pohledu na „jazyk“?

    Czech Academy of Sciences Publication Activity Database

    Beneš, Martin

    2015-01-01

    Roč. 6, č. 2 (2015), s. 181-191 ISSN 1804-3240 Grant - others:Evropské sociální fondy(CZ) CZ.1.07/2.2.00/28.0076 Institutional support: RVO:68378092 Keywords : dichotomical approach to language * Itkonen * language norms * language rules * ontological socialism * physicalism Subject RIV: AI - Linguistics

  5. The Paracel Islands and U.S. Interests and Approaches in the South China Sea

    Science.gov (United States)

    2014-06-01

    recent bloody history and other confrontations described further in this text make the situation dangerous for both these countries and for outside...Disputes and Advisory Options” section pertaining to the Seabed Disputes 191 Chamber of the International Tribunal of the Law of the Sea. UN- CLOS, UN

  6. Download this PDF file

    African Journals Online (AJOL)

    User

    of prophetic vision” ('Morning Yet'191). What the majority of African literary ..... like a dream, billowing with dark fuming smoke which builds a mountain in the sky, thick and blocking the sun for .... distorted world-view, their lives and dreams have been smothered; they are truly not existing entities; they are only living in a sort ...

  7. Has Plan Colombia Ignored Neighboring Countries

    Science.gov (United States)

    2008-06-01

    Franklin Foer, “The Talented Mr. Chavez," Atlantic Monthly, May 2006, 14. 191 Sullivan and Olhero, 17. 192 Alice M. Chacon , “Venezuelan President...www.cato.org/pub_display.php?pub_id=3949, (accessed August 16, 2007). Chacon , Alice M. “Venezuelan President Says His Greatest Rival is George W. Bush

  8. prevalence of iron deficiency in children with cyanotic heart disease

    African Journals Online (AJOL)

    2009-12-01

    Dec 1, 2009 ... blood flow from right to left with the development of Eisenmenger's complex) keep the body in a state of constant ... Sample size calculation:The sample size was calculated using Fischer's method. .... 1979; 43:191-199. 3. Gaiha, M., Sethi, H. and Sudha, R. A clinico- hematological study of iron deficiency ...

  9. Cognition-Based and Affect-Based Trust as Mediators of Leader Behavior Influences on Team Performance

    Science.gov (United States)

    Schaubroeck, John; Lam, Simon S. K.; Peng, Ann Chunyan

    2011-01-01

    We develop a model in which cognitive and affective trust in the leader mediate the relationship between leader behavior and team psychological states that, in turn, drive team performance. The model is tested on a sample of 191 financial services teams in Hong Kong and the U.S. Servant leadership influenced team performance through affect-based…

  10. Dicty_cDB: Contig-U14965-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 00140 |pid:none) Parabacteroides distasonis ATCC... 191 9e-47 AB045875_1( AB045875 |pid:none) Kurthia sp. 53...66 2e-39 CP000454_1304( CP000454 |pid:none) Arthrobacter sp. FB24, complete... 166 2e-39 AB045873_5( AB045873 |pid:none) Kurt

  11. Confederate Staff Work At Chickamauga: An Analysis of the Staff of the Army of Tennessee.

    Science.gov (United States)

    1992-06-05

    schooling had by now moved from staff to line service. Lieut. Col. Robert Bogardus Snowden is an example. He had been a student of General Bushrod Johnson’s...action reports in the O.R., Volumes XXIII, XXX, and LII. Finally, the CSR, micro- film rolls 51, 101, 165, 191, 199, 211, and 223 confirmed the presence

  12. Development of Restricted and Repetitive Behaviors from 15 to 77 Months: Stability of Two Distinct Subtypes?

    Science.gov (United States)

    Uljarevic, Mirko; Arnott, Bronia; Carrington, Sarah J.; Meins, Elizabeth; Fernyhough, Charles; McConachie, Helen; Le Couteur, Ann; Leekam, Susan R.

    2017-01-01

    A community sample of 192 parents reported on their children's restricted and repetitive behaviors (RRBs) at mean ages 15 months (N = 138), 26 months (N = 191), and 77 months (N = 125) using the Repetitive Behavior Questionnaire-2 (RBQ-2). Consistent with previous factor analytic research, 2 factors were found at each age: 1 comprising repetitive…

  13. AcEST: BP911533 [AcEST

    Lifescience Database Archive (English)

    Full Text Available HUMAN cDNA FLJ35079 fis, clone PLACE6005283, hi... 33 7.1 tr|Q7ZZ40|Q7ZZ40_DANRE Novel protein similar to human autism...6 +P+V VS Sbjct: 191 VPKSPSVDKYNVS 203 >tr|Q7ZZ40|Q7ZZ40_DANRE Novel protein similar to human autism-related

  14. Applicability of structured telephone monitoring to follow up heart ...

    African Journals Online (AJOL)

    Pilly Chillo

    compared to other cardiovascular diseases, its incidence, prevalence as well as ... related to discharge planning, which emphasizes on medication review ... asked to note for development or worsening of lower limbs swelling, .... During the follow-up period, 25 (19.1%) patients were re-admitted back .... chronic heart failure.

  15. Proper depiction of monsoon depression through IRS-P4 MSMR

    Indian Academy of Sciences (India)

    R. Narasimhan (Krishtel eMaging) 1461 1996 Oct 15 13:05:22

    analyzed for the complete life cycle of monsoon depression. Geophysical parameters obtained through IRS-P4 .... plete life cycle of this depression have been brought out. 2. Data. IRS-P4 MSMR measurement at .... data products; Pacific Ocean Remote Sensing Conference. (PORSEC-2000) 182–191. Bhalme H N 1972 ...

  16. Gclust Server: 198795 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 198795 Cvi_CV0725 Cluster Sequences - 191 hypothetical protein 1 1.00e-99 0.0 0.0 0.0 0.0 3.23 0.0 Show 1987...95 Cluster ID 198795 Sequence ID Cvi_CV0725 Link to cluster sequences Cluster Seque

  17. Examining Social Perceptions between Arab and Jewish Children through Human Figure Drawings

    Science.gov (United States)

    Yedidia, Tova; Lipschitz-Elchawi, Rachel

    2012-01-01

    This study examined social perceptions among 191 Arab and Jewish children who live in mixed neighborhoods in Israel. Human Figure Drawing assessment was used to examine the children's social perceptions. The drawings that the Jewish Israeli children created portrayed Arabs as the enemy, whereas the Arab Israeli children expressed a more positive…

  18. Bioacoustic Signal Classification in Cat Auditory Cortex

    Science.gov (United States)

    1994-01-01

    Suga, 1965), vocalization specific Peurons in squirrel monkeys (Newman and Wollberg, 1973a), song selective neurons in birds (Langner et al., 1981...191-205., 1990. Heffner, H.E. and Heffner, R.S. Effect of restricted cortical lesions on absolute thresholds and aphasia -like deficits in Japanese

  19. Gravity anomalies, crustal structure and rift tectonics at the Konkan ...

    Indian Academy of Sciences (India)

    ern India; In: Studies in continental margin geology (eds). Watkins J S and Drake C L, Am. Assoc. Pet. Geol. Mem. 34 167–191. NGRI 1978 NGRI/GPH-1 to 5: Gravity Maps of India, scale 1:5,000,000; National Geophysical Research Insti- tute, Hyderabad, India. Norton I O and Sclater J G 1979 A model for the evolution of.

  20. An analysis of Malaysia road traffic death distribution by road ...

    Indian Academy of Sciences (India)

    Yusria Darma

    2017-07-14

    Jul 14, 2017 ... epidemic in Jamaica: implications for governance and public policy. Asian Soc. Sci. 4(10): 182–191. [6] Das A and Abdel-Aty M 2010 A genetic programming approach to explore the crash severity on multi-lane roads. Accident Anal. Prev. 42(2): 548–557. [7] Department of Statistics 2001–2012 Statistic ...

  1. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics; Volume 90; Issue 2. Issue front cover thumbnail. Volume 90, Issue 2. August 2011, pages 187-395. pp 187-190 Perspectives. The evolutionary landscape of antifolate resistance in Plasmodium falciparum · Marna S. Costanzo Daniel L. Hartl · More Details Fulltext PDF. pp 191-202 ...

  2. References:

    African Journals Online (AJOL)

    Lwanda, J. Scotland, Malawi and Medicine: Livingstone's Legacy,. I Presume? An Historical Perspective. Scottish Medical Journal 2007,. 52 (3), 36 – 44. 7. Muula, A. 'Successes and challenges of Malawi's only medical school'. Croat Med J. 2009 April; 50(2): 189–191. 8. Malawi Government. Statement of Development ...

  3. Author Details

    African Journals Online (AJOL)

    Kroon, S. Vol 33, No 1 (2017) - Articles New reinforcement learning algorithm for robot soccer. Abstract. ISSN: 0529-191-X. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's Partners · Terms and Conditions of Use · Contact AJOL · News.

  4. Author Details

    African Journals Online (AJOL)

    Bekker, J. Vol 28, No 2 (2012) - Articles Multi-objective optimisation with stochastic discrete-event simulation in retail banking: A case study. Abstract PDF · Vol 33, No 1 (2017) - Articles New reinforcement learning algorithm for robot soccer. Abstract. ISSN: 0529-191-X. AJOL African Journals Online. HOW TO USE AJOL.

  5. Indexes to Volume 76

    Indian Academy of Sciences (India)

    X-ray spectrometry for preventive conservation of cultural heritage. René Van Grieken and Anna Worobiec. 191–200. Total reflection X-ray fluorescence and energy-dispersive X-ray fluorescence characterizations of nuclear materials. N L Misra. 201–212. New applications of the good old wavelength-dispersive X-ray ...

  6. Motivational Orientation and Burnout among Undergraduate College Students

    Science.gov (United States)

    Pisarik, Christopher T.

    2009-01-01

    This study examined the relationships among motivational orientations based on self-determination theory (Ryan & Deci, 2000b) and burnout among undergraduate college students. A sample of 191 university students was administered the "Academic Motivation Scale" (Vallerand et al., 1992) and the "Maslach Burnout Inventory-Student…

  7. AcEST: BP913884 [AcEST

    Lifescience Database Archive (English)

    Full Text Available oprotein N-acyltransferase OS=Neisseri... 33 0.61 sp|Q91610|DHH1_XENLA Desert hedgehog protein 1 OS=Xenopus ...VQTN 460 +HM+TL+ + WL++ N Sbjct: 168 LGGIHMVTLATAFLGVWLVLASNN 191 >sp|Q91610|DHH1_XENLA Desert

  8. Interpersonal Relationships and Emotional Distress in Adolescence

    Science.gov (United States)

    Kenny, Rachel; Dooley, Barbara; Fitzgerald, Amanda

    2013-01-01

    The aim of this study was to examine positive and negative qualities in adolescents' interpersonal relationships and their relative importance in predicting emotional distress. Participants were 260 students from three schools in the Dublin area (119 girls; 141 boys), aged 12-18 years (M = 15.32, SD = 1.91). Students completed questionnaires…

  9. Which Way Did the Bicycle Go?...and Other Intriguing Mathematical Mysteries. Dolciani Mathematical Expositions Series of the Mathematical Association of America, No. 18.

    Science.gov (United States)

    Konhauser, Joseph D. E.; And Others

    This book provides a collection of 191 mathematical problems aimed at the advanced high school student level and above. Problems cover general mathematical areas including plane geometry, three-dimensional geometry, number theory, algebra, combinatorics and graph theory, and a number of miscellaneous questions that combine mathematical…

  10. The Genus Ixodes (Acari: Ixodidae) in Mexico: Adult Identification Keys, Diagnoses, Hosts, and Distribution (El genero Ixodes (Acari: Ixodidae) en Mexico: claves de identificacion para adultos, diagnosis, huespedes y distribucion)

    Science.gov (United States)

    2010-01-01

    Distribution in Mexico. Puebla . Hosts in Mexico. Heteromyidae (Mammalia). Ixodes guatemalensis Kohls, 1956 Ixodes guatemalensis Kohls, 1956: 636...de Historia Natural 23:191-307. Hoffmann, A. 1969. Un caso de parálisis por picadura de garrapata. Revista Latinoamericana de Microbiología y

  11. The Genus Ixodes (Acari: Ixodidae) in Mexico: Adult Identification Keys, Diagnoses, Hosts, and Distribution

    Science.gov (United States)

    2010-01-01

    spur; coxa II with a small internal spur; all coxae with moderate external spurs. Distribution in Mexico. Puebla . Hosts in Mexico. Heteromyidae...1962. Monografía de los Ixodoidea de México. I Parte. Revista de la Sociedad Mexicana de Historia Natural 23:191-307. Hoffmann, A. 1969. Un caso de

  12. Gclust Server: 195720 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 195720 Caur_c60_g1864 Cluster Sequences - 191 no annotation 1 1.00e-99 0.0 0.0 0.0 ...6.67 0.0 0.0 Show 195720 Cluster ID 195720 Sequence ID Caur_c60_g1864 Link to cluster sequences Cluster Sequ

  13. DOD Ammunition and Explosives Safety Standards

    Science.gov (United States)

    2008-02-29

    following: bulk lead azide, lead styphnate, mercury fulminate , tetracene, dry cyclotrimethylenetrinitramine (RDX) (also known as cyclonite, hexogen, or...primary explosives are lead azide and mercury fulminate . AP1.191. Primary fragment. A fragment from material in intimate contact with reacting AE

  14. Associations between Sadness and Anger Regulation Coping, Emotional Expression, and Physical and Relational Aggression among Urban Adolescents

    Science.gov (United States)

    Sullivan, Terri N.; Helms, Sarah W.; Kliewer, Wendy; Goodman, Kimberly L.

    2010-01-01

    This study examined associations between self-reports of sadness and anger regulation coping, reluctance to express emotion, and physical and relational aggression between two cohorts of predominantly African-American fifth (N = 191; 93 boys and 98 girls) and eighth (N = 167; 73 boys and 94 girls) graders. Multiple regression analyses indicated…

  15. EST Table: DC553775 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available milar to Sorting and assembly machinery component 50 homolog (S. cerevisiae) [Nasonia vitripennis] 10/09/02 .../10 52 %/191 aa gi|189238341|ref|XP_966817.2| PREDICTED: similar to sorting and assembly machinery component 50 homolog [Tribolium castaneum] FS904485 wd-- ...

  16. Toestande in die Unie van Suid-Afrika op die vooraand van die ...

    African Journals Online (AJOL)

    31; Judd, D.,Balfour and the British Empire,p 191. 11. UG 42-16, Judicial Commission of Inquiry into the Causes and. Circumstances of the recent Rebellion in South Africa. Minutes of. Evidence, p 73. 12. Hankey, M" TheSupreme Command 1914-1918, pp 168-169; Guinn. P., British Strategy and Polilics 1914-1918, p 41; ...

  17. Local Marine Geoid Variations and Jason-2 Bias Determination using the Gavdos Permanent Cal/Val Facility

    DEFF Research Database (Denmark)

    Mertikas, S. P.; Daskalakis, A.; Tziavos, I. N.

    2012-01-01

    , but others are related to under-sampling of the Earth's gravity field due to the resolution of the geoid model. New reference surfaces for calibration have thus emerged. Finally, new updated values for the Jason-2 altimeter bias have been determined as 191.81 ± 2.80 mm with the geoid model and as 181.51 ± 2...

  18. Juhatuse liikme vastu esitatavate nõuete aegumise erandlik viieaastane tähtaeg: kas õigustatud anomaalia või põhjendamatu kõrvalekalle? / Kärt Pormeister

    Index Scriptorium Estoniae

    Pormeister, Kärt, 1990-

    2013-01-01

    8. mai 2013. aasta Riigikohtu lahendist 3-2-1-191-12, milles kohus otsustas tsiviilõiguslike nõuete aegumise osas üheselt, et äriühingu poolt tema juhatuse liikme vastu esitatavale kahju hüvitamise nõudele kohaldub üksnes viieaastane aegumistähtaeg

  19. Journal of the Cameroon Academy of Sciences - Vol 7, No 3 (2008)

    African Journals Online (AJOL)

    The geological control and triggering mechanisms of landslides of 20th July of 2003 within the Bamboutos Caldera, Cameroon · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. SN Ayonghe, EB Ntasin, 191-204 ...

  20. Oil Politics and its Social Implications in the Niger Delta: A Study of ...

    African Journals Online (AJOL)

    info

    An International Multi-disciplinary Journal, Ethiopia. Vol. 10(3), Serial No.42, June, 2016: 183-191 ... Yet Shell swears it loves the Delta. SHELL SWEARS. Shell swears its strong love, its killer-love ... other due to it callous, mindless modus operandi and capitalist tendency. The killing of the 'Ogoni Nine' and other killings on ...

  1. Prevalence of malaria and patients in Ethiope E alence of malaria ...

    African Journals Online (AJOL)

    McRoy

    2014-12-31

    Dec 31, 2014 ... Malaria and human blood factors. Int J Med Biomed Res 2014;3(3):191-201. 192. Human malaria is commonly caused by five plasmodiumspecies: Plasmodium vivax, P. malariae, P. falciparum, P. ovale and P. knowlesi each with their geographical location and varied incubation periods (IP), from infection ...

  2. Genetics of leaf and stripe rust resistance in a bread wheat cultivar ...

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics; Volume 87; Issue 2. Genetics of leaf and stripe rust resistance in a bread wheat cultivar Tonichi. Satinder Kaur U. K. Bansal Renu Khanna R. G. Saini. Research Note Volume 87 Issue 2 August 2008 pp 191-194 ...

  3. Prevalence of Cataract Blindness in Rural Ethiopia

    African Journals Online (AJOL)

    Bernt Lindtjørn

    Salud Pública 2005;17:387–93. 11. Nano ME, Nano HD, Mugica JM, Silva JC, Montaρa. G, Limburg H. Rapid assessment of visual impairment because of cataract and cataract surgical services in urban Argentina. Ophthalmic Epidemiol. 2006; 13:191-7. 12. Limburg H, Foster A, Gilbert C, G J Johnson1, M. Kyndt , M Myatt.

  4. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. A K ghosh. Articles written in Sadhana. Volume 25 Issue 2 April 2000 pp 181-191. Parameter estimation of an aeroelastic aircraft using neural networks · S C Raisinghani A K Ghosh · More Details Abstract Fulltext PDF. Application of neural networks to the problem of aerodynamic modelling and ...

  5. (Lycopersicon esculentum Mill.) resistance to Botrytis cinerea

    African Journals Online (AJOL)

    AJL

    2012-05-08

    May 8, 2012 ... in tomato inoculated with Pseudomonas syringae pv. tomato. DC3000. Mol. Plant Microbe Interact. 20: 955-965. Van Loon LC, Geraats BPJ, Linhorst HJM (2006). Ethylene as a modulator of disease resistance in plants. Trends Plant Sci. 11: 184-. 191. Verberne MC, Verpoorte R, Bol JF, Mercado-Blanco J, ...

  6. Snail abundance in freshwater canals in the eastern province of ...

    African Journals Online (AJOL)

    Ksu-network

    2012-07-19

    Jul 19, 2012 ... succincta historia. Volumen alterum. pp. I-XXVI [= 1-36], 1-214, [1-. 10]. Havniæ & Lipsiæ. (Heineck & Faber). page 191. Opisa S, Odiere MR, Jura WGZO, Karanja DMS, Mwinzi PNM (2011). Malacological survey and geographical distributionof vector snails for schistosomiasis within informal settlements of ...

  7. Afrikaner spirituality: A complex mixture

    African Journals Online (AJOL)

    UPuser

    and they work without stopping, like bees in a cove. The Churches are big, simple, and used only for religious purposes. Everybody respects the members ...... Covenant, calling and democracy: The foundations of Paul. Kruger's political theology. Studia Historiae Ecclesiasticae XXX(2), 134-191. Rompel-Koopman, L 1916.

  8. Evaluation of the concomitant use of two different EIA tests for HIV screening in blood banks

    National Research Council Canada - National Science Library

    Otani, Marcia M; Salles, Nanci A; Barreto, Angela M.E; Barreto, Claudia C; Chamone, Dalton F; Sabino, Ester C

    2003-01-01

    ...: We analyzed data from 1999 through 2001 obtained by testing 698 191 units of donated blood using two EIA HIV screening tests concomitantly at the Pro-Blood Foundation/Blood Center of São Paulo (Fundação Pró...

  9. Evaluation of the concomitant use of two different EIA tests for HIV screening in blood banks

    National Research Council Canada - National Science Library

    Otani, Marcia M; Salles, Nanci A; Barreto, Angela M E; Barreto, Claudia C; Chamone, Dalton F; Sabino, Ester C

    2003-01-01

    .... We analyzed data from 1999 through 2001 obtained by testing 698 191 units of donated blood using two EIA HIV screening tests concomitantly at the Pro-Blood Foundation/Blood Center of São Paulo (Fundação Pró...

  10. The Development, Validation and Use of the Rural and Remote Teaching, Working, Living and Learning Environment Survey (RRTWLLES)

    Science.gov (United States)

    Dorman, Jeffrey; Kennedy, Joy; Young, Janelle

    2015-01-01

    Research in rural and remote schools and communities of Queensland resulted in the development and validation of the Rural and Remote Teaching, Working, Living and Learning Environment Survey (RRTWLLES). Samples of 252 teachers and 191 community members were used to validate the structure of this questionnaire. It was developed within the standard…

  11. Author Details

    African Journals Online (AJOL)

    Yadavalli, VSM. Vol 26, No 2 (2010) - Articles Modelling T4 cell count as a marker of HIV progression in the absence of any defense mechanism. Abstract PDF. ISSN: 0529-191-X. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's Partners ...

  12. A Need to Know: The Role of Air Force Reconnaissance in War Planning, 1945 - 1953

    Science.gov (United States)

    1991-01-01

    added to the shock of the Soviet atomic bomb. Although the Truman Administration eventually realized the inept , corrupt nature of Chiang Kai-shek’s...electromagnetic spectrum to which it is tuned. (JCS Pub 1, pp. 190-191) Need to Know -- A criterion used in security procedures that requires the custodians

  13. Supplement to J. Genet. 84, 217–222 (2005), V. Rodrigues ...

    Indian Academy of Sciences (India)

    rdt

    191,. 93-95. (1967). 9. CAMPOS-ORTEGA, J.A., V. NEUHOFF and P. GLEES. Ultrastructural analysis of individual layers in the lateral geniculate body of the monkey. Z. Zellforsch. 87, 82-100. (1968). 10. CAMPOS-ORTEGA, J.A., P. GLEES and M. BLANK. Die absteigenden Verbindungen der Sehrinde des Halbaffen Galago.

  14. A mammalian H+ channel generated through alternative splicing of the NADPH oxidase homolog NOH-1

    NARCIS (Netherlands)

    Bánfi, B; Maturana, A; Jaconi, S; Arnaudeau, S; Laforge, T; Sinha, B; Ligeti, E; Demaurex, N; Krause, K H

    2000-01-01

    Voltage-gated proton (H+) channels are found in many human and animal tissues and play an important role in cellular defense against acidic stress. However, a molecular identification of these unique ion conductances has so far not been achieved. A 191-amino acid protein is described that, upon

  15. Comparison of USDA Forest Service and stakeholder motivations and experiences in collaborative federal forest governance in the Western United States

    Science.gov (United States)

    Emily Jane Davis; Eric M. White; Lee K. Cerveny; David Seesholtz; Meagan L. Nuss; Donald R. Ulrich

    2017-01-01

    In the United States, over 191 million acres of land is managed by the United States Department of Agriculture Forest Service, a federal government agency. In several western U.S. states, organized collaborative groups have become a de facto governance approach to providing sustained input on management decisions on much public land. This is most extensive in Oregon,...

  16. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences. Shashi Wadhwa. Articles written in Journal of Biosciences. Volume 26 Issue 2 June 2001 pp 179-191 Articles. Differential expression of syntaxin-1 and synaptophysin in the developing and adult human retina · T C Nag Shashi Wadhwa · More Details Abstract Fulltext PDF.

  17. Introducing Products to DoD Using Specifications and Standards

    Science.gov (United States)

    2011-08-18

    1 .... oil~- ., ... _.~ ....... p~..., .. (D!P, • .J how .......... .,.._.,.,.,,._~ eel* toci =J--...IH<. o,r...eel* toci =J--...IH<. o,r., .,,...,;. ,_,,.,..., "’"• ~ ,...._,"~oc ... tw. ... .., ..... , .. ~ . .:;e frNw fni’ II. ,.. 191W󈧄 I!IIBC’PO

  18. Epitrochoid Power-law Nozzle Concept for Reducing Launch Architecture Propulsion Costs

    Science.gov (United States)

    2010-11-16

    Merlin 1 C vacuum engine c. Energia booster RD-170-7Zenit RO-171-7Atlas V RD-180-7Angara RO-191 4. Develop a new propulsion system to incorporate...the four liquid boosters of the Energia launch vehicle designed to launch the Soviet Buran space shuttle. In parallel with the Buran development, a

  19. The Peer Relations of Dropouts: A Comparative Study of At-Risk and Not At-Risk Youths.

    Science.gov (United States)

    Ellenbogen, Stephen; Chamberland, Claire

    1997-01-01

    Compared the characteristics of friends, the environments of the friendship network, and the nature of peer relations of students (N=191) at-risk and not at risk of leaving high school. Results indicate that at risk students had more dropout friends, more working friends, fewer school friends, and fewer same-sex friends. (RJM)

  20. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. S C Raisinghani. Articles written in Sadhana. Volume 25 Issue 2 April 2000 pp 181-191. Parameter estimation of an aeroelastic aircraft using neural networks · S C Raisinghani A K Ghosh · More Details Abstract Fulltext PDF. Application of neural networks to the problem of aerodynamic modelling ...

  1. Cloning and sequence analysis of putative type II fatty acid synthase ...

    Indian Academy of Sciences (India)

    Prakash

    Peanut (A. hypogaea cultivar luhua-14) was grown in the farm and gynophores were labelled. The immature ..... Planta 191 102–111. Lai C Y and Cronan J E 2003 β-ketoacyl-acyl carrier protein synthase III (FabH) is essential for bacterial fatty acid synthesis;. J. Biol. Chem. 278 51494–51503. Lamppa G and Jacks C 1991 ...

  2. A Narrative Approach to Ethnic Identity in Emerging Adulthood: Bringing Life to the Identity Status Model

    Science.gov (United States)

    Syed, Moin; Azmitia, Margarita

    2008-01-01

    This study used a narrative approach to understand how emerging adults experience ethnicity in their everyday lives and to link ethnic identity processes with the content of how ethnic identity is experienced. Participants were 191 ethnically diverse emerging adults who completed the Multigroup Ethnic Identity Measure (MEIM) and provided a written…

  3. Evaluating Voltage Regulation Compliance of MIL-PRF-GCS600A (Army) for Vehicle On-Board Generators and Assessing Overall Vehicle Bus Compliance

    Science.gov (United States)

    2012-08-16

    Characterization • Back EMF Measurement and Characterization • Rotor Inertia • Spinning Losses (Iron Loss, Friction, Windage) – Spin Down Test...Speed (rpm) UNCLASSIFIED UNCLASSIFIED Electrical and Mechanical Response Estimation 16 August 2012 1.87 1.88 1.89 1.9 1.91 1.92 1.93 1.94 1.95

  4. Predictors of Treatment Response to Fluoxetine in PTSD Following a Recent History of War Zone Stress Exposure

    Science.gov (United States)

    2013-07-01

    traumatic memories, or dissociating the emotional response from the traumatic memory. 49 The N-methyl-D-aspartate (NMDA) glutamate receptors play a...gender, race, ethnicity and age appear to have minimal if any effects on antidepressant response. 165 However, living with a significant other...peroxidation, 192 improving mitochondrial function, 191 blocking excitotoxic effects of glutamate and other excitatory amino acid neurotransmitters

  5. New Fellows and Honorary Fellow

    Indian Academy of Sciences (India)

    .D. (Toronto), FNA, FNASc. Date of birth: 19 September 1927. Date of death: 6 April 2002. Specialization: Biochemistry, Microbiology and Toxicology Last known address: 42, Palmcrest Co-op. Hsg. Soc. Ltd, 191/192, St. Paul Road, Bandra ...

  6. Examination of Stress-Coping Methods of Primary School Teachers in Terms of Different Variables

    Science.gov (United States)

    Bayraktar, Hatice Vatansever; Yilmaz, Kamile Özge

    2016-01-01

    This research is a study that aims to reveal whether there is a significant difference between primary school teachers' stress-coping methods and their demographic features, and if any, whether it is negative or positive. The study consists of 191 primary school teachers working in 14 primary schools in seven geographical regions. The…

  7. Author Details

    African Journals Online (AJOL)

    Venter, L. Vol 32, No 2 (2016) - Articles On the solution of petrochemical blending problems with classical metaheuristics. Abstract. ISSN: 0529-191-X. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's Partners · Terms and Conditions of Use ...

  8. Author Details

    African Journals Online (AJOL)

    Matthews, J. Vol 29, No 1 (2013) - Articles Metaheuristic approaches to order sequencing on a unidirectional picking line. Abstract PDF · Vol 31, No 2 (2015) - Articles SKU assignment to unidirectional picking lines using correlations. Abstract PDF. ISSN: 0529-191-X. AJOL African Journals Online. HOW TO USE AJOL.

  9. Author Details

    African Journals Online (AJOL)

    de Villiers, AP. Vol 29, No 1 (2013) - Articles Metaheuristic approaches to order sequencing on a unidirectional picking line. Abstract PDF. ISSN: 0529-191-X. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's Partners · Terms and Conditions ...

  10. An Annotated Bibliography of United States Air Force Engineering Anthropometry - 1946 to 1988

    Science.gov (United States)

    1988-05-01

    Dimensions Churchill, E. A. Kuby & G.S. Daniels Abstract: The design of equipment which must fit closely a part of the user’s body calls for a...Krogman, W. M. Kroh, G. Kuby , A. 184 60, 69, 74, 84, 92, 102, 123, 124, 126, 128, 134, 143, 154, 155, 191, 210, 212 151, 152, 164, 198, 199

  11. 76 FR 78330 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2011-12-16

    ... following methods: Government-wide rulemaking web site: Go to http://www.regulations.gov and follow the instructions for sending your comments electronically. Mail: Send comments to the Docket Management Facility; U... Technology and Education Center, Inc. (ITEC). Section of 14 CFR Affected: 14 CFR part 21, Sec. 21.191(i...

  12. Knowledge, attitude and practice of the trainee seafarers to HIV ...

    African Journals Online (AJOL)

    Seventy one (75.5%) of the respondents were between ages 21-25 years. Twenty three (25%) did not believe that having sex with commercial sex workers puts them at high risk of HIV while eighteen (19.1%) did not believe that condoms were protective. Only ten (10.6%) practiced abstinence while three were homosexual.

  13. Commentary: Analysing phenotypic variation: when old-fashioned ...

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences; Volume 27; Issue 3. Commentary: Analysing phenotypic variation: when old-fashioned means up-to-date. Vincent Debat Jean R David. Volume 27 Issue 3 June 2002 pp 191-193. Fulltext. Click here to view fulltext PDF. Permanent link:

  14. Isolation of a human lymphoblastoid line heterozygous at the thymidine kinase locus: possibility for a rapid human cell mutation assay

    Energy Technology Data Exchange (ETDEWEB)

    Skopek, T.R.; Liber, H.L.; Penman, B.W.; Thilly, W.G.

    1978-09-29

    A thymidine kinase heterozygote designated H2BT has been isolated from the human lymphoblast line HH4. Significant increase in the trifluorothymidine-resistant fraction was observed in the new cell line following treatment with the mutagens ICR-191 and butylmethansulfonate. Phenotypic expression was complete forty-eight hours after treatment.

  15. EST Table: CK536390 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available -PA 10/09/10 42 %/191 aa gi|91078946|ref|XP_974065.1| PREDICTED: similar to Outer dense fiber protein 2 (Out...er dense fiber of sperm tails protein 2) (84 kDa outer dense fiber protein) (Cenexin) [Tribolium castaneum] CK536834 swg ...

  16. Author Details

    African Journals Online (AJOL)

    Steel, SJ. Vol 29, No 2 (2013) - Articles Identifying secondary series for stepwise common singular spectrum analysis. Abstract PDF. ISSN: 0529-191-X. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's Partners · Terms and Conditions of ...

  17. Martin Guerre ei tulnud tagasi üksi / Jürgen Beyer ; saksa keelest tõlkinud Tiina Lias

    Index Scriptorium Estoniae

    Beyer, Jürgen, 1965-

    2002-01-01

    Rets. rmt.: Davis, Natalie Zemon. Martin Guerre'i tagasitulek / inglise keelest tõlkinud Ainiki Väljataga. Tallinn : Varrak, 2002. Arvustus ilmus ka ajakirjas Vikerkaar, 2002, nr. 8-9 lk. 189-191, kuna käesolevast numbrist oli välja jäänud üks lõik

  18. A Model of Emotion Management for U.S. Army Leaders

    Science.gov (United States)

    2010-12-01

    Rauch and G. F. Carr (Eds.), Semiotics around the world: Synthesis in diversity (pp.191-193). Ekman, P. (1999). Basic emotions. In T. Dalgeish and...Taylor, C. (1985). Human agency and language . Philosophical papers (Vol. 1). Cambridge, UK: Cambridge University Press. Taylor, S. E. (1991

  19. Classroom Collective Moral Disengagement Scale: Validation in Czech adolescents

    Czech Academy of Sciences Publication Activity Database

    Kollerová, Lenka; Soukup, P.; Gini, G.

    2018-01-01

    Roč. 15, č. 2 (2018), s. 184-191 ISSN 1740-5629 R&D Projects: GA ČR(CZ) GA15-00682S Institutional support: RVO:68081740 Keywords : aggressive behavior * bullying * defending * moral disengagement * victimization Subject RIV: AN - Psychology Impact factor: 1.302, year: 2016

  20. Publications | Page 20 | IDRC - International Development Research ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 191 - 200 of 6379 ... In rural Colombia, most families own small farms (less than 3 hectares) on which they chiefly grow potatoes. Planting ... In Benin, extreme climate variability has threatened the food security of rural populations, with agricultural yields declining and crop losses increasing due to extreme weather.

  1. Browse Title Index

    African Journals Online (AJOL)

    Items 351 - 400 of 490 ... Vol 191 (2001), Responses of Eucalyptus species to fertilizer applications ... in the Mpumalanga and Northern Provinces of South Africa, Abstract ... on forests and its implication for forest-based climate change interventions, Abstract ... Vol 200 (2004), Survival and growth of Pinus patula at two years in ...

  2. Effects of the Bogus-Pipeline on Enhancing Validity of Self-Reported Adolescent Drug Use Measures.

    Science.gov (United States)

    Werch, Chudley E.; And Others

    1987-01-01

    This study examined the effects of a bogus objective measure (bogus pipeline) on self-reports of experimentation, frequency, intentions, beliefs, and attitudes related to alcohol, tobacco, and other drug use of 191 youths aged 10 to 16. Results are discussed. (Author/MT)

  3. 78 FR 6202 - Airworthiness Directives; the Boeing Company

    Science.gov (United States)

    2013-01-30

    ...-191-AD; Amendment 39-17326; AD 2013-02-05] RIN 2120-AA64 Airworthiness Directives; the Boeing Company... airworthiness directive (AD) for certain The Boeing Company Model 737-600, -700, -700C, -800, -900, and -900ER... revising the airplane flight manual to remove certain requirements of previous AD actions, and to advise...

  4. Attachment Styles as a Predictor of Emotional Intelligence

    Science.gov (United States)

    Hamarta, Erdal; Deniz, M. Engin; Saltali, Neslihan

    2009-01-01

    The purpose of this study is to examine if attachment styles predict emotional intelligence (intrapersonal, interpersonal, adaptability, stress management, and general mood). Participants of the study consisted of 463 (272 females, 191 males) undergraduate students selected randomly from different faculties of Selcuk University. Regression and…

  5. Perceived Physical Appearance Mediates the Rumination and Bulimic Symptom Link in Adolescent Girls

    Science.gov (United States)

    Holm-Denoma, Jill M.; Hankin, Benjamin L.

    2010-01-01

    The prospective relationship between initial rumination and subsequent bulimic symptoms, and vice versa, was examined, and possible mediators were tested in a community sample of 191 adolescent girls (M age = 14.5) at 3 different assessment time points. Path analyses indicated that Time 1 rumination predicted Time 3 bulimic symptoms, and vice…

  6. Author Details

    African Journals Online (AJOL)

    Scholtz, E. Vol 28, No 2 (2012) - Articles Multi-objective optimisation with stochastic discrete-event simulation in retail banking: A case study. Abstract PDF. ISSN: 0529-191-X. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's Partners · Terms ...

  7. 40 CFR Appendix Vi to Part 265 - Compounds With Henry's Law Constant Less Than 0.1 Y/X

    Science.gov (United States)

    2010-07-01

    ... acid 65-85-0 Benzo(g,h,i)perylene 191-24-2 Benzo(a)pyrene 50-32-8 Benzyl alcohol 100-51-6 gamma-BHC 58... 75-12-7 Formic acid 64-18-6 Fumaric acid 110-17-8 Glutaric acid 110-94-1 Glycerin (Glycerol) 56-81-5...

  8. Induced Insecurity: Understanding the Potential Pitfalls in Developing Theater Campaign Plans

    Science.gov (United States)

    2015-06-11

    34 International Security 9, no. I (Summer 1984): 62. 23. Jervis, 191. 18 The primary lesson learned from this historical case study is that the...revolted violently by commencing a brutal guerilla war that, combined with attacks from the united British and Portuguese armies, eventually caused

  9. Influences of Gender and Adolescent Pleasure Book Reading on Young Adult Media Use.

    Science.gov (United States)

    Stone, Gerald; Wu, Lei

    A study examined gender differences in media use with emphasis on reading for pleasure as adolescents. Subjects, 191 freshmen and sophomores enrolled in survey courses in mass media at Memphis State University and Southern Illinois University, completed surveys designed to investigate how young adults established their pattern of mass media use in…

  10. Performance Needs Assessment of Maternal and Newborn Health ...

    African Journals Online (AJOL)

    AJRH Managing Editor

    In year 2000, the World Health Organization. (WHO) ranked the Nigerian health system as 187th out of 191 member States, indicating its poor state5. Since then, there has been several efforts to strengthen the Nigerian health system, including the launch of the National Strategic Health. Development Plan Framework with ...

  11. tropical OCTOBER

    African Journals Online (AJOL)

    Neilson JP, Lavender T, Quenby S, Wray S. Obstructed labour: reducing maternal death and disability during pregnancy. Br. Med Bull2003; 67: 191-204. 9. Kulkarni R, Kyari OA, Basumalik MK. An analytical study of obstructed labour. Nig Med Pract 1983; 5: 11-18. 10. Udoma EJ, Ekanem AD, John ME, Eshiet AT The role of.

  12. Essential Oil of Brachylaena hutchinsii Hutch from Tanzania ...

    African Journals Online (AJOL)

    Key Words: Brachylaena hutchinsii, essential oil, sesquiterpenes, antimicrobial activity. ... Screening of B. hutchinsii leaves from ... The oil is rich in caryophyllene (19.1 %), P-cubebene (1 5.5%), cis calamenene (10.5%) and .a-copaene (9.0%). Table 1. Antimicrobial of the essential oil of Brachylaena hutchinsii leavm-.

  13. Who are the targets of youth programs: results of a capacity building ...

    African Journals Online (AJOL)

    Who are the targets of youth programs: results of a capacity building exercise in Ethiopia. Tekle-Ab Mekbib, Annabel Erulkar, Fekerte Belete. Abstract. No Abstract Available Ethiop.J.Health Dev. Vol.19(1) 2005: 60-62. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD ...

  14. Multikriteriálna klasifikácia zdravotného stavu

    Czech Academy of Sciences Publication Activity Database

    Ocelíková, E.; Zolotová, I.; Klimešová, Dana

    2002-01-01

    Roč. 33, č. 6 (2002), s. 187-191 ISSN 0301-5491 R&D Projects: GA AV ČR KSK1019101 Institutional research plan: CEZ:AV0Z1075907 Keywords : risk class * health status * multicriterial classification Subject RIV: BB - Applied Statistics, Operational Research

  15. 76 FR 17971 - Notice of Applications for Deregistration Under Section 8(f) of the Investment Company Act of 1940

    Science.gov (United States)

    2011-03-31

    ... Fundamental Value Fund Summary: Each applicant seeks an order declaring that it has ceased to be an investment... Investment Funds, based on net asset value. Expenses of approximately $183,371, $191,468, $410,968, $186,821... Investment Advisors Inc., 522 Fifth Ave., New York, NY 10036. ] Morgan Stanley Special Value Fund ; Morgan...

  16. Podhradem Interstadial; A critical review of the middle and late MIS 3 (Denekamp, Hengelo) in Moravia, Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Lisá, Lenka; Neruda, P.; Nerudová, Z.; Nejman, L.

    2018-01-01

    Roč. 182, 15 February (2018), s. 191-201 ISSN 0277-3791 Institutional support: RVO:67985831 Keywords : Quaternary geochronology * climate change * cave climatic record * Palaeolithic * human environment Subject RIV: DB - Geology ; Mineralogy Impact factor: 4.797, year: 2016

  17. 19 CFR 19.12 - Inventory control and recordkeeping system.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Inventory control and recordkeeping system. 19.12... § 19.12 Inventory control and recordkeeping system. (a) Systems capability. The proprietor of a class 11 general order warehouse as described in § 19.1 must have an automated inventory control and...

  18. ejesm.v10i2.5

    African Journals Online (AJOL)

    USER

    2017-03-06

    Mar 6, 2017 ... Ethiopian Journal of Environmental Studies & Management 10(2): 186 – 191, 2017. ISSN:1998-0507 ... is doing everything within its power to equip the ... practical and operational problems in our business environment. These techniques include;. Linear and dynamic. Programming,. Inventory. Models,.

  19. Reflection nebulae in the Galactic center: soft X-ray imaging polarimetry

    Czech Academy of Sciences Publication Activity Database

    Marin, Frederic; Muleri, F.; Soffitta, P.; Karas, Vladimír; Kunneriath, Devaky

    2015-01-01

    Roč. 576, April (2015), A19/1-A19/7 ISSN 0004-6361 R&D Projects: GA MŠk LD12010; GA ČR(CZ) GC13-00070J Institutional support: RVO:67985815 Keywords : Galaxy * nucleus * structure Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.378, year: 2014

  20. Learning in a medium-scale DSGE model with expectations based on small forecasting models

    Czech Academy of Sciences Publication Activity Database

    Slobodyan, Sergey; Wouters, R.

    2012-01-01

    Roč. 4, č. 2 (2012), s. 65-101 ISSN 1945-7707 R&D Projects: GA ČR(CZ) GCP402/11/J018 Institutional support: PRVOUK-P23 Keywords : monetary-policy * inflation * convergence Subject RIV: AH - Economics Impact factor: 3.191, year: 2012