WorldWideScience

Sample records for astatine 191

  1. Radiochemistry of astatine

    International Nuclear Information System (INIS)

    Ruth, T.J.; Dombsky, M.; D'Auria, J.M.; Ward, T.E.

    1988-01-01

    This monograph is a review of the literature through 1987 and covers the methods of producing the radioisotopes of astatine and the inorganic, nuclear, and organic chemistry of astatine. The discussion is limited to chemical and physical chemical properties of astatine. The monograph, after the introduction, is divided into chapters titled: production methods, nuclear spectroscopy, chemistry of astatine, separation and isolation (dry and wet), and selected procedures. 209 refs., 15 figs., 7 tabs

  2. Formation and decomposition of astatine molecules

    International Nuclear Information System (INIS)

    Takahashi, Naruto; Ishikuro, Mituhiro; Baba Hiroshi

    1989-01-01

    A method determining the boiling points of elementary astatine and astatine iodide has been developed (K. Otozai and N. Takahashi, Radio. Chim. Acta 31, (1982) 201). Further, it was concluded from the simple rule among the boiling point of elementary halogens and interhalogen compounds that elementary astatine might exist in diatomic molecules as the other halogens. In the present work the reaction mechanisms of elementary astatine with radioactive iodine and organic solvents were studied by means of radiogaschromatography in order to obtain further experimental evidences for diatomic astaine molecules. The following conclusions were obtained by the analysis of reaction kinetics. Two astatine atoms are lost from the elementary astatine fraction per each radioactive decay of astatine. The astatine radical or hot atom liberated by the decay of the complementary astatine atom immediately reacts with iodine or organic solvents. Thus formed astatine compounds decompose in turn due to the decay of astatine

  3. Organic astatine compounds, their preparation and properties

    Energy Technology Data Exchange (ETDEWEB)

    Vasaros, L; Berei, K

    1985-01-01

    Aromatic astatine compounds of possible medical application were prepared by high energy substitutions, by astatine-halogen, and by electrophil astatine-hydrogen substitutions at the Joint Institute of Nuclear Researches, Dubna. Physico-chemical properties of organic astatine compounds such as boiling point and evaporation heat, and the refraction and dissociation energy of carbon-astatine bonds were determined experimentally by gas chromatography. The results are compared with extrapolated data. (V.N.). 41 refs.; 7 figs.; 5 tables.

  4. Direct astatination of a tumour-binding protein, human epidermal growth factor, using nido-carborane as a prosthetic group

    Czech Academy of Sciences Publication Activity Database

    Sjostrom, A.; Tolmachev, V.; Lebeda, Ondřej; Koziorowski, J.; Carlsson, J.; Lundqvist, H.

    2003-01-01

    Roč. 256, č. 7 (2003), s. 191-197 ISSN 0236-5731 R&D Projects: GA AV ČR KSK4055109 Keywords : neutron-capture therapy * astatine-211 Subject RIV: CH - Nuclear ; Quantum Chemistry Impact factor: 0.472, year: 2003

  5. Bibliography of astatine chemistry and biomedical applications

    International Nuclear Information System (INIS)

    Berei, K.; Vasaros, L.

    1992-02-01

    An overall bibliography is presented on astatine chemistry and on the biomedical applications of its 211 At isotope. The references were grouped in the following chapters: General reviews; Discovery, Natural Occurence; Nuclear Data; Preparation, Handling, Radiation Risk; Physico-chemical Properties; Astatine Compounds and Chemical Reactions; Biological Effects and Applications. Entries are sorted alphabetically by authors name in each chapter, and cross-references to other chapters are provided if appropriate. (R.P.)

  6. Recent advances in the organic chemistry of astatine

    International Nuclear Information System (INIS)

    Berei, K.; Vasaros, L.

    1994-03-01

    Investigation on the chemical behaviour of astatine in the last decade are surveyed. The survey covers the physical and chemical properties of astatine, synthesis and identification of organic astatine compounds, their physicochemical properties. A special chapter is devoted to biomedical applications, including inorganic 211 At species, 211 At-labelled proteins and drugs. An extensive bibliography of the related literature is given. (N.T.) 129 refs.; 12 figs.; 14 tabs

  7. Experimental and computational evidence of halogen bonds involving astatine

    Science.gov (United States)

    Guo, Ning; Maurice, Rémi; Teze, David; Graton, Jérôme; Champion, Julie; Montavon, Gilles; Galland, Nicolas

    2018-03-01

    The importance of halogen bonds—highly directional interactions between an electron-deficient σ-hole moiety in a halogenated compound and an acceptor such as a Lewis base—is being increasingly recognized in a wide variety of fields from biomedicinal chemistry to materials science. The heaviest halogens are known to form stronger halogen bonds, implying that if this trend continues down the periodic table, astatine should exhibit the highest halogen-bond donating ability. This may be mitigated, however, by the relativistic effects undergone by heavy elements, as illustrated by the metallic character of astatine. Here, the occurrence of halogen-bonding interactions involving astatine is experimentally evidenced. The complexation constants of astatine monoiodide with a series of organic ligands in cyclohexane solution were derived from distribution coefficient measurements and supported by relativistic quantum mechanical calculations. Taken together, the results show that astatine indeed behaves as a halogen-bond donor—a stronger one than iodine—owing to its much more electrophilic σ-hole.

  8. The reaction of astatine with aromatic diazonium compounds

    International Nuclear Information System (INIS)

    Visser, G.W.M.; Diemer, E.L.

    1982-01-01

    Astatine reacts prefrentially with that type of aromatic diazonium salt that decomposes via a radical reaction channel (homolytic breakage of the C-N bond). The dediazonation with p-aminobenzoic acid and p-toluidine as model compounds was investigated through estatin produced in the 209 Bi(α,2n) 211 At reaction. (author)

  9. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    Science.gov (United States)

    Rothe, S.; Andreyev, A. N.; Antalic, S.; Borschevsky, A.; Capponi, L.; Cocolios, T. E.; De Witte, H.; Eliav, E.; Fedorov, D. V.; Fedosseev, V. N.; Fink, D. A.; Fritzsche, S.; Ghys, L.; Huyse, M.; Imai, N.; Kaldor, U.; Kudryavtsev, Yuri; Köster, U.; Lane, J. F. W.; Lassen, J.; Liberati, V.; Lynch, K. M.; Marsh, B. A.; Nishio, K.; Pauwels, D.; Pershina, V.; Popescu, L.; Procter, T. J.; Radulov, D.; Raeder, S.; Rajabali, M. M.; Rapisarda, E.; Rossel, R. E.; Sandhu, K.; Seliverstov, M. D.; Sjödin, A. M.; Van den Bergh, P.; Van Duppen, P.; Venhart, M.; Wakabayashi, Y.; Wendt, K. D. A.

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.31751(8) eV. New ab initio calculations are performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of superheavy element 117, the heaviest homologue of astatine. PMID:23673620

  10. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    DEFF Research Database (Denmark)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom

    2015-01-01

    To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical...... vector, which can guide the radiation to the cancer cells. Consequently, an appropriate method is required for coupling the nuclide to the vector. To increase the availability of astatine-211 radiopharmaceuticals for targeted alpha therapy, their production should be automated. Here, we present a method...... challenging, alpha-emitting radionuclide. In this work, we describe the process platform, and we demonstrate the production of both astaine-211, for preclinical use, and astatine-211 labelled antibodies....

  11. Synthesis and Evaluation of Astatinated N-[2-(Maleimido)ethyl]-3-(trimethylstannyl)benzamide Immunoconjugates

    DEFF Research Database (Denmark)

    Aneheim, Emma; Gustafsson, Anna; Albertsson, Per

    2016-01-01

    Effective treatment of metastasis is a great challenge in the treatment of different types of cancers. Targeted alpha therapy utilizes the short tissue range (50-100 μm) of α particles, making the method suitable for treatment of disseminated occult cancers in the form of microtumors or even single...... to the antibody arbitrarily on lysine residues. By instead coupling astatine to disulfide bridges in the antibody structure, the immunoreactivity of the antibody conjugates could possibly be increased. Here, the disulfide-based conjugation was performed using a new coupling reagent, maleimidoethyl 3......-(trimethylstannyl)benzamide (MSB), and evaluated for chemical stability in vitro. The immunoconjugates were subsequently astatinated, resulting in both high radiochemical yield and high specific activity. The MSB-conjugate was shown to be stable with a long shelf life prior to the astatination. In a comparison...

  12. Some aspects of the organic, biological and inorganic chemistry of astatine

    International Nuclear Information System (INIS)

    Visser, G.W.M.

    1982-01-01

    Astatine has no stable isotopes and the radioactive isotopes with half-lives sufficiently long for chemical experiments ( 209 At, 210 At, 211 At) must be produced artificially with a cyclotron or with a high energy accelerator by spallation of Th. This thesis deals with the synthesis and chemistry of At-compounds and the determination of some of their properties. (C.F.)

  13. Direct astatination of a tumour-binding protein, human epidermal growth factor, using nido-carborane as a prosthetic group

    International Nuclear Information System (INIS)

    Sjoestroem, A.; Carlsson, J.; Lundqvist, H.; Koziorowski, J.

    2003-01-01

    A method for direct astatine labeling of proteins has been investigated. Binding sites for astatine were created by coupling of a nido-carborane derivative to a protein, the human epidermal growth factor (hEGF), using two different conjugation methods - by glutaraldehyde cross-linking or by introduction of sulfohydryl groups by Traut's reagent with subsequent linking of ANC-1 with m-maleimidobenzoyl-N-hydroxysulfosuccinimide ester. The conjugates were astatinated using the Chloramine-T method in high yield. The best labeling was obtained by the glutaraldehyde conjugate with an average yield of 68 ± 9%. In vitro stability tests indicated that the glutaraldehyde conjugated label was as stable as hEGF labeled with astatobenzoate. (author)

  14. Estimation of the chemical form and the boiling point of elementary astatine by radiogas-chromatography

    International Nuclear Information System (INIS)

    Otozai, K.; Takahashi, N.

    1982-01-01

    After astatine (0) was mixed with 131 I 2 containing carrier I 2 , the sample was analyzed by means of radiogaschromatography and the peaks due to I 2 , AtI and At 2 were observed. Further, the boiling points were estimated from the retention volume in terms of the semi-empirical theory on gas chromatography. The boiling points of I 2 , AtI and At 2 were 457 +- 2,486 +- 2 and 503 +- 3K, respectively. The boiling point of At 2 obtained in the present work is far smaller than that expected by the extrapolation of lighter halogens. (orig.)

  15. 211At-Rh(16-S4-diol) complex as a precursor for astatine radiopharmaceuticals

    International Nuclear Information System (INIS)

    Pruszynski, M.; Bilewicz, A.

    2006-01-01

    211 At is one of the most promising radionuclides in α-radioimmunotherapy (α-RIT). Unfortunately, biomolecules labeled by direct electrophilic astatination are unstable due to the rapid loss of 211 At under both in vitro and in vivo conditions. The present paper describes the results of our studies on attaching At - to the rhodium(III) complex with thioether ligand: 1,5,9,13-etrathiacyclohexadecane-3,11-diol (16-S4-diol). Rh 3+ was chosen as a moderately soft metal cation which should form very strong bonds with soft At - anions, but first of all because of the kinetic inertness of low spin rhodium(III) d 6 complexes. The 16-S4-diol ligand was selected due to formation of stable complexes with Rh 3+ . The experiments related to optimization of the reaction conditions were performed with the 131 I, basing on a chemical similarity of I - to At - . The experiments with 211 At were then carried out under the conditions found optimal for I - . The preliminary results are promising, and indicate a possibility for astatination of biomolecules by using the 211 At-Rh(16-S4-diol) complex

  16. The decay of 191Os

    International Nuclear Information System (INIS)

    Malmskog, S.G.; Baecklin, A.

    1969-03-01

    Gamma ray and conversion electron energies and intensities for transitions in 191 Ir have been measured in the decay of 191 Os using a Ge(Li) detector and a double focusing beta spectrometer. The following energies (in keV) and transition multipolarities were found: 41.92 ± 0.02 (E3), 47.05 ± 0.03 (E2), 82.46 ± 0.04 (56% M1 + 44% E2) and 129.52 + 0.02 (88% M1 + 12% E2). From a delayed coincidence measurement the half-life of the 129.52 keV level in 191 Ir was found to be (1.26 ± 0.11) x 10 -10 sec

  17. Yrast excitations in 191Pb

    International Nuclear Information System (INIS)

    Fotiades, N.; Andreyev, A.

    1997-01-01

    Prompt, in-beam γ rays in coincidence with evaporation residues were measured in the 164,166 Er + 164 MeV 32 S reactions. A level scheme built on the 13/2 + isomer has been deduced from four transitions assigned to 191 Pb. The states in 191 Pb are interpreted in terms of a weak coupling of the odd i 13/2 neutron-hole to the spherical states in the even-mass 192 Pb core. (orig.). With 4 figs

  18. Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical

    Energy Technology Data Exchange (ETDEWEB)

    Lahiri, Susanta [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India)], E-mail: susanta.lahiri@saha.ac.in; Roy, Kamalika [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India); Sen, Souvik [Berhampur Sadar Hospital, Berhampur, Murshidabad 742 101 (India)

    2008-12-15

    No-carrier-added astatine radionuclides produced in the {sup 7}Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about {approx}12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h.

  19. Laser photodetachment of radioactive ions: towards the determination of the electronegativity of astatine

    CERN Multimedia

    Rothe, Sebastian; Welander, Jakob Emanuel; Chrysalidis, Katerina; Day Goodacre, Thomas; Fedosseev, Valentine; Fiotakis, Spyridon; Forstner, Oliver; Heinke, Reinhard Matthias; Johnston, Karl; Kron, Tobias; Koester, Ulli; Liu, Yuan; Marsh, Bruce; Ringvall Moberg, Annie; Rossel, Ralf Erik; Seiffert, Christoph; Studer, Dominik; Wendt, Klaus; Hanstorp, Dag

    2017-01-01

    Negatively charged ions are mainly stabilized through the electron correlation effect. A measure of the stability of a negative ion is the electron affinity, which the energy gain by attaching an electron to a neutral atom. This fundamental quantity is, due to the almost general lack of bound excited states, the only atomic property that can be determined with high accuracy for negative ions. We will present the results of the first laser photodetachment studies of radioactive negative ions at CERN-ISOLDE. The photodetachment threshold for the radiogenic iodine isotope 128I was measured successfully, demonstrating the performance of the upgraded GANDALPH experimental beam line. The first detection of photo-detached astatine atoms marks a milestone towards the determination of the EA of this radioactive element.

  20. Thermogravimetric determination of the enthalpy of astatine and radon adsorption on palladium surfaces

    International Nuclear Information System (INIS)

    Eichler, B.; Son Chun, K.

    1985-01-01

    In order to investigate the adsorption of astatine and radon on a palladium surface some on- and off-line thermochromatographic experiments were carried out with 210 At and 220 Rn tracers. The partial molar adsorption enthalpy for zero covering was found to be ΔH/sub a//sup 0, loc./(At) = -(15S +- 10) kJ mole -1 and ΔH/sub a//sup 0, mob./(Rn) = -(37 +- 4) kJ mole -1 . The results are compared with theoretical and experimental values for other elements of the sixth period. The adsorption behaviour of At is in conformity with that of the p-metals on a palladium surface. (author)

  1. Determination of the electron affinity of astatine and polonium by laser photodetachment

    CERN Multimedia

    We propose to conduct the first electron affinity (EA) measurements of the two elements astatine (At) and polonium (Po). Collinear photo-detachment spectroscopy will allow us to measure these quantities with an uncertainty limited only by the spectral line width of the laser. We plan to use negative ion beams of the two radioactive elements At and Po, which are only accessible on-line and at ISOLDE. The feasibility of our proposed method and the functionality of the experimental setup have been demonstrated at ISOLDE in off-line tests by the clear observation of the photo-detachment threshold for stable iodine. This proposal is based on our Letter of Intent I-148.

  2. Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical

    International Nuclear Information System (INIS)

    Lahiri, Susanta; Roy, Kamalika; Sen, Souvik

    2008-01-01

    No-carrier-added astatine radionuclides produced in the 7 Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about ∼12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h

  3. Superdeformation in {sup 191}Tl

    Energy Technology Data Exchange (ETDEWEB)

    Pilotte, S; Lewis, J M; Riedinger, L L; Yu, C H [Tennessee Univ., Knoxville, TN (United States). Dept. of Physics; Capenter, M P; Janssens, R V.F.; Khoo, T L; Lauritsen, T; Liang, Y; Soramel, F [Argonne National Lab., IL (United States). Physics Div.; Bearden, I G [Purdue Univ., Lafayette, IN (United States)

    1992-08-01

    High spin states in {sup 191}T1 have been populated via the {sup 159}Tb({sup 36}S,4n) reaction at 165 MeV. Two weak sequences of regularly spaced transitions have been identified. These bands exhibit many of the properties observed in many other superdeformed nuclei in the Hg region. (author). 23 refs., 5 figs.

  4. 19 CFR 191.13 - Packaging materials.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Packaging materials. 191.13 Section 191.13 Customs... (CONTINUED) DRAWBACK General Provisions § 191.13 Packaging materials. (a) Imported packaging material... packaging material when used to package or repackage merchandise or articles exported or destroyed pursuant...

  5. 40 CFR 191.02 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... TRANSURANIC RADIOACTIVE WASTES Environmental Standards for Management and Storage § 191.02 Definitions. Unless... process associated with the management and storage of spent nuclear fuel or radioactive waste is conducted... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Definitions. 191.02 Section 191.02...

  6. 34 CFR 75.191 - Consultation costs.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 1 2010-07-01 2010-07-01 false Consultation costs. 75.191 Section 75.191 Education... Development of Curricula Or Instructional Materials § 75.191 Consultation costs. An applicant may budget reasonable consultation fees or planning costs in connection with the development of curricula or...

  7. 22 CFR 191.21 - Applicable benefits.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Applicable benefits. 191.21 Section 191.21 Foreign Relations DEPARTMENT OF STATE HOSTAGE RELIEF HOSTAGE RELIEF ASSISTANCE Medical Benefits § 191.21 Applicable benefits. A person eligible for benefits under this part shall be eligible for authorized medical...

  8. 22 CFR 191.11 - Applicable benefits.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Applicable benefits. 191.11 Section 191.11...' and Sailors' Civil Relief Act § 191.11 Applicable benefits. (a) Eligible persons are entitled to the benefits provided by the Soldiers' and Sailors' Civil Relief Act of 1940 (50 U.S.C. App. 501, et seq...

  9. Astatine-211 Radiochemistry: The Development Of Methodologies For High Activity Level Radiosynthesis

    International Nuclear Information System (INIS)

    Zalutsky, Michael R.

    2012-01-01

    Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for α-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the α-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At-labeled targeted

  10. ASTATINE-211 RADIOCHEMISTRY: THE DEVELOPMENT OF METHODOLOGIES FOR HIGH ACTIVITY LEVEL RADIOSYNTHESIS

    Energy Technology Data Exchange (ETDEWEB)

    MICHAEL R. ZALUTSKY

    2012-08-08

    Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At

  11. Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy

    CERN Document Server

    Andreyev, Andrei

    2013-01-01

    Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy

  12. In vitro evaluation of the astatinated chimeric monoclonal antibody U36, a potential candidate for treatment of head and neck squamous cell carcinoma

    Energy Technology Data Exchange (ETDEWEB)

    Nestor, M.; Anniko, M. [Uppsala University, Unit of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala (Sweden); Persson, M. [Uppsala University, Unit of Urology, Department of Surgical Sciences, Uppsala (Sweden); Uppsala University, Unit of Biomedical Radiation Science, Department of Oncology, Radiology and Clinical Immunology, Uppsala (Sweden); Dongen, G.A.M.S. van [Vrije Universiteit Medical Center, Department of Otolaryngology/Head and Neck Surgery, Amsterdam (Netherlands); Jensen, H.J. [Righshospitalet, PET and Cyclotron Unit, Department of Clinical Physiology and Nuclear Medicine, Copenhagen (Denmark); Lundqvist, H.; Tolmachev, V. [Uppsala University, Unit of Biomedical Radiation Science, Department of Oncology, Radiology and Clinical Immunology, Uppsala (Sweden)

    2005-11-01

    The purpose of this study was to analyse the properties of the astatinated chimeric MAb (cMAb) U36 as a conjugate to selectively target and eradicate head and neck squamous cell carcinoma (HNSCC). cMAb U36 was labelled with {sup 211}At via the linker N-succinimidyl 4-(trimethylstannyl)benzoate (SPMB). The quality of the conjugate was extensively evaluated for binding and internalisation capacity, and compared with {sup 125}I-SPMB-cMAb U36. The cellular toxicity of the astatinated conjugate was assessed in two types of in vitro growth assay and compared with {sup 131}I-labelled cMAb U36 (directly labelled). Comparisons between {sup 211}At-cMAb U36 and {sup 125}I-cMAb U36 demonstrated an optimal functional capacity of the labelled products. Immunoreactivity and affinity assays showed high immunoreactive fractions (>93%), and an affinity in good agreement between the astatinated and iodinated antibodies. For both conjugates, specific binding to HNSCC cells could be demonstrated, as well as some internalisation. Retention of the astatinated conjugate was just slightly lower than for the iodinated conjugate and still reasonable for therapeutic use (31{+-}2% vs 42.6{+-}1.0% at 22 h), demonstrating no adverse effects from astatination of the antibody. Studies on cellular toxicity demonstrated a dose-dependent and antigen-specific cellular toxicity for {sup 211}At-cMAb U36, with about 10% cell survival at 50 decays per cell. The {sup 131}I-labelled conjugate was not as efficient, with a surviving cell fraction of about 50% at 55 decays per cell. (orig.)

  13. In vitro evaluation of the astatinated chimeric monoclonal antibody U36, a potential candidate for treatment of head and neck squamous cell carcinoma

    International Nuclear Information System (INIS)

    Nestor, M.; Anniko, M.; Persson, M.; Dongen, G.A.M.S. van; Jensen, H.J.; Lundqvist, H.; Tolmachev, V.

    2005-01-01

    The purpose of this study was to analyse the properties of the astatinated chimeric MAb (cMAb) U36 as a conjugate to selectively target and eradicate head and neck squamous cell carcinoma (HNSCC). cMAb U36 was labelled with 211 At via the linker N-succinimidyl 4-(trimethylstannyl)benzoate (SPMB). The quality of the conjugate was extensively evaluated for binding and internalisation capacity, and compared with 125 I-SPMB-cMAb U36. The cellular toxicity of the astatinated conjugate was assessed in two types of in vitro growth assay and compared with 131 I-labelled cMAb U36 (directly labelled). Comparisons between 211 At-cMAb U36 and 125 I-cMAb U36 demonstrated an optimal functional capacity of the labelled products. Immunoreactivity and affinity assays showed high immunoreactive fractions (>93%), and an affinity in good agreement between the astatinated and iodinated antibodies. For both conjugates, specific binding to HNSCC cells could be demonstrated, as well as some internalisation. Retention of the astatinated conjugate was just slightly lower than for the iodinated conjugate and still reasonable for therapeutic use (31±2% vs 42.6±1.0% at 22 h), demonstrating no adverse effects from astatination of the antibody. Studies on cellular toxicity demonstrated a dose-dependent and antigen-specific cellular toxicity for 211 At-cMAb U36, with about 10% cell survival at 50 decays per cell. The 131 I-labelled conjugate was not as efficient, with a surviving cell fraction of about 50% at 55 decays per cell. (orig.)

  14. 27 CFR 20.191 - Bulk articles.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Bulk articles. 20.191... Users of Specially Denatured Spirits Operations by Users § 20.191 Bulk articles. Users who convey articles in containers exceeding one gallon may provide the recipient with a photocopy of subpart G of this...

  15. 40 CFR 191.13 - Containment requirements.

    Science.gov (United States)

    2010-07-01

    ... requirements. (a) Disposal systems for spent nuclear fuel or high-level or transuranic radioactive wastes shall... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Containment requirements. 191.13 Section 191.13 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) RADIATION PROTECTION...

  16. 40 CFR 191.03 - Standards.

    Science.gov (United States)

    2010-07-01

    ...) Management and storage of spent nuclear fuel or high-level or transuranic radioactive wastes at all... and storage of spent nuclear fuel or high-level or transuranic radioactive wastes at all facilities... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Standards. 191.03 Section 191.03...

  17. 40 CFR 191.01 - Applicability.

    Science.gov (United States)

    2010-07-01

    ... wastes at any facility regulated by the Nuclear Regulatory Commission or by Agreement States, to the... storage of spent nuclear fuel or high-level or transuranic wastes at any disposal facility that is... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Applicability. 191.01 Section 191.01...

  18. 40 CFR 191.11 - Applicability.

    Science.gov (United States)

    2010-07-01

    ... of spent nuclear fuel or high-level or transuranic radioactive wastes; (2) Radiation doses received... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Applicability. 191.11 Section 191.11 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) RADIATION PROTECTION PROGRAMS...

  19. 19 CFR 191.103 - Additional requirements.

    Science.gov (United States)

    2010-04-01

    ... which the alcohol was withdrawn; (iv) Date of withdrawal; (v) Serial number of the tax-paid stamp or... 19 Customs Duties 2 2010-04-01 2010-04-01 false Additional requirements. 191.103 Section 191.103 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE...

  20. 49 CFR 191.19 - Report forms.

    Science.gov (United States)

    2010-10-01

    ... forms. Copies of the prescribed report forms are available without charge upon request from the address... 49 Transportation 3 2010-10-01 2010-10-01 false Report forms. 191.19 Section 191.19 Transportation... size and kind of paper. In addition, the information required by these forms may be submitted by any...

  1. 19 CFR 191.76 - Landing certificate.

    Science.gov (United States)

    2010-04-01

    ... landing certificate shall be waived by the requiring Customs authority if the claimant demonstrates... 19 Customs Duties 2 2010-04-01 2010-04-01 false Landing certificate. 191.76 Section 191.76 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY...

  2. Development of a new osmium-191: Iridium-191m radionuclide generator: Final report

    International Nuclear Information System (INIS)

    Treves, S.; Packard, A.B.

    1986-01-01

    The use of iridium-191m (T/sub 1/2/ = 5s) for first-pass radionuclide angiography offers the potential advantages of lower patient radiation dose and the ability to obtain repeated studies without interference from the previously administered radioisotope. These potential advantages have been offset by the absence of satisfactory 191 Os-/sup 191m/Ir generators. The goal of this project was, therefore, the development of an 191 Os-/sup 191m/Ir generator that would be suitable for clinical use. This goal was first sought through modifications of an existing 191 Os-/sup 191m/Ir generator design (i.e., changes in the ion exchange material and eluent) but these changes did not lead to the required improvements. A new approach was then undertaken in which different chemical forms of the 191 Os parent were evaluated in prototype generators. The complex trans-dioxobisoxalatoosmate (VI) led to a generator with higher /sup 191m/Ir yield (25 to 30%/mL) and lower 191 Os breakthrough ( -4 %) with a more physiologically compatible eluent than had been previously achieved. Toxicity studies were conducted on the eluate and an IND subsequently obtained. While this is not a final solution to the problem of developing a clinically acceptable 191 Os-/sup 191m/Ir generator, the ''oxalate'' generator is the most significant improvement of the 191 Os-/sup 191m/Ir generator to date and will be used in an expanded program of clinical studies. 16 refs., 16 tabs

  3. High-efficiency astatination of antibodies using N-iodosuccinimide as the oxidising agent in labelling of N-succinimidyl 3-(trimethylstannyl)benzoate

    International Nuclear Information System (INIS)

    Lindegren, S.; Andersson, H.; Baeck, T.; Jacobsson, L.; Karlsson, B.; Skarnemark, G.

    2001-01-01

    Monoclonal antibodies C215, reactive with colorectal carcinomas, and MOv18, reactive with most of the ovarian carcinomas, were radiohalogenated with [ 211 At]astatine. The radiohalogen was conjugate coupled to antibodies via the intermediate labelling reagent N-succinimidyl-3-(trimethylstannyl)benzoate (m-MeATE) in a two-step, single-pot reaction. Optimisation of the labelling of the reagent was achieved using N-iodosuccinimide, NIS, as the oxidising agent. The yields ranged from 69-95% in the labelling of 0.1-1.0 nmole of the m-MeATE precursor. Subsequent conjugation to antibodies resulted in yields of 58±7%. In vitro binding to tumour cells showed that the immunoreactivity of both antibodies was retained after astatine labelling

  4. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE, CERN

    CERN Document Server

    Rothe, Sebastian; Nörtershäuser, W

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at ISOLDE, CERN, by the addition of an all-solid state tuneable titanium: sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE, CERN, and at ISAC, TRIUMF, radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  5. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    International Nuclear Information System (INIS)

    Rothe, Sebastian

    2012-01-01

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  6. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    Energy Technology Data Exchange (ETDEWEB)

    Rothe, Sebastian

    2012-09-24

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  7. Radiobiological Effects of Alpha-Particles from Astatine-211: From DNA Damage to Cell Death

    Energy Technology Data Exchange (ETDEWEB)

    Claesson, Kristina

    2011-05-15

    In recent years, the use of high linear energy transfer (LET) radiation for radiotherapeutic applications has gained increased interest. Astatine-211 (211At) is an alpha-particle emitting radionuclide, promising for targeted radioimmunotherapy of isolated tumor cells and microscopic clusters. To improve development of safe radiotherapy using 211At it is important to increase our knowledge of the radiobiological effects in cells. During radiotherapy, both tumors and adjacent normal tissue will be irradiated and therefore, it is of importance to understand differences in the radio response between proliferating and resting cells. The aim of this thesis was to investigate effects in fibroblasts with different proliferation status after irradiation with alpha-particles from 211At or X-rays, from inflicted DNA damage, to cellular responses and biological consequences. Throughout this work, irradiation was performed with alpha-particles from 211A or X-rays. The induction and repair of double-strand breaks (DSBs) in human normal fibroblasts were investigated using pulsed-field gel electrophoresis and fragment analysis. The relative biological effectiveness (RBE) of 211At for DSB induction varied between 1.4 and 3.1. A small increase of DSBs was observed in cycling cells compared to stationary cells. The repair kinetics was slower after 211At and more residual damage was found after 24 h. Comparison between cells with different proliferation status showed that the repair was inefficient in cycling cells with more residual damage, regardless of radiation quality. Activation of cell cycle arrests was investigated using immunofluorescent labeling of the checkpoint kinase Chk2 and by measuring cell cycle distributions with flow cytometry analysis. After alpha-particle irradiation, the average number of Chk2-foci was larger and the cells had a more affected cell cycle progression for several weeks compared with X-irradiated cells, indicating a more powerful arrest after 211At

  8. The decay of {sup 191}Os

    Energy Technology Data Exchange (ETDEWEB)

    Malmskog, S G; Baecklin, A

    1969-03-15

    Gamma ray and conversion electron energies and intensities for transitions in {sup 191}Ir have been measured in the decay of {sup 191}Os using a Ge(Li) detector and a double focusing beta spectrometer. The following energies (in keV) and transition multipolarities were found: 41.92 {+-} 0.02 (E3), 47.05 {+-} 0.03 (E2), 82.46 {+-} 0.04 (56% M1 + 44% E2) and 129.52 + 0.02 (88% M1 + 12% E2). From a delayed coincidence measurement the half-life of the 129.52 keV level in {sup 191}Ir was found to be (1.26 {+-} 0.11) x 10{sup -10} sec.

  9. Development of the osmium-191 → iridium-191m radionuclide generator. Annual report

    International Nuclear Information System (INIS)

    Treves, S.; Packard, A.B.

    1985-01-01

    The use of /sup 191m/Ir in radionuclide angiography has been the subject of increasing interest in recent years. The 191 Os-/sup 191m/Ir generator that has been used for these studies suffers, however, from low /sup 191m/Ir yield (10%/ml) and higher than desirable 191 Os breakthrough (5 x 10 -3 %). We have recently developed a /sup 191m/Ir generator that has higher yield (25 to 30%/ml) and lower breakthrough ( -4 %) when eluted with an eluent (0.001 M oxalic acid/0.9% saline) that does not require buffering prior to injection. Studies within the last year have shown the eluate of this generator to be non-toxic at up to 100 times the expected human dose and work is in progress to obtain approval for human use of this system. While a significant improvement over past generator designs, the yield of this generator is still modest and the evaluation of new osmium complexes for use on the generator has continued. Clinical studies involving the use of /sup 191m/Ir for first-pass angiography in adults and children have continued. A comparison of ejection fractions measured in adults with both /sup 99m/Tc and /sup 191m/Ir has confirmed the feasibilty of /sup 191m/Ir for radionuclide angiography in both the left and right ventricles of adults. Studies in collaboration with Baylor Medical College have demonstrated the efficacy of /sup 191m/Ir in combination with the multi-wire gamma camera. 31 refs., 2 figs., 10 tabs

  10. Osmium-191 → iridium-191m radionuclide generator: development and clinical application. Progress report, March 1, 1981-February 28, 1982

    International Nuclear Information System (INIS)

    Treves, S.; Cheng, C.

    1981-01-01

    A prototype osmium-191 (T 1/2 = 16 days) → iridium-191m (T 1/2 = 4.9 seconds) generator designed for first pass radionuclide angiography was developed in our laboratory (Os-191 → Ir-191m). Our generator had 14 to 20% Ir-191m yield and a 1 to 3 x 10 -3 % Os-191 breakthrough. Iridium-191m decays with emission of a 65 and a 129 keV photon in 50% and 25% abundance respectively. This radionuclide is advantageous for angiography since it provides higher photon flux and results in much lower radiation dose to the patient than Tc-99m. One objective of this research is to improve the Os-191 → Ir-191m generator for first pass radionuclide angiography at an increase in the Ir-191m yield and a decrease in the Os-191 breakthrough. In addition, we would like to develop an Os-191 → Ir-191m generator for continuous infusion which will be used for ECG gated blood pool ventriculography, venography, and arteriography. Another approach will be to develop a carrier free Os-191 → Ir-191m generator in combination with organic or inorganic exchangers. Iridium-191m from our current generator has been employed successfully in two patient studies for the quantitation left-to-right shunting and the measurement of right and left ventricular ejection fractions. These types of studies will be expanded and further evaluated

  11. 19 CFR 191.2 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... under the provision for the substitution of finished petroleum derivatives, § 313(p), as amended (19 U.S... identified for purposes of direct identification drawback by use of the accounting methods provided for in... (CONTINUED) DRAWBACK General Provisions § 191.2 Definitions. For the purposes of this part: (a) Abstract...

  12. 27 CFR 25.191 - General.

    Science.gov (United States)

    2010-04-01

    ... TREASURY LIQUORS BEER Removals Without Payment of Tax Removal of Beer Unfit for Beverage Use § 25.191 General. A brewer may remove sour or damaged beer, or beer which the brewer has deliberately rendered unfit for beverage use, from the brewery without payment of tax for use in manufacturing. Unfit beer may...

  13. 19 CFR 191.102 - Procedure.

    Science.gov (United States)

    2010-04-01

    ... (CONTINUED) DRAWBACK Internal Revenue Tax on Flavoring Extracts and Medicinal or Toilet Preparations (Including Perfumery) Manufactured From Domestic Tax-Paid Alcohol § 191.102 Procedure. (a) General. Other provisions of this part relating to direct identification drawback (see subpart B of this part) shall apply...

  14. Chemical and physical parameters affecting the performance of the Os-191/Ir-191m generator

    International Nuclear Information System (INIS)

    Packard, A.B.; Butler, T.A.; Knapp, F.F.; O'Brien, G.M.; Treves, S.

    1984-01-01

    The development of an Os-191/Ir-191m generator suitable for radionuclide angiography in humans has elicited much interest. This generator employs ''(OsO 2 Cl 4 ) 2- '' on AG MP-1 anion exchange resin with a Dowex-2 scavenger column and is eluted with normal saline at pH 1. The parent Os species is, however, neither welldefined nor homogeneous leading to less than optimal breakthrough of Os-191 (5 x 10 -3 %) and modest Ir-191m yield (10-15%). The effect of a range of parameters on generator performance has been evaluated as has been the way in which the assembly and loading process affects generator performance. In addition, a number of potential alternative generator systems have been evaluated

  15. 32 CFR 191.7 - Civilian EEO program staff.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Civilian EEO program staff. 191.7 Section 191.7...) MISCELLANEOUS THE DOD CIVILIAN EQUAL EMPLOYMENT OPPORTUNITY (EEO) PROGRAM § 191.7 Civilian EEO program staff. (a) EEO Managers, including SEP Managers and other staff who are responsible for EEO and affirmative...

  16. 19 CFR 19.1 - Classes of customs warehouses.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Classes of customs warehouses. 19.1 Section 19.1 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS WAREHOUSES, CONTAINER STATIONS AND CONTROL OF MERCHANDISE THEREIN § 19.1 Classes of...

  17. 19 CFR 191.152 - Merchandise released from Customs custody.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Merchandise released from Customs custody. 191.152 Section 191.152 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) DRAWBACK Merchandise Exported From Continuous Customs Custody § 191...

  18. 19 CFR 191.153 - Continuous Customs custody.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Continuous Customs custody. 191.153 Section 191.153 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) DRAWBACK Merchandise Exported From Continuous Customs Custody § 191.153...

  19. 19 CFR 191.44 - Destruction under Customs supervision.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Destruction under Customs supervision. 191.44 Section 191.44 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) DRAWBACK Rejected Merchandise § 191.44 Destruction under Customs supervision. A claimant may destroy merchandise an...

  20. 19 CFR 191.37 - Destruction under Customs supervision.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Destruction under Customs supervision. 191.37 Section 191.37 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) DRAWBACK Unused Merchandise Drawback § 191.37 Destruction under Customs supervision. A claimant may destroy...

  1. 19 CFR 191.25 - Destruction under Customs supervision.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Destruction under Customs supervision. 191.25 Section 191.25 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) DRAWBACK Manufacturing Drawback § 191.25 Destruction under Customs supervision. A claimant may destroy merchandise...

  2. 19 CFR 191.10 - Certificate of delivery.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Certificate of delivery. 191.10 Section 191.10... TREASURY (CONTINUED) DRAWBACK General Provisions § 191.10 Certificate of delivery. (a) Purpose; when... other party a certificate of delivery, certified by the importer or other party through whose possession...

  3. Observation of superdeformation in 191Hg

    International Nuclear Information System (INIS)

    Moore, E.F.; Janssens, R.V.F.; Chasman, R.R.

    1989-01-01

    The first observation of superdeformation in the A ≅ 190 mass region is reported. A rotational band of 12 transitions with an average energy spacing of 37 keV, an average moment of inertia of 110 ℎ 2 MeV -1 , and an average quadrupole moment of 18 ± 3 eb has been observed in 191 Hg. These results are in excellent agreement with a calculation that predicts an ellipsoidal axis ratio of 1.65:1 for the superdeformed shape in this nucleus. Evidence for another discrete superdeformed band and superdeformed structures in the quasi-continuum was also found in the data. 19 refs., 6 figs

  4. Superdeformation studies in {sup 191}Hg

    Energy Technology Data Exchange (ETDEWEB)

    Carpenter, M.P.; Janssens, R.V.F.; Crowell, B. [and others

    1995-08-01

    Superdeformation in the A {approximately} 190 region was first observed in {sup 191}Hg from an experiment performed at ATLAS using the Argonne Notre Dame {gamma}-ray facility. We recently revisited the study of superdeformation in this nucleus using Gammasphere and the {sup 160}Gd({sup 36}S,5n) and {sup 174}Yb({sup 22}Ne,5n) reactions at 172 and 120 MeV in order to populate and measure states in the second well. The goal of the experiment was to identify new bands in the data, and thus allow us to gain understanding on the relative placement of single particle orbitals near the N = 112 SD shell gap. From an analysis of the data, the three previously identified SD bands were extended, and their feeding into the yrast states delineated. Two new SD bands were observed and preliminary evidence for a third new band was obtained as well.

  5. Final Report for research grant "Development of Methods for High Specific Activity Labeling of Biomolecules Using Astatine-211 in Different Oxidation States"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, D. Scott [Univ. of Washington, Seattle, WA (United States)

    2011-12-14

    The overall objective of this research effort was to develop methods for labeling biomolecules with higher oxidation state species of At-211. This was to be done in an effort to develop reagents that had higher in vivo stability than the present carbon-bonded At-211-labeled compounds. We were unsuccessful in that effort, as none of the approaches studied provided reagents that were stable to in vivo deastatination. However, we gained a lot of information about At-211 in higher oxidation states. The studies proved to be very difficult as small changes in pH and other conditions appeared to change the nature of the species that obtained (by HPLC retention time analyses), with many of the species being unidentifiable. The fact that there are no stable isotopes of astatine, and the chemistry of the nearest halogen iodine is quite different, made it very difficult to interpret results of some experiments. With that said, we believe that a lot of valuable information was obtained from the studies. The research effort evaluated: (1) methods for chemical oxidation of At-211, (2) approaches to chelation of oxidized At-211, and (3) approaches to oxidation of astatophenyl compounds. A major hurdle that had to be surmounted to conduct the research was the development of HPLC conditions to separate and identify the various oxidized species formed. Attempts to develop conditions for separation of iodine and astatine species by normal and reversed-phase TLC and ITLC were not successful. However, we were successful in developing conditions (from a large number of attempts) to separate oxidized forms of iodine ([I-125]iodide, [I-125]iodate and [I-125]periodate) and astatine ([At-211]astatide, [At-211]astatate, [At-211]perastatate, and several unidentified At-211 species). Information on the basic oxidation and characterization of At-211 species is provided under Objective 1. Conditions were developed to obtain new At-211 labeling method where At-211 is chelated with the DOTA and

  6. 22 CFR 191.5 - Relationships among agencies.

    Science.gov (United States)

    2010-04-01

    ... Family Member of such employee, is determined to be eligible for benefits under this subchapter. (b) In... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Relationships among agencies. 191.5 Section 191... Relationships among agencies. (a) The Assistant Secretary of State for Administration shall promptly inform the...

  7. 40 CFR 191.15 - Individual protection requirements.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Individual protection requirements. 191.15 Section 191.15 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) RADIATION... Individual protection requirements. (a) Disposal systems for waste and any associated radioactive material...

  8. 40 CFR 191.25 - Compliance with other Federal regulations.

    Science.gov (United States)

    2010-07-01

    ... SPENT NUCLEAR FUEL, HIGH-LEVEL AND TRANSURANIC RADIOACTIVE WASTES Environmental Standards for Ground... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Compliance with other Federal regulations. 191.25 Section 191.25 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED...

  9. 49 CFR 192.191 - Design pressure of plastic fittings.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Design pressure of plastic fittings. 192.191... Components § 192.191 Design pressure of plastic fittings. (a) Thermosetting fittings for plastic pipe must conform to ASTM D 2517, (incorporated by reference, see § 192.7). (b) Thermoplastic fittings for plastic...

  10. 19 CFR 191.7 - General manufacturing drawback ruling.

    Science.gov (United States)

    2010-04-01

    ... Section 191.7 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY... production under § 191.2(q) of this subpart. (2) Computer-generated number. With the letter of acknowledgment the drawback office shall include the unique computer-generated number assigned to the acknowledgment...

  11. Decay out of the yrast superdeformed band in 191Hg

    International Nuclear Information System (INIS)

    Sien, S.; Reiter, P.; Khoo, T.; Lauritsen, T.; Carpenter, M. P.; Ahmad, I.; Amro, H.; Calderin, I.; Dossing, T.; Fischer, S. M.; Garg, U.; Gassmann, D.; Hackman, G.; Hannachi, F.; Janssens, R. V. F.; Kharraja, B.; Korichi, A.; Lopez-Martens, A.; Moore, E. F.; Nisius, D.; Schuck, C.

    1999-01-01

    The excitation energies and spins of the yrast superdeformed band in 191 Hg have been determined by analyzing the quasicontinuum spectrum connecting the superdeformed and normal-deformed states. The results from this analysis, combined with that given by one-step decay lines, give confident assignments of the spins and energies of the yrast superdeformed band in 191 Hg

  12. The zinc finger transcription factor 191 is required for early embryonic development and cell proliferation

    International Nuclear Information System (INIS)

    Li Jianzhong; Chen Xia; Yang Hua; Wang Shuiliang; Guo Baoyu; Yu Long; Wang Zhugang; Fu Jiliang

    2006-01-01

    Human zinc finger protein 191 (ZNF191/ZNF24) was cloned and characterized as a SCAN family member, which shows 94% identity to its mouse homologue zinc finger protein 191 (Zfp191). ZNF191 can specifically interact with an intronic polymorphic TCAT repeat (HUMTH01) in the tyrosine hydroxylase (TH) gene. Allelic variations of HUMTH01 have been stated to have a quantitative silencing effect on TH gene expression and to correlate with quantitative and qualitative changes in the binding by ZNF191. Zfp191 is widely expressed during embryonic development and in multiple tissues and organs in adult. To investigate the functions of Zfp191 in vivo, we have used homologous recombination to generate mice that are deficient in Zfp191. Heterozygous Zfp191 +/- mice are normal and fertile. Homozygous Zfp191 -/- embryos are severely retarded in development and die at approximately 7.5 days post-fertilization. Unexpectedly, in Zfp191 -/- and Zfp191 +/- embryos, TH gene expression is not affected. Blastocyst outgrowth experiments and the RNA interference-mediated knockdown of ZNF191 in cultured cells revealed an essential role for Zfp191 in cell proliferation. In further agreement with this function, no viable Zfp191 -/- cell lines were obtained by derivation of embryonic stem (ES) cells from blastocysts of Zfp191 +/- intercrosses or by forced homogenotization of heterozygous ES cells at high concentrations of G418. These data show that Zfp191 is indispensable for early embryonic development and cell proliferation

  13. The Low Energy Level Structure of {sup 191}lr

    Energy Technology Data Exchange (ETDEWEB)

    Malmskog, S G; Berg, V [AB Atomenergi, Nykoeping (Sweden); [Inst. of Physics, U niv. of Stockholm (Sweden); Baecklin, A; Hedin, G [Inst. of Physics, Univ. of Upp sala (Sweden)

    1970-02-15

    The decay of {sup 191}Pt to {sup 191}Ir has been investigated using Ge(Li)-detectors and a double focusing beta spectrometer. 35 transitions were observed and most of them were placed in a level scheme. Special attention was given to the low energy level band structure. Several multipolarity mixing ratios were determined from L-subshell ratio measurements. Using the delayed coincidence technique the half-life of the 179.05 keV level was measured to 40 {+-} 12 psec. The low level decay properties are discussed in terms of the Nilsson model with the inclusion of Coriolis coupling.

  14. 19 CFR 191.24 - Certificate of manufacture and delivery.

    Science.gov (United States)

    2010-04-01

    ... Section 191.24 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY... manufactured or produced under a general manufacturing drawback ruling, the unique computer-generated number... manufactured or produced under a specific manufacturing drawback ruling, either the unique computer number or...

  15. Estrabismo sensorial: estudo de 191 casos Sensorial strabismus: a study of 191 cases

    Directory of Open Access Journals (Sweden)

    Bráulio Folco Telles de Oliveira

    2006-02-01

    Full Text Available OBJETIVO: Avaliar os prontuários dos pacientes com estrabismo sensorial em aspectos variados, como etiologia, tipo e medida do desvio, correlação do tipo do desvio com a idade de aparecimento da doença de base, e resultado cirúrgico dos casos operados. MÉTODOS: Avaliação dos prontuários médicos dos pacientes com estrabismo sensorial atendidos no Hospital das Clínicas da Faculdade de Medicina da Universidade de São Paulo - USP - no setor de Motilidade Ocular Extrínseca, no período de setembro de 1990 a julho de 2002. RESULTADOS: Foram avaliados 84 pacientes masculinos e 107 femininos; o diagnóstico mais freqüente para baixa visual foi coriorretinite atrófica em 49 casos. Oitenta e sete pacientes tinham exotropia e 97 tinham esotropia. Oitenta e dois pacientes tiveram cirurgia indicada, e 50 foram operados. Em 42 deles, foi constatado sucesso cirúrgico de 90,5% (desvio longe e perto menor ou igual a 15 dioptrias prismáticas. CONCLUSÕES: O bom resultado cirúrgico observado neste e em outros estudos reforça a necessidade da correção cirúrgica nesses casos.PURPOSE: To evaluate the charts of patients with sensorial strabismus regarding range of different aspects, such as etiology, the type and the amount of deviation, relationship between the type of deviation and the patient's age when the disease occurred and the surgical outcome. METHODS: A retrospective analysis of data charts of 191 patients seen at the section of Ophthalmology at the University of São Paulo, from September 1990 to July 2002. RESULTS: There were 84 male and 107 female patients. The most frequent diagnosis responsible for low vision in the squinted eye was atrophic chorioretinitis in 49 patients. Eighty-seven were exotropes and 97 were esotropes. Fifty patients were operated on, but 8 of them were lost to follow-up. In 90.5% the surgical outcome was successful: less than 15 prismatic diopters of hyper or undercorrection after surgery. CONCLUSIONS: The

  16. Mutation induction in Haemophilus influenzae by ICR-191. Pt. 1

    International Nuclear Information System (INIS)

    Perdue, S.W.; Kimball, R.F.; McGray, P.C.; Tennessee Univ., Oak Ridge

    1981-01-01

    The investigation of mutagenic mechanisms in Haemophilus influenzae has been confined until now to mutagens that normally produce mainly base pair substitutions. This paper describes the development of a system suitable for detecting frameshift mutations induced by ICR-191. The system involves reversions from thymidine dependence to thymidine independence. Evidence is presented from a comparison of the responses to ICR-191 and to N-methyl-N'-nitro-N-nitrosoguanidine that the system is specific for frameshift mutations. The genetic recombination involved in transformation leads to a marked increase in spontaneous reversion of the frameshift mutations but not of the base substitution mutations. Presumably, this is a consequence of mispairing, with consequent change in the number of bases, during the recombination. (orig.)

  17. 28 CFR 0.191 - Changes which affect the overall structure of the Department.

    Science.gov (United States)

    2010-07-01

    ... structure of the Department. 0.191 Section 0.191 Judicial Administration DEPARTMENT OF JUSTICE ORGANIZATION OF THE DEPARTMENT OF JUSTICE Sections and Subunits § 0.191 Changes which affect the overall structure of the Department. Changes to the overall structure of the Department include: The establishment...

  18. 40 CFR Appendix B to Part 191 - Calculation of Annual Committed Effective Dose

    Science.gov (United States)

    2010-07-01

    ... SPENT NUCLEAR FUEL, HIGH-LEVEL AND TRANSURANIC RADIOACTIVE WASTES Pt. 191, App. B Appendix B to Part 191... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Calculation of Annual Committed Effective Dose B Appendix B to Part 191 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED...

  19. 37 CFR 2.191 - Business to be transacted in writing.

    Science.gov (United States)

    2010-07-01

    ... Trademark Cases § 2.191 Business to be transacted in writing. All business with the Office should be... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Business to be transacted in writing. 2.191 Section 2.191 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE...

  20. 27 CFR 479.191 - Applicability of other provisions of internal revenue laws.

    Science.gov (United States)

    2010-04-01

    ... GUNS, DESTRUCTIVE DEVICES, AND CERTAIN OTHER FIREARMS Other Laws Applicable § 479.191 Applicability of other provisions of internal revenue laws. All of the provisions of the internal revenue laws not... provisions of internal revenue laws. 479.191 Section 479.191 Alcohol, Tobacco Products, and Firearms BUREAU...

  1. 9 CFR 381.191 - Distribution of inspected products to small lot buyers.

    Science.gov (United States)

    2010-01-01

    ... small lot buyers. 381.191 Section 381.191 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE...; Exportation; or Sale of Poultry or Poultry Products § 381.191 Distribution of inspected products to small lot... small lot buyers (such as small restaurants), distributors or jobbers may remove inspected and passed...

  2. 19 CFR 191.184 - Merchandise transferred from continuous Customs custody.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Merchandise transferred from continuous Customs custody. 191.184 Section 191.184 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND... From Customs Territory § 191.184 Merchandise transferred from continuous Customs custody. (a) Procedure...

  3. 19 CFR 191.71 - Drawback on articles destroyed under Customs supervision.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Drawback on articles destroyed under Customs supervision. 191.71 Section 191.71 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) DRAWBACK Exportation and Destruction § 191.71 Drawback on articles destroyed under Customs...

  4. 19 CFR 191.173 - Imported duty-paid derivatives (no manufacture).

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Imported duty-paid derivatives (no manufacture). 191.173 Section 191.173 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND... § 191.173 Imported duty-paid derivatives (no manufacture). When the basis for drawback under 19 U.S.C...

  5. RDM Lifetime measurements in ^191Hg using the Gammasphere Plunger

    Science.gov (United States)

    Jin, H.; Kharraja, B.; Garg, U.; Ghugre, S. S.; Carpenter, M. P.; Fischer, S.; Janssens, R. V. F.; Khoo, T. L.; Lauritsen, T.; Nisius, D.; Kaczarowski, R.; Govil, I. M.; Kruecken, R.; Machiavelli, A.; MacLeod, R.

    1998-10-01

    Recoil Distance Lifetime Measurements have been performed for the nucleus ^191Hg at Gammasphere with a view to further investigate the prolate non-collective structure (ɛ2 = 0.1 - 0.15, γ ~= - 120^circ) reported several years ago by D. Ye et al. (D. Ye et al.,) Phys. Lett. B236, 7 (1990) The ^174Yb(^22Ne, 5n) reaction was employed at a beam energy of 120 MeV. In this experiment the new Gammasphere Plunger was used for the first time. Data were collected at 7 distances ranging from 50 μm to 1070 μm. The extracted lifetimes for the level sequence of interest are in the range of ~ 7 ps to 120 ps, leading to transition probabilities that indeed correspond to a non-collective nature.

  6. Pharmocokinetics of the antitumor drug oxoplatinum labelled with 191Pt

    International Nuclear Information System (INIS)

    Lobanova, E.A.

    1985-01-01

    A pharmacokinetic study of the antitumor drug oxoplatinum labeled with 191 Pt when agministered to control mice and mice with B-16 melanoma have shown that distribution of the drug in organs and tissues in both groups of animals is nonuniform. The drug is more tropic to the kidneys, liver, spleen, adrenals, thymus, skin and tumor. Correlation was established between the values of the coefficient ratios of differential accumulation (CDA) of the organ/blood in the f;.nal and initial periods of observation and the period of the drug half-life in the organs. The higher the CDA of the organ/blood the longer the period of the drug half-life. The excretion of the drug from the blood and most other organs is described by a bioexponential curve

  7. Accelerated fatigue testing of LM 19.1 blades

    DEFF Research Database (Denmark)

    Kristensen, Ole Jesper Dahl; Jørgensen, E.

    2003-01-01

    A series of 19.1 metre wind turbine blades manufactured by LM Glasfiber A/S of Lunderskov, Denmark were subjected to a series of flapwise fatigue tests. The object of these fatigue tests is to evaluate the impact of an increased load on the blade in afatigue test and to give information...... if it is possible to increase the load in fatigue test to shorten test time. The tests were carried out as a part of a project financed by the Danish Energy Agency. During the fatigue tests the blades have beensurveyed with thermal imaging equipment to determine how an increase in fatigue load affects the blade...... material. In addition to the thermal imaging surveillance the blades were instrumented with strain gauges. This report presents the temperature duringtest, calibration test results, moment range measurements, strain statistics, thermal imaging registrations and a determination of the size and cause...

  8. Biological fate of a single administration of 191Pt in rats following different routes of exposure

    International Nuclear Information System (INIS)

    Moore, W. Jr.; Hysell, D.; Crocker, W.; Stara, J.

    1975-01-01

    The retention, tissue distribution, and excretion of 191 Pt in adult rats was determined following oral, intravenous (IV), and intratracheal administration. The highest retention was obtained following IV dosing, and lowest retention (less than 0.5 percent) occurred after oral dosing. Tissues containing the highest concentrations of 191 Pt following IV administration were the kidney, adrenal, spleen, and liver. Following a single oral dose, almost all of the 191 Pt was excreted in the feces due to nonabsorption, whereas after IV dosing, similar quantities were excreted in both the urine and feces. Following IV dosing of pregnant rats, 191 Pt was found in all the fetuses; however, the amount was small

  9. Influence of pH adjustment agents on the biologic behavior of osmium-191 impurity in iridium-191m generator eluates

    International Nuclear Information System (INIS)

    Weininger, J.; Issachar, D.; Lubin, E.; Zabari, M.; Trumper, J.

    1990-01-01

    The influence of four pH adjustment agents on the biologic behavior of osmium-191 (191Os) impurity in 191Os/191mIr generator eluates was studied. Extended body clearance and biodistribution studies were performed in mice. The solutions to be injected were obtained by eluting generators with a 0.9% NaCl solution at pH 1. The pH of these eluates was adjusted to 5-9 with succinate, phosphate, lysine or NaOH solution. Our results demonstrate that the biologic behavior of these generator eluates is significantly dependent on the agent used for pH adjustment. Buffering with lysine leads to the best results: (a) the mice show no adverse reaction after injection of 150 human doses and the body clearance is very rapid and (b) more than 75% I.D. at 24 hr postinjection. Preliminary calculations based on these results suggest a significant decrease in the estimated patient radiation dose when lysine buffered 191Os/191mIr generator eluates are used for radionuclide angiography

  10. 13 CFR 120.191 - The contents of a business loan application.

    Science.gov (United States)

    2010-01-01

    ..., among other things, a description of the history and nature of the business, the amount and purpose of... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false The contents of a business loan application. 120.191 Section 120.191 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS...

  11. 40 CFR Appendix C to Part 191 - Guidance for Implementation of Subpart B

    Science.gov (United States)

    2010-07-01

    ... to make use of rather complex computational models, analytical theories, and prevalent expert... established in §§ 191.15 and 191.16, respectively. The Agency assumes that compliance can be determined based... exploratory drilling for resources (other than any provided by the disposal system itself) can be the most...

  12. 19 CFR 191.1 - Authority of the Commissioner of Customs.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Authority of the Commissioner of Customs. 191.1 Section 191.1 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY... Customs. Pursuant to Treasury Department Order No. 165, Revised (T.D. 53654, 19 FR 7241), as amended, the...

  13. 50 CFR 216.191 - Designation of Offshore Biologically Important Marine Mammal Areas.

    Science.gov (United States)

    2010-10-01

    ...) Detailed information on the biology of marine mammals within the area, including estimated population size... Important Marine Mammal Areas. 216.191 Section 216.191 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS...

  14. Performance of different metrics proposed to CIE TC 1-91

    NARCIS (Netherlands)

    Bhusal, P.; Dangol, R.

    2017-01-01

    The main aim of the article is to find out the performance of different metrics proposed to CIE TC 1-91. Currently, six different indexes have been proposed to CIE TC 1-91: Colour Quality Scale (CQS), Feeling of Contrast Index (FCI), Memory colour rendering index (MCRI), Preference of skin (PS),

  15. Hyperfine structure of six low-lying fine structure levels of 191Ir and 193Ir and the 191Δs193 hyperfine anomaly

    International Nuclear Information System (INIS)

    Buettgenbach, S.; Dicke, R.; Gebauer, H.; Kuhnen, R.; Traeber, F.

    1978-01-01

    The hyperfine interaction constants A and B of six low-lying metastable fine structure states of the two iridium isotopes 191 Ir and 193 Ir and the electronic g-factors of these levels have been measured using the atomic-beam magnetic-resonance method. From the values of the magnetic-dipole interaction constants A, corrected for off-diagonal perturbations, we extracted the hyperfine anomaly of a pure 6s-electron state: 191 Δs 193 = 0.64(7)%. Using nonrelativistic approximations for the effective radial parameters the nuclear electric-quadrupole moments were obtained: Q( 191 Ir) = 0.81(21)b, Q( 193 Ir) = 0.73(19)b (corrected for Sternheimer shielding effects). (orig.) [de

  16. Structure of $^{191}$Pb from $\\alpha$- and $\\beta$-decay spectroscopy

    CERN Document Server

    Cocolios, T E; Van de Walle, J; Franchoo, S; Marsh, B A; Sjoedin, A M; Huyse, M; Zemlyanoy, S; Cocolios, T E; Bastin, B; Barzakh, A; Page, R D; Mane, E; Van Duppen, P; Darby, I G; Venhart, M; Kudryavtsev, Yu; Huber, G; Fedosseev, V N; Andreyev, A N; Keupers, M; Flanagan, K T; Stefan, I; Dexters, W; Koester, U; Antalic, S; Buscher, J; Molkanov, P; Fedorov, D V

    2010-01-01

    Complementary studies of $^{191}$Pb have been made in the $\\beta$- decay of $^{191}$Bi at LISOL (CRC) and in the $\\alpha$- decay of $^{195}$Po at ISOLDE (CERN). Fine structures in the $\\alpha$- decay of the low-spin and high-spin isomers of $^{195}$Po have been fully resolved. Identification of the parent state is made possible via isomer selection based on narrow-band laser frequency scanning. The $\\alpha$-particle and $\\gamma$-ray energies have been determined with greater precision. New $\\alpha$-particle and $\\gamma$-ray energies are identified. Branching ratios in the decay of $^{195}$Po and $^{191}$Pb have been examined.

  17. Ferimentos cervicais: análise retrospectiva de 191 casos

    Directory of Open Access Journals (Sweden)

    Luiz Carlos Von Bahten

    Full Text Available OBJETIVOS: Analisar a epidemiologia e a conduta nos ferimentos cervicais. MÉTODO: Foram analisados 487.128 prontuários de pacientes que ingressaram no Serviço de Emergência do Hospital Universitário Cajuru no período de 01/1996 a 06/2001. Destes, selecionaram-se 378 pacientes com ferimentos cervicais. Foram excluídos 153 que apresentavam lesões associadas e 14 por óbito no atendimento inicial. O estudo foi feito , assim, em 191 pacientes com lesões cervicais exclusivas. Avaliou-se a localização da ferida, o mecanismo de trauma, o comprometimento do platisma, sinais e sintomas, a hora de admissão e a conduta empregada. RESULTADOS: Cento e sessenta e quatro (86% pacientes eram masculinos. A média de idade foi de 28 anos (10-72. Noventa (47% ferimentos foram por arma de fogo (FAF e 88 (46% por arma branca (FAB. O principal horário de admissão foi entre 20 e 04 horas. Quanto à localização, 53% das lesões foram à esquerda, 45% à direita e 2% medianos; 36% em zona I, 55% em zona II e 9% em zona III. Em 101 o ferimento penetrou o platisma: cinqüenta e um (50% apresentaram sinais e sintomas clínicos e receberam conduta operatória. As lesões vasculares foram as mais encontradas (20. Houve 24 (47% cervicotomias não-terapêuticas. O tratamento conservador foi empregado em 41 (45% casos de acordo com os exames físico e complementares. CONCLUSÕES: Homens jovens são mais acometidos quanto aos ferimentos cervicais. Estes ocorrem mais freqüentemente na zona II, e a incidência dos FAF e FAB foi equivalente. É adequado um manejo mais seletivo em relação aos ferimentos cervicais, devendo o manejo da zona II adequar-se à disposição de recursos dos serviços de trauma.

  18. 77 FR 57594 - Comment Request for Information Collection for the ETA 191, Statement of Expenditures and...

    Science.gov (United States)

    2012-09-18

    ... DEPARTMENT OF LABOR Employment and Training Administration Comment Request for Information Collection for the ETA 191, Statement of Expenditures and Financial Adjustments of Federal Funds for Unemployment Compensation for Federal Employees and Ex- Servicemembers Report, Extension Without Revisions...

  19. Iridium-191m radionuclide angiocardiography detection and quantitation of left-to-rigth shunts

    International Nuclear Information System (INIS)

    Treves, S.; Fujii, A.; Cheng, C.; Kuruc, A.

    1983-01-01

    The purpose of this study was to determine whether Iridium-191m (Ir-191m) could replace Technetium-99m (Tc-99m) in the detection and quantitation of left-to-right shunts. It was demonstrated that Ir-191m radionuclide angiography is a safe, rapid, and accurate method for the detection and quantitation of left-to-right shunts with very low radiation dose to the patient. It is also possible with this radiotracer to evaluate other aspects of the anatomy and physiology of the circulation such as ventricular function, patency of major vessels, renal and cerebral perfusion. Further improvements on 0s-191 production, generator design and gamma cameras would expand the use of this ultrashort-lived radionuclide

  20. Performance of different colour quality metrics proposed to CIE TC 1-91

    OpenAIRE

    Bhusal, Pramod; Dangol, Rajendra

    2017-01-01

    The main aim of the article is to find out the performance of different metrics proposed to CIE TC 1-91. Currently, six different indexes have been proposed to CIE TC 1-91: Colour Quality Scale (CQS), Feeling of Contrast Index (FCI), Memory colour rendering index (MCRI), Preference of skin (PS), Relative gamut area index (RGAI) and Illuminating Engineering society Method for evaluating light source colour rendition (IES TM-30). The evaluation and analysis are based on previously conducted exp...

  1. P53-miR-191-SOX4 regulatory loop affects apoptosis in breast cancer.

    Science.gov (United States)

    Sharma, Shivani; Nagpal, Neha; Ghosh, Prahlad C; Kulshreshtha, Ritu

    2017-08-01

    miRNAs have emerged as key participants of p53 signaling pathways because they regulate or are regulated by p53. Here, we provide the first study demonstrating direct regulation of an oncogenic miRNA, miR-191-5p, by p53 and existence of a regulatory feedback loop. Using a combination of qRT-PCR, promoter-luciferase, and chromatin-immunoprecipitation assays, we show that p53 brings about down-regulation of miR-191-5p in breast cancer. miR-191-5p overexpression brought about inhibition of apoptosis in breast cancer cell lines (MCF7 and ZR-75) as demonstrated by reduction in annexin-V stained cells and caspase 3/7 activity, whereas miR-191-5p down-regulation showed the opposite. We further unveiled that SOX4 was a direct target of miR-191-5p. SOX4 overexpression was shown to increase p53 protein levels in MCF7 cells. miR-191-5p overexpression brought about down-regulation of SOX4 and thus p53 levels, suggesting the existence of a regulatory feedback loop. Breast cancer treatment by doxorubicin, an anti-cancer drug, involves induction of apoptosis by p53; we thus wanted to check whether miR-191-5p affects doxorubicin sensitivity. Interestingly, Anti-miR-191 treatment significantly decreased the IC50 of the doxorubicin drug and thus sensitized breast cancer cells to doxorubicin treatment by promoting apoptosis. Overall, this work highlights the importance of the p53-miR-191- SOX4 axis in the regulation of apoptosis and drug resistance in breast cancer and offers a preclinical proof-of-concept for use of an Anti-miR-191 and doxorubicin combination as a rational approach to pursue for better breast cancer treatment. © 2017 Sharma et al.; Published by Cold Spring Harbor Laboratory Press for the RNA Society.

  2. Search for entrance-channel dependence in the population of superdeformed bands in {sup 191}Hg

    Energy Technology Data Exchange (ETDEWEB)

    Soramel, F.; Khoo, T.L.; Janssens, R.V.F. [and others

    1995-08-01

    The population intensity of some SD bands in the mass 150 region were observed to depend on the mass symmetry of the entrance channel in the fusion reaction. The authors raised the possibility that the population of SD bands had a memory of the entrance channel. To check this interesting possibility, we made measurements of the population intensities of superdeformed (SD) bands in the {sup 160}Gd({sup 36}S,5n){sup 191}Hg and {sup 130}Te({sup 64}Ni,3n){sup 191}Hg reactions. To ensure that any observed effect was not due to a simple angular momentum difference in the entrance channels, we also measured the average entry points and spin distributions of normal and SD states in {sup 191}Hg in the two reactions. The entry points and spin distributions for {sup 191}Hg are the same and, indeed, so are the SD intensities in the two reactions. Hence, no entrance-channel effect is observed in the population of the SD band in {sup 191}Hg, in contrast with data for SD bands in the mass 150 regions. We suggest that the effect observed previously in the mass 150 region is due to an angular momentum effect. A letter reporting our results was submitted for publication.

  3. Studies of radioactive cisplatin ({sup 191}Pt) for tumour imaging and therapy

    Energy Technology Data Exchange (ETDEWEB)

    Areberg, J

    2000-01-01

    A radioactive variant of the cytostatic agent cis-dichlorodiammineplatinum(II), cisplatin, was synthesised from {sup 191}PtCl{sub 4}. The {sup 191}Pt-cisplatin was found to be a sterile product of high radionuclide, radiochemical and chemical purity. The pharmacokinetics of platinum in tumour tissue and organs at risk of fourteen patients undergoing treatment with cisplatin were studied by exchanging a small fraction of the prescribed amount of cisplatin with {sup 191}Pt-cisplatin. The uptake and retention of platinum were investigated by gamma camera measurements up to ten days after infusion of {sup 191}Pt-cisplatin. Highest concentration of platinum was found in the liver, on average 5.7 {+-} 0.5 {mu}g/g normalised to a given amount of 180 mg cisplatin. Corresponding value for the kidneys was 1.9 {+-} 0.3 {mu}g/g. Uptake of platinum in tumours was visualised in five patients with an average maximum concentration of 4.9 {+-} 1.0 {mu}g/g normalised to a given amount of 180 mg cisplatin. The data from the pharmacokinetic study was used together with data from the literature to estimate the absorbed dose and effective dose to patients receiving radioactive cisplatin. The effective doses were calculated to be 0.10 {+-} 0.02 mSv/MBq, 0.17 {+-} 0.04 mSv/MBq and 0.23 {+-} 0.05 mSv/MBq for {sup 191}Pt-, {sup 193m}Pt-, and {sup 195m}Pt-cisplatin respectively. The combined effect of the radio- and chemotoxicity from {sup 191}Pt-cisplatin was investigated both in vitro and in vivo. A cervical cancer cell line was incubated with cisplatin or {sup 191}Pt-cisplatin with various concentrations and specific activities. It was shown that the surviving fraction was smaller for cells treated with {sup 191}Pt-cisplatin than for cells treated with the same concentration of non-radioactive cisplatin. The surviving fraction decreased with increasing specific activity. Isobologram technique showed that the radio- and chemotoxicity interacted in a supra-additive (synergistic) manner. In

  4. Studies of radioactive cisplatin (191Pt) for tumour imaging and therapy

    International Nuclear Information System (INIS)

    Areberg, J.

    2000-01-01

    A radioactive variant of the cytostatic agent cis-dichlorodiammineplatinum(II), cisplatin, was synthesised from 191 PtCl 4 . The 191 Pt-cisplatin was found to be a sterile product of high radionuclide, radiochemical and chemical purity. The pharmacokinetics of platinum in tumour tissue and organs at risk of fourteen patients undergoing treatment with cisplatin were studied by exchanging a small fraction of the prescribed amount of cisplatin with 191 Pt-cisplatin. The uptake and retention of platinum were investigated by gamma camera measurements up to ten days after infusion of 191 Pt-cisplatin. Highest concentration of platinum was found in the liver, on average 5.7 ± 0.5 μg/g normalised to a given amount of 180 mg cisplatin. Corresponding value for the kidneys was 1.9 ± 0.3 μg/g. Uptake of platinum in tumours was visualised in five patients with an average maximum concentration of 4.9 ± 1.0 μg/g normalised to a given amount of 180 mg cisplatin. The data from the pharmacokinetic study was used together with data from the literature to estimate the absorbed dose and effective dose to patients receiving radioactive cisplatin. The effective doses were calculated to be 0.10 ± 0.02 mSv/MBq, 0.17 ± 0.04 mSv/MBq and 0.23 ± 0.05 mSv/MBq for 191 Pt-, 193m Pt-, and 195m Pt-cisplatin respectively. The combined effect of the radio- and chemotoxicity from 191 Pt-cisplatin was investigated both in vitro and in vivo. A cervical cancer cell line was incubated with cisplatin or 191 Pt-cisplatin with various concentrations and specific activities. It was shown that the surviving fraction was smaller for cells treated with 191 Pt-cisplatin than for cells treated with the same concentration of non-radioactive cisplatin. The surviving fraction decreased with increasing specific activity. Isobologram technique showed that the radio- and chemotoxicity interacted in a supra-additive (synergistic) manner. In an in vivo model, nude mice with xenografted tumours were given

  5. Measurement of the ground state spectroscopic quadrupole moments of 191Os and 193Os

    International Nuclear Information System (INIS)

    Ernst, H.; Hagn, E.; Zech, E.

    1979-01-01

    Radioactive 191 Os and 193 Os nuclei have been aligned in an Os single crystal at temperatures down to 4 mK. From the temperature dependence of the γ-anisotropy the quadrupole frequencies vsub(Q) = e 2 qQ/h have been determined as vsub(Q)( 191 OsOs) = -278+-9 MHz and vsub(Q)( 193 OsOs) = -96+-15 MHz. With the known electric field gradient for OsOs of eq = (-4.54+-0.24) x 10 17 V/cm 2 the ground state spectroscopic quadrupole moments are deduced to be Q( 191 Os) = +2.53+-0.16 b and Q( 193 Os) = +0.87+-0.15 b. (orig.)

  6. Extreme ultraviolet spectroscopy of G191-B2B - Direct observation of ionization edges

    Science.gov (United States)

    Wilkinson, Erik; Green, James C.; Cash, Webster

    1992-01-01

    We present the first spectrum of the hot, DA white dwarf G191-B2B (wd 0501 + 527) between 200 and 330 A. The spectrum, which has about 2 A resolution, was obtained with a sounding rocket-borne, grazing incidence spectrograph. The spectrum shows no evidence of He II, the expected primary opacity source in this wavelength region. Three ionization edges and one absorption feature were observed and are suggestive of O III existing in the photosphere of G191-B2B. Also noted is a broad spectral depression that may result from Fe VI in the photosphere.

  7. 26 CFR 31.3121(b)(19)-1 - Services of certain nonresident aliens.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 15 2010-04-01 2010-04-01 false Services of certain nonresident aliens. 31.3121... 1954) General Provisions § 31.3121(b)(19)-1 Services of certain nonresident aliens. (a) (1) Services performed after 1961 by a nonresident alien individual who is temporarily present in the United States as a...

  8. Apiano de Alejandría, traductor (BC IV 45 y V 191

    Directory of Open Access Journals (Sweden)

    José B. Torres

    2006-06-01

    Full Text Available This paper defends that Appian regards as translations two passages in his work (cfr. BC IV 45 and V 191. Both translations show different features which may be explained from the point of view of ancient theories concerning translation.

  9. 30 CFR 250.191 - How does MMS conduct incident investigations?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false How does MMS conduct incident investigations... Reporting Requirements § 250.191 How does MMS conduct incident investigations? Any investigation that MMS... meetings conducted by a chairperson appointed by MMS. The following requirements apply to any panel...

  10. 26 CFR 1.501(c)(19)-1 - War veterans organizations.

    Science.gov (United States)

    2010-04-01

    ...) INCOME TAX (CONTINUED) INCOME TAXES (CONTINUED) Exempt Organizations § 1.501(c)(19)-1 War veterans... members of the United States Armed Forces, (iii) Cadets (including only students in college or university... provision described in § 1.501(c)(3)-1(b)(4). (2) The corpus or income cannot be diverted or used other than...

  11. Critical comments on the US Environmental Protection Agency Standards 40 CFR 191

    International Nuclear Information System (INIS)

    Pflum, C.G.; Van Konynenburg, R.A.; Krishna, P.

    1993-01-01

    This paper is about the US Environmental Protection Agency (EPA) ''Environmental Standards for the Disposal of Spent Nuclear Fuel, High-Level and Transuranic Wastes,'' 40 CFR 191. These standards regulate the disposal of radioactive wastes in geologic repositories. Currently, two repository sites are under investigation: The Waste Isolation Pilot Plant (WIPP) site, located near Carlsbad, New Mexico, may become the repository for defense-generated transuranic waste (TRU); and the Yucca Mountain site, located near Las Vegas, Nevada, may become the repository for spent reactor fuel and a small amount of reprocessing waste (hereinafter called high-level radioactive waste or HLW). The paper was written for readers who have an interest in 40 CFR 191 but do not have the time or inclination to ponder the technical details

  12. Performance of different metrics proposed to CIE TC 1-91

    Directory of Open Access Journals (Sweden)

    Pramod Bhusal

    2017-12-01

    Full Text Available The main aim of the article is to find out the performance of different metrics proposed to CIE TC 1-91. Currently, six different indexes have been proposed to CIE TC 1-91: Colour Quality Scale (CQS, Feeling of Contrast Index (FCI, Memory colour rendering index (MCRI, Preference of skin (PS, Relative gamut area index (RGAI and Illuminating Engineering society Method for evaluating light source colour rendition (IES TM-30. The evaluation and analysis are based on previously conducted experiment in lighting booth. The analysis showed the area based metric FCI was good subjective preference indicator. The subjective preference was measured in terms of naturalness of objects, colourfulness of colour checker chart, and the visual appearance of the lit scene in the booth.

  13. Reagents for Astatination of Biomolecules. 5. Evaluation of hydrazone linkers in 211At- and 125I-labeled closo-decaborate(2-) conjugates of Fab′ as a means of decreasing kidney retention

    Science.gov (United States)

    Wilbur, D. Scott; Chyan, Ming-Kuan; Hamlin, Donald K.; Nguyen, Holly; Vessella, Robert L.

    2011-01-01

    Evaluation of monoclonal antibody (MAb) fragments (e.g. Fab′, Fab or engineered fragments) as cancer-targeting reagents for therapy with the α-particle emitting radionuclide astatine-211 (211At) has been hampered by low in vivo stability of the label and a propensity of these proteins localize to kidneys. Fortunately, our group has shown that the low stability of the 211At label, generally a meta- or para-[211At]astatobenzoyl conjugate, on MAb Fab′ fragments can be dramatically improved by use of closo-decaborate(2-) conjugates. However, the higher stability of radiolabeled MAb Fab′ conjugates appears to result in retention of the radioactivity in kidneys. This investigation was conducted to evaluate whether the retention of radioactivity in kidney might be decreased by the use of acid-cleavable hydrazone between the Fab′ and the radiolabeled closo-decaborate(2-) moiety. Five conjugation reagents containing sulfhydryl-reactive maleimide groups, a hydrazone functionality and a closo-decaborate(2-) moiety were prepared. In four of the five conjugation reagents, a discrete polyethylene glycol (PEG) linker was used, and one substituent adjacent to the hydrazone was varied (phenyl, benzoate, anisole or methyl) to provide varying acid-sensitivity. In the initial studies, the five maleimido-closo-decaborate(2-) conjugation reagents were radioiodinated (125I or 131I), then conjugated with an anti-PSMA Fab′ (107-1A4 Fab′). Biodistributions of the five radioiodinated Fab′ conjugates were obtained in nude mice at 1, 4 and 24 h post injection (pi). In contrast to closo-decaborate(2-) conjugated to 107-1A4 Fab′ through a non-cleavable linker, two conjugates containing either a benzoate or a methyl substituent on the hydrazone functionality displayed clearance rates from kidney, liver and spleen that were similar to those obtained with directly radioiodinated Fab′ (i.e. no conjugate). The maleimido-closo-decaborate(2-) conjugation reagent containing a benzoate

  14. Possible detection of an emission feature near 584 A in the direction of G191-B2B

    Science.gov (United States)

    Green, James; Bowyer, Stuart; Jelinsky, Patrick

    1990-01-01

    A possible spectral emission feature is reported in the direction of the nearby hot white dwarf G191-B2B at 581.5 + or - 6 A with a significance of 3.8 sigma. This emission has been identified as He I 584.3 A. The emission cannot be due to local geocoronal emission or interplanetary backscatter of solar He I 584 A emission because the feature is not detected in a nearby sky exposure. Possible sources for this emission are examined, including the photosphere of G191-B2B, the comparison star G191-B2A, and a possible nebulosity near or around G191-B2B. The parameters required to explain the emission are derived for each case. All of these explanations require unexpected physical conditions; hence we believe this result must receive confirming verification despite the statistical likelihood of the detection.

  15. Possible detection of an emission feature near 584 A in the direction of G191-B2B

    International Nuclear Information System (INIS)

    Green, J.; Bowyer, S.; Jelinsky, P.

    1990-01-01

    A possible spectral emission feature is reported in the direction of the nearby hot white dwarf G191-B2B at 581.5 + or - 6 A with a significance of 3.8 sigma. This emission has been identified as He I 584.3 A. The emission cannot be due to local geocoronal emission or interplanetary backscatter of solar He I 584 A emission because the feature is not detected in a nearby sky exposure. Possible sources for this emission are examined, including the photosphere of G191-B2B, the comparison star G191-B2A, and a possible nebulosity near or around G191-B2B. The parameters required to explain the emission are derived for each case. All of these explanations require unexpected physical conditions; hence we believe this result must receive confirming verification despite the statistical likelihood of the detection. 15 refs

  16. Novel genetic variants in miR-191 gene and familial ovarian cancer

    International Nuclear Information System (INIS)

    Shen, Jie; DiCioccio, Richard; Odunsi, Kunle; Lele, Shashikant B; Zhao, Hua

    2010-01-01

    Half of the familial aggregation of ovarian cancer can't be explained by any known risk genes, suggesting the existence of other genetic risk factors. Some of these unknown factors may not be traditional protein encoding genes. MicroRNA (miRNA) plays a critical role in tumorigenesis, but it is still unknown if variants in miRNA genes lead to predisposition to cancer. Considering the fact that miRNA regulates a number of tumor suppressor genes (TSGs) and oncogenes, genetic variations in miRNA genes could affect the levels of expression of TSGs or oncogenes and, thereby, cancer risk. To test this hypothesis in familial ovarian cancer, we screened for genetic variants in thirty selected miRNA genes, which are predicted to regulate key ovarian cancer genes and are reported to be misexpressed in ovarian tumor tissues, in eighty-three patients with familial ovarian cancer. All of the patients are non-carriers of any known BRCA1/2 or mismatch repair (MMR) gene mutations. Seven novel genetic variants were observed in four primary or precursor miRNA genes. Among them, three rare variants were found in the precursor or primary precursor of the miR-191 gene. In functional assays, the one variant located in the precursor of miR-191 resulted in conformational changes in the predicted secondary structures, and consequently altered the expression of mature miR-191. In further analysis, we found that this particular variant exists in five family members who had ovarian cancer. Our findings suggest that there are novel genetic variants in miRNA genes, and those certain genetic variants in miRNA genes can affect the expression of mature miRNAs and, consequently, might alter the regulation of TSGs or oncogenes. Additionally, the variant might be potentially associated with the development of familial ovarian cancer

  17. Clinical analysis and follow-up of 191 cases of lacrimal gland occupying lesions

    Directory of Open Access Journals (Sweden)

    Peng-Peng Wu

    2017-02-01

    Full Text Available AIM: To investigate the clinical characteristics and follow-up of 191 patients with lacrimal glandoccupying lesions. METHODS: We selected 191 patients(221 eyeswith lacrimal gland occupancy from January 2011 to August 2015. All patients underwent lacrimal gland tumor removal and were followed up for 1a. RESULTS: In the 191 patients(221 eyes, 44 were male(49 eyesand 147 were female(172 eyes. There were inflammatory lesions in 171 eyes, constituted by IgG4 sclerosing dacryocystitis 66 eyes, 27 eyes of chronic lacrimal gland, lacrimal gland prolapse with inflammatory enlargement 54 eyes, Grave's disease in 24 eyes; 16 eyes of lymphoid hyperplastic lesions, constituted by malignant lymphoma in 6 eyes, benign lymphoid hyperplasia in 10 eyes; epithelial lesions in 34 eyes, constituted by pleomorphic adenoma in 26 eyes, 2 eyes of pleomorphic adenocarcinoma, adenoid cystic carcinoma in 3 eyes, 3 eyes of adenocarcinoma. Lacrimal glandoccupying lesions with IgG4 sclerosing dacryocystitis, lacrimal gland prolapse associated with inflammatory enlargement were the most common, of which 159 eyes of Han, Uighur 36 eyes, Kazak 16 eyes, 10 eyes of Mongolian. After surgery, mainly symptoms were dry eye, crying with no tears, with bilateral lacrimal gland removed significantly, but the local use of artificial tears can ease those symptoms with no serious adverse reactions. CONCLUSION: History and imaging characteristics of lacrimal gland-occupying lesions give a great help to the diagnosis and differential diagnosis. In Xinjiang region, lacrimal gland, with non-epithelial lesions is the most common, followed by epithelial lesions, occurred in the Han, Uighur patients, and rare occurred in other ethnic. Dry eye after surgery and crying with no tears are the main symptoms. Patients with short course of disease and dry eye tend to delay the removal of patients.

  18. Multifrequency VLA observations of PKS 0745-191: the archetypal 'cooling flow' radio source?

    International Nuclear Information System (INIS)

    Baum, S.A.; O'Dea, C.P.

    1991-01-01

    We present 90-, 20-, 6- and 2-cm VLA observations of the high radio luminosity, cooling flow radio source PKS 0745-191. We find that the radio source has a core with a very steep spectrum and diffuse emission with an even steeper spectrum without clear indications of the jets, hotspots or double lobes found in other radio sources of comparable luminosity. The appearance of the source is highly dependent on frequency and resolution. This dependence reflects both the diffuse nature of the extended emission and the steep, but position-dependent, spectrum of the radio emission. (author)

  19. Towards a Standardized Line List for G 191-B2B and other DA Type Objects

    Science.gov (United States)

    Preval, S. P.; Barstow, M. A.; Holberg, J. B.; Dickinson, N. J.

    2013-01-01

    We present a comprehensive analysis of the far UV spectrum of G 191-B2B over the range of 900-1700Å using co-added data from the FUSE and STIS archives. While previous identifications made by Holberg et al. (2003) are reaffirmed in this work, it is found that many previously unidentified lines can now be attributed to Fe, Ni, and a few lighter metals. Future work includes extending this detailed analysis to a wider range of DA objects, in the expectation that a more complete analysis of their atmospheres can be realised.

  20. Identification of the unfavored N=7 superdeformed band in 191Hg

    International Nuclear Information System (INIS)

    Carpenter, M.P.; Janssens, R.V.F.; Cederwall, B.; Crowell, B.; Ahmad, I.; Becker, J.A.; Brinkman, M.J.; Deleplanque, M.A.; Diamond, R.M.; Fallon, P.; Farris, L.P.; Garg, U.; Gassmann, D.; Henry, E.A.; Henry, R.G.; Hughes, J.R.; Khoo, T.L.; Lauritsen, T.; Lee, I.Y.; Machiavelli, A.O.; Moore, E.F.; Nisius, D.; Stephens, F.S.

    1995-01-01

    A new superdeformed band has been identified in 191 Hg bringing the total number of bands observed in this nucleus to four. The new band has properties similar to those of a superdeformed band reported recently in 193 Hg. Both bands are believed to be built on the unfavored signature of the j 15/2 intruder configuration. Comparisons between the data and cranked Woods-Saxon calculations highlight the strengths and weaknesses of theory in describing high-N orbitals at large deformation

  1. Status of Waste Isolation Pilot Plant compliance with 40 CFR 191B, December 1992

    International Nuclear Information System (INIS)

    Marietta, M.G.; Anderson, D.R.

    1993-10-01

    Before disposing of transuranic radioactive waste at the Waste Isolation Pilot Plant (WIPP), the US Department of Energy (DOE) must evaluate compliance with long-term regulations of the US Environmental Protection Agency (EPA). Sandia National Laboratories (SNL) is conducting iterative performance assessments (PAs) of the WIPP for the DOE to provide interim guidance while preparing for final compliance evaluations. This paper describes the 1992 preliminary comparison with Subpart B of the Environmental Standards for the Management and Disposal of Spent Nuclear Fuel, High-Level and Transuranic Radioactive Wastes (40 CFR 191), which regulates long-term releases of radioactive waste. Results of the 1992 PA are preliminary, and cannot be used to determine compliance or noncompliance with EPA regulations because portions of the modeling system and data base are incomplete. Results are consistent, however, with those of previous iterations of PA, and the SNL WIPP PA Department has high confidence that compliance with 40 CFR 191B can be demonstrated. Comparison of predicted radiation doses from the disposal system also gives high confidence that the disposal system is safe for long-term isolation

  2. MO-A-BRB-00: TG191: Clinical Use of Luminescent Dosimeters

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2016-06-15

    This presentation will highlight the upcoming TG-191 report: Clinical Use of Luminescent Dosimeters. Luminescent dosimetry based on TLD and OSLD is a practical, accurate, and precise technique for point dosimetry in medical physics applications. The charges of Task Group 191 were to detail the methodologies for practical and optimal luminescent dosimetry in a clinical setting. This includes (1) To review the variety of TLD/OSL materials available, including features and limitations of each. (2) To outline the optimal steps to achieve accurate and precise dosimetry with luminescent detectors and to evaluate the uncertainty induced when less rigorous procedures are used. (3) To develop consensus guidelines on the optimal use of luminescent dosimeters for clinical practice. (4) To develop guidelines for special medically relevant uses of TLDs/OSLs (e.g., mixed field i.e. photon/neutron dosimetry, particle beam dosimetry, skin dosimetry). While this report provides general guidelines for arbitrary TLD and OSLD processes, the report, and therefore this presentation, provide specific guidance for TLD-100 (LiF:Ti,Mg) and nanoDot (Al2O3:C) dosimeters because of their prevalence in clinical practice. Learning Objectives: Understand the available dosimetry systems, and basic theory of their operation Understand the range of dose determination methodologies and the uncertainties associated with them Become familiar with special considerations for TLD/OSLD relevant for special clinical situations Learn recommended commissioning and QA procedures for these dosimetry systems.

  3. MO-A-BRB-01: TG191: Clinical Use of Luminescent Dosimeters

    Energy Technology Data Exchange (ETDEWEB)

    Kry, S. [UT MD Anderson Cancer Center (United States)

    2016-06-15

    This presentation will highlight the upcoming TG-191 report: Clinical Use of Luminescent Dosimeters. Luminescent dosimetry based on TLD and OSLD is a practical, accurate, and precise technique for point dosimetry in medical physics applications. The charges of Task Group 191 were to detail the methodologies for practical and optimal luminescent dosimetry in a clinical setting. This includes (1) To review the variety of TLD/OSL materials available, including features and limitations of each. (2) To outline the optimal steps to achieve accurate and precise dosimetry with luminescent detectors and to evaluate the uncertainty induced when less rigorous procedures are used. (3) To develop consensus guidelines on the optimal use of luminescent dosimeters for clinical practice. (4) To develop guidelines for special medically relevant uses of TLDs/OSLs (e.g., mixed field i.e. photon/neutron dosimetry, particle beam dosimetry, skin dosimetry). While this report provides general guidelines for arbitrary TLD and OSLD processes, the report, and therefore this presentation, provide specific guidance for TLD-100 (LiF:Ti,Mg) and nanoDot (Al2O3:C) dosimeters because of their prevalence in clinical practice. Learning Objectives: Understand the available dosimetry systems, and basic theory of their operation Understand the range of dose determination methodologies and the uncertainties associated with them Become familiar with special considerations for TLD/OSLD relevant for special clinical situations Learn recommended commissioning and QA procedures for these dosimetry systems.

  4. MO-A-BRB-01: TG191: Clinical Use of Luminescent Dosimeters

    International Nuclear Information System (INIS)

    Kry, S.

    2016-01-01

    This presentation will highlight the upcoming TG-191 report: Clinical Use of Luminescent Dosimeters. Luminescent dosimetry based on TLD and OSLD is a practical, accurate, and precise technique for point dosimetry in medical physics applications. The charges of Task Group 191 were to detail the methodologies for practical and optimal luminescent dosimetry in a clinical setting. This includes (1) To review the variety of TLD/OSL materials available, including features and limitations of each. (2) To outline the optimal steps to achieve accurate and precise dosimetry with luminescent detectors and to evaluate the uncertainty induced when less rigorous procedures are used. (3) To develop consensus guidelines on the optimal use of luminescent dosimeters for clinical practice. (4) To develop guidelines for special medically relevant uses of TLDs/OSLs (e.g., mixed field i.e. photon/neutron dosimetry, particle beam dosimetry, skin dosimetry). While this report provides general guidelines for arbitrary TLD and OSLD processes, the report, and therefore this presentation, provide specific guidance for TLD-100 (LiF:Ti,Mg) and nanoDot (Al2O3:C) dosimeters because of their prevalence in clinical practice. Learning Objectives: Understand the available dosimetry systems, and basic theory of their operation Understand the range of dose determination methodologies and the uncertainties associated with them Become familiar with special considerations for TLD/OSLD relevant for special clinical situations Learn recommended commissioning and QA procedures for these dosimetry systems.

  5. MO-A-BRB-00: TG191: Clinical Use of Luminescent Dosimeters

    International Nuclear Information System (INIS)

    2016-01-01

    This presentation will highlight the upcoming TG-191 report: Clinical Use of Luminescent Dosimeters. Luminescent dosimetry based on TLD and OSLD is a practical, accurate, and precise technique for point dosimetry in medical physics applications. The charges of Task Group 191 were to detail the methodologies for practical and optimal luminescent dosimetry in a clinical setting. This includes (1) To review the variety of TLD/OSL materials available, including features and limitations of each. (2) To outline the optimal steps to achieve accurate and precise dosimetry with luminescent detectors and to evaluate the uncertainty induced when less rigorous procedures are used. (3) To develop consensus guidelines on the optimal use of luminescent dosimeters for clinical practice. (4) To develop guidelines for special medically relevant uses of TLDs/OSLs (e.g., mixed field i.e. photon/neutron dosimetry, particle beam dosimetry, skin dosimetry). While this report provides general guidelines for arbitrary TLD and OSLD processes, the report, and therefore this presentation, provide specific guidance for TLD-100 (LiF:Ti,Mg) and nanoDot (Al2O3:C) dosimeters because of their prevalence in clinical practice. Learning Objectives: Understand the available dosimetry systems, and basic theory of their operation Understand the range of dose determination methodologies and the uncertainties associated with them Become familiar with special considerations for TLD/OSLD relevant for special clinical situations Learn recommended commissioning and QA procedures for these dosimetry systems.

  6. A review and evaluation of the Draft EPA standard (40 CFR 191)

    International Nuclear Information System (INIS)

    Ortiz, N.R.; Chu, M.S.Y.; Siegel, M.D.; Wahi, K.K.

    1984-01-01

    The Environmental Protection Agency's proposed rule for the management and disposal of high-level waste (Draft Standard, 40 CFR 191), was reviewed and analyzed using the risk assessment methodology developed at Sandia National Laboratories. The methodology was exercised on hypothetical repository systems in basalt, bedded salt, and tuff. Among the issues addressed were achievability, release limits, uncertainty, and compliance. The proposed release limits were also analyzed in terms of their relationship to the health effects. The uncertainty in the input parameters of the deterministic models was taken into account in calculating releases to the accessible environment. Extentions to an existing compliance-assessment methodolog are suggested that would allow one to incorporate the uncertainty associated with the frequency of occurrence of scenarios. The results indicate that, in general, the standards are achievable and the release limits are sufficiently conservative

  7. Iron abundance in the hot DA white dwarfs Feige 24 and G191 B2B

    Science.gov (United States)

    Vennes, Stephane; Chayer, Pierre; Thorstensen, John R.; Bowyer, Stuart; Shipman, Harry L.

    1992-01-01

    Attention is given to model calculations of the far- and extreme-UV line spectra of highly ionized Fe species (Fe IV, Fe V, and Fe VI) for hot high-gravity H-rich stars. A spectral analysis of 31 hr of exposure of the DA white dwarf Feige 24 with IUE in the echelle mode reveals the presence of Fe with an abundance relative to H by number of (5-10) x 10 exp -6 with an uncertainty dominated by the determination of stellar parameters. An analysis of IUE data from the white dwarf G191 B2B results in a similar Fe abundance if this star shares similar atmospheric parameters (Teff, g) with Feige 24. Fe is thus the second most abundant photospheric element in hot DA white dwarfs.

  8. Conversion of the 42 keV transition in the decay of 191Os

    International Nuclear Information System (INIS)

    Bhuloka Reddy, S.; Narasimham, K.L.; Thirumala Rao, B.V.; Lakshminarayana, V.

    1986-01-01

    The total as well as the L-conversion coefficient of the 42 KeV transition in the decay of 191 Os are determined from intensity balance considerations and XPG technique, respectively, using a 3 mm Si(Li) detector system. The resultant values are αsub(T) = 13709 (1900), αsub(L) = 11700 (2100). The present total conversion coefficients shows good agreement within the uncertainty limits, with the value αsub(T) = 13.500→ 5200 +21100 reported by Lange, whereas the L-conversion coefficient is reported for the first time. Our present values are also compared with the theoretical values interpolated from the tables of Hager and Seltzer and of Rosel et al

  9. Non-accidental injuries found in necropsies of domestic cats: a review of 191 cases.

    Science.gov (United States)

    de Siqueira, Adriana; Cassiano, Fabiana Cecília; de Albuquerque Landi, Marina Frota; Marlet, Elza Fernandes; Maiorka, Paulo César

    2012-10-01

    Animal cruelty is defined as a deliberate action that causes pain and suffering to an animal. In Brazil, legislation known as the Environmental Crimes Law states that cruelty toward all animal species is criminal in nature. From 644 domestic cats necropsied between January 1998 and December 2009, 191 (29.66%) presented lesions highly suggestive of animal cruelty. The main necroscopic finding was exogenous carbamate poisoning (75.39%) followed by blunt-force trauma (21.99%). Cats from 7 months to 2 years of age were the most affected (50.79%). In Brazil, violence is a public health problem and there is a high prevalence of domestic violence. Therefore, even if laws provide for animal welfare and protection, animals are common targets for violent acts. Within a context of social violence, cruelty toward animals is an important parameter to be considered, and the non-accidental lesions that were found are evidence of malicious actions.

  10. α-decay properties of 190Po and the identification of 191Po

    International Nuclear Information System (INIS)

    Batchelder, J.C.; Batchelder, J.C.; Zganjar, E.F.; Toth, K.S.; Bingham, C.R.; Bingham, C.R.; Wauters, J.; Brown, L.T.; Davids, C.N.; Seweryniak, D.; Brown, L.T.; Conticchio, L.F.; Seweryniak, D.; Conticchio, L.F.; Wood, J.L.

    1997-01-01

    The α-decay properties of 190 Po were investigated through the use of a fragment mass analyzer in conjunction with a double-sided Si strip detector. The isotope was produced via the 96 Mo( 96 Mo,2n) reaction, and its α-decay energy and T 1/2 were measured as 7529(10) keV and 2.4 -0.3 +0.4 ms, respectively. The resulting reduced width is nearly identical to that of the 192,194 Po isotopes. This is believed to result from significant mixing between the ground state π(2p) and the low-lying 0 + π(4p-2h) intruder state in the Po parent. The result provides further evidence for shape coexistence in the light Po isotopes. In addition, 191 Po was unambiguously identified, and the 186 Pb α-decay branch was determined experimentally for the first time. copyright 1997 The American Physical Society

  11. CNV-association meta-analysis in 191,161 European adults reveals new loci associated with anthropometric traits

    NARCIS (Netherlands)

    Macé, Aurélien; Tuke, Marcus A; Deelen, Patrick; Kristiansson, Kati; Mattsson, Hannele; Nõukas, Margit; Sapkota, Yadav; Schick, Ursula; Porcu, Eleonora; Rüeger, Sina; McDaid, Aaron F; Porteous, David; Winkler, Thomas W; Salvi, Erika; Shrine, Nick; Liu, Xueping; Ang, Wei Q; Zhang, Weihua; Feitosa, Mary F; Venturini, Cristina; van der Most, Peter J; Rosengren, Anders; Wood, Andrew R; Beaumont, Robin N; Jones, Samuel E; Ruth, Katherine S; Yaghootkar, Hanieh; Tyrrell, Jessica; Havulinna, Aki S; Boers, Harmen; Mägi, Reedik; Kriebel, Jennifer; Müller-Nurasyid, Martina; Perola, Markus; Nieminen, Markku; Lokki, Marja-Liisa; Kähönen, Mika; Viikari, Jorma S; Geller, Frank; Lahti, Jari; Palotie, Aarno; Koponen, Päivikki; Lundqvist, Annamari; Rissanen, Harri; Bottinger, Erwin P; Afaq, Saima; Wojczynski, Mary K; Lenzini, Petra; Nolte, Ilja M; Sparsø, Thomas; Schupf, Nicole; Christensen, Kaare; Perls, Thomas T; Newman, Anne B; Werge, Thomas; Snieder, Harold; Spector, Timothy D; Chambers, John C; Koskinen, Seppo; Melbye, Mads; Raitakari, Olli T; Lehtimäki, Terho; Tobin, Martin D; Wain, Louise V; Sinisalo, Juha; Peters, Annette; Meitinger, Thomas; Martin, Nicholas G; Wray, Naomi R; Montgomery, Grant W; Medland, Sarah E; Swertz, Morris A; Vartiainen, Erkki; Borodulin, Katja; Männistö, Satu; Murray, Anna; Bochud, Murielle; Jacquemont, Sébastien; Rivadeneira, Fernando; Hansen, Thomas F; Oldehinkel, Albertine J; Mangino, Massimo; Province, Michael A; Deloukas, Panos; Kooner, Jaspal S; Freathy, Rachel M; Pennell, Craig; Feenstra, Bjarke; Strachan, David P; Lettre, Guillaume; Hirschhorn, Joel; Cusi, Daniele; Heid, Iris M; Hayward, Caroline; Männik, Katrin; Beckmann, Jacques S; Loos, Ruth J F; Nyholt, Dale R; Metspalu, Andres; Eriksson, Johan G; Weedon, Michael N; Salomaa, Veikko; Franke, Lude; Reymond, Alexandre; Frayling, Timothy M; Kutalik, Zoltán

    2017-01-01

    There are few examples of robust associations between rare copy number variants (CNVs) and complex continuous human traits. Here we present a large-scale CNV association meta-analysis on anthropometric traits in up to 191,161 adult samples from 26 cohorts. The study reveals five CNV associations at

  12. 77 FR 30335 - Proposed Revision 3 to Standard Review Plan, Section 19.1 on Determining the Technical Adequacy...

    Science.gov (United States)

    2012-05-22

    ...). The Office of New Reactors and Office of Nuclear Reactor Regulation are revising SRP Section 19.1... of the Code of Federal Regulations (10 CFR), 50.71(h)(1), (h)(2), and (h)(3) for new reactors, (2... searching on http://www.regulations.gov under Docket ID NRC-2012-0113. You may submit comments by the...

  13. 10 CFR 501.191 - Use of natural gas or petroleum for certain unanticipated equipment outages and emergencies...

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false Use of natural gas or petroleum for certain unanticipated... Natural Gas or Petroleum for Emergency and Unanticipated Equipment Outage Purposes § 501.191 Use of natural gas or petroleum for certain unanticipated equipment outages and emergencies defined in section...

  14. Compact self-Q-switched Tm:YLF laser at 1.91 μm

    Science.gov (United States)

    Zhang, B.; Li, L.; He, C. J.; Tian, F. J.; Yang, X. T.; Cui, J. H.; Zhang, J. Z.; Sun, W. M.

    2018-03-01

    We report self-Q-switching operation in a diode-pumped Tm:YLF bulk laser by exploiting saturable re-absorption under the quasi-three-level regime. Robust self-Q-switched pulse output at 1.91 μm in fundamental mode is demonstrated experimentally with 1.5 at.% doped Tm:YLF crystal. At maximum absorbed pump power of 4.5 W, the average output power and pulse energy are obtained as high as 610 mW and 29 μJ, respectively, with the corresponding slope efficiency of 22%. Pulse repetition rate is tunable in the range of 3-21 kHz with changing the pump power. The dynamics of self-Q-switching of Tm:YLF laser are discussed with the help of a rate equation model showing good agreement with the experiment. The compact self-Q-switched laser near 2 μm has potential application in laser radar systems for accurate wind velocity measurements.

  15. Draft Title 40 CFR 191 compliance certification application for the Waste Isolation Pilot Plant. Volume 1

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-03-31

    The Waste Isolation Pilot Plant (WIPP) is a research and development facility for the demonstration of the permanent isolation of transuranic radioactive wastes in a geologic formation. The facility was constructed in southeastern New Mexico in a manner intended to meet criteria established by the scientific and regulatory community for the safe, long-term disposal of transuranic wastes. The US Department of Energy (DOE) is preparing an application to demonstrate compliance with the requirements outlined in Title 40, Part 191 of the Code of Federal Regulations (CFR) for the permanent disposal of transuranic wastes. As mandated by the Waste Isolation Pilot Plant (WIPP) Land Withdrawal Act of 1992, the US Environmental Protection Agency (EPA) must evaluate this compliance application and provide a determination regarding compliance with the requirements within one year of receiving a complete application. Because the WIPP is a very complex program, the DOE has planned to submit the application as a draft in two parts. This strategy will allow for the DOE and the EPA to begin technical discussions on critical WIPP issues before the one-year compliance determination period begins. This report is the first of these two draft submittals.

  16. Draft Title 40 CFR 191 compliance certification application for the Waste Isolation Pilot Plant. Volume 1

    International Nuclear Information System (INIS)

    1995-01-01

    The Waste Isolation Pilot Plant (WIPP) is a research and development facility for the demonstration of the permanent isolation of transuranic radioactive wastes in a geologic formation. The facility was constructed in southeastern New Mexico in a manner intended to meet criteria established by the scientific and regulatory community for the safe, long-term disposal of transuranic wastes. The US Department of Energy (DOE) is preparing an application to demonstrate compliance with the requirements outlined in Title 40, Part 191 of the Code of Federal Regulations (CFR) for the permanent disposal of transuranic wastes. As mandated by the Waste Isolation Pilot Plant (WIPP) Land Withdrawal Act of 1992, the US Environmental Protection Agency (EPA) must evaluate this compliance application and provide a determination regarding compliance with the requirements within one year of receiving a complete application. Because the WIPP is a very complex program, the DOE has planned to submit the application as a draft in two parts. This strategy will allow for the DOE and the EPA to begin technical discussions on critical WIPP issues before the one-year compliance determination period begins. This report is the first of these two draft submittals

  17. Population of yrast states in 191Os using deep-inelastic reactions

    Science.gov (United States)

    Jones, G. A.; Podolyák, Zs; Walker, P. M.; Regan, P. H.; de Angelis, G.; Axiotis, M.; Bazzacco, D.; Bizzeti, P. G.; Brandolini, F.; Broda, R.; Bucurescu, D.; Farnea, E.; Gelletly, W.; Gadea, A.; Ionescu-Bujor, M.; Iordachescu, A.; Kröll, Th; Langdown, S. D.; Lunardi, S.; Marginean, N.; Martinez, T.; Medina, N. H.; Quintana, B.; Rubio, B.; Ur, C. A.; Valiente-Dobón, J. J.; Williams, S. J.; Zhang, Y. H.

    2005-10-01

    Several nuclei in the A ~ 190 region have been studied following deep-inelastic reactions using a 460 MeV 82Se projectile impinging upon a thick 192Os target. The GASP array (at the Legnaro National Laboratory in Italy) was used to measure the resulting γ-decays. The previously reported near-yrast structure of 191Os is extended to a t\\frac{1{2}} = 61 ns isomer, at an energy of 2640 keV. Branching ratios for ΔI = 1 and ΔI = 2 transitions in the Kπ =\\frac{11}{2}+ band have been measured, giving |(gK - gR)/Q0| = 0.022(3) and 0.024(7) for transitions from the \\frac{17}{2}+ and \\big(\\frac{19}{2}^+\\big) states respectively. These are consistent with the theoretical calculation for the proposed ν11/2+[615] configuration of the band. Nilsson plus BCS calculations reveal that the isomer is likely to have a {ν11/2+[615] π11/2-[505] π9/2-[514]} configuration with Jπ =Kπ =\\frac{31}{2}+ . This yields an implied reduced hindrance of fν= 1.9, in accordance with empirical systematics of K isomers in the A ~ 180-190 region.

  18. Crystal Structure of Bacteriophage SPP1 Distal Tail Protein (gp19.1)

    Science.gov (United States)

    Veesler, David; Robin, Gautier; Lichière, Julie; Auzat, Isabelle; Tavares, Paulo; Bron, Patrick; Campanacci, Valérie; Cambillau, Christian

    2010-01-01

    Siphophage SPP1 infects the Gram-positive bacterium Bacillus subtilis using its long non-contractile tail and tail-tip. Electron microscopy (EM) previously allowed a low resolution assignment of most orf products belonging to these regions. We report here the structure of the SPP1 distal tail protein (Dit, gp19.1). The combination of x-ray crystallography, EM, and light scattering established that Dit is a back-to-back dimer of hexamers. However, Dit fitting in the virion EM maps was only possible with a hexamer located between the tail-tube and the tail-tip. Structure comparison revealed high similarity between Dit and a central component of lactophage baseplates. Sequence similarity search expanded its relatedness to several phage proteins, suggesting that Dit is a docking platform for the tail adsorption apparatus in Siphoviridae infecting Gram-positive bacteria and that its architecture is a paradigm for these hub proteins. Dit structural similarity extends also to non-contractile and contractile phage tail proteins (gpVN and XkdM) as well as to components of the bacterial type 6 secretion system, supporting an evolutionary connection between all these devices. PMID:20843802

  19. The importance of scenario development in meeting 40 CFR part 191

    International Nuclear Information System (INIS)

    Hunter, R.L.

    1988-01-01

    Scenario development and screening is a fundamental part of performance assessment, but its importance in satisfying 40 CFR Part 191 (the standard) is sometimes underestimated. The first step in scenario development in support of performance assessment for the standard's containment requirements is to identify a set of potentially disruptive events and processes. This set must be broad enough to allow the identification, as required by the standard, of those processes and events that might affect the disposal system; data can then be collected on the scenarios identified in this step. The standard also requires that releases be estimated for all significant processes and events; thus the final step in scenario development is systematically screening the scenarios, on the basis of their probabilities and consequences, to select those that are important enough to be modeled in detail. In general, a few hundred scenarios for the release of radionuclides from a nuclear-waste repository can be identified, but only a few of these can or should be modeled in detail

  20. Spectrum of {gamma} rays from the decay of SD to normal states in {sup 191}Hg

    Energy Technology Data Exchange (ETDEWEB)

    Gassmann, D.; Khoo, T.L.; Lauritsen, T. [and others

    1995-08-01

    In B.a.7. we propose that the statistical spectrum emitted from a sharp single excited state serves as a probe of pairing in excited states. A specific test of this proposal is the comparison of the spectra from even-even and odd-even nuclei. Whereas a pair gap exists in an even-even nucleus, it gets filled in an odd-even nucleus. Consequently, low-energy transitions can arise in the latter case, whereas they are calculated to be absent in the former case because very few levels exist in the cold gap region. In addition, transitions between 1.4 - 2.2 MeV, which {open_quotes}jump{close_quotes} across the gap, are predicted to have lower yield in the odd-even nuclei. Serendipitously, decay from a superdeformed state serves as a good initial excited sharp state. We extracted the spectrum pairwise-coincident with SD lines in {sup 191}Hg from Gammasphere data and compared it with the equivalent spectra from the even-even nuclei {sup 192,194}Hg. The differences that are predicted to occur are indeed observed. Thus, the data support our proposal that the reduction of pairing with thermal excitation energy can be probed with statistical decay spectra.

  1. Deletion of the pluripotency-associated Tex19.1 gene causes activation of endogenous retroviruses and defective spermatogenesis in mice

    DEFF Research Database (Denmark)

    Ollinger, Rupert; Childs, Andrew J; Burgess, Hannah M

    2008-01-01

    . During male spermatogenesis, Tex19.1 expression is highest in mitotic spermatogonia and diminishes as these cells differentiate and progress through meiosis. In pluripotent stem cells, Tex19.1 expression is also downregulated upon differentiation. However, it is not clear whether Tex19.1 has an essential...... spermatogenesis. Immunostaining and histological analysis revealed defects in meiotic chromosome synapsis, the persistence of DNA double-strand breaks during meiosis, and a loss of post-meiotic germ cells in the testis. Furthermore, expression of a class of endogenous retroviruses is upregulated during meiosis...... in the Tex19.1(-/-) testes. Increased transposition of endogenous retroviruses in the germline of Tex19.1(-/-) mutant mice, and the concomitant increase in DNA damage, may be sufficient to disrupt the normal processes of recombination and chromosome synapsis during meiosis and cause defects...

  2. Gastrointestinal Diagnosis of Classical Whipple Disease: Clinical, Endoscopic, and Histopathologic Features in 191 Patients

    Science.gov (United States)

    Günther, Ute; Moos, Verena; Offenmüller, Gabriel; Oelkers, Gerrit; Heise, Walther; Moter, Annette; Loddenkemper, Christoph; Schneider, Thomas

    2015-01-01

    Abstract Classic Whipple disease (CWD) is a systemic infection caused by Tropheryma whipplei. Different diagnostic tools have been developed over the last decades: periodic acid-Schiff (PAS) staining, T whipplei-specific polymerase chain reaction (PCR), and T whipplei-specific immunohistochemistry (IHC). Despite all these advances, CWD is still difficult to diagnose because of a variety of clinical symptoms and possibly a long time span between first unspecific symptoms and the full-blown clinical picture of the disease. Herein, we report an observational cohort study summarizing epidemiologic data, clinical manifestations, and diagnostic parameters of 191 patients with CWD collected at our institution. Gastrointestinal manifestations are the most characteristic symptoms of CWD affecting 76% of the cohort. Although the small bowel was macroscopically conspicuous in only 27% of cases, 173 (91%) patients presented with characteristic histological changes in small bowel biopsies (in 2 patients, these changes were only seen within the ileum). However, 18 patients displayed normal small bowel histology without typical PAS staining. In 9 of these patients, alternative test were positive from their duodenal specimens (ie, T whipplei-specific PCR and/or IHC). Thus, in 182 patients (95%) a diagnostic hint toward CWD was obtained from small bowel biopsies. Only 9 patients (5%) were diagnosed solely based on positive T whipplei-specific PCR and/or IHC of extraintestinal fluids (eg, cerebrospinal fluid, synovial fluid) or extraintestinal tissue (eg, lymph node, synovial tissue), respectively. Thus, despite efforts to diagnose CWD from alternative specimens, gastroscopy with duodenal biopsy and subsequent histological and molecular–biological examination is the most reliable diagnostic tool for CWD. PMID:25881849

  3. Astatine-211 labeling. A study towards automatic production of astatinated antibodies

    International Nuclear Information System (INIS)

    Emma Aneheim; Per Albertsson; Sture Lindegren; Holger Jensen

    2015-01-01

    Targeted alpha therapy is especially interesting for therapy of microscopic cancer tumors due to short path length and high linear energy transfer of the alpha particles. One of the most promising nuclides for targeted alpha therapy is 211 At. To facilitate larger clinical studies using 211 At, the current manual synthesis of radiolabeled antibodies would benefit from being transferred into an automated method. In this work, successful modifications of the manual synthesis have been performed in order to adapt it to automation. The automatic synthesis has also been tested using the modified synthesis method. (author)

  4. Proto-planetary nebulae. I. The extreme bipolar nebulae M2-9 and M1-91

    International Nuclear Information System (INIS)

    Goodrich, R.W.

    1991-01-01

    Results are presented on a long-slit optical spectroscopy measurements of the prototype bipolar planetary nebula M2-9 and the M1-91 bipolar nebula, performed in order to determine the nature of the morphology of the wings of these two nebulae. It is concluded that the overall bipolar morphologies of these nebulae might be due to the orbital motions of binaries, with the orbital angular momentum vector defining the axis of the nebula. Secondary symmetries in the nebulae, such as the point-symmetric knots in M1-91, could be due to other symmetries, such as the rotation axis of one of the individual stars or the polar axis of the accretion disk. 39 refs

  5. Insights into location dependent loss-of-coolant-accident (LOCA) frequency assessment for GSI-191 risk-informed applications

    Energy Technology Data Exchange (ETDEWEB)

    Fleming, K.N., E-mail: KarlFleming@comcast.net [KNF Consulting LLC, Spokane, WA (United States); Lydell, B.O.Y. [SIGMA-PHASE INC., Vail, AZ (United States)

    2016-08-15

    Highlights: • Role of operating experience in loss-of-coolant-accident (LOCA) frequency assessment. • Plant-to-plant variability in calculated LOCA frequency. • Frequency of double-ended-guillotine-break (DEGB). • Uncertainties in LOCA frequencies. • Risk management insights. - Abstract: As a tribute to the published work by S.H. Bush, S. Beliczey and H. Schulz, this paper assesses the progress with methods and techniques for quantifying the reliability of piping systems in commercial nuclear power plants on the basis of failure rate estimates derived from field experience data in combination with insights and results from probabilistic fracture mechanics analyses and expert elicitation exercises. This status assessment is made from a technical perspective obtained through development of location-specific loss-of-coolant-accident (LOCA) frequencies for input to risk-informed resolution of the generic safety issue (GSI) 191. The methods and techniques on which these GSI-191 applications are based build on a body of work developed by the authors during a period spanning more than two decades. The insights that are presented and discussed in this paper cover today’s knowledge base concerning how to utilize a risk-informed approach to the assessment of piping reliability in the context of probabilistic risk assessment (PRA) in general and the resolution of GSI-191 in particular. Specifically the paper addresses the extent to which LOCA frequencies vary from location to location within a reactor coolant system pressure boundary (RCPB) for a given plant as well as vary from plant to plant, and the reasons for these variabilities. Furthermore, the paper provides the authors’ perspectives on interpretations and applications of information extracted from an expert elicitation process to obtain LOCA frequencies as documented in NUREG-1829 and how to apply this information to GSI-191. Finally, this paper documents technical insights relative to mitigation of

  6. VizieR Online Data Catalog: NLTE spectral analysis of white dwarf G191-B2B (Rauch+, 2013)

    Science.gov (United States)

    Rauch, T.; Werner, K.; Bohlin, R.; Kruk, J. W.

    2013-08-01

    In the framework of the Virtual Observatory, the German Astrophysical Virtual Observatory developed the registered service TheoSSA. It provides easy access to stellar spectral energy distributions (SEDs) and is intended to ingest SEDs calculated by any model-atmosphere code. In case of the DA white dwarf G191-B2B, we demonstrate that the model reproduces not only its overall continuum shape but also the numerous metal lines exhibited in its ultraviolet spectrum. (3 data files).

  7. Implementation of the Resource Disincentive in 40 CFR part 191.14 (e) at the Waste Isolation Pilot Plant

    International Nuclear Information System (INIS)

    1993-06-01

    In 1986, the US Department of Energy (DOE) Waste Isolation Pilot Plant (WIPP) Project Office (WPO) (DOE-WPO) prepared a strategy for complying with the Environmental Protection Agency's (EPA's) Standards for the management of transuranic (TRU) waste. Section 3.2.2.2 of the DOE's report addressed compliance with the Assurance Requirements found in 40 CFR section 191.14. One of the Assurance Requirements addresses the selection of repository sites that contain recoverable natural resources. This report documents that the site selection process for the WIPP facility did indeed comply with the natural resource disincentive requirement in 40 CFR section 191,14(e) at the time selected and therefore complies with the standard at this time. Thus, it shall be shown that it is reasonably certain that the WIPP site provides better overall protection than practical alternatives that were available when the site was selected. It is important to point out here, and it will be discussed later in the report, that the resource disincentive requirement is a preliminary siting criterion that requires further evaluation of sites that have resources (i.e, hydrocarbons, minerals and groundwater) in the vicinity or on the site. This further evaluation requires that for sites that do have resources, a qualitative determination must be made that the site will provide better overall protection than practical alternatives. The purpose of this report is not to provide a quantitative evaluation for selection of the WIPP site. A further discussion on the difference between the qualitative analysis required under 40 CFR section 191.14(e) and the quantitative analysis under other sections of 40 CFR 191 is provided in section 2.1 of this report

  8. Insights into location dependent loss-of-coolant-accident (LOCA) frequency assessment for GSI-191 risk-informed applications

    International Nuclear Information System (INIS)

    Fleming, K.N.; Lydell, B.O.Y.

    2016-01-01

    Highlights: • Role of operating experience in loss-of-coolant-accident (LOCA) frequency assessment. • Plant-to-plant variability in calculated LOCA frequency. • Frequency of double-ended-guillotine-break (DEGB). • Uncertainties in LOCA frequencies. • Risk management insights. - Abstract: As a tribute to the published work by S.H. Bush, S. Beliczey and H. Schulz, this paper assesses the progress with methods and techniques for quantifying the reliability of piping systems in commercial nuclear power plants on the basis of failure rate estimates derived from field experience data in combination with insights and results from probabilistic fracture mechanics analyses and expert elicitation exercises. This status assessment is made from a technical perspective obtained through development of location-specific loss-of-coolant-accident (LOCA) frequencies for input to risk-informed resolution of the generic safety issue (GSI) 191. The methods and techniques on which these GSI-191 applications are based build on a body of work developed by the authors during a period spanning more than two decades. The insights that are presented and discussed in this paper cover today’s knowledge base concerning how to utilize a risk-informed approach to the assessment of piping reliability in the context of probabilistic risk assessment (PRA) in general and the resolution of GSI-191 in particular. Specifically the paper addresses the extent to which LOCA frequencies vary from location to location within a reactor coolant system pressure boundary (RCPB) for a given plant as well as vary from plant to plant, and the reasons for these variabilities. Furthermore, the paper provides the authors’ perspectives on interpretations and applications of information extracted from an expert elicitation process to obtain LOCA frequencies as documented in NUREG-1829 and how to apply this information to GSI-191. Finally, this paper documents technical insights relative to mitigation of

  9. HIF-inducible miR-191 promotes migration in breast cancer through complex regulation of TGFβ-signaling in hypoxic microenvironment.

    Science.gov (United States)

    Nagpal, Neha; Ahmad, Hafiz M.; Chameettachal, Shibu; Sundar, Durai; Ghosh, Sourabh; Kulshreshtha, Ritu

    2015-01-01

    The molecular mechanisms of hypoxia induced breast cell migration remain incompletely understood. Our results show that hypoxia through hypoxia-inducible factor (HIF) brings about a time-dependent increase in the level of an oncogenic microRNA, miR-191 in various breast cancer cell lines. miR-191 enhances breast cancer aggressiveness by promoting cell proliferation, migration and survival under hypoxia. We further established that miR-191 is a critical regulator of transforming growth factor beta (TGFβ)-signaling and promotes cell migration by inducing TGFβ2 expression under hypoxia through direct binding and indirectly by regulating levels of a RNA binding protein, human antigen R (HuR). The levels of several TGFβ pathway genes (like VEGFA, SMAD3, CTGF and BMP4) were found to be higher in miR-191 overexpressing cells. Lastly, anti-miR-191 treatment given to breast tumor spheroids led to drastic reduction in spheroid tumor volume. This stands as a first report of identification of a microRNA mediator that links hypoxia and the TGFβ signaling pathways, both of which are involved in regulation of breast cancer metastasis. Together, our results show a critical role of miR-191 in hypoxia-induced cancer progression and suggest that miR-191 inhibition may offer a novel therapy for hypoxic breast tumors. PMID:25867965

  10. Preliminary comparison with 40 CFR Part 191, Subpart B for the Waste Isolation Pilot Plant, December 1990

    International Nuclear Information System (INIS)

    Bertram-Howery, S.G.; Marietta, M.G.; Rechard, R.P.; Anderson, D.R.; Swift, P.N.; Baker, B.L.; Bean, J.E. Jr.; McCurley, R.D.; Rudeen, D.K.; Beyeler, W.; Brinster, K.F.; Guzowski, R.V.; Schreiber, J.D.; Helton, J.C.; Vaughn, P.

    1990-12-01

    The Waste Isolation Pilot Plant (WIPP) is planned as the first mined geologic repository for transuranic (TRU) wastes generated by defense programs of the United States Department of Energy (DOE). Before disposing of waste at the WIPP, the DOE must evaluate compliance with the United states Environmental Protection Agency's (EPA) Standard, Environmental Radiation Protection Standards for Management and Disposal of Spent Nuclear Fuel, High-Level and Transuranic Radioactive Wastes (40 CFR Part 191, US EPA, 1985). Sandia National Laboratories (SNL) is evaluating long-term performance against criteria in Subpart B of the Standard. ''Performance assessment'' as used in this report includes analyses for the Containment Requirements (section 191.13(a)) and the Individual Protection Requirements (section 191.15). Because proving predictions about future human actions or natural events is not possible, the EPA expects compliance to be determined on the basis of specified quantitative analyses and informed, qualitative judgment. The goal of the WIPP performance-assessment team at SNL is to provide as detailed and thorough a basis as practical for the quantitative aspects of that decision. This report summarizes SNL's late-1990 understanding of the WIPP Project's ability to evaluate compliance with Subpart B. 245 refs., 88 figs., 23 tabs

  11. Study of (n,2n reaction on 191,193Ir isotopes and isomeric cross section ratios

    Directory of Open Access Journals (Sweden)

    Vlastou R.

    2017-01-01

    Full Text Available The cross section of 191Ir(n,2n190Irg+m1 and 191Ir(n,2n190Irm2 reactions has been measured at 17.1 and 20.9 MeV neutron energies at the 5.5 MV tandem T11/25 Accelerator Laboratory of NCSR “Demokritos”, using the activation method. The neutron beams were produced by means of the 3H(d,n4He reaction at a flux of the order of 2 × 105 n/cm2s. The neutron flux has been deduced implementing the 27Al(n,α reaction, while the flux variation of the neutron beam was monitored by using a BF3 detector. The 193Ir(n,2n192Ir reaction cross section has also been determined, taking into account the contribution from the contaminant 191Ir(n,γ192Ir reaction. The correction method is based on the existing data in ENDF for the contaminant reaction, convoluted with the neutron spectra which have been extensively studied by means of simulations using the NeusDesc and MCNP codes. Statistical model calculations using the code EMPIRE 3.2.2 and taking into account pre-equilibrium emission, have been performed on the data measured in this work as well as on data reported in literature.

  12. Preliminary comparison with 40 CFR Part 191, Subpart B for the Waste Isolation Pilot Plant, December 1990

    Energy Technology Data Exchange (ETDEWEB)

    Bertram-Howery, S.G.; Marietta, M.G.; Rechard, R.P.; Anderson, D.R. (Sandia National Labs., Albuquerque, NM (USA)); Swift, P.N. (Tech. Reps., Inc., Albuquerque, NM (USA)); Baker, B.L. (Technadyne Engineering Consultants, Inc., Albuquerque, NM (USA)); Bean, J.E. Jr.; McCurley, R.D.; Rudeen, D.K. (New Mexico Engineering Research Inst., Albuquerque, NM (USA)); Beyeler, W.; Brinster, K.F.; Guzowski, R.V.; Sch

    1990-12-01

    The Waste Isolation Pilot Plant (WIPP) is planned as the first mined geologic repository for transuranic (TRU) wastes generated by defense programs of the United States Department of Energy (DOE). Before disposing of waste at the WIPP, the DOE must evaluate compliance with the United states Environmental Protection Agency's (EPA) Standard, Environmental Radiation Protection Standards for Management and Disposal of Spent Nuclear Fuel, High-Level and Transuranic Radioactive Wastes (40 CFR Part 191, US EPA, 1985). Sandia National Laboratories (SNL) is evaluating long-term performance against criteria in Subpart B of the Standard. Performance assessment'' as used in this report includes analyses for the Containment Requirements ({section} 191.13(a)) and the Individual Protection Requirements ({section} 191.15). Because proving predictions about future human actions or natural events is not possible, the EPA expects compliance to be determined on the basis of specified quantitative analyses and informed, qualitative judgment. The goal of the WIPP performance-assessment team at SNL is to provide as detailed and thorough a basis as practical for the quantitative aspects of that decision. This report summarizes SNL's late-1990 understanding of the WIPP Project's ability to evaluate compliance with Subpart B. 245 refs., 88 figs., 23 tabs.

  13. A Title 40 Code of Federal Regulations Part 191 Evaluation of Buried Transuranic Waste at the Nevada Test Site - 8210

    International Nuclear Information System (INIS)

    G J Shott; V Yucel; L Desotell

    2008-01-01

    In 1986, 21 m 3 of transuranic (TRU) waste was inadvertently buried in a shallow land burial trench at the Area 5 Radioactive Waste Management Site on the Nevada Test Site (NTS). The U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office is considered five options for management of the buried TRU waste. One option is to leave the waste in-place if the disposal can meet the requirements of Title 40 Code of Federal Regulations (CFR) Part 191, 'Environmental Radiation Protection Standard for Management and Disposal of Spent Nuclear Fuel, High-Level, and Transuranic Radioactive Wastes'. This paper describes analyses that assess the likelihood that TRU waste in shallow land burial can meet the 40 CFR 191 standards for a geologic repository. The simulated probability of the cumulative release exceeding 1 and 10 times the 40 CFR 191.13 containment requirements is estimated to be 0.009 and less than 0.0001, respectively. The cumulative release is most sensitive to the number of groundwater withdrawal wells drilled through the disposal trench. The mean total effective dose equivalent for a member of the public is estimated to reach a maximum of 0.014 milliSievert (mSv) at 10,000 years, or approximately 10 percent of the 0.15 mSv 40 CFR 191.15 individual protection requirement. The dose is predominantly from inhalation of short-lived Rn-222 progeny in air produced by low-level waste disposed in the same trench. The transuranic radionuclide released in greatest amounts, Pu-239, contributes only 0.4 percent of the dose. The member of public dose is most sensitive to the U-234 inventory and the radon emanation coefficient. Reasonable assurance of compliance with the Subpart C groundwater protection standard is provided by site characterization data and hydrologic processes modeling which support a conclusion of no groundwater pathway within 10,000 years. Limited quantities of transuranic waste in a shallow land burial trench at the NTS can meet

  14. ROSAT EUV and soft X-ray studies of atmospheric composition and structure in G191-B2B

    Science.gov (United States)

    Barstow, M. A.; Fleming, T. A.; Finley, D. S.; Koester, D.; Diamond, C. J.

    1993-01-01

    Previous studies of the hot DA white dwarf GI91-B2B have been unable to determine whether the observed soft X-ray and EUV opacity arises from a stratified hydrogen and helium atmosphere or from the presence of trace metals in the photosphere. New EUV and soft X-ray photometry of this star, made with the ROSAT observatory, when analyzed in conjunction with the earlier data, shows that the stratified models cannot account for the observed fluxes. Consequently, we conclude that trace metals must be a substantial source of opacity in the photosphere of G191-B2B.

  15. Implementation of the resource disincentive in 40 CFR Part 191.14(e) at the Waste Isolation Pilot Plant

    International Nuclear Information System (INIS)

    1991-08-01

    In 1986, the US Department of Energy (DOE) Waste Isolation Pilot Plant (WIPP) Project Office (WPO) (DOE-WPO) prepared a strategy for complying with the Environmental Protection Agency's (EPA's) Standards for the management of transuranic (TRU) waste. Section 3.2.2.2 of the DOE's report addressed compliance with the Assurance Requirements found in 40 CFR Part 191.14. One of the Assurance Requirements addresses the selection of repository sites that contain recoverable natural resources and is referred to as the Resource Disincentive Requirement: This document addresses 40 CFR 191, Subpart B, Section 14 (e). The approach is to first summarize the development of the resource requirement to provide a proper perspective for evaluation of WIPP compliance. In addition, a summary of the discussions regarding resources at the WIPP is provided to demonstrate the extent to which the topic has been discussed between the DOE and various oversight groups. Finally, the information on resources at the WIPP site is presented, along with a summary of activities to mitigate negative impacts associated with the denial of resources. 77 refs., 3 figs., 3 tabs

  16. The extreme ultraviolet spectrum of G191 - B2B and the ionization of the local interstellar medium

    International Nuclear Information System (INIS)

    Green, J.; Jelinsky, P.; Bowyer, S.

    1990-01-01

    The measurement of the extreme ultraviolet spectrum of the nearby hot white dwarf G191 - B2B is reported. The results are used to derive interstellar neutral column densities of 1.6 + or - 0.2 x 10 to the 18th/sq cm and 9.8 + 2.8 or - 2.6 x 10 to the 16th/sq cm for H I and He I, respectively. This ratio of neutral hydrogen to neutral helium indicates that the ionization of hydrogen along the line of sight is less than about 30 percent unless significant helium ionization is present. The scenario in which the hydrogen is highly ionized and the helium is neutral is ruled out by this observation. 54 refs

  17. The extreme ultraviolet spectrum of G191 - B2B and the ionization of the local interstellar medium

    Science.gov (United States)

    Green, James; Jelinsky, Patrick; Bowyer, Stuart

    1990-01-01

    The measurement of the extreme ultraviolet spectrum of the nearby hot white dwarf G191 - B2B is reported. The results are used to derive interstellar neutral column densities of 1.6 + or - 0.2 x 10 to the 18th/sq cm and 9.8 + 2.8 or - 2.6 x 10 to the 16th/sq cm for H I and He I, respectively. This ratio of neutral hydrogen to neutral helium indicates that the ionization of hydrogen along the line of sight is less than about 30 percent unless significant helium ionization is present. The scenario in which the hydrogen is highly ionized and the helium is neutral is ruled out by this observation.

  18. Derivation of airfoil characteristics for the LM 19.1 blade based on 3D CFD rotor calculations

    Energy Technology Data Exchange (ETDEWEB)

    Bak, C; Soerensen, N N; Madsen, H A [Risoe National Lab., Roskilde (Denmark)

    1999-03-01

    Airfoil characteristics for the LM 19.1 blade are derived from 3D CFD computations on a full-scale 41-m rotor. Based on 3D CFD the force distributions on the blades are determined, from which airfoil characteristics are derived using the momentum theory. The final airfoil characteristics are constructed using both wind tunnel measurements and 3D CFD. Compared to 2D wind tunnel measurements they show a low lift in stall for the airfoil sections at the tip. At the airfoil sections at the inner part of the blade, they show a high lift in stall. At about 60% radius the lift agrees well to 2D wind tunnel measurements. Aero-elastic calculations using the final airfoil characteristics show good agreement to measured power and flap moments. Furthermore, a fatigue load analysis shows a reduction of up to 15% of the load compared to commonly used data. (au)

  19. Deuterium Abundance Toward G191-B2B: Results from the Far Ultraviolet Spectroscopic Explorer (FUSE) Mission

    Science.gov (United States)

    Lemoine, M.; Vidal-Madjar, A.; Hebrard, G.; Desert, J.-M.; Ferlet, R.; LecavelierdesEtangs, A.; Howk, J. C.; Andre, M.; Blair, W. P.; Friedman, S. D.; hide

    2002-01-01

    High-resolution spectra of the hot white dwarf G191-B2B covering the wavelength region 905-1187A were obtained with the Far Ultraviolet Spectroscopic Explorer (FUSE). This data was used in conjunction with existing high-resolution Hubble Space Telescope STIS observations to evaluate the total H(sub I), D(sub I), O(sub I) and N(sub I) column densities along the line of sight. Previous determinations of N(D(sub I)) based upon GHRS (Goddard High Resolution Spectrograph) and STIS (Space Telescope Imaging Spectrograph) observations were controversial due to the saturated strength of the D(sub I) Lyman alpha line. In the present analysis the column density of D(sub I) has been measured using only the unsaturated Lyman beta and Lyman gamma lines observed by FUSE. A careful inspection of possible systematic uncertainties tied to the modeling of the stellar continuum or to the uncertainties in the FUSE instrumental character series has been performed. The column densities derived are: log N(D(sub I)) = 13.40+/-0.07, log N(O(sub I)) = 14.86+/-0.07, and log N(N(sub I)) = 13.87+/-0.07 quoted with 2sigma, uncertainties. The measurement of the H(sub I) column density by profile fitting of the Lyman alpha line has been found to be unsecure. If additional weak hot interstellar components are added to the three detected clouds along the line of sight, the H(sub I)) column density can be reduced quite significantly, even though the signal-to-noise ratio and spectral resolution at Lyman alpha are excellent. The new estimate of N(H(sub I)) toward G191-B2B reads: logN(H (sub I)) = 18.18+/-0.18 (2sigma uncertainty), so that the average (D/H) ratio on the line of sight is: (D/H)= 1.66(+0.9/-0.6) x 10(exp -5) (2sigma uncertainty).

  20. The p.T191M mutation of the CBS gene is highly prevalent among homocystinuric patients from Spain, Portugal and South America.

    Science.gov (United States)

    Urreizti, Roser; Asteggiano, Carla; Bermudez, Marta; Córdoba, Alfonso; Szlago, Marina; Szlago, Mariana; Grosso, Carola; de Kremer, Raquel Dodelson; Vilarinho, Laura; D'Almeida, Vania; Martínez-Pardo, Mercedes; Peña-Quintana, Luís; Dalmau, Jaime; Bernal, Jaime; Briceño, Ignacio; Couce, María Luz; Rodés, Marga; Vilaseca, Maria Antonia; Balcells, Susana; Grinberg, Daniel

    2006-01-01

    Classical homocystinuria is due to cystathionine beta-synthase (CBS) deficiency. More than 130 mutations, which differ in prevalence and severity, have been described at the CBS gene. Mutation p.I278T is very prevalent, has been found in all European countries where it has been looked for with the exception of the Iberian peninsula, and is known to respond to vitamin B6. On the other hand, mutation p.T191M is prevalent in Spain and Portugal and does not respond to B6. We analysed 30 pedigrees from Spain, Portugal, Colombia and Argentina, segregating for homocystinuria. The p.T191M mutation was detected in patients from all four countries and was particularly prevalent in Colombia. The number of p.T191M alleles described in this study, together with those previously published, is 71. The prevalence of p.T191M among CBS mutant alleles in the different countries was: 0.75 in Colombia, 0.52 in Spain, 0.33 in Portugal, 0.25 in Venezuela, 0.20 in Argentina and 0.14 in Brazil. Haplotype analyses suggested a double origin for this mutation. No genotype-phenotype correlation other than the B6-nonresponsiveness could be established for the p.T191M mutation. Additionally, three new mutations, p.M173V, p.I429del and c.69_70+8del10, were found. The p.M173V was associated with a mild, B6-responsive, phenotype.

  1. Safety profile of snake antivenom (use) in Hong Kong - a review of 191 cases from 2008 to 2015.

    Science.gov (United States)

    Mong, Rupeng; Ng, Vember C H; Tse, Man Li

    2017-12-01

    The mainstay of treatment for significant envenoming from snakebites is antivenom. However, there is insufficient data regarding the safety of antivenom used in Hong Kong. We describe the incidence of hypersensitivity reactions from antivenom use and review the frequency and reasons for intensive care unit (ICU) admission. The Hong Kong Poisons Information Centre database was reviewed. All patients given snake antivenom between 2008 and 2015 were included. Patient demographics, species of snake involved, details of antivenom used, treatment location, use of pre-treatment, reasons for ICU admission (where applicable) and details of early and late antivenom reactions were extracted. There were 191 patients who received snake antivenom. Most (93%) were treated with either the green pit viper antivenom from Thailand or the Agkistrodon halys antivenom from China. The incidences of early hypersensitivity reactions to green pit viper antivenom and Agkistrodon Halys antivenom were 4.7% and 1.4%, respectively. Most patients (69%) were managed in the ED observation ward or general ward. There were 59 patients managed in ICU, most (90%) of whom were admitted for close monitoring during antivenom administration. There were no cases of significant morbidity from antivenom administration. Eight patients (5.6%) had features suggestive of mild serum sickness. The incidence of immediate hypersensitivity reaction to antivenom commonly used in Hong Kong is low. Majority of patients were managed safely in the emergency department observation ward or general ward. Serum sickness appears to be uncommon and possible cases presented with mild features.

  2. Detection of 191 Taxifolin Metabolites and Their Distribution in Rats Using HPLC-ESI-IT-TOF-MSn

    Directory of Open Access Journals (Sweden)

    Ping Yang

    2016-09-01

    Full Text Available Taxifolin is a ubiquitous bioactive constituent of foods and herbs. To thoroughly explore its metabolism in vivo, an HPLC-ESI-IT-TOF-MSn method combined with specific metabolite detection strategy was used to detect and identify the metabolites of taxifolin in rats. Of the 191 metabolites tentatively identified, 154 were new metabolites, 69 were new compounds and 32 were dimers. This is the first report of the in vivo biotransformation of a single compound into more than 100 metabolites. Furthermore, acetylamination and pyroglutamic acid conjugation were identified as new metabolic reactions. Seventeen metabolites were found to have various taxifolin-related bioactivities. The potential targets of taxifolin and 63 metabolites were predicted using PharmMapper, with results showing that more than 60 metabolites have the same five targets. Metabolites with the same fragment pattern may have the same pharmacophore. Thus these metabolites may exert the same pharmacological effects as taxifolin through an additive effect on the same drug targets. This observation indicates that taxifolin is bioactive not only in the parent form, but also through its metabolites. These findings enhance understanding of the metabolism and effective forms of taxifolin and may provide further insight of the beneficial effects of taxifolin and its derivatives.

  3. A Compact Size 4–19.1 GHz Heart Shape UWB Antenna with Triangular Patches

    Directory of Open Access Journals (Sweden)

    Gokmen Isik

    2013-01-01

    Full Text Available An ultrawideband antenna is designed, simulated, and realized. To overcome the narrow bandwidth characteristics of basic patch antennas, the structure of the radiation pattern is optimized by the aid of elliptical and rectangular patches. Also triangular patches are applied to the antenna edge in order to enhance the VSWR and gain properties. A typical VSWR of 1.5 (less than 2 in the whole frequency range and a typical gain of 2 dBi (mainly above 1 dBi in the whole frequency range are observed. The simulations present that the designed antenna has a bandwidth ratio of ~5 : 1 within the frequency range of 4–19.1 GHz with compact dimensions of 25 × 26 mm2. It is fabricated on a 0.5 mm thick, RO3035 substrate. The input impedance, gain, and radiation characteristics of the antenna are also presented. With these properties, it is verified that, with its novel shape, the proposed antenna can be used for various UWB applications.

  4. CNV-association meta-analysis in 191,161 European adults reveals new loci associated with anthropometric traits

    DEFF Research Database (Denmark)

    Macé, Aurélien; Tuke, Marcus A; Deelen, Patrick

    2017-01-01

    There are few examples of robust associations between rare copy number variants (CNVs) and complex continuous human traits. Here we present a large-scale CNV association meta-analysis on anthropometric traits in up to 191,161 adult samples from 26 cohorts. The study reveals five CNV associations......-scale genome-wide meta-analysis of structural variation and find rare CNVs associated with height, weight and BMI with large effect sizes.......)). Burden analysis shows a 0.41 cm decrease in height, a 0.003 increase in waist-to-hip ratio and increase in BMI by 0.14 kg/m(2) for each Mb of total deletion burden (P = 2.5 × 10(-10), 6.0 × 10(-5), and 2.9 × 10(-3)). Our study provides evidence that the same genes (e.g., MC4R, FIBIN, and FMO5) harbor...

  5. Constitutional rights to health, public health and medical care: the status of health protections in 191 countries.

    Science.gov (United States)

    Heymann, Jody; Cassola, Adèle; Raub, Amy; Mishra, Lipi

    2013-07-01

    United Nations (UN) member states have universally recognised the right to health in international agreements, but protection of this right at the national level remains incomplete. This article examines the level and scope of constitutional protection of specific rights to public health and medical care, as well as the broad right to health. We analysed health rights in the constitutions of 191 UN countries in 2007 and 2011. We examined how rights protections varied across the year of constitutional adoption; national income group and region; and for vulnerable groups within each country. A minority of the countries guaranteed the rights to public health (14%), medical care (38%) and overall health (36%) in their constitutions in 2011. Free medical care was constitutionally protected in 9% of the countries. Thirteen per cent of the constitutions guaranteed children's right to health or medical care, 6% did so for persons with disabilities and 5% for each of the elderly and the socio-economically disadvantaged. Valuable next steps include regular monitoring of the national protection of health rights recognised in international agreements, analyses of the impact of health rights on health outcomes and longitudinal multi-level studies to assess whether specific formulations of the rights have greater impact.

  6. A comprehensive near- and far-ultraviolet spectroscopic study of the hot DA white dwarf G191-B2B

    Science.gov (United States)

    Preval, S. P.; Barstow, M. A.; Holberg, J. B.; Dickinson, N. J.

    2013-11-01

    We present a detailed spectroscopic analysis of the hot DA white dwarf G191-B2B, using the best signal-to-noise ratio, high-resolution near- and far-UV spectrum obtained to date. This is constructed from co-added Hubble Space Telescope (HST) Space Telescope Imaging Spectrometer (STIS) E140H, E230H and FUSE observations, covering the spectral ranges of 1150-3145 Å and 910-1185 Å, respectively. With the aid of recently published atomic data, we have been able to identify previously undetected absorption features down to equivalent widths of only a few mÅ. In total, 976 absorption features have been detected to 3σ confidence or greater, with 947 of these lines now possessing an identification, the majority of which are attributed to Fe and Ni transitions. In our survey, we have also potentially identified an additional source of circumstellar material originating from Si III. While we confirm the presence of Ge detected by Vennes et al., we do not detect any other species. Furthermore, we have calculated updated abundances for C, N, O, Si, P, S, Fe and Ni, while also calculating, for the first time, a non-local thermodynamic equilibrium abundance for Al, deriving Al III/H=1.60_{-0.08}^{+0.07}× {10}^{-7}. Our analysis constitutes what is the most complete spectroscopic survey of any white dwarf. All observed absorption features in the FUSE spectrum have now been identified, and relatively few remain elusive in the STIS spectrum.

  7. CONFIRMATION OF THE COMPACTNESS OF A z = 1.91 QUIESCENT GALAXY WITH HUBBLE SPACE TELESCOPE'S WIDE FIELD CAMERA 3

    International Nuclear Information System (INIS)

    Szomoru, Daniel; Franx, Marijn; Bouwens, Rychard J.; Van Dokkum, Pieter G.; Trenti, Michele; Illingworth, Garth D.; Labbe, Ivo; Oesch, Pascal A.; Carollo, C. Marcella

    2010-01-01

    We present very deep Wide Field Camera 3 (WFC3) photometry of a massive, compact galaxy located in the Hubble Ultra Deep Field. This quiescent galaxy has a spectroscopic redshift z = 1.91 and has been identified as an extremely compact galaxy by Daddi et al. We use new H F160W imaging data obtained with Hubble Space Telescope/WFC3 to measure the deconvolved surface brightness profile to H ∼ 28 mag arcsec -2 . We find that the surface brightness profile is well approximated by an n = 3.7 Sersic profile. Our deconvolved profile is constructed by a new technique which corrects the best-fit Sersic profile with the residual of the fit to the observed image. This allows for galaxy profiles which deviate from a Sersic profile. We determine the effective radius of this galaxy: r e = 0.42 ± 0.14 kpc in the observed H F160W band. We show that this result is robust to deviations from the Sersic model used in the fit. We test the sensitivity of our analysis to faint 'wings' in the profile using simulated galaxy images consisting of a bright compact component and a faint extended component. We find that due to the combination of the WFC3 imaging depth and our method's sensitivity to extended faint emission we can accurately trace the intrinsic surface brightness profile, and that we can therefore confidently rule out the existence of a faint extended envelope around the observed galaxy down to our surface brightness limit. These results confirm that the galaxy lies a factor ∼10 off from the local mass-size relation.

  8. Draft forecast of the final report for the comparison to 40 CFR Part 191, Subpart B, for the Waste Isolation Pilot Plant

    Energy Technology Data Exchange (ETDEWEB)

    Bertram-Howery, S.G.; Marietta, M.G.; Anderson, D.R.; Gomez, L.S.; Rechard, R.P. (Sandia National Labs., Albuquerque, NM (USA)); Brinster, K.F.; Guzowski, R.V. (Science Applications International Corp., Albuquerque, NM (USA))

    1989-12-01

    The United States Department of Energy is planning to dispose of transuranic wastes, which have been generated by defense programs, at the Waste Isolation Pilot Plant. The WIPP Project will assess compliance with the requirements of the United States Environmental Protection Agency. This report forecasts the planned 1992 document, Comparison to 40 CFR, Part 191, Subpart B, for the Waste Isolation Pilot Plant (WIPP). 130 refs., 36 figs., 11 tabs.

  9. Implementation of the Resource Disincentive in 40 CFR part 191.14 (e) at the Waste Isolation Pilot Plant. Revision 1

    Energy Technology Data Exchange (ETDEWEB)

    1993-06-01

    In 1986, the US Department of Energy (DOE) Waste Isolation Pilot Plant (WIPP) Project Office (WPO) (DOE-WPO) prepared a strategy for complying with the Environmental Protection Agency`s (EPA`s) Standards for the management of transuranic (TRU) waste. Section 3.2.2.2 of the DOE`s report addressed compliance with the Assurance Requirements found in 40 CFR {section} 191.14. One of the Assurance Requirements addresses the selection of repository sites that contain recoverable natural resources. This report documents that the site selection process for the WIPP facility did indeed comply with the natural resource disincentive requirement in 40 CFR {section} 191,14(e) at the time selected and therefore complies with the standard at this time. Thus, it shall be shown that it is reasonably certain that the WIPP site provides better overall protection than practical alternatives that were available when the site was selected. It is important to point out here, and it will be discussed later in the report, that the resource disincentive requirement is a preliminary siting criterion that requires further evaluation of sites that have resources (i.e, hydrocarbons, minerals and groundwater) in the vicinity or on the site. This further evaluation requires that for sites that do have resources, a qualitative determination must be made that the site will provide better overall protection than practical alternatives. The purpose of this report is not to provide a quantitative evaluation for selection of the WIPP site. A further discussion on the difference between the qualitative analysis required under 40 CFR {section} 191.14(e) and the quantitative analysis under other sections of 40 CFR 191 is provided in {section}2.1 of this report.

  10. Astatine-211 labelled proteins and their stability in vivo

    International Nuclear Information System (INIS)

    Yi Changhou; Jin Jannan; Zhang Shuyuan; Wang Ketai; Zhang Dayuan; Zhou Maolun

    1989-01-01

    211 At or 131 I labelled proteins, e.g. 211 At-IgG or 211 At-BSA (bovine serum albumin) were prepared by 211 At reaction with the diazo-compound of para-aminobenzoic acid, which is then conjugated with IgG or BSA via an acylation reaction. The 211 At-carbon bond was found metabolically stable under in vivo conditions. For the labelling of proteins with 211 At or 131 I, other methods of direct oxidation are also described. The results show that for the labelling of proteins with 211 At, high rate of incorporation can be obtained with hydrogen peroxide as oxidant, but the labelling of proteins with 131 I is more favourable with the strong oxidant Chloramine-T. (author) 12 refs.; 6 figs

  11. The phenotype of polycythemia due to Croatian homozygous VHL (571C>G:H191D) mutation is different from that of Chuvash polycythemia (VHL 598C>T:R200W).

    Science.gov (United States)

    Tomasic, Nikica Ljubas; Piterkova, Lucie; Huff, Chad; Bilic, Ernest; Yoon, Donghoon; Miasnikova, Galina Y; Sergueeva, Adelina I; Niu, Xiaomei; Nekhai, Sergei; Gordeuk, Victor; Prchal, Josef T

    2013-04-01

    Mutations of VHL (a negative regulator of hypoxia-inducible factors) have position-dependent distinct cancer phenotypes. Only two known inherited homozygous VHL mutations exist and they cause polycythemia: Chuvash R200W and Croatian H191D. We report a second polycythemic Croatian H191D homozygote distantly related to the first propositus. Three generations of both families were genotyped for analysis of shared ancestry. Biochemical and molecular tests were performed to better define their phenotypes, with an emphasis on a comparison with Chuvash polycythemia. The VHL H191D mutation did not segregate in the family defined by the known common ancestors of the two subjects, suggesting a high prevalence in Croatians, but haplotype analysis indicated an undocumented common ancestor ∼six generations ago as the founder of this mutation. We show that erythropoietin levels in homozygous VHL H191D individuals are higher than in VHL R200W patients of similar ages, and their native erythroid progenitors, unlike Chuvash R200W, are not hypersensitive to erythropoietin. This observation contrasts with a report suggesting that polycythemia in VHL R200W and H191D homozygotes is due to the loss of JAK2 regulation from VHL R200W and H191D binding to SOCS1. In conclusion, our studies further define the hematologic phenotype of VHL H191D and provide additional evidence for phenotypic heterogeneity associated with the positional effects of VHL mutations.

  12. Preliminary performance assessment for the Waste Isolation Pilot Plant, December 1992. Volume 4: Uncertainty and sensitivity analyses for 40 CFR 191, Subpart B

    Energy Technology Data Exchange (ETDEWEB)

    1993-08-01

    Before disposing of transuranic radioactive waste in the Waste Isolation Pilot Plant (WIPP), the United States Department of Energy (DOE) must evaluate compliance with applicable long-term regulations of the United States Environmental Protection Agency (EPA). Sandia National Laboratories is conducting iterative performance assessments (PAs) of the WIPP for the DOE to provide interim guidance while preparing for a final compliance evaluation. This volume of the 1992 PA contains results of uncertainty and sensitivity analyses with respect to the EPA`s Environmental Protection Standards for Management and Disposal of Spent Nuclear Fuel, High-Level and Transuranic Radioactive Wastes (40 CFR 191, Subpart B). Additional information about the 1992 PA is provided in other volumes. Results of the 1992 uncertainty and sensitivity analyses indicate that, conditional on the modeling assumptions, the choice of parameters selected for sampling, and the assigned parameter-value distributions, the most important parameters for which uncertainty has the potential to affect compliance with 40 CFR 191B are: drilling intensity, intrusion borehole permeability, halite and anhydrite permeabilities, radionuclide solubilities and distribution coefficients, fracture spacing in the Culebra Dolomite Member of the Rustler Formation, porosity of the Culebra, and spatial variability of Culebra transmissivity. Performance with respect to 40 CFR 191B is insensitive to uncertainty in other parameters; however, additional data are needed to confirm that reality lies within the assigned distributions.

  13. Baicalin Protects against TNF-α-Induced Injury by Down-Regulating miR-191a That Targets the Tight Junction Protein ZO-1 in IEC-6 Cells.

    Science.gov (United States)

    Wang, Li; Zhang, Ren; Chen, Jian; Wu, Qihui; Kuang, Zaoyuan

    2017-04-01

    Tumor necrosis factor-alpha (TNF-α) plays an important role in the developing process of inflammatory bowel disease. Tight junction protein zonula occludens-1 (ZO-1), one of epithelial junctional proteins, maintains the permeability of intestinal barrier. The objective of this study was to investigate the mechanism of the protective effect of baicalin on TNF-α-induced injury and ZO-1 expression in intestinal epithelial cells (IECs). We found that baicalin pretreatment significantly improved cell viability and cell migration following TNF-α stimulation. miR-191a inhibitor increased the protective effect of baicalin on cell motility injured by TNF-α. In addition, miR-191a down-regulated the mRNA and protein level of its target gene ZO-1. TNF-α stimulation increased miR-191a expression, leading to the decline of ZO-1 mRNA and protein. Moreover, pretreatment with baicalin reversed TNF-α induced decrease of ZO-1 and increase of miR-191a, miR-191a inhibitor significantly enhanced ZO-1 protein expression restored by baicalin. These results indicate that baicalin exerts a protective effect on IEC-6 (rat small intestinal epithelial cells) cells against TNF-α-induced injury, which is at least partly via inhibiting the expression of miR-191a, thus increasing ZO-1 mRNA and protein levels.

  14. Technical assistance for regulatory development: review and evaluation of the EPA standard 40 CFR191 for disposal of high-level waste. Vol. 1

    International Nuclear Information System (INIS)

    Ortiz, N.R.; Wahi, K.K.

    1983-04-01

    The Environmental Protection Agency (EPA) has prepared a draft Standard (40CFR191, Draft 19) which, when finalized, will provide the overall system requirements for the geologic disposal of radioactive waste. This document (Vol. 1) provides an Executive Summary of the work performed at Sandia National Laboratories, Albuquerque, NM, under contract to the US Nuclear Regulatory Commission to analyze certain aspects of the draft Standard. The issues of radionuclide release limits, interpretation, uncertainty, achievability, and assessment of compliance with respect to the requirements of the draft Standard are addressed based on the detailed analyses presented in five companion volumes to this report

  15. Preliminary performance assessment for the Waste Isolation Pilot Plant, December 1992. Volume 1, Third comparison with 40 CFR 191, Subpart B

    Energy Technology Data Exchange (ETDEWEB)

    1992-12-01

    Before disposing of transuranic radioactive wastes in the Waste Isolation Pilot Plant (WIPP), the United States Department of Energy (DOE) must evaluate compliance with applicable long-term regulations of the United States Environmental Protection Agency (EPA). Sandia National Laboratories is conducting iterative performance assessments of the WIPP for the DOE to provide interim guidance while preparing for final compliance evaluations. This volume contains an overview of WIPP performance assessment and a preliminary comparison with the long-term requirements of the Environmental Radiation Protection Standards for Management and Disposal of Spent Nuclear Fuel, High-Level and Transuranic Radioactive Wastes (40 CFR 191, Subpart B).

  16. Entrance channel dependence in the population of the superdeformed bands in {sup 191}Hg and a model for the feeding mechanism

    Energy Technology Data Exchange (ETDEWEB)

    Lauritsen, T; Soramel, F; Khoo, T L; Janssens, R V.F.; Ahmad, I; Carpenter, M P; Liang, Y [Argonne National Lab., IL (United States); Fornal, B; Bearden, I; Benet, Ph; Daley, P; Grabowski, Z W; Maier, R [Purdue Univ., Lafayette, IN (United States); Ye, D; Garg, U; Reviol, W [Notre Dame Univ., IN (United States); Drigert, M W [Idaho National Engineering Lab., Idaho Falls, ID (United States)

    1992-08-01

    The population of the superdeformed bands in {sup 191} Hg has been measured for two reactions with different mass asymmetry. No entrance channel effect was observed, in contrast to similar measurements in the A=150 region. To further elucidate this problem, the entry distribution for the superdeformed band in {sup 192}Hg was measured and a monte Carlo model for the feeding was developed. The simulations suggest that the decision on trapping in the superdeformed well is made at the barrier between the normal and superdeformed wells rather than at the entry point. (author). 9 refs., 3 figs.

  17. Passively mode-locked diode-pumped Tm3+:YLF laser emitting at 1.91 µm using a GaAs-based SESAM

    Science.gov (United States)

    Tyazhev, A.; Soulard, R.; Godin, T.; Paris, M.; Brasse, G.; Doualan, J.-L.; Braud, A.; Moncorgé, R.; Laroche, M.; Camy, P.; Hideur, A.

    2018-04-01

    We report on a diode-pumped Tm:YLF laser passively mode-locked with an InGaAs saturable absorber. The laser emits a train of 31 ps pulses at a wavelength of 1.91 µm with a repetition rate of 94 MHz and a maximum average power of 95 mW. A sustained and robust mode-locking with a signal-to-noise ratio of ~70 dB is obtained even at high relative air humidity, making this system attractive for applications requiring ultra-short pulses in the spectral window just below 2 µm.

  18. The discovery of Ni V in the photospheres of the hot DA white dwarfs RE 2214-492 and G191-B2B

    Science.gov (United States)

    Holberg, J. B.; Hubeny, I.; Barstow, M. A.; Lanz, T.; Sion, E. M.; Tweedy, R. W.

    1994-01-01

    We have co-added six recently obtained International Ultraviolet Explorer (IUE) echelle spectra of the hot DA white dwarf RE 2214-492 and 10 existing archive spectra of the well-known hot DA, G191-B2B. We find that both stars contain numerous weak features due to Ni V. Nickel is thus the second iron-group element to be found in the spectra of the very hottest DA white dwarfs. In addition to Ni V, we also observe Al III in both stars and present evidence for the possible presence of Ni IV and Fe IV in RE 2214-492. The presence of Ni and Al, together with previously reported elements, will contribute significantly to both the EUV opacity and to the apparent complexity of the UV spectra of these stars. Using Non-Local Thermodynamic Equilibrium (NLTE) model atmospheres we estimate the Ni abundances in RE 2214-492 the G191-B2B to be log(Ni/H) = -5.5 +/- 0.3 and -6.0 +/- 0.3, respectively.

  19. Preliminary performance assessment for the Waste Isolation Pilot Plant, December 1992. Vol. 1: Third comparison with 40 CFR 191, Subpart B

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1992-12-15

    Before disposing of transuranic radioactive wastes in the Waste Isolation Pilot Plant (WIPP), the United States Department of Energy (DOE) must evaluate compliance with applicable long-term regulations of the United States Environmental Protection Agency (EPA). Sandia National Laboratories is conducting iterative performance assessments of the WIPP for the DOE to provide interim guidance while preparing for final compliance evaluations. This volume contains an overview of WIPP performance assessment and a preliminary comparison with the long-term requirements of the Environmental Radiation Protection Standards for Management and Disposal of Spent Nuclear Fuel, High-Level and Transuranic Radioactive Wastes (40 CFR 191, Subpart B). Detailed information about the technical basis for the preliminary comparison is contained in Volume 2. The reference data base and values for input parameters used in the modeling system are contained in Volume 3. Uncertainty and sensitivity analyses related to 40 CFR 191B are contained in Volume 4. Volume 5 contains uncertainty and sensitivity analyses of gas and brine migration for undisturbed performance. Finally, guidance derived from the entire 1992 performance assessment is presented in Volume 6. Results of the 1992 performance assessment are preliminary, and are not suitable for final comparison with 40 CFR 191, Subpart B. Portions of the modeling system and the data base remain incomplete, and the level of confidence in the performance estimates is not sufficient for a defensible compliance evaluation. Results are, however, suitable for providing guidance to the WIPP Project. All results are conditional on the models and data used, and are presented for preliminary comparison to the Containment Requirements of 40 CFR 191, Subpart B as mean complementary cumulative distribution functions (CCDFs) displaying estimated probabilistic releases of radionuclides to the accessible environment. Results compare three conceptual models for

  20. Preliminary performance assessment for the Waste Isolation Pilot Plant, December 1992. Vol. 1: Third comparison with 40 CFR 191, Subpart B

    International Nuclear Information System (INIS)

    1992-12-01

    Before disposing of transuranic radioactive wastes in the Waste Isolation Pilot Plant (WIPP), the United States Department of Energy (DOE) must evaluate compliance with applicable long-term regulations of the United States Environmental Protection Agency (EPA). Sandia National Laboratories is conducting iterative performance assessments of the WIPP for the DOE to provide interim guidance while preparing for final compliance evaluations. This volume contains an overview of WIPP performance assessment and a preliminary comparison with the long-term requirements of the Environmental Radiation Protection Standards for Management and Disposal of Spent Nuclear Fuel, High-Level and Transuranic Radioactive Wastes (40 CFR 191, Subpart B). Detailed information about the technical basis for the preliminary comparison is contained in Volume 2. The reference data base and values for input parameters used in the modeling system are contained in Volume 3. Uncertainty and sensitivity analyses related to 40 CFR 191B are contained in Volume 4. Volume 5 contains uncertainty and sensitivity analyses of gas and brine migration for undisturbed performance. Finally, guidance derived from the entire 1992 performance assessment is presented in Volume 6. Results of the 1992 performance assessment are preliminary, and are not suitable for final comparison with 40 CFR 191, Subpart B. Portions of the modeling system and the data base remain incomplete, and the level of confidence in the performance estimates is not sufficient for a defensible compliance evaluation. Results are, however, suitable for providing guidance to the WIPP Project. All results are conditional on the models and data used, and are presented for preliminary comparison to the Containment Requirements of 40 CFR 191, Subpart B as mean complementary cumulative distribution functions (CCDFs) displaying estimated probabilistic releases of radionuclides to the accessible environment. Results compare three conceptual models for

  1. Overexpression of microRNA miR-30a or miR-191 in A549 lung cancer or BEAS-2B normal lung cell lines does not alter phenotype.

    Directory of Open Access Journals (Sweden)

    Santosh Kumar Patnaik

    Full Text Available BACKGROUND: MicroRNAs (miRNAs are small, noncoding RNAs (ribonucleic acids that regulate translation. Several miRNAs have been shown to be altered in whole cancer tissue compared to normal tissue when quantified by microarray. Based on previous such evidence of differential expression, we chose to study the functional significance of miRNAs miR-30a and -191 alterations in human lung cancer. METHODOLOGY/PRINCIPAL FINDINGS: The functional significance of miRNAs miR-30a and -191 was studied by creating stable transfectants of the lung adenocarcinoma cell line A549 and the immortalized bronchial epithelial cell line BEAS-2B with modest overexpression of miR-30a or -191 using a lentiviral system. When compared to the corresponding controls, both cell lines overexpressing miR-30a or -191 do not demonstrate any significant changes in cell cycle distribution, cell proliferation, adherent colony formation, soft agar colony formation, xenograft formation in a subcutaneous SCID mouse model, and drug sensitivity to doxorubicin and cisplatin. There is a modest increase in cell migration in cell lines overexpressing miR-30a compared to their controls. CONCLUSIONS/SIGNIFICANCE: Overexpression of miR-30a or -191 does not lead to an alteration in cell cycle, proliferation, xenograft formation, and chemosensitivity of A549 and BEAS-2B cell lines. Using microarray data from whole tumors to select specific miRNAs for functional study may be a suboptimal strategy.

  2. Regulatory issues for Waste Isolation Pilot Plant long-term compliance with U.S. Environmental Protection Agency 40 CFR 191B and 268

    International Nuclear Information System (INIS)

    Anderson, D.R.; Marietta, M.G.; Higgins, P.J. Jr.

    1993-10-01

    Before disposing of transuranic radioactive waste at the Waste Isolation Pilot Plant (WIPP), the United States Department of Energy (DOE) must evaluate compliance with long-term regulations of the United States Environmental Protection Agency (EPA), specifically the Environmental Standards for the Management and Disposal of Spent Nuclear Fuel, High-Level and Transuranic Radioactive Wastes (40 CFR 191), and the Land Disposal Restrictions (40 CFR 268) of the Hazardous and Solid Waste Amendments to the Resource Conservation and Recovery Act (RCRA). Sandia National Laboratories (SNL) is conducting iterative performance assessments (PAs) of the WIPP for the DOE to provide interim guidance while preparing for final compliance evaluations. This paper provides background information on the regulations, describes the SNL WIPP PA Departments approach to developing a defensible technical basis for consistent compliance evaluations, and summarizes the major observations and conclusions drawn from the 1991 and 1992 PAs

  3. Expression in Whole Blood Samples of miRNA-191 and miRNA-455-3p in Patients with AAA and Their Relationship to Clinical Outcomes after Endovascular Repair.

    Science.gov (United States)

    Tenorio, Emanuel Junio Ramos; Braga, Andre Felipe Farias; Tirapelli, Daniela Pretti Da Cunha; Ribeiro, Mauricio Serra; Piccinato, Carlos Eli; Joviliano, Edwaldo Edner

    2018-03-05

    The purpose of this study was to quantify and evaluate the expression response of miRNA-191 and miRNA-455-3p endovascular repair of abdominal aortic aneurysm (AAA) based in whole blood samples. This report describes a prospective study of a single center of 30 patients with AAA who underwent endovascular repair. Blood samples were collected preoperatively and 6 months postoperatively. The differential expression of the miRNAs was performed by the real-time polymerase chain reaction method, after extraction of the RNA from the blood samples at the 2 moments. In addition, bioinformatic tools were used to determine pathophysiological pathways related to AAA. The miR-191 and miR-455-3p were overexpressed preoperatively. After 6 months postoperatively, miR-191 (median 0.98, IQR 0.5-2.1, P AAA showed no significant differences in the expression of miR-191 and miR-455-3p. Exclusion of the aneurysmal sac after endovascular treatment induces a decrease in the expression of the studied miRNAs in whole blood samples, which suggests a possible use of them as biomarkers of therapeutic success. Copyright © 2018 Elsevier Inc. All rights reserved.

  4. Fast neutron capture cross sections of /sup 169/Tm, /sup 191/Ir, /sup 193/Ir, and /sup 175/Lu for 3 less than or equal to E/sub n/ less than or equal to 2000 keV

    Energy Technology Data Exchange (ETDEWEB)

    Macklin, R.L.; Drake, D.M.; Malanify, J.J.

    1977-11-01

    Fast neutron capture cross sections of /sup 169/Tm, /sup 191/Ir, /sup 193/Ir, and /sup 175/Lu, and the /sup 6/Li(n,..cap alpha..)/sup 3/H cross sections to which they are normalized are presented in tabular form for neutron energies between 3 and 2000 keV.

  5. Stellar Laboratories . [VI. New Mo IV - VII Oscillator Strengths and the Molybdenum Abundance in the Hot White Dwarfs G191-B2B and RE 0503-289

    Science.gov (United States)

    Rauch, T.; Quinet, T.; Hoyer, D.; Werner, K.; Demleitner, M.; Kruk, J. W.

    2016-01-01

    For the spectral analysis of high-resolution and high signal-to-noise (SN) spectra of hot stars, state-of-the-art non-local thermodynamic equilibrium (NLTE) model atmospheres are mandatory. These are strongly dependent on the reliability of the atomic data that is used for their calculation. Aims: To identify molybdenum lines in the ultraviolet (UV) spectra of the DA-type white dwarf G191B2B and the DO-type white dwarf RE 0503289 and, to determine their photospheric Mo abundances, reliable Mo iv-vii oscillator strengths are used. Methods: We newly calculated Mo iv-vii oscillator strengths to consider their radiative and collisional bound-bound transitions indetail in our NLTE stellar-atmosphere models for the analysis of Mo lines exhibited in high-resolution and high SN UV observations of RE 0503289.Results. We identified 12 Mo v and nine Mo vi lines in the UV spectrum of RE 0503289 and measured a photospheric Mo abundance of 1.2 3.0 104(mass fraction, 22 500 56 400 times the solar abundance). In addition, from the As v and Sn iv resonance lines,we measured mass fractions of arsenic (0.51.3 105, about 300 1200 times solar) and tin (1.33.2 104, about 14 300 35 200 times solar). For G191B2B, upper limits were determined for the abundances of Mo (5.3 107, 100 times solar) and, in addition, for Kr (1.1106, 10 times solar) and Xe (1.7107, 10 times solar). The arsenic abundance was determined (2.35.9 107, about 21 53 times solar). A new, registered German Astrophysical Virtual Observatory (GAVO) service, TOSS, has been constructed to provide weighted oscillator strengths and transition probabilities.Conclusions. Reliable measurements and calculations of atomic data are a prerequisite for stellar-atmosphere modeling. Observed Mo v-vi line profiles in the UV spectrum of the white dwarf RE 0503289 were well reproduced with our newly calculated oscillator strengths. For the first time, this allowed the photospheric Mo abundance in a white dwarf to be determined.

  6. SOLVENT HOLD TANK SAMPLE RESULTS FOR MCU-13-189, MCU-13-190, AND MCU-13-191: QUARTERLY SAMPLE FROM SEPTEMBER 2013

    Energy Technology Data Exchange (ETDEWEB)

    Fondeur, F.; Taylor-Pashow, K.

    2013-10-31

    Savannah River National Laboratory (SRNL) analyzed solvent samples from Modular Caustic-Side Solvent Extraction Unit (MCU) in support of continuing operations. A quarterly analysis of the solvent is required to maintain solvent composition within specifications. Analytical results of the analyses of Solvent Hold Tank (SHT) samples MCU-13-189, MCU-13-190, and MCU-13-191 received on September 4, 2013 are reported. The results show that the solvent (remaining heel in the SHT tank) at MCU contains excess Isopar L and a deficit concentration of modifier and trioctylamine when compared to the standard MCU solvent. As with the previous solvent sample results, these analyses indicate that the solvent does not require Isopar L trimming at this time. Since MCU is switching to NGS, there is no need to add TOA nor modifier. SRNL also analyzed the SHT sample for {{sup 137}Cs content and determined the measured value is within tolerance and the value has returned to levels observed in 2011.

  7. The interstellar medium and the highly ionized species observed in the spectrum of the nearby white dwarf G191-B2B

    Science.gov (United States)

    Bruhweiler, F. C.; Kondo, Y.

    1981-01-01

    High-resolution spectra of the nearby (48 pc) white dwarf G191-B2B, obtained with the International Ultraviolet Explorer, reveal sharp resonance lines of N V, C IV, and Si IV. The origin of these features is most likely linked to the white dwarf, possibly being formed in an expanding halo around the star. Interstellar lines of C II, N I, Mg II, Si II, and Fe II are also seen in the spectrum. Analysis of these features indicates an average neutral hydrogen number density of 0.064 for this line of sight. In combination with the recent EUV and soft X-ray results, this is interpreted to mean that the interstellar medium in the most immediate solar vicinity is of the normal density n approximately equal to 0.1/cu cm of lower ionization, while just beyond it, at least in some directions, is a hot lower density plasma. These results are apparently in conflict with the model of the interstellar medium by McKee and Ostriker (1977) in its present form.

  8. Interstellar medium and the highly ionized species observed in the spectrum of the nearby white dwarf G191-B2B

    International Nuclear Information System (INIS)

    Bruhweiler, F.C.; Kondo, Y.

    1981-01-01

    High-resolution spectra of the neargy (48 pc) white dwarf G191-B2B obtained with the International Ultraviolet Explorer (IUE) reveal sharp resonance lines of N V, C IV, and Si IV. The origin of these features is most likely linked to the white dwarf, possibly being formed in an expanding halo around the star. Interstellar lines of C II, N I, Mg II, Si II, Fe II are also seen in the spectrum. Analysis of these features indicates an average neutral hydrogen number density, n/sub Htsi/ = 6.4 x 10 -3 , for this line of sight. In combination with the recent EUV and soft X-ray results, we interpret this to mean that the interstellar medium in the most immediate solar vicinity is of the ''normal'' density (nroughly-equal0.1 cm -3 ) of lower ionization, while just beyond it, at least in some directions, is a hot, lower density plasma. These results are apparently in conflict with the model of the interstellar medium by McKee and Ostriker in its present form

  9. High-resolution extreme ultraviolet spectroscopy of G191-B2B: structure of the stellar photosphere and the surrounding interstellar medium

    Science.gov (United States)

    Barstow, M. A.; Cruddace, R. G.; Kowalski, M. P.; Bannister, N. P.; Yentis, D.; Lapington, J. S.; Tandy, J. A.; Hubeny, I.; Schuh, S.; Dreizler, S.; Barbee, T. W.

    2005-10-01

    We have continued our detailed analysis of the high-resolution (R= 4000) spectroscopic observation of the DA white dwarf G191-B2B, obtained by the Joint Astrophysical Plasmadynamic Experiment (J-PEX) normal incidence sounding rocket-borne telescope, comparing the observed data with theoretical predictions for both homogeneous and stratified atmosphere structures. We find that the former models give the best agreement over the narrow waveband covered by J-PEX, in conflict with what is expected from previous studies of the lower resolution but broader wavelength coverage Extreme Ultraviolet Explorer spectra. We discuss the possible limitations of the atomic data and our understanding of the stellar atmospheres that might give rise to this inconsistency. In our earlier study, we obtained an unusually high ionization fraction for the ionized HeII present along the line of sight to the star. In the present paper, we obtain a better fit when we assume, as suggested by Space Telescope Imaging Spectrograph results, that this HeII resides in two separate components. When one of these is assigned to the local interstellar cloud, the implied He ionization fraction is consistent with measurements along other lines of sight. However, the resolving power and signal-to-noise available from the instrument configuration used in this first successful J-PEX flight are not sufficient to clearly identify and prove the existence of the two components.

  10. miR-191 and miR-135 are required for long-lasting spine remodelling associated with synaptic long-term depression

    Science.gov (United States)

    Hu, Zhonghua; Yu, Danni; Gu, Qin-Hua; Yang, Yanqin; Tu, Kang; Zhu, Jun; Li, Zheng

    2014-02-01

    Activity-dependent modification of dendritic spines, subcellular compartments accommodating postsynaptic specializations in the brain, is an important cellular mechanism for brain development, cognition and synaptic pathology of brain disorders. NMDA receptor-dependent long-term depression (NMDAR-LTD), a prototypic form of synaptic plasticity, is accompanied by prolonged remodelling of spines. The mechanisms underlying long-lasting spine remodelling in NMDAR-LTD, however, are largely unclear. Here we show that LTD induction causes global changes in miRNA transcriptomes affecting many cellular activities. Specifically, we show that expression changes of miR-191 and miR-135 are required for maintenance but not induction of spine restructuring. Moreover, we find that actin depolymerization and AMPA receptor exocytosis are regulated for extended periods of time by miRNAs to support long-lasting spine plasticity. These findings reveal a miRNA-mediated mechanism and a role for AMPA receptor exocytosis in long-lasting spine plasticity, and identify a number of candidate miRNAs involved in LTD.

  11. External Validation of the European Hernia Society Classification for Postoperative Complications after Incisional Hernia Repair: A Cohort Study of 2,191 Patients.

    Science.gov (United States)

    Kroese, Leonard F; Kleinrensink, Gert-Jan; Lange, Johan F; Gillion, Jean-Francois

    2018-03-01

    Incisional hernia is a frequent complication after midline laparotomy. Surgical hernia repair is associated with complications, but no clear predictive risk factors have been identified. The European Hernia Society (EHS) classification offers a structured framework to describe hernias and to analyze postoperative complications. Because of its structured nature, it might prove to be useful for preoperative patient or treatment classification. The objective of this study was to investigate the EHS classification as a predictor for postoperative complications after incisional hernia surgery. An analysis was performed using a registry-based, large-scale, prospective cohort study, including all patients undergoing incisional hernia surgery between September 1, 2011 and February 29, 2016. Univariate analyses and multivariable logistic regression analysis were performed to identify risk factors for postoperative complications. A total of 2,191 patients were included, of whom 323 (15%) had 1 or more complications. Factors associated with complications in univariate analyses (p < 0.20) and clinically relevant factors were included in the multivariable analysis. In the multivariable analysis, EHS width class, incarceration, open surgery, duration of surgery, Altemeier wound class, and therapeutic antibiotic treatment were independent risk factors for postoperative complications. Third recurrence and emergency surgery were associated with fewer complications. Incisional hernia repair is associated with a 15% complication rate. The EHS width classification is associated with postoperative complications. To identify patients at risk for complications, the EHS classification is useful. Copyright © 2017. Published by Elsevier Inc.

  12. Sweet Taste Receptor TAS1R2 Polymorphism (Val191Val Is Associated with a Higher Carbohydrate Intake and Hypertriglyceridemia among the Population of West Mexico

    Directory of Open Access Journals (Sweden)

    Omar Ramos-Lopez

    2016-02-01

    Full Text Available Some high-carbohydrate diets may lead to obesity and multiple metabolic disorders, including hypertriglyceridemia (HTG. This lipid abnormality is considered an important risk factor for cardiovascular disease and type 2 diabetes. The sweet taste receptor TAS1R2 polymorphism (Ile191Val has been reported to be associated with carbohydrate intake. The aim of this study was to analyze the association of the TAS1R2 gene polymorphism with carbohydrate intake and HTG among the population of West Mexico. In a cross-sectional study, 441 unrelated subjects were analyzed for TAS1R2 genotypes (Ile/Ile, Ile/Val and Val/Val by an allelic discrimination assay. Biochemical tests and a three-day food record were assessed. The Val/Val genotype carriers had a higher intake of total carbohydrates, fiber and servings of cereals and vegetables than the other genotype carriers. The Val/Val genotype conferred a higher risk for HTG than the Ile/Val and Ile/Ile genotypes (OR = 3.26, 95%CI 1.35–7.86, p = 0.006 and OR = 2.61, 95%CI 1.12–6.07, p = 0.02, respectively. Furthermore, the Val/Val genotype was associated with approximately 30% higher triglycerides compared with Ile/Val and Ile/Ile genotypes (β = 44.09, 95%CI 9.94–78.25, p = 0.01 and β = 45.7, 95%CI 10.85–80.54, p = 0.01, respectively. In conclusion, the Val/Val genotype of TAS1R2 was associated with a higher carbohydrate intake and HTG.

  13. Odd and even partial waves of ηπ− and η′π− in π−p→η(′)π−p at 191 GeV/c

    NARCIS (Netherlands)

    Adolph, C.; Akhunzyanov, R.; Alexeev, M. G.; Alexeev, G. D.; Amoroso, A.; Andrieux, V.; Anosov, V.; Austregesilo, A.; Badelek, B.; Balestra, F.; Barth, J.; Baum, G.; Beck, R.; Bedfer, Y.; Berlin, A.; Bernhard, J.; Bicker, K.; Bielert, E. R.; Bieling, J.; Birsa, R.; Bisplinghoff, J.; Bodlak, M.; Boer, M.; Bordalo, P.; Bradamante, F.; Braun, C.; Bressan, A.; Buechele, M.; Burtin, E.; Capozza, L.; Chiosso, M.; Chung, S. U.; Cicuttin, A.; Crespo, M. L.; Curiel, Q.; Torre, S. Dalla; Dasgupta, S. S.; Dasgupta, S.; Denisov, O. Yu; Donskov, S. V.; Doshita, N.; Duic, V.; Duennweber, W.; Dziewiecki, M.; Efremov, A.; Elia, C.; Eversheim, P. D.; Eyrich, W.; Faessler, M.; Ferrero, A.; Filin, A.; Finger, M.; jr, M. Finger; Fischer, H.; Franco, C.; Hohenesche, N. du Fresne von; Friedrich, J. M.; Frolov, V.; Gautheron, F.; Gavrichtchouk, O. P.; Gerassimov, S.; Geyer, R.; Gnesi, I.; Gobbo, B.; Goertz, S.; Gorzellik, M.; Grabmueller, S.; Grasso, A.; Grube, B.; Grussenmeyer, T.; Guskov, A.; Haas, F.; Harrach, D. von; Hahne, D.; Hashimoto, R.; Heinsius, F. H.; Herrmann, F.; Hinterberger, F.; Hoeppner, Ch; Horikawa, N.; d'Hose, N.; Huber, S.; Ishimoto, S.; Ivanov, A.; Ivanshin, Yu; Iwata, T.; Jahn, R.; Jary, V.; Jasinski, P.; Joerg, P.; Joosten, R.; Kabuss, E.; Ketzer, B.; Khaustov, G. V.; Khokhlov, Yu A.; Kisselev, Yu; Klein, F.; Klimaszewski, K.; Koivuniemi, J. H.; Kolosov, V. N.; Kondo, K.; Koenigsmann, K.; Konorov, I.; Konstantinov, V. F.; Kotzinian, A. M.; Kouznetsov, O.; Kraemer, M.; Kroumchtein, Z. V.; Kuchinski, N.; Kunne, F.; Kurek, K.; Kurjata, R. P.; Lednev, A. A.; Lehmann, A.; Levillain, M.; Levorato, S.; Lichtenstadt, J.; Maggiora, A.; Magnon, A.; Makke, N.; Mallot, G. K.; Marchand, C.; Martin, A.; Marzec, J.; Matousek, J.; Matsuda, H.; Matsuda, T.; Meshcheryakov, G.; Meyer, W.; Michigami, T.; Mikhailov, Yu V.; Miyachi, Y.; Nagaytsev, A.; Nagel, T.; Nerling, F.; Neubert, S.; Neyret, D.; Nikolaenko, V. I.; Novy, J.; Nowak, W. -D.; Nunes, A. S.; Olshevsky, A. G.; Orlov, I.; Ostrick, M.; Panknin, R.; Panzieri, D.; Parsamyan, B.; Paul, S.; Peshekhonov, D. V.; Platchkov, S.; Pochodzalla, J.; Polyakov, V. A.; Pretz, J.; Quaresma, M.; Quintans, C.; Ramos, S.; Regali, C.; Reicherz, G.; Rocco, E.; Rossiyskaya, N. S.; Ryabchikov, D. I.; Rychter, A.; Samoylenko, V. D.; Sandacz, A.; Sarkar, S.; Savin, I. A.; Sbrizzai, G.; Schiavon, P.; Schill, C.; Schlueter, T.; Schmidt, K.; Schmieden, H.; Schoenning, K.; Schopferer, S.; Schott, M.; Shevchenko, O. Yu; Silva, L.; Sinha, L.; Sirtl, S.; Slunecka, M.; Sosio, S.; Sozzi, F.; Srnka, A.; Steiger, L.; Stolarski, M.; Sulc, M.; Sulej, R.; Suzuki, H.; Szabelski, A.; Szameitat, T.; Sznajder, P.; Takekawa, S.; Wolbeek, J. ter; Tessaro, S.; Tessarotto, F.; Thibaud, F.; Uhl, S.; Uman, I.; Virius, M.; Wang, L.; Weisrock, T.; Wilfert, M.; Windmolders, R.; Wollny, H.; Zaremba, K.; Zavertyaev, M.; Zemlyanichkina, E.; Ziembicki, M.; Zink, A.

    2015-01-01

    Exclusive production of ηπ− and η′π− has been studied with a 191 GeV/cπ− beam impinging on a hydrogen target at COMPASS (CERN). Partial-wave analyses reveal different odd/even angular momentum (L ) characteristics in the inspected invariant mass range up to 3 GeV/c2. A striking similarity between

  14. Chemonuclear studies for identification for new production routes for the therapeutically useful radionuclides {sup 140}Nd, {sup 192}Ir, {sup 191}Pt, {sup 193m}Pt, und {sup 195m}Pt; Kernchemische Studien zur Entwicklung neuerer Produktionsverfahren fuer die therapierelevanten Radionuklide {sup 140}Nd, {sup 192}Ir, {sup 191}Pt, {sup 193m}Pt, und {sup 195m}Pt

    Energy Technology Data Exchange (ETDEWEB)

    Hilgers, K.

    2005-12-15

    New production routes for the therapeutically useful radionuclides {sup 140}Nd, {sup 192}Ir, {sup 191}Pt, {sup 193m}Pt and {sup 195m}Pt were investigated. Cross section data were measured using the stacked-foil technique and compared with theoretical calculations. A production method for the platinum nuclides was developed. The {sup 141}Pr(p, 2n){sup 140}Nd and {sup nat}Ce({sup 3}He, xn){sup 140}Nd reactions were investigated for production of {sup 140}Nd. Cross section data of nuclear reactions leading to the side products {sup 141}Nd, {sup 139}Nd and {sup 139}Ce could also be achieved. The experimental data were compared with theoretical calculations using the code ALICE-IPPE. A comparison of the calculated thick target yields showed that the {sup 141}Pr(p, 2n){sup 140}Nd reaction gives a higher yield. The {sup 192}Os(p, n){sup 192}Ir reaction was examined in the context of the production of {sup 192}Ir. Cross section data were determined and compared with theoretical calculations using the codes ALICE-IPPE and EMPIRE II. The yield of this reaction was compared with the yield of the reactor production of this nuclide. The reactor production seems to be more suitable because of a higher purity and yield. Cross section data were measured for the {sup 192}Os({alpha}, n){sup 195m}Pt, {sup 192}Os({alpha}, 3n){sup 193m}Pt and {sup 192}Os({sup 3}He, 4n){sup 191}Pt reactions. The activity of {sup 193m}Pt and {sup 195m}Pt was determined by X-ray spectroscopy after a chemical separation procedure. The ALICE-IPPE code was found to be inappropriate to reproduce the experimental values. The calculated yields were compared with the yields of other reactions, especially the reactor production of {sup 195m}Pt. The yield of the {sup 192}Os({alpha}, n){sup 195m}Pt reaction is lower compared to the yield of the reactor production, but offers lower target costs and higher specific activity. A production method for {sup 193m}Pt and {sup 195m}Pt was developed. Batch yields of 0.9 MBq

  15. Efficacy of double-stranded RNA against white spot syndrome virus (WSSV non-structural (orf89, wsv191 and structural (vp28, vp26 genes in the Pacific white shrimp Litopenaeus vannamei

    Directory of Open Access Journals (Sweden)

    César M. Escobedo-Bonilla

    2015-04-01

    Full Text Available White spot syndrome virus (WSSV is a major pathogen in shrimp aquaculture. RNA interference (RNAi is a promising tool against viral infections. Previous works with RNAi showed different antiviral efficacies depending on the silenced gene. This work evaluated the antiviral efficacy of double-stranded (ds RNA against two non-structural (orf89, wsv191 WSSV genes compared to structural (vp26, vp28 genes to inhibit an experimental WSSV infection. Gene orf89 encodes a putative regulatory protein and gene white spot virus (wsv191 encodes a nonspecific nuclease; whereas genes vp26 and vp28 encode envelope proteins, respectively. Molecules of dsRNA against each of the WSSV genes were intramuscularly injected (4 μg per shrimp into a group of shrimp 48 h before a WSSV challenge. The highest antiviral activity occurred with dsRNA against orf89, vp28 and vp26 (cumulative mortalities 10%, 10% and 21%, respectively. In contrast, the least effective treatment was wsv191 dsRNA (cumulative mortality 83%. All dead animals were WSSV-positive by one-step PCR, whereas reverse-transcription PCR of all surviving shrimp confirmed inhibition of virus replication. This study showed that dsRNA against WSSV genes orf89, vp28 and vp26 were highly effective to inhibit virus replication and suggest an essential role in WSSV infection. Non-structural WSSV genes such as orf89 can be used as novel targets to design therapeutic RNAi molecules against WSSV infection.

  16. Stellar Laboratories: 3. New Ba 5, Ba 6, and Ba 7 Oscillator Strengths and the Barium Abundance in the Hot White Dwarfs G191-B2B and RE 0503-289

    Science.gov (United States)

    Rauch, T.; Werner, K.; Quinet, P.; Kruk, Jeffrey Walter

    2014-01-01

    Context. For the spectral analysis of high-resolution and high-signal-to-noise (S/N) spectra of hot stars, state-of-the-art non-local thermodynamic equilibrium (NLTE) model atmospheres are mandatory. These are strongly dependent on the reliability of the atomic data that is used for their calculation. Aims. Reliable Ba 5-7 oscillator strengths are used to identify Ba lines in the spectra of the DA-type white dwarf G191-B2B and the DO-type white dwarf RE 0503-289 and to determine their photospheric Ba abundances. Methods. We newly calculated Ba v-vii oscillator strengths to consider their radiative and collisional bound-bound transitions in detail in our NLTE stellar-atmosphere models for the analysis of Ba lines exhibited in high-resolution and high-S/N UV observations of G191-B2B and RE 0503-289. Results. For the first time, we identified highly ionized Ba in the spectra of hot white dwarfs. We detected Ba vi and Ba vii lines in the Far Ultraviolet Spectroscopic Explorer (FUSE) spectrum of RE 0503-289. The Ba vi/Ba vii ionization equilibrium is well reproduced with the previously determined effective temperature of 70 000 K and surface gravity of log g=7.5. The Ba abundance is 3.5 +/- 0.5 × 10(exp-4) (mass fraction, about 23 000 times the solar value). In the FUSE spectrum of G191-B2B, we identified the strongest Ba vii line (at 993.41 Å) only, and determined a Ba abundance of 4.0 +/- 0.5 × 10(exp-6) (about 265 times solar). Conclusions. Reliable measurements and calculations of atomic data are a pre-requisite for stellar-atmosphere modeling. Observed Ba vi-vii line profiles in two white dwarfs' (G191-B2B and RE 0503-289) far-ultraviolet spectra were well reproduced with our newly calculated oscillator strengths. This allowed to determine the photospheric Ba abundance of these two stars precisely.

  17. Measurement of the Ir-191,193(n,2n)Ir-190,192 Reaction Cross Section Between 9.0 and 16.5 MeV

    Science.gov (United States)

    Wildenhain, Elizabeth; Finch, Sean; Tornow, Werner; Krishichayan, F.

    2017-09-01

    Iridium is one of the elements prioritized by Nonproliferation and Homeland Security agencies. In addition, Ir-192 is being used in various medical treatments. Improved data and corresponding evaluations of neutron-induced reactions on the iridium isotopes are required to meet the demands of several applications of societal interest. This study measured the cross section of the Ir-191,193(n, 2n)Ir-190,192 reactions at energies from 9.0 to 16.5 MeV using the activation technique. Natural Ir samples [Ir-191 37.3%, Ir-193 62.7%] were sandwiched between Au-197 monitor foils and irradiated with monoenergetic neutron beams at the tandem facility of the Triangle Universities Nuclear Laboratory (TUNL). Gamma rays from the irradiated samples were counted in TUNL's low background facility using high-efficient HPGe detectors. Measured cross-section data are compared to previous data and to predictions from nuclear data libraries (e.g. ENDF). Research at TUNL funded by the NSF.

  18. Stellar laboratories. II. New Zn iv and Zn v oscillator strengths and their validation in the hot white dwarfs G191-B2B and RE 0503-289

    Science.gov (United States)

    Rauch, T.; Werner, K.; Quinet, P.; Kruk, J. W.

    2014-04-01

    Context. For the spectral analysis of high-resolution and high-signal-to-noise (S/N) spectra of hot stars, state-of-the-art non-local thermodynamic equilibrium (NLTE) model atmospheres are mandatory. These are strongly dependent on the reliability of the atomic data that is used for their calculation. In a recent analysis of the ultraviolet (UV) spectrum of the DA-type white dwarf G191-B2B, 21 Zn iv lines were newly identified. Because of the lack of Zn iv data, transition probabilities of the isoelectronic Ge vi were adapted for a first, coarse determination of the photospheric Zn abundance. Aims: Reliable Zn iv and Zn v oscillator strengths are used to improve the Zn abundance determination and to identify more Zn lines in the spectra of G191-B2B and the DO-type white dwarf RE 0503-289. Methods: We performed new calculations of Zn iv and Zn v oscillator strengths to consider their radiative and collisional bound-bound transitions in detail in our NLTE stellar-atmosphere models for the analysis of the Zn iv - v spectrum exhibited in high-resolution and high-S/N UV observations of G191-B2B and RE 0503-289. Results: In the UV spectrum of G191-B2B, we identify 31 Zn iv and 16 Zn v lines. Most of these are identified for the first time in any star. We can reproduce well almost all of them at log Zn = -5.52 ± 0.2 (mass fraction, about 1.7 times solar). In particular, the Zn iv / Zn v ionization equilibrium, which is a very sensitive Teff indicator, is well reproduced with the previously determined and log g = 7.60 ± 0.05. In the spectrum of RE 0503-289, we identified 128 Zn v lines for the first time and determined log Zn = -3.57 ± 0.2 (155 times solar). Conclusions: Reliable measurements and calculations of atomic data are a pre-requisite for stellar-atmosphere modeling. Observed Zn iv and Zn v line profiles in two white dwarf (G191-B2B and RE 0503-289) ultraviolet spectra were well reproduced with our newly calculated oscillator strengths. This allowed us to

  19. Certification of the contents (mass fractions) of Cd, Pb, Se, Cu, Zn, Fe and Mn in wholemeal flour and lyophilized brown bread reference materials. Wholemeal flour - CRM no. 189; brown bread - CRM no. 191

    Energy Technology Data Exchange (ETDEWEB)

    Wagstaffe, P J; Griepink, B; Muntau, H; Schramel, P

    1987-01-01

    The report describes the preparation and certification of a wholemeal flour (CRM 189) and a lyophilised brown breas (CRM 191) for their contents (mass fractions) of elements of toxicological and nutritional importance: Cd, Pb, Se, Cu, Zn, Fe and Mn. Indicative values are also given for As, Ca, Cl, Cr, Hg, Mg, Na, Ni, P and K. Details are given of a preliminary intercomparison of methods for these elements in a wholemeal flour sample, homogeneity and stability studies on the two reference materials and the results and evaluation of the certification exercise which involved 21 European Laboratories. Summaries of the certification methods are also presented. The report concludes with a discussion of the most common sources of error in determining the elements of interest and the steps to be taken to control them. With 7 figs., 28 tabs.

  20. Stellar laboratories . VIII. New Zr iv-vii, Xe iv-v, and Xe vii oscillator strengths and the Al, Zr, and Xe abundances in the hot white dwarfs G191-B2B and RE 0503-289

    Science.gov (United States)

    Rauch, T.; Gamrath, S.; Quinet, P.; Löbling, L.; Hoyer, D.; Werner, K.; Kruk, J. W.; Demleitner, M.

    2017-03-01

    Context. For the spectral analysis of high-resolution and high-signal-to-noise spectra of hot stars, state-of-the-art non-local thermodynamic equilibrium (NLTE) model atmospheres are mandatory. These are strongly dependent on the reliability of the atomic data that is used for their calculation. Aims: To search for zirconium and xenon lines in the ultraviolet (UV) spectra of G191-B2B and RE 0503-289, new Zr iv-vii, Xe iv-v, and Xe vii oscillator strengths were calculated. This allows, for the first time, determination of the Zr abundance in white dwarf (WD) stars and improvement of the Xe abundance determinations. Methods: We calculated Zr iv-vii, Xe iv-v, and Xe vii oscillator strengths to consider radiative and collisional bound-bound transitions of Zr and Xe in our NLTE stellar-atmosphere models for the analysis of their lines exhibited in UV observations of the hot WDs G191-B2B and RE 0503-289. Results: We identified one new Zr iv, 14 new Zr v, and ten new Zr vi lines in the spectrum of RE 0503-289. Zr was detected for the first time in a WD. We measured a Zr abundance of -3.5 ± 0.2 (logarithmic mass fraction, approx. 11 500 times solar). We identified five new Xe vi lines and determined a Xe abundance of -3.9 ± 0.2 (approx. 7500 times solar). We determined a preliminary photospheric Al abundance of -4.3 ± 0.2 (solar) in RE 0503-289. In the spectra of G191-B2B, no Zr line was identified. The strongest Zr iv line (1598.948 Å) in our model gave an upper limit of -5.6 ± 0.3 (approx. 100 times solar). No Xe line was identified in the UV spectrum of G191-B2B and we confirmed the previously determined upper limit of -6.8 ± 0.3 (ten times solar). Conclusions: Precise measurements and calculations of atomic data are a prerequisite for advanced NLTE stellar-atmosphere modeling. Observed Zr iv-vi and Xe vi-vii line profiles in the UV spectrum of RE 0503-289 were simultaneously well reproduced with our newly calculated oscillator strengths. Based on observations

  1. Stellar laboratories. III. New Ba v, Ba vi, and Ba vii oscillator strengths and the barium abundance in the hot white dwarfs G191-B2B and RE 0503-289

    Science.gov (United States)

    Rauch, T.; Werner, K.; Quinet, P.; Kruk, J. W.

    2014-06-01

    Context. For the spectral analysis of high-resolution and high-signal-to-noise (S/N) spectra of hot stars, state-of-the-art non-local thermodynamic equilibrium (NLTE) model atmospheres are mandatory. These are strongly dependent on the reliability of the atomic data that is used for their calculation. Aims: Reliable Ba v-vii oscillator strengths are used to identify Ba lines in the spectra of the DA-type white dwarf G191-B2B and the DO-type white dwarf RE 0503-289 and to determine their photospheric Ba abundances. Methods: We newly calculated Ba v-vii oscillator strengths to consider their radiative and collisional bound-bound transitions in detail in our NLTE stellar-atmosphere models for the analysis of Ba lines exhibited in high-resolution and high-S/N UV observations of G191-B2B and RE 0503-289. Results: For the first time, we identified highly ionized Ba in the spectra of hot white dwarfs. We detected Ba vi and Ba vii lines in the Far Ultraviolet Spectroscopic Explorer (FUSE) spectrum of RE 0503-289. The Ba vi/Ba vii ionization equilibrium is well reproduced with the previously determined effective temperature of 70 000 K and surface gravity of log g = 7.5. The Ba abundance is 3.5 ± 0.5 × 10-4 (mass fraction, about 23 000 times the solar value). In the FUSE spectrum of G191-B2B, we identified the strongest Ba vii line (at 993.41 Å) only, and determined a Ba abundance of 4.0 ± 0.5 × 10-6 (about 265 times solar). Conclusions: Reliable measurements and calculations of atomic data are a pre-requisite for stellar-atmosphere modeling. Observed Ba vi-vii line profiles in two white dwarfs' (G191-B2B and RE 0503-289) far-ultraviolet spectra were well reproduced with our newly calculated oscillator strengths. This allowed to determine the photospheric Ba abundance of these two stars precisely. Based on observations with the NASA/ESA Hubble Space Telescope, obtained at the Space Telescope Science Institute, which is operated by the Association of Universities for

  2. Stellar laboratories. IV. New Ga iv, Ga v, and Ga vi oscillator strengths and the gallium abundance in the hot white dwarfs G191-B2B and RE 0503-289

    Science.gov (United States)

    Rauch, T.; Werner, K.; Quinet, P.; Kruk, J. W.

    2015-05-01

    Context. For the spectral analysis of high-resolution and high-signal-to-noise (S/N) spectra of hot stars, advanced non-local thermodynamic equilibrium (NLTE) model atmospheres are mandatory. These atmospheres are strongly dependent on the reliability of the atomic data that are used to calculate them. Aims: Reliable Ga iv-vi oscillator strengths are used to identify Ga lines in the spectra of the DA-type white dwarf G191-B2B and the DO-type white dwarf RE 0503-289 and to determine their photospheric Ga abundances. Methods: We newly calculated Ga iv-vi oscillator strengths to consider their radiative and collisional bound-bound transitions in detail in our NLTE stellar-atmosphere models for analyzing of Ga lines exhibited in high-resolution and high-S/N UV observations of G191-B2B and RE 0503-289. Results: We unambiguously detected 20 isolated and 6 blended (with lines of other species) Ga v lines in the Far Ultraviolet Spectroscopic Explorer (FUSE) spectrum of RE 0503-289. The identification of Ga iv and Ga vi lines is uncertain because they are weak and partly blended by other lines. The determined Ga abundance is 3.5 ± 0.5 × 10-5 (mass fraction, about 625 times the solar value). The Ga iv/Ga v ionization equilibrium, which is a very sensitive indicator for the effective temperature, is well reproduced in RE 0503-289. We identified the strongest Ga iv lines (at 1258.801, 1338.129 Å) in the HST/STIS spectrum of G191-B2B and measured a Ga abundance of 2.0 ± 0.5 × 10-6 (about 22 times solar). Conclusions: Reliable measurements and calculations of atomic data are a prerequisite for stellar-atmosphere modeling. The observed Ga iv-v line profiles in two white dwarf (G191-B2B and RE 0503-289) ultraviolet spectra were well reproduced with our newly calculated oscillator strengths. For the first time, this allowed us to determine the photospheric Ga abundance in white dwarfs. Based on observations with the NASA/ESA Hubble Space Telescope, obtained at the Space

  3. Basic residues in the 74-83 and 191-198 segments of protein kinase CK2 catalytic subunit are implicated in negative but not in positive regulation by the beta-subunit

    DEFF Research Database (Denmark)

    Sarno, S; Vaglio, P; Marin, O

    1997-01-01

    by the beta-subunit many fold more than that of alpha wild type, while extrastimulation by beta mutant D55L56E57A, observable with alpha wild type, is abolished with these mutants. These data support the conclusion that down regulation by the acidic residues clustered in the N-terminal moiety of beta...... is mediated by basic residues in the 74-83 and in the 191-198 sequences of the alpha-subunit. These are also implicated in substrate recognition consistent with the concept that the N-terminal acidic region of the beta subunit operates as a pseudosubstrate. In contrast, another CK2alpha mutant, V66A, is more...

  4. Final Report for grant entitled "Production of Astatine-211 for U.S. Investigators"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott

    2012-12-12

    Alpha-particle emitting radionuclides hold great promise in the therapy of cancer, but few alpha-emitters are available to investigators to evaluate. Of the alpha-emitters that have properties amenable for use in humans, 211At is of particular interest as it does not have alpha-emitting daughter radionuclides. Thus, there is a high interest in having a source of 211At for sale to investigators in the US. Production of 211At is accomplished on a cyclotron using an alpha-particle beam irradiation of bismuth metal. Unfortunately, there are few cyclotrons available that can produce an alpha particle beam for that production. The University of Washington has a cyclotron, one of three in the U.S., that is currently producing 211At. In the proposed studies, the things necessary for production and shipment of 211At to other investigators will be put into place at UW. Of major importance is the efficient production and isolation of 211At in a form that can be readily used by other investigators. In the studies, production of 211At on the UW cyclotron will be optimized by determining the best beam energy and the highest beam current to maximize 211At production. As it would be very difficult for most investigators to isolate the 211At from the irradiated target, the 211At-isolation process will be optimized and automated to more safely and efficiently obtain the 211At for shipment. Additional tasks to make the 211At available for distribution include obtaining appropriate shipping vials and containers, putting into place the requisite standard operating procedures for Radiation Safety compliance at the levels of 211At activity to be produced / shipped, and working with the Department of Energy, Isotope Development and Production for Research and Applications Program, to take orders, make shipments and be reimbursed for costs of production and shipment.

  5. Reaction of aromatic diazonium salts with carrier-free radioiodine and astatine, evidence for complex formation

    International Nuclear Information System (INIS)

    Meyer, G.J.; Roessler, K.; Stoecklin, G.

    1979-01-01

    Systematic studies of the astatodiazoniation reaction and a comparison with iododediazoniation under comparable conditions are reported. The yields for all astatohalobenzenes and -toluenes were nearly constant and unaffected by the nature of the diazonium compound, its isomeric form, and the number of isomers used at the same time. Only astatofluorobenzenes were obtained at higher yields. An electron-transfer mechanism is proposed for dediazoniation at these low halide concentration levels. At sufficient thermal excitation levels the electron transfer leads to the dissociation of nitrogen, while the phenyl and halogen radicals recombine. The isomer distribution found for some of the derivatives from dediazoniation may also be due to steric effects

  6. Astatine-211-labeled biotin conjugates resistant to biotinidase for use in pretargeted radioimmunotherapy

    International Nuclear Information System (INIS)

    Foulon, Catherine F.; Alston, Kevin L.; Zalutsky, Michael R.

    1998-01-01

    We report herein the preparation and biological evaluation of two radioastatinated biotin conjugates, (3-[ 211 At]astatobenzoyl)norbiotinamide and ((5-[ 211 At]astato-3-pyridinyl)carbonyl)norbiotinamide. Both conjugates were stable in the presence of human serum and cerebrospinal fluid as well as murine serum, indicating a resistance to degradation to biotinidase. The normal tissue clearance of (3-[ 211 At]astatobenzoyl)norbiotinamide and ((5-[ 211 At]astato-3-pyridinyl)carbonyl)norbiotinamide was rapid, as observed previously with their iodo analogues. Also reported are the first syntheses of N-succinimidyl 5-[ 211 At]astato-3-pyridinecarboxylate and 3-[ 211 At]astatoaniline, two reagents of potential utility for labeling proteins and peptides with 211 At

  7. Microdosimetry of astatine-211 and comparison with that of iodine-125

    International Nuclear Information System (INIS)

    Unak, T.

    2001-01-01

    211 At is an alpha and Auger emitter radionuclide and has been frequently used for labeling of different kind of chemical agents. 125 I is also known as an effective Auger emitter. The radionuclides which emit short range and high LET radiations such as alpha particles and Auger electrons have high radiotoxic effectiveness on the living systems. The microdosimetric data are suitable to clarify the real radiotoxic effectiveness and to get the detail of diagnostic and therapeutic application principles of these radionuclides. In this study, the energy and dose absorptions by cell nucleus from alpha particles and Auger electrons emitted by 211 At have been calculated using a Monte Carlo calculation program (code: UNMOC). For these calculations two different model corresponding to the cell nucleus have been used and the data obtained were compared with the data earlier obtained for 125 I. As a result, the radiotoxicity of 211 At is in the competition with 125 I. In the case of a specific agent labelled with 211 At or 125 I is incorporated into the cell or cell nucleus, but non-bound to DNA or not found very close to it, 211 At should considerably be much more radiotoxic than 125 I, but in the case of the labelled agent is bound to DNA or take a place very close to it, the radiotoxicity of 125 I should considerably be higher than 211 At. (author)

  8. Evaluation of Novel Wet Chemistry Separation and Purification Methods to Facilitate Automation of Astatine-211 Isolation

    International Nuclear Information System (INIS)

    Wilbur, Daniel Scott

    2016-01-01

    This research is a collaborative effort between the research groups of the PIs, Dr. D. Scott Wilbur in the Department of Radiation Oncology at the University of Washington (UW) and Matthew O'Hara at the Pacific Northwest National Laboratory (PNNL). In this report only those studies conducted at UW and the budget information from UW will be reported. A separate progress and financial report will be provided by PNNL. This final report outlines the experiments (Tasks) conducted and results obtained at UW from July 1, 2013 thru June 30, 2016 (2-year project with 1 year no-cost extension). The report divides the information on the experiments and results obtained into the 5 specific objectives of the research efforts and the Tasks within those objectives. This format is used so that it is easy to see what has been accomplished in each area. A brief summary of the major findings from the studies is provided below. Summary of Major Findings from Research/Training Activities at UW: Anion and cation exchange columns did not provide adequate 211 At capture and/or extraction results under conditions studied to warrant further evaluation; PEG-Merrifield resins containing mPEG350, mPEG750, mPEG2000 and mPEG5000 were synthesized and evaluated; All of the mPEG resins with different sized mPEG moieties conjugated gave similar 211 At capture (>95%) from 8M HCl solutions and release with conc. NH 4 OH (~50-80%), but very low quantities were released when NaOH was used as an eluent; Capture and release of 211 At when loading [ 211 At]astatate appeared to be similar to that of [ 211 At]astatide on PEG columns, but further studies need to be conducted to confirm that; Capture of 211 At on PEG columns was lower (e.g. 80-90%) from solutions of 8M HNO 3 , but higher capture rates (e.g. 99%) can be obtained when 10M HNO 3 is mixed with an equal quantity of 8M HCl; Addition of reductants to the 211 At solutions did not appear to change the percent capture, but may have an effect on the % extracted; There was some indication that the PEG-Merrifield resins could be saturated (perhaps with Bi) resulting in lower capture percentages, but more studies need to be done to confirm that; A target dissolution chamber, designed and built at PNNL, works well with syringe pumps so it can be used in an automated system; Preliminary semi-automated 211 At isolation studies have been conducted with full-scale target dissolution and 211 At isolation using a PEG column on the Hamilton automated system gave low overall recoveries, but HNO 3 was used (rather than HCl) for loading the 211 At and flow rates were not optimized; Results obtained using PEG columns are high enough to warrant further development on a fully automated system; Results obtained also indicate that additional studies are warranted to evaluate other types of columns for 211 At separation from bismuth, which allow use of HNO 3 /HCl mixtures for loading and NaOH for eluting 211 At. Such a column could greatly simplify the overall isolation process and make it easier to automate.

  9. The potential of 211Astatine for NIS-mediated radionuclide therapy in prostate cancer

    International Nuclear Information System (INIS)

    Willhauck, Michael J.; Sharif Samani, Bibi-Rana; Goeke, Burkhard; Wolf, Ingo; Senekowitsch-Schmidtke, Reingard; Stark, Hans-Juergen; Meyer, Geerd J.; Knapp, Wolfram H.; Morris, John C.; Spitzweg, Christine

    2008-01-01

    We reported recently the induction of selective iodide uptake in prostate cancer cells (LNCaP) by prostate-specific antigen (PSA) promoter-directed sodium iodide symporter (NIS) expression that allowed a significant therapeutic effect of 131 I. In the current study, we studied the potential of the high-energy alpha-emitter 211 At, also transported by NIS, as an alternative radionuclide after NIS gene transfer in tumors with limited therapeutic efficacy of 131 I due to rapid iodide efflux. We investigated uptake and therapeutic efficacy of 211 At in LNCaP cells stably expressing NIS under the control of the PSA promoter (NP-1) in vitro and in vivo. NP-1 cells concentrated 211 At in a perchlorate-sensitive manner, which allowed a dramatic therapeutic effect in vitro. After intrapertoneal injection of 211 At (1 MBq), NP-1 tumors accumulated approximately 16% ID/g 211 At (effective half-life 4.6 h), which resulted in a tumor-absorbed dose of 1,580 ± 345 mGy/MBq and a significant tumor volume reduction of up to 82 ± 19%, while control tumors continued their growth exponentially. A significant therapeutic effect of 211 At has been demonstrated in prostate cancer after PSA promoter-directed NIS gene transfer in vitro and in vivo suggesting a potential role for 211 At as an attractive alternative radioisotope for NIS-targeted radionuclide therapy, in particular in smaller tumors with limited radionuclide retention time. (orig.)

  10. Sci-Thur AM: YIS – 01: New technologies for astatine-211 targeted alpha therapy research

    Energy Technology Data Exchange (ETDEWEB)

    Crawford, Jason; Yang, Hua; Schaffer, Paul; Ruth, Thomas [University of Victoria, Victoria, BC (Canada); TRIUMF, Vancouver, BC (Canada)

    2016-08-15

    Purpose: The short-range, densely ionizing α-particles emitted by {sup 211}At (t{sub 1/2}=7.2h) are well suited for the treatment of diffuse microscopic disease, using cancer targeting biomolecules. {sup 211}At availability is limited by the rarity of α-cyclotrons required for standard production. Image-based dosimetry is also limited for {sup 211}At, which emits low intensity X-rays. Our goal was to leverage state-of-the-art infrastructure at TRIUMF to produce and evaluate two related isotopes, {sup 211}Rn (t{sub 1/2}=14.6h, 73% decay to {sup 211}At) as a generator for {sup 211}At, and {sup 209}At (t{sub 1/2}=5.4h, X-ray/gamma-ray emitter) as a novel 211At surrogate for preclinical imaging studies. Methods: Produced by spallation of uranium with 480 MeV protons, mass separated ion beams of short-lived francium isotopes were implanted into NaCl targets where {sup 211}Rn or {sup 209}At were produced by radioactive decay, in situ. {sup 211}Rn was transferred to dodecane from which {sup 211}At was efficiently extracted and evaluated for clinical applicability. High energy SPECT/CT was evaluated for measuring {sup 209}At activity distributions in mice and phantoms. Results: Our small scale {sup 211}Rn/{sup 211}At generator system provided high purity {sup 211}At samples. The methods are immediately scalable to the level of radioactivity required for in vivo experiments with {sup 211}At. {sup 209}At-based high energy SPECT imaging was determined suitable for pursuing image-based dosimetry in mouse tumour models. In the future, we will utilize quantitative {sup 209}At-SPECT for image-based dose calculations. Conclusion: These early studies provided a foundation for future endeavours with {sup 211}At-based α-therapy. Canada is now significantly closer to clinical targeted α-therapy of cancer.

  11. Targeted radionuclide therapy with astatine-211: Oxidative dehalogenation of astatobenzoate conjugates.

    Science.gov (United States)

    Teze, David; Sergentu, Dumitru-Claudiu; Kalichuk, Valentina; Barbet, Jacques; Deniaud, David; Galland, Nicolas; Maurice, Rémi; Montavon, Gilles

    2017-05-31

    211 At is a most promising radionuclide for targeted alpha therapy. However, its limited availability and poorly known basic chemistry hamper its use. Based on the analogy with iodine, labelling is performed via astatobenzoate conjugates, but in vivo deastatination occurs, particularly when the conjugates are internalized in cells. Actually, the chemical or biological mechanism responsible for deastatination is unknown. In this work, we show that the C-At "organometalloid" bond can be cleaved by oxidative dehalogenation induced by oxidants such as permanganates, peroxides or hydroxyl radicals. Quantum mechanical calculations demonstrate that astatobenzoates are more sensitive to oxidation than iodobenzoates, and the oxidative deastatination rate is estimated to be about 6 × 10 6 faster at 37 °C than the oxidative deiodination one. Therefore, we attribute the "internal" deastatination mechanism to oxidative dehalogenation in biological compartments, in particular lysosomes.

  12. Production of Astatine-211 at the Duke University Medical Center for its regional distribution

    Energy Technology Data Exchange (ETDEWEB)

    Zalutsky, Michael [Duke University Medical Center, Durham, NC (United States)

    2016-01-01

    Systemic targeted radiation therapy and radioimmunotherapy continue to be important tools in the treatment of certain cancers. Because of their high energy and short path length, alpha particle emitters such as 211At are more effective than either external beam x- ray or in vivo beta radiation in delivering potentially curative doses of radiation. The limited clinical trials that have been conducted to date have yielded encouraging responses in some patients, e.g., malignant brain tumors. In order to escalate the additional necessary research and development in radiochemistry, radiobiology and efficacy evaluation of alpha particle radiotherapeutics, it is universally agreed that access to an affordable, reliable supply of 211At is warranted. In conjunction with the Department of Energy's intent to enhance stable and radioactive isotope availability for research applications, it is the primary objective of this project to improve 211At production and purification capabilities at Duke so that this radionuclide can be supplied to researchers at other institutions throughout the US.The most widely used 211At production method involves the α,2n reaction on Bismuth using a cyclotron with beams ≤ 28 MeV. Yields can be enhanced with use of an internal target that allows for a higher alpha fluence plus efficient heat dissipation in the target. Both of these items are in place at Duke; however, in order to support production for multi-institutional use, irradiation campaigns in excess of 50 µAp and four hours duration will be needed. Further, post-irradiation processing equipment is lacking that will enable the distribution process. Financial support is sought for i) a shielded, ventilated processing/containment hood; ii) development of a post-irradiation target retrieval system; iii) fabrication of a 211At distillation and recovery module and iv) a performance review and, where needed, an enhancement of seven major subsystems that comprise the CS-30 Cyclotron. With these modifications in place, routine production of ≥200 mCi of At-211 should be readily achievable, given our methodological development of At-211 target preparation, internal target irradiation and dry distillation to recover the radionuclide.

  13. Use of interhalogen exchange for preparation of astatine-benzene and iodo-benzene

    International Nuclear Information System (INIS)

    Kolachkovski, A.; Khalkin, V.A.

    1976-01-01

    Experimental testing of interhalogen exchange between the solid and liquid phases has been carried out at 155 deg C with particular reference to a NaOH-Na 131 I-BrPh system. Iodine transition rate is dependent on the process duration and alkali amount. The relative amounts of 131 IPh resultant from the reaction of interhalogen exchange is evaluated by paper chromatography. The results obtained may be considered as those which provide experimental support for the assumed efficiency of the production of 131 IPh based on the reaction of interhalogen exchange to yield 70-80% 131 IPh

  14. Preparation and evaluation of an astatine-211-labeled sigma receptor ligand for alpha radionuclide therapy

    International Nuclear Information System (INIS)

    Ogawa, Kazuma; Mizuno, Yoshiaki; Washiyama, Kohshin; Shiba, Kazuhiro; Takahashi, Naruto; Kozaka, Takashi; Watanabe, Shigeki; Shinohara, Atsushi; Odani, Akira

    2015-01-01

    Introduction: Sigma receptors are overexpressed in a variety of human tumors, making them potential targets for radionuclide receptor therapy. We have previously synthesized and evaluated 131 I-labeled (+)-2-[4-(4-iodophenyl)piperidino]cyclohexanol [(+)-[ 131 I]pIV], which has a high affinity for sigma receptors. Therefore, (+)-[ 131 I]pIV significantly inhibited tumor cell proliferation in tumor-bearing mice. In the present study, we report the synthesis and the in vitro and in vivo characterization of (+)-[ 211 At]pAtV, an 211 At-labeled sigma receptor ligand, that has potential use in alpha-radionuclide receptor therapy. Methods: The radiolabeled sigma receptor ligand (+)-[ 211 At]pAtV was prepared using a standard halogenation reaction generating a 91% radiochemical yield with 98% purity after HPLC purification. The partition coefficient of (+)-[ 211 At]pAtV was measured. Cellular uptake experiments and in vivo biodistribution experiments were performed using a mixed solution of (+)-[ 211 At]pAtV and (+)-[ 125 I]pIV; the human prostate cancer cell line DU-145, which expresses high levels of the sigma receptors, and DU-145 tumor-bearing mice. Results: The lipophilicity of (+)-[ 211 At]pAtV was similar to that of (+)-[ 125 I]pIV. DU-145 cellular uptake and the biodistribution patterns in DU-145 tumor-bearing mice at 1 h post-injection were also similar between (+)-[ 211 At]pAtV and (+)-[ 125 I]pIV. Namely, (+)-[ 211 At]pAtV demonstrated high uptake and retention in tumor via binding to sigma receptors. Conclusion: These results indicate that (+)-[ 211 At]pAtV could function as an new agent for alpha-radionuclide receptor therapy.

  15. Preparation and evaluation of an astatine-211-labeled sigma receptor ligand for alpha radionuclide therapy.

    Science.gov (United States)

    Ogawa, Kazuma; Mizuno, Yoshiaki; Washiyama, Kohshin; Shiba, Kazuhiro; Takahashi, Naruto; Kozaka, Takashi; Watanabe, Shigeki; Shinohara, Atsushi; Odani, Akira

    2015-11-01

    Sigma receptors are overexpressed in a variety of human tumors, making them potential targets for radionuclide receptor therapy. We have previously synthesized and evaluated (131)I-labeled (+)-2-[4-(4-iodophenyl)piperidino]cyclohexanol [(+)-[(131)I]pIV], which has a high affinity for sigma receptors. Therefore, (+)-[(131)I]pIV significantly inhibited tumor cell proliferation in tumor-bearing mice. In the present study, we report the synthesis and the in vitro and in vivo characterization of (+)-[(211)At]pAtV, an (211)At-labeled sigma receptor ligand, that has potential use in alpha-radionuclide receptor therapy. The radiolabeled sigma receptor ligand (+)-[(211)At]pAtV was prepared using a standard halogenation reaction generating a 91% radiochemical yield with 98% purity after HPLC purification. The partition coefficient of (+)-[(211)At]pAtV was measured. Cellular uptake experiments and in vivo biodistribution experiments were performed using a mixed solution of (+)-[(211)At]pAtV and (+)-[(125)I]pIV; the human prostate cancer cell line DU-145, which expresses high levels of the sigma receptors, and DU-145 tumor-bearing mice. The lipophilicity of (+)-[(211)At]pAtV was similar to that of (+)-[(125)I]pIV. DU-145 cellular uptake and the biodistribution patterns in DU-145 tumor-bearing mice at 1h post-injection were also similar between (+)-[(211)At]pAtV and (+)-[(125)I]pIV. Namely, (+)-[(211)At]pAtV demonstrated high uptake and retention in tumor via binding to sigma receptors. These results indicate that (+)-[(211)At]pAtV could function as an new agent for alpha-radionuclide receptor therapy. Copyright © 2015 Elsevier Inc. All rights reserved.

  16. The Virtual Observatory Service TheoSSA: Establishing a Database of Synthetic Stellar Flux Standards I. NLTE Spectral Analysis of the DA-Type White Dwarf G191-B2B *,**,***,****

    Science.gov (United States)

    Rauch, T.; Werner, K.; Bohlin, R.; Kruk, J. W.

    2013-01-01

    Hydrogen-rich, DA-type white dwarfs are particularly suited as primary standard stars for flux calibration. State-of-the-art NLTE models consider opacities of species up to trans-iron elements and provide reliable synthetic stellar-atmosphere spectra to compare with observations. Aims. We will establish a database of theoretical spectra of stellar flux standards that are easily accessible via a web interface. Methods. In the framework of the Virtual Observatory, the German Astrophysical Virtual Observatory developed the registered service TheoSSA. It provides easy access to stellar spectral energy distributions (SEDs) and is intended to ingest SEDs calculated by any model-atmosphere code. In case of the DA white dwarf G191-B2B, we demonstrate that the model reproduces not only its overall continuum shape but also the numerous metal lines exhibited in its ultraviolet spectrum. Results. TheoSSA is in operation and contains presently a variety of SEDs for DA-type white dwarfs. It will be extended in the near future and can host SEDs of all primary and secondary flux standards. The spectral analysis of G191-B2B has shown that our hydrostatic models reproduce the observations best at Teff =60 000 +/- 2000K and log g=7.60 +/- 0.05.We newly identified Fe vi, Ni vi, and Zn iv lines. For the first time, we determined the photospheric zinc abundance with a logarithmic mass fraction of -4.89 (7.5 × solar). The abundances of He (upper limit), C, N, O, Al, Si, O, P, S, Fe, Ni, Ge, and Sn were precisely determined. Upper abundance limits of about 10% solar were derived for Ti, Cr, Mn, and Co. Conclusions. The TheoSSA database of theoretical SEDs of stellar flux standards guarantees that the flux calibration of all astronomical data and cross-calibration between different instruments can be based on the same models and SEDs calculated with different model-atmosphere codes and are easy to compare.

  17. Single-layer TiO x reconstructions on SrTiO3 (111): (√7 × √7)R19.1°, (√13 × √13)R13.9°, and related structures

    Energy Technology Data Exchange (ETDEWEB)

    Andersen, Tassie K.; Wang, Shuqiu; Castell, Martin R.; Fong, Dillon D.; Marks, Laurence D.

    2018-09-01

    The atomic structures of two reconstructions, (√7 × √7)R19.1° and (√13 × √13)R13.9°, on the SrTiO3 (111) surface were determined using a combination of density functional theory and scanning tunneling microscopy data and simulations. The combination of these methods allows for potential surface structures to be generated and verified in the absence of diffraction data, providing another tool for solving surface reconstructions. These reconstructions belong to the same stoichiometric, nSrTiO3 • mTiO2, structural family made up of an interconnected, single layer of edge-sharing TiO6 and TiO5[] octahedra. This family is found to include the previously-solved (2 × 2)a reconstruction as its smallest unit-cell sized member and serves as a tool for better understanding and predicting the structure of other reconstructions of arbitrary surface unit-cell size on SrTiO3 (111). This reconstruction family and the calculations of surface energies for different hypothesis structures also shed light on the structure of Schottky defects observed on these reconstructed SrTO3 (111) surfaces.

  18. Odd and Even Partial Waves of $\\eta\\pi^-$ and $\\eta'\\pi^-$ in $\\pi^-p\\to\\eta^{(\\prime)}\\pi^-p$ at $191\\,\\textrm{GeV}/c$

    CERN Document Server

    Adolph, C.; Alexeev, M.G.; Alexeev, G.D.; Amoroso, A.; Andrieux, V.; Anosov, V.; Austregesilo, A.; Badelek, B.; Balestra, F.; Barth, J.; Baum, G.; Beck, R.; Bedfer, Y.; Berlin, A.; Bernhard, J.; Bicker, K.; Bielert, E.R.; Bieling, J.; Birsa, R.; Bisplinghoff, J.; Bodlak, M.; Boer, M.; Bordalo, P.; Bradamante, F.; Braun, C.; Bressan, A.; Buchele, M.; Burtin, E.; Capozza, L.; Chiosso, M.; Chung, S.U.; Cicuttin, A.; Crespo, M.L.; Curiel, Q.; Dalla Torre, S.; Dasgupta, S.S.; Dasgupta, S.; Denisov, O.Yu.; Donskov, S.V.; Doshita, N.; Duic, V.; Dunnweber, W.; Dziewiecki, M.; Efremov, A.; Elia, C.; Eversheim, P.D.; Eyrich, W.; Faessler, M.; Ferrero, A.; Finger, M.; M. Finger jr; Fischer, H.; Franco, C.; von Hohenesche, N. du Fresne; Friedrich, J.M.; Frolov, V.; Gautheron, F.; Gavrichtchouk, O.P.; Gerassimov, S.; Geyer, R.; Gnesi, I.; Gobbo, B.; Goertz, S.; Gorzellik, M.; Grabmuller, S.; Grasso, A.; Grube, B.; Grussenmeyer, T.; Guskov, A.; Haas, F.; von Harrach, D.; Hahne, D.; Hashimoto, R.; Heinsius, F.H.; Herrmann, F.; Hinterberger, F.; Hoppner, Ch.; Horikawa, N.; d'Hose, N.; Huber, S.; Ishimoto, S.; Ivanov, A.; Ivanshin, Yu.; Iwata, T.; Jahn, R.; Jary, V.; Jasinski, P.; Jorg, P.; Joosten, R.; Kabuss, E.; Ketzer, B.; Khaustov, G.V.; Khokhlov, Yu. A.; Kisselev, Yu.; Klein, F.; Klimaszewski, K.; Koivuniemi, J.H.; Kolosov, V.N.; Kondo, K.; Konigsmann, K.; Konorov, I.; Konstantinov, V.F.; Kotzinian, A.M.; Kouznetsov, O.; Kramer, M.; Kroumchtein, Z.V.; Kuchinski, N.; Kunne, F.; Kurek, K.; Kurjata, R.P.; Lednev, A.A.; Lehmann, A.; Levillain, M.; Levorato, S.; Lichtenstadt, J.; Maggiora, A.; Magnon, A.; Makke, N.; Mallot, G.K.; Marchand, C.; Martin, A.; Marzec, J.; Matousek, J.; Matsuda, H.; Matsuda, T.; Meshcheryakov, G.; Meyer, W.; Michigami, T.; Mikhailov, Yu. V.; Miyachi, Y.; Nagaytsev, A.; Nagel, T.; Nerling, F.; Neubert, S.; Neyret, D.; Novy, J.; Nowak, W.D.; Nunes, A.S.; Olshevsky, A.G.; Orlov, I.; Ostrick, M.; Panknin, R.; Panzieri, D.; Parsamyan, B.; Paul, S.; Peshekhonov, D.V.; Platchkov, S.; Pochodzalla, J.; Polyakov, V.A.; Pretz, J.; Quaresma, M.; Quintans, C.; Ramos, S.; Regali, C.; Reicherz, G.; Rocco, E.; Rossiyskaya, N.S.; Ryabchikov, D.I.; Rychter, A.; Samoylenko, V.D.; Sandacz, A.; Sarkar, S.; Savin, I.A.; Sbrizzai, G.; Schiavon, P.; Schill, C.; Schluter, T.; Schmidt, K.; Schmieden, H.; Schonning, K.; Schopferer, S.; Schott, M.; Shevchenko, O.Yu.; Silva, L.; Sinha, L.; Sirtl, S.; Slunecka, M.; Sosio, S.; Sozzi, F.; Srnka, A.; Steiger, L.; Stolarski, M.; Sulc, M.; Sulej, R.; Suzuki, H.; Szabelski, A.; Szameitat, T.; Sznajder, P.; Takekawa, S.; Wolbeek, J. ter; Tessaro, S.; Tessarotto, F.; Thibaud, F.; Uhl, S.; Uman, I.; Virius, M.; Wang, L.; Weisrock, T.; Wilfert, M.; Windmolders, R.; Wollny, H.; Zaremba, K.; Zavertyaev, M.; Zemlyanichkina, E.; Ziembicki, M.; Zink, A.

    2015-01-01

    Exclusive production of $\\eta\\pi^-$ and $\\eta'\\pi^-$ has been studied with a $191\\,\\textrm{GeV}/c$ $\\pi^-$ beam impinging on a hydrogen target at COMPASS (CERN). Partial-wave analyses reveal different odd/even angular momentum ($L$) characteristics in the inspected invariant mass range up to $3\\,\\textrm{GeV}/c^2$. A striking similarity between the two systems is observed for the $L=2,4,6$ intensities (scaled by kinematical factors) and the relative phases. The known resonances $a_2(1320)$ and $a_4(2040)$ are in line with this similarity. In contrast, a strong enhancement of $\\eta'\\pi^-$ over $\\eta\\pi^-$ is found for the $L=1,3,5$ waves, which carry non-$q\\bar q$ quantum numbers. The $L=1$ intensity peaks at $1.7\\,\\textrm{GeV}/c^2$ in $\\eta'\\pi^-$ and at $1.4\\,\\textrm{GeV}/c^2$ in $\\eta\\pi^-$, the corresponding phase motions with respect to $L=2$ are different.

  19. Estrabismo sensorial: estudo de 191 casos

    OpenAIRE

    Oliveira,Bráulio Folco Telles de; Bigolin,Silvane; Souza,Murilo Barreto; Polati,Mariza

    2006-01-01

    OBJETIVO: Avaliar os prontuários dos pacientes com estrabismo sensorial em aspectos variados, como etiologia, tipo e medida do desvio, correlação do tipo do desvio com a idade de aparecimento da doença de base, e resultado cirúrgico dos casos operados. MÉTODOS: Avaliação dos prontuários médicos dos pacientes com estrabismo sensorial atendidos no Hospital das Clínicas da Faculdade de Medicina da Universidade de São Paulo - USP - no setor de Motilidade Ocular Extrínseca, no período de setembro ...

  20. 14 CFR 21.191 - Experimental certificates.

    Science.gov (United States)

    2010-01-01

    ... techniques, or new uses for aircraft. (b) Showing compliance with regulations. Conducting flight tests and..., sales demonstrations, and customer crew training only as provided in § 21.195. (g) Operating amateur...

  1. 40 CFR 63.191 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... product. Research and development facility means laboratory and pilot plant operations whose primary... part. Bench-scale batch process means a batch process (other than a research and development facility... source begins production. Initial start-up does not include operation solely for testing equipment. For...

  2. 21 CFR 155.191 - Tomato concentrates.

    Science.gov (United States)

    2010-04-01

    ... Tomato concentrates. (a) Identity—(1) Definition. Tomato concentrates are the class of foods each of... greater in length. (c) Blemishes, such as dark brown or black particles (specks)—not more than four exceed...; place a U.S. No. 12 screen (1.68 millimeters (0.066 inch) openings) over the sink drain; transfer the...

  3. 19 CFR 191.42 - Procedure.

    Science.gov (United States)

    2010-04-01

    ... number and e-mail address of a contact person, and the location of the merchandise. (e) Decision to waive... transported in-bond to the port of exportation or destruction. (g) Extent of examination. The appropriate... evidence of exportation (see subpart G of this part). The claimant may establish exportation by mail as set...

  4. 49 CFR 572.191 - General description.

    Science.gov (United States)

    2010-10-01

    ... Transportation Other Regulations Relating to Transportation (Continued) NATIONAL HIGHWAY TRAFFIC SAFETY... the SID-IIsD Side Impact Crash Test Dummy, July 1, 2008,” and, (5) Sign convention for signal outputs reference document SAE J1733 Information Report, titled “Sign Convention for Vehicle Crash Testing,” dated...

  5. 19 CFR 191.22 - Substitution drawback.

    Science.gov (United States)

    2010-04-01

    ... the date of succession as the basis for drawback on articles manufactured or produced by the successor after the date of succession. (2) Drawback successor. A “drawback successor” is a manufacturer or... liabilities of the predecessor; or (ii) The assets and other business interests of a division, plant, or other...

  6. 19 CFR 191.32 - Substitution drawback.

    Science.gov (United States)

    2010-04-01

    ... succession: (i) Imported merchandise which the predecessor, before the date of succession, imported; or (ii... which the predecessor received, before the date of succession, a certificate of delivery from the person..., and liabilities of the predecessor; or (ii) The assets and other business interests of a division...

  7. 32 CFR 191.5 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ...-Federal organizations concerned with EEO programs, and coordinate DoD support of such organizations... prevention of sexual harassment) for civilian and military personnel who supervise civilian employees. (12) Establish EEO Awards Programs to recognize individuals and organizational units for outstanding achievement...

  8. 40 CFR 191.12 - Definitions.

    Science.gov (United States)

    2010-07-01

    .... Aquifer means an underground geological formation, group of formations, or part of a formation that is... chemical characteristics that significantly decrease the mobility of radionuclides, or a material placed... disposal system. Performance assessment means an analysis that: (1) Identifies the processes and events...

  9. 15 CFR 922.191 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... Sanctuary regulations. State Archaeologist means the State Archaeologist, Michigan Historical Center... decisions related to the Treaty. Underwater cultural resource means: (1) Any sunken watercraft, including a... underwater cultural resource by the Director pursuant to § 922.198. Underwater cultural resource also means...

  10. 12 CFR 19.191 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... the District of Columbia. (c) Accountant means any individual who is duly qualified to practice as a certified public accountant or a public accountant in any state, possession, territory, commonwealth of the..., opinion or other paper or document by an attorney, accountant, or other licensed professional which is...

  11. 32 CFR 191.3 - Definitions.

    Science.gov (United States)

    2010-07-01

    ..., walking, seeing, hearing, speaking, breathing, learning, and working. (c) Has a record of such impairment... conduct interferes with an individual's performance or creates an intimidating, hostile, or offensive... group, women, or people with disabilities. Standard-setting agencies. Non-DoD Federal Agencies...

  12. Gender | Page 191 | IDRC - International Development Research ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    As more women participate in the workplace, inequality may be increasing, rather ... and that the lines between the private and public spheres — home and work ... comparative performance against a number of indicators and focusing on the ...

  13. 29 CFR 19.1 - Definitions.

    Science.gov (United States)

    2010-07-01

    ...: (a) Financial institution means any office of a bank, savings bank, card issuer as defined in section 103 of the Consumer Credit Protection Act (15 U.S.C. 1602(n)), industrial loan company, trust company, savings and loan, building and loan, or homestead association (including cooperative banks), credit union...

  14. 19 CFR 191.9 - Agency.

    Science.gov (United States)

    2010-04-01

    .... CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED... merchandise while it is in the agent's custody; and (vi) The period that the contract is in effect. (2... of manufacturing or production operations performed by the agent; (iv) Total quantity and description...

  15. 1 CFR 19.1 - Form.

    Science.gov (United States)

    2010-01-01

    ... suitable title. (b) The order or proclamation shall contain a citation of the authority under which it is issued. (c) Punctuation, capitalization, spelling, and other matters of style shall, in general, conform to the most recent edition of the U.S. Government Printing Office Style Manual. (d) The spelling of...

  16. 40 CFR 191.14 - Assurance requirements.

    Science.gov (United States)

    2010-07-01

    ... barriers to isolate the wastes from the accessible environment. Both engineered and natural barriers shall... covered by this part unless the favorable char-acter-is-tics of such places com-pen-sate for their greater...

  17. 32 CFR 191.6 - Procedures.

    Science.gov (United States)

    2010-07-01

    .... (7) Develop procedures for and implement a program to eliminate sexual harassment in Component work places, consistent with DoD Policy on Sexual Harassment memorandums, and to ensure compliance with the...

  18. 19 CFR 191.92 - Accelerated payment.

    Science.gov (United States)

    2010-04-01

    ... contain: (i) Company name and address; (ii) Internal Revenue Service (IRS) number (with suffix); (iii... may itself be appealed to CBP Headquarters, Office of International Trade, Trade Policy and Programs... to CBP Headquarters may be extended for good cause, upon written request by the applicant or holder...

  19. Publications | Page 191 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Journal articles. Papers ... Centre for Regional Studies, School of Social Sciences, Hyderabad Central University ... Poor communities rarely benefit from global emissions trading schemes, because of the high transaction costs of participation.

  20. The virtual observatory service TheoSSA: Establishing a database of synthetic stellar flux standards. I. NLTE spectral analysis of the DA-type white dwarf G191-B2B

    Science.gov (United States)

    Rauch, T.; Werner, K.; Bohlin, R.; Kruk, J. W.

    2013-12-01

    Context. Hydrogen-rich, DA-type white dwarfs are particularly suited as primary standard stars for flux calibration. State-of-the-art NLTE models consider opacities of species up to trans-iron elements and provide reliable synthetic stellar-atmosphere spectra to compare with observations. Aims: We will establish a database of theoretical spectra of stellar flux standards that are easily accessible via a web interface. Methods: In the framework of the Virtual Observatory, the German Astrophysical Virtual Observatory developed the registered service TheoSSA. It provides easy access to stellar spectral energy distributions (SEDs) and is intended to ingest SEDs calculated by any model-atmosphere code. In case of the DA white dwarf G191-B2B, we demonstrate that the model reproduces not only its overall continuum shape but also the numerous metal lines exhibited in its ultraviolet spectrum. Results: TheoSSA is in operation and contains presently a variety of SEDs for DA-type white dwarfs. It will be extended in the near future and can host SEDs of all primary and secondary flux standards. The spectral analysis of G191-B2B has shown that our hydrostatic models reproduce the observations best at and log g = 7.60 ± 0.05. We newly identified Fe vi, Ni vi, and Zn iv lines. For the first time, we determined the photospheric zinc abundance with a logarithmic mass fraction of -4.89 (7.5 × solar). The abundances of He (upper limit), C, N, O, Al, Si, O, P, S, Fe, Ni, Ge, and Sn were precisely determined. Upper abundance limits of about 10% solar were derived for Ti, Cr, Mn, and Co. Conclusions: The TheoSSA database of theoretical SEDs of stellar flux standards guarantees that the flux calibration of all astronomical data and cross-calibration between different instruments can be based on the same models and SEDs calculated with different model-atmosphere codes and are easy to compare. Based on observations with the NASA/ESA Hubble Space Telescope, obtained at the Space Telescope

  1. Stellar laboratories. VI. New Mo iv-vii oscillator strengths and the molybdenum abundance in the hot white dwarfs G191-B2B and RE 0503-289

    Science.gov (United States)

    Rauch, T.; Quinet, P.; Hoyer, D.; Werner, K.; Demleitner, M.; Kruk, J. W.

    2016-03-01

    Context. For the spectral analysis of high-resolution and high signal-to-noise (S/N) spectra of hot stars, state-of-the-art non-local thermodynamic equilibrium (NLTE) model atmospheres are mandatory. These are strongly dependent on the reliability of the atomic data that is used for their calculation. Aims: To identify molybdenum lines in the ultraviolet (UV) spectra of the DA-type white dwarf G191-B2B and the DO-type white dwarf RE 0503-289 and, to determine their photospheric Mo abundances, reliable Mo iv-vii oscillator strengths are used. Methods: We newly calculated Mo iv-vii oscillator strengths to consider their radiative and collisional bound-bound transitions in detail in our NLTE stellar-atmosphere models for the analysis of Mo lines exhibited in high-resolution and high S/N UV observations of RE 0503-289. Results: We identified 12 Mo v and 9 Mo vi lines in the UV spectrum of RE 0503-289 and measured a photospheric Mo abundance of 1.2-3.0 × 10-4 (mass fraction, 22 500-56 400 times the solar abundance). In addition, from the As v and Sn iv resonance lines, we measured mass fractions of arsenic (0.5-1.3 × 10-5, about 300-1200 times solar) and tin (1.3-3.2 × 10-4, about 14 300-35 200 times solar). For G191-B2B, upper limits were determined for the abundances of Mo (5.3 × 10-7, 100 times solar) and, in addition, for Kr (1.1 × 10-6, 10 times solar) and Xe (1.7 × 10-7, 10 times solar). The arsenic abundance was determined (2.3-5.9 × 10-7, about 21-53 times solar). A new, registered German Astrophysical Virtual Observatory (GAVO) service, TOSS, has been constructed to provide weighted oscillator strengths and transition probabilities. Conclusions: Reliable measurements and calculations of atomic data are a prerequisite for stellar-atmosphere modeling. Observed Mo v-vi line profiles in the UV spectrum of the white dwarf RE 0503-289 were well reproduced with our newly calculated oscillator strengths. For the first time, this allowed the photospheric Mo

  2. Long-Term Effect of Renal Transplantation and Aging on Hemoglobin A1C Levels: A Case-Control Study in 191 Non-Diabetic Deceased Donor Renal Transplant Recipients.

    Science.gov (United States)

    Tillmann, Frank-Peter; Hermsen, Derik; Hemmrich, Katrin; Woznowski, Magdalena; Rump, Lars Christian; Quack, Ivo

    2015-12-08

    Reduced renal function in patients with chronic kidney disease is linked to insulin resistance; and impairments in glucose homeostasis, as measured by HbA1c levels, are related to cardiovascular events. Recently, aging has been reported to affect HbA1c levels over time in non-diabetic individuals. The objective of this study was to investigate the association between renal function and aging in non-diabetic deceased-donor renal transplant recipients. A total of 191 patients were analyzed (mean age 50.6±12.2 years, dialysis vintage 6.5±3.1 years, 53.4% male patients). HbA1-c levels were measured on the day of transplantation and on follow-up. The mean follow-up time was 4.9±3.1 years. Renal transplantation resulted in an increase in eGFR of 38.6±18.9 mL/min/1.73 m2 as compared to baseline levels on dialysis and the mean eGFR on follow-up was 45.5±18.9 mL/min/1.73 m2. HbA1c levels increased significantly from the day of transplantation to the last follow-up (5.3±0.4% to 5.6±0.4%, page and renal transplant function. In conclusion, we observed a significant increase in HbA1c levels over a 5-year post-transplant follow-up period in non-diabetic deceased-donor renal transplant recipients. In contrast to the non-diabetic general population, the increase in HbA1c observed in this cohort was greater but not associated with aging.

  3. Freedom of information applications as an "evergreening" tactic: Secretary, Department of Health and Ageing v iNOVA Pharmaceuticals (Australia) Pty Ltd (2010) 191 FCR 573; [2010] FCA 1442.

    Science.gov (United States)

    Vines, Tim; Faunce, Thomas

    2011-09-01

    A recent decision of the Federal Court of Australia illustrates how patent-holding pharmaceutical companies are attempting to use Australia's Freedom of Information Act 1982 (Cth) to force Australian safety, quality and efficacy regulators to disclose whether generic competitors are attempting to enter the market. In Secretary, Department of Health and Ageing v iNova Pharmaceuticals (Australia) Pty Ltd (2010) 191 FCR 573; [2010] FCA 1442 a single judge of the Federal Court overturned a decision of the Administrative Appeals Tribunal (AAT) that would have compelled the Australian Therapeutic Goods Administration (TGA) to reveal whether they were in possession of an application to register generic versions of two iNova products: imiquimod and phentermine. In its justification to the AAT for refusing to confirm or deny the existence of any application, the TGA argued that to reveal the existence of such a document would prejudice the proper administration of the National Health Act 1953 (Cth) as it could compromise the listing of a generic on the Pharmaceutical Benefits Scheme. The AAT failed to appreciate the extent to which this revelation to a competitor would have undercut 2004 amendments to the Therapeutic Goods Act 1989 (Cth) that provided penalties for evergreening tactics involving TGA notifications to drug patent-holders and 2006 amendments to the Patents Act 1990 (Cth) which protected the right of generic manufacturers to "springboard". The decision of the Federal Court is one of the first to explore the use of freedom of information legislation by patent-holders as a potential "evergreening" technique to prolong royalties by marginalising generic competition. Because of the significant amounts of money involved in ensuring rapid market entry of low-cost generic products, the issue has considerable public health significance.

  4. Stellar laboratories . IX. New Se v, Sr iv-vii, Te vi, and I vi oscillator strengths and the Se, Sr, Te, and I abundances in the hot white dwarfs G191-B2B and RE 0503-289

    Science.gov (United States)

    Rauch, T.; Quinet, P.; Knörzer, M.; Hoyer, D.; Werner, K.; Kruk, J. W.; Demleitner, M.

    2017-10-01

    Context. To analyze spectra of hot stars, advanced non-local thermodynamic equilibrium (NLTE) model-atmosphere techniques are mandatory. Reliable atomic data is crucial for the calculation of such model atmospheres. Aims: We aim to calculate new Sr iv-vii oscillator strengths to identify for the first time Sr spectral lines in hot white dwarf (WD) stars and to determine the photospheric Sr abundances. To measure the abundances of Se, Te, and I in hot WDs, we aim to compute new Se v, Te vi, and I vi oscillator strengths. Methods: To consider radiative and collisional bound-bound transitions of Se v, Sr iv - vii, Te vi, and I vi in our NLTE atmosphere models, we calculated oscillator strengths for these ions. Results: We newly identified four Se v, 23 Sr v, 1 Te vi, and three I vi lines in the ultraviolet (UV) spectrum of RE 0503-289. We measured a photospheric Sr abundance of 6.5+ 3.8-2.4× 10-4 (mass fraction, 9500-23 800 times solar). We determined the abundances of Se (1.6+ 0.9-0.6× 10-3, 8000-20 000), Te (2.5+ 1.5-0.9× 10-4, 11 000-28 000), and I (1.4+ 0.8-0.5× 10-5, 2700-6700). No Se, Sr, Te, and I line was found in the UV spectra of G191-B2B and we could determine only upper abundance limits of approximately 100 times solar. Conclusions: All identified Se v, Sr v, Te vi, and I vi lines in the UV spectrum of RE 0503-289 were simultaneously well reproduced with our newly calculated oscillator strengths. Based on observations with the NASA/ESA Hubble Space Telescope, obtained at the Space Telescope Science Institute, which is operated by the Association of Universities for Research in Astronomy, Inc., under NASA contract NAS5-26666. Based on observations made with the NASA-CNES-CSA Far Ultraviolet Spectroscopic Explorer. Full Tables A.15 to A.21 are only available via the German Astrophysical Virtual Observatory (GAVO) service TOSS (http://dc.g-vo.org/TOSS).

  5. 211 At-labeled agents for alpha-immunotherapy: On the in vivo stability of astatine-agent bonds

    OpenAIRE

    Ayed , Tahra ,; Pilmé , Julien; Tézé , David; Bassal , Fadel ,; Barbet , Jacques ,; Chérel , Michel; Champion , Julie ,; Maurice , Rémi; Montavon , Gilles ,; Galland , Nicolas ,

    2016-01-01

    International audience; The application of 211 At to targeted cancer therapy is currently hindered by the rapid deastatination that occurs in vivo. As the deastatination mechanism is unknown, we tackled this issue from the viewpoint of the intrinsic properties of At-involving chemical bonds. An apparent correlation has been evidenced between in vivo stability of 211 At-labeled compounds and the AtÀR (R ¼ C, B) bond enthalpies obtained from relativistic quantum mechanical calculations. Further...

  6. Preparation and biological evaluation of an astatine-211 labeled biotin conjugate: Biotinyl-3-[211At]astatoanilide

    International Nuclear Information System (INIS)

    Foulon, Catherine F.; Schoultz, Bent W.; Zalutsky, Michael R.

    1997-01-01

    Biotinyl-3-[ 211 At]astatoanilide ([ 211 At]AtBA) was prepared in more than 80% yield by destannylation. In vitro, [ 211 At]AtBA exhibited a high affinity for streptavidin, and was stable after incubation in human serum, cerebrospinal fluid and distilled water, whereas it was rapidly degraded in mouse serum. HPLC analysis showed that the main degradation pathway in mouse serum was the cleavage of [ 211 At]astatoaniline. In mice, [ 211 At]AtBA and its 125 I-labeled analogue cleared rapidly from most tissues; however, there was some evidence for dehalogenation of both tracers

  7. Evaluation of Novel Wet Chemistry Separation and Purification Methods to Facilitate Automation of Astatine-­211 Isolation

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott [Univ. of Washington, Seattle, WA (United States)

    2016-07-19

    This research is a collaborative effort between the research groups of the PIs, Dr. D. Scott Wilbur in the Department of Radiation Oncology at the University of Washington (UW) and Matthew O’Hara at the Pacific Northwest National Laboratory (PNNL). In this report only those studies conducted at UW and the budget information from UW will be reported. A separate progress and financial report will be provided by PNNL. This final report outlines the experiments (Tasks) conducted and results obtained at UW from July 1, 2013 thru June 30, 2016 (2-­year project with 1 year no-­cost extension). The report divides the information on the experiments and results obtained into the 5 specific objectives of the research efforts and the Tasks within those objectives. This format is used so that it is easy to see what has been accomplished in each area. A brief summary of the major findings from the studies is provided below. Summary of Major Findings from Research/Training Activities at UW: Anion and cation exchange columns did not provide adequate 211At capture and/or extraction results under conditions studied to warrant further evaluation; PEG-­Merrifield resins containing mPEG350, mPEG750, mPEG2000 and mPEG5000 were synthesized and evaluated; All of the mPEG resins with different sized mPEG moieties conjugated gave similar 211At capture (>95%) from 8M HCl solutions and release with conc. NH4OH (~50-­80%), but very low quantities were released when NaOH was used as an eluent; Capture and release of 211At when loading [211At]astatate appeared to be similar to that of [211At]astatide on PEG columns, but further studies need to be conducted to confirm that; Capture of 211At on PEG columns was lower (e.g. 80-­90%) from solutions of 8M HNO3, but higher capture rates (e.g. 99%) can be obtained when 10M HNO3 is mixed with an equal quantity of 8M HCl; Addition of reductants to the 211At solutions did not appear to change the percent capture, but may have an effect on the % extracted; There was some indication that the PEG-­Merrifield resins could be saturated (perhaps with Bi) resulting in lower capture percentages, but more studies need to be done to confirm that; A target dissolution chamber, designed and built at PNNL, works well with syringe pumps so it can be used in an automated system; Preliminary semi-­automated 211At isolation studies have been conducted with full-scale target dissolution and 211At isolation using a PEG column on the Hamilton automated system gave low overall recoveries, but HNO3 was used (rather than HCl) for loading the 211At and flow rates were not optimized; Results obtained using PEG columns are high enough to warrant further development on a fully automated system; Results obtained also indicate that additional studies are warranted to evaluate other types of columns for 211At separation from bismuth, which allow use of HNO3/HCl mixtures for loading and NaOH for eluting 211At. Such a column could greatly simplify the overall isolation process and make it easier to automate.

  8. 191 Weaning Practices and Nutritional Status of Infants in Isoko ...

    African Journals Online (AJOL)

    Nekky Umera

    collection. The anthropometry used was the height and weight of the infants. ... Baby feeding practices are nutritional behaviours and actions by mothers and childcare ... breastfeeding, which is commonly referred to as weaning is a time of.

  9. 19 CFR 191.8 - Specific manufacturing drawback ruling.

    Science.gov (United States)

    2010-04-01

    ...; (3) Description of the type of business in which engaged; (4) Description of the manufacturing or... that is to be exported or destroyed; (5) In the case of a business entity, the names of persons listed... drawback ruling of the manufacturer or producer; (B) The succession of a sole proprietorship, partnership...

  10. 24 CFR 200.191 - Placement of 203(k) consultant.

    Science.gov (United States)

    2010-04-01

    ... HUD has developed such an exam. (c) Delayed effective date of examination requirement for consultants... date to pass the comprehensive exam. Failure to pass the examination by the deadline date constitutes...

  11. 29 CFR 4.191 - Complaints and compliance assistance.

    Science.gov (United States)

    2010-07-01

    ... part 70) and the “Privacy Act of 1974” (5 U.S.C. 552a). (b) A report of breach or violation relating... identity of its confidential sources and to prevent an unwarranted invasion of personal privacy...) Any other report of breach or violation may be in writing and addressed to the Assistant Regional...

  12. 19 CFR 191.164 - Return to Customs custody.

    Science.gov (United States)

    2010-04-01

    ... TREASURY (CONTINUED) DRAWBACK Distilled Spirits, Wines, or Beer Which Are Unmerchantable or Do Not Conform... return to Customs custody of distilled spirits, wine, or beer subject to refund of taxes under the...

  13. 19 CFR 191.166 - Destruction of merchandise.

    Science.gov (United States)

    2010-04-01

    ... THE TREASURY (CONTINUED) DRAWBACK Distilled Spirits, Wines, or Beer Which Are Unmerchantable or Do Not... drawback claimant who proposes to destroy rather than export the distilled spirits, wine, or beer shall state that fact on Customs Form 7551. (b) Action by Customs. Distilled spirits, wine, or beer returned...

  14. 47 CFR 0.191 - Functions of the Bureau.

    Science.gov (United States)

    2010-10-01

    ... related activities, including public safety communications (including 911, enhanced 911, and other...) Conducts studies of public safety, homeland security, national security, emergency management and... during non-business hours when the other Offices and Bureaus of the Commission are closed. Such actions...

  15. Oral pyogenic granuloma: a epidemiologic study of 191 cases

    Directory of Open Access Journals (Sweden)

    Thiago de Santana SANTOS

    2008-01-01

    Full Text Available Objectives: To evaluate the prevalence of pyogenic granuloma and compare the data obtained with those of other reports in the worldliterature. Methods: The study material was surveyed from the records of patients with diagnosis of oral pyogenic granuloma, at the Oral Pathology Laboratory of the School of Dentistry of the University of Pernambuco, in the period from January 1992 to March 2007 (15 years. The following indicators were analyzed: gender, age group, race, anatomic location, diameter of lesions and presence of symptomatology.Results: Among the 5007 records in the laboratory, 3.81% corresponded to lesions diagnosed as oral pyogenic granuloma, in which 19.9% of the patients were in the second decade of life, 40.1% were white, the gingiva was the most affected location (77.9% and lesion of smaller diameter (0.1 to 2 cm were those most observed at the initial diagnosis. Conclusion: The clinical-pathological characteristics of oral pyogenic granuloma in the studied population are similar to those of other studies in the literature

  16. The UV attenuation in JWST target VV 191

    Science.gov (United States)

    Holwerda, Benne

    2017-08-01

    We aim to map the UV-near-IR attenuation curve along many sightlines within nearby disk galaxies to resolve a large fundamental uncertainty in galaxy evolution studies: the variance in the attenuation curve within an indivual galaxy disk on linear scales relatively blue elliptical beautifully backlights the outer disk of a foreground face-on spiral galaxy.Dither strategy:We opt for a 2-point dither in the case of the F336W observations (1 orbit) and a 3pt dither strategy for the F225W observations. The 9 orbits for the F225W observations are broken into three groupings of 3 orbits in the 3 dither pattern. This is to ensure correction of cosmics and detector artifacts. Our secondary aim is an HST/JWST image with good public outreach potential and our aim is to maximize image quality for this reason as well.

  17. 44 CFR 206.191 - Duplication of benefits.

    Science.gov (United States)

    2010-10-01

    ... to section 408 of the Stafford Act. (iii) Small Business Administration and Farmers Home Administration disaster loans; (iv) Other Needs assistance, pursuant to section 408 of the Stafford Act or its... resources it must consider before it does so. (4) If following the delivery sequence concept would adversely...

  18. JCSC_128_2_185-191_SI.docx

    Indian Academy of Sciences (India)

    Dr.Rekha

    _computing_data_reduction 'CrysAlisPro (Oxford Diffraction,2010)'. _computing_structure_solution 'SHELXS-97 (Sheldrick, 2008)'. _computing_structure_refinement 'SHELXL-97 (Sheldrick, 2008)'. _computing_molecular_graphics 'ORTEP3 (Farrugia, 1997)'. _computing_publication_material 'PLATON(Spek,2009)'.

  19. Dicty_cDB: VSK191 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available avgsnyrvslglpvgavmnsadnsgaknlyviavkgikgrlnrlpsagvgdmv matvkkgkpelrkkvctglvvrqrkhwkrkdgvyiyfednagvmcnpkgevkgn...qavgsnyrvslglpvgavmnsadnsgaknlyviavkgikgrlnrlpsagvgdmv matvkkgkpelrkkvctglvvrqrkhwkrkdgvyiyfednagvmcnpkgevkg...lyviavkgikgrlnrlpsagvg dmvmatvkkgkpelrkkvctglvvrqrkhwkrkdgvyiyfednagvmcnpkgevkgnilg pvakecsdlwpkvatnagtiv*in

  20. All projects related to | Page 191 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... PRIVATE SECTOR, Economic and social development, POLICY MAKING ... RIMISP: Core Support for Rural Development Research Phase 2 ... MAKING, AFRICA SOUTH OF SAHARA, SOCIAL INEQUALITY, ASIA, Poverty alleviation.

  1. 191-IJBCS-Article-Dr A D V Ayansina

    African Journals Online (AJOL)

    RHUMSIKI

    Effect of organic amendments on microbial biomass of a tropical soil treated with some ... A.D.V. AYANSINA and B.A. OSO / Int. J. Biol. Chem. Sci. 2(4): 417-424, 2008. 418 cultivation ... microorganisms and transformed to humic ... al., 1987). The application of organic manure (e.g. ..... J. Agric. Food Chem., 34: 746-749.

  2. 191-IJBCS-Article-Dr A D V Ayansina

    African Journals Online (AJOL)

    RHUMSIKI

    Effect of organic amendments on microbial biomass of a tropical soil treated ... soils resulted in significant (P<0.05) increases in microbial biomass and ..... and Fauna Interactions in Natural and ... conventional agricultural management on soil ...

  3. Dicty_cDB: SHE191 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available strand read from insert in 3'HPRT insertion targeting and chromosome engineering clone MHPP186g09. 50 0.063 ...sert in 3'HPRT insertion targeting and chromosome engineering clone MHPP47e19. 50 0.063 1 CR034434 |CR034434....1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering clone MHPP47e19....ion targeting and chromosome engineering clone MHPP142o16. 50 0.063 1 dna update 2006. 2.10 Homology vs Prot...1 CR023465 |CR023465.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engine

  4. Southern Forests: a Journal of Forest Science - Vol 191 (2001)

    African Journals Online (AJOL)

    Valuing South Africa's savannas: methodological issues · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. A Ballance, CM Shackleton, SE Shackleton, B Geach, D Crookes, M De Wit, J Evans, G Von Maltitz, C Willis, S Kelatwang, J Havemann, 43-52 ...

  5. South Asia | Page 191 | IDRC - International Development Research ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Although economic growth has reduced poverty in much of Asia, rural and ... These pressures strain the infrastructure and fray human relations, ultimately hampering development. ... Our regional office for Asia is located in New Delhi, India.

  6. 22 CFR 191.12 - Description of benefits.

    Science.gov (United States)

    2010-04-01

    ... taking advantage of the Act. (k) Further relief. Section 700 (50 U.S.C. App. 590) provides that a person... occupied for dwelling, business, or agricultural purpose, executed by persons who subsequently become... assignee of a life insurance policy assigned as security, other than the insurer in connection with a...

  7. Inactivation of human osteosarcoma cells in vitro by 211At-TP-3 monoclonal antibody: Comparison with astatine-211 and external-beam X rays

    International Nuclear Information System (INIS)

    Larsen, R.H.; Bruland, O.S.; Hoff, P.; Alstad, J.; Lindmo, T.; Rofstad, E.K.

    1994-01-01

    The potential usefulness of α-particle radioimmunotherapy in the treatment of osteosarcoma was studied in vitro by using the monoclonal antibody TP-3 and cells of three human osteosarcoma cell lines (OHS, SAOS and KPDX) differing in antigen expression. Cell survival curves were established after treatment with (a) 211 At-TP-3 of different specific activities, (b) 211 At-labeled bovine serum albumin (BSA), (c) free 211 At and (d) external-beam X rays. The three osteosarcoma cell lines showed similar survival curves, whether treated with external-beam X rays, 211 At-BSA or free 211 At. The D o 's were lower for free 211 At than for 211 At-BSA. The survival curves for 211 At-TP-3 treatment, on the other hand, differed significantly among the cell lines, suggesting that sensitivity to 211 At-TP-3 treatment was governed by cellular properties other than sensitivity to external-beam X rays. The cellular property most important for sensitivity to 211 At-TP-3 treatment was the antigen expression. Cell inactivation after 211 At-TP-3 treatment increased substantially with increasing specific activity of the 211 At-TP-3. At high specific activities, the cytotoxic effect of 211 At-TP-3 was significantly higher than that of 211 At-BSA. In conclusion, 211 At-TP-3 has the potential to give clinically favorable therapeutic ratios in the treatment of osteosarcoma. 39 refs., 5 figs., 2 tabs

  8. Sexospécificités | Page 191 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Women in many African countries have a legal right to own land, but this often means little in areas where “customary law” prevails. ... Land is an important source of security against poverty across the developing world, but, in many places, unequal rights to land put women at a disadvantage, perpetuates poverty, and ...

  9. EUR-L3P-NAR_AVHRR_NOAA_19:1

    Data.gov (United States)

    National Aeronautics and Space Administration — A Group for HIgh Resolution Sea Surface Temperature (GHRSST) dataset for the North Atlantic Region (NAR) from the Advanced Very High Resolution Radiometer (AVHRR) on...

  10. 19 CFR 191.35 - Notice of intent to export; examination of merchandise.

    Science.gov (United States)

    2010-04-01

    ..., if available, fax number and e-mail address of a contact person, and the location of the merchandise... merchandise shall be transported in-bond to the port of exportation. (e) Extent of examination. The...

  11. Kolasani et al., Afr J Tradit Complement Altern Med. (2011) 8(S):191 ...

    African Journals Online (AJOL)

    AJTCAM

    2 School of Biomedical and Health Sciences, Victoria University, Australia. 3 Institute of ... The development of herbal formulae has been an empirical process in which the properties of herbs and the effects of .... Table 1. The method of preparation of decoction was done according to the Chinese standard procedure. The.

  12. 191 Analyse de la répartition spatiale des places publiques dans la ...

    African Journals Online (AJOL)

    TOHOZIN

    de Porto-Novo, Bénin. Coovi Aimé Bernadin TOHOZIN1* et Odile DOSSOU GUEDEGBE2. 1RECTAS, Département de Cartographie, Obafemi Awolowo University Campus Off Road 1,. PMB 5545, Ilé - Ifè, Osun State, Nigéria. 2Université d'Abomey-Calavi, Département de Géographie et d'Aménagement du Territoire, Bénin ...

  13. Location of Rotator Cuff Tear Initiation: A Magnetic Resonance Imaging Study of 191 Shoulders.

    Science.gov (United States)

    Jeong, Jeung Yeol; Min, Seul Ki; Park, Keun Min; Park, Yong Bok; Han, Kwang Joon; Yoo, Jae Chul

    2018-03-01

    Degenerative rotator cuff tears (RCTs) are generally thought to originate at the anterior margin of the supraspinatus tendon. However, a recent ultrasonography study suggested that they might originate more posteriorly than originally thought, perhaps even from the isolated infraspinatus (ISP) tendon, and propagate toward the anterior supraspinatus. Hypothesis/Purpose: It was hypothesized that this finding could be reproduced with magnetic resonance imaging (MRI). The purpose was to determine the most common location of degenerative RCTs by using 3-dimensional multiplanar MRI reconstruction. It was assumed that the location of the partial-thickness tears would identify the area of the initiation of full-thickness tears. Cross-sectional study; Level of evidence, 3. A retrospective analysis was conducted including 245 patients who had RCTs (nearly full- or partial-thickness tears) at the outpatient department between January 2011 and December 2013. RCTs were measured on 3-dimensional multiplanar reconstruction MRI with OsiriX software. The width and distance from the biceps tendon to the anterior margin of the tear were measured on T2-weighted sagittal images. In a spreadsheet, columns of consecutive numbers represented the size of each tear (anteroposterior width) and their locations with respect to the biceps brachii tendon. Data were pooled to graphically represent the width and location of all tears. Frequency histograms of the columns were made to visualize the distribution of tears. The tears were divided into 2 groups based on width (group A, location related to size. The mean width of all RCTs was 11.9 ± 4.1 mm, and the mean length was 11.1 ± 5.0 mm. Histograms showed the most common location of origin to be 9 to 10 mm posterior to the biceps tendon. The histograms of groups A and B showed similar tear location distributions, indicating that the region approximately 10 mm posterior to the biceps tendon is the most common site of tear initiation. These results demonstrate that degenerative RCTs most commonly originate from approximately 9 to 10 mm posterior to the biceps tendon.

  14. Chemical effects head-loss research in support of generic safety issue 191.

    Energy Technology Data Exchange (ETDEWEB)

    Park, J. H.; Kasza, K.; Fisher, B.; Oras, J.; Natesan, K.; Shack, W. J.; Nuclear Engineering Division

    2006-10-31

    This summary report describes studies conducted at Argonne National Laboratory on the potential for chemical effects on head loss across sump screens. Three different buffering solutions were used for these tests: trisodium phosphate (TSP), sodium hydroxide, and sodium tetraborate. These pH control agents used following a LOCA at a nuclear power plant show various degrees of interaction with the insulating materials Cal-Sil and NUKON. Results for Cal-Sil dissolution tests in TSP solutions, settling rate tests of calcium phosphate precipitates, and benchmark tests in chemically inactive environments are also presented. The dissolution tests were intended to identify important environmental variables governing both calcium dissolution and subsequent calcium phosphate formation over a range of simulated sump pool conditions. The results from the dissolution testing were used to inform both the head loss and settling test series. The objective of the head loss tests was to assess the head loss produced by debris beds created by Cal-Sil, fibrous debris, and calcium phosphate precipitates. The effects of both the relative arrival time of the precipitates and insulation debris and the calcium phosphate formation process were specifically evaluated. The debris loadings, test loop flow rates, and test temperature were chosen to be reasonably representative of those expected in plants with updated sump screen configurations, although the approach velocity of 0.1 ft/s used for most of the tests is 3-10 times that expected in plants with large screens . Other variables were selected with the intent to reasonably bound the head loss variability due to arrival time and calcium phosphate formation uncertainty. Settling tests were conducted to measure the settling rates of calcium phosphate precipitates (formed by adding dissolved Ca to boric acid and TSP solutions) in water columns having no bulk directional flow. For PWRs where NaOH and sodium tetraborate are used to control sump pH and fiberglass insulation is prevalent, relatively high concentrations of soluble aluminum can be expected. Tests in which the dissolved aluminum (Al) resulted from aluminum nitrate additions were used to investigate potential chemical effects that may lead to high head loss. Dissolved Al concentrations of 100 ppm were shown to lead to large pressure drops for the screen area to sump volume ratio and fiber debris bed studied. No chemical effects on head loss were observed in sodium tetraborate buffered solutions even for environments with high ratios of submerged Al area to sump volume. However, in tests with much higher concentrations of dissolved Al than expected in plants, large pressure drops did occur. Interaction with NUKON/Cal-Sil debris mixtures produced much lower head losses than observed in corresponding tests with TSP, although tests were not performed over the full range of Cal-Sil that might be of interest.

  15. People and things. CERN Courier, Mar 1979, v. 19(1)

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    1979-03-15

    The article reports on various achievements of CERN staff members and gives news updates on upcoming or past events, for example the First Workshop on Ultra-Relativistic Nuclear Collisions, or the CERN 25th Anniversary Celebrations.

  16. SU-E-J-191: Motion Prediction Using Extreme Learning Machine in Image Guided Radiotherapy

    International Nuclear Information System (INIS)

    Jia, J; Cao, R; Pei, X; Wang, H; Hu, L

    2015-01-01

    Purpose: Real-time motion tracking is a critical issue in image guided radiotherapy due to the time latency caused by image processing and system response. It is of great necessity to fast and accurately predict the future position of the respiratory motion and the tumor location. Methods: The prediction of respiratory position was done based on the positioning and tracking module in ARTS-IGRT system which was developed by FDS Team (www.fds.org.cn). An approach involving with the extreme learning machine (ELM) was adopted to predict the future respiratory position as well as the tumor’s location by training the past trajectories. For the training process, a feed-forward neural network with one single hidden layer was used for the learning. First, the number of hidden nodes was figured out for the single layered feed forward network (SLFN). Then the input weights and hidden layer biases of the SLFN were randomly assigned to calculate the hidden neuron output matrix. Finally, the predicted movement were obtained by applying the output weights and compared with the actual movement. Breathing movement acquired from the external infrared markers was used to test the prediction accuracy. And the implanted marker movement for the prostate cancer was used to test the implementation of the tumor motion prediction. Results: The accuracy of the predicted motion and the actual motion was tested. Five volunteers with different breathing patterns were tested. The average prediction time was 0.281s. And the standard deviation of prediction accuracy was 0.002 for the respiratory motion and 0.001 for the tumor motion. Conclusion: The extreme learning machine method can provide an accurate and fast prediction of the respiratory motion and the tumor location and therefore can meet the requirements of real-time tumor-tracking in image guided radiotherapy

  17. SU-E-T-191: First Principle Calculation of Quantum Yield in Photodynamic Therapy

    Energy Technology Data Exchange (ETDEWEB)

    Abolfath, R; Guo, F; Chen, Z; Nath, R [Yale New Haven Hospital, New Haven, CT (United States)

    2014-06-01

    Purpose: We present a first-principle method to calculate the spin transfer efficiency in oxygen induced by any photon fields especially in MeV energy range. The optical pumping is mediated through photosensitizers, e.g., porphyrin and/or ensemble of quantum dots. Methods: Under normal conditions, oxygen molecules are in the relatively non-reactive triplet state. In the presence of certain photosensitizer compounds such as porphyrins, electromagnetic radiation of specific wavelengths can excite oxygen to highly reactive singlet state. With selective uptake of photosensitizers by certain malignant cells, photon irradiation of phosensitized tumors can lead to selective killing of cancer cells. This is the basis of photodynamic therapy (PDT). Despite several attempts, PDT has not been clinically successful except in limited superficial cancers. Many parameters such as photon energy, conjugation with quantum dots etc. can be potentially combined with PDT in order to extend the role of PDT in cancer management. The key quantity for this optimization is the spin transfer efficiency in oxygen by any photon field. The first principle calculation model presented here, is an attempt to fill this need. We employ stochastic density matrix description of the quantum jumps and the rate equation methods in quantum optics based on Markov/Poisson processes and calculate time evolution of the population of the optically pumped singlet oxygen. Results: The results demonstrate the feasibility of our model in showing the dependence of the optical yield in generating spin-singlet oxygen on the experimental conditions. The adjustable variables can be tuned to maximize the population of the singlet oxygen hence the efficacy of the photodynamic therapy. Conclusion: The present model can be employed to fit and analyze the experimental data and possibly to assist researchers in optimizing the experimental conditions in photodynamic therapy.

  18. 40 CFR Appendix A to Part 191 - Table for Subpart B

    Science.gov (United States)

    2010-07-01

    ... the definition of high-level waste in the NWPA); (d) Each 1,000,000 curies of other radionuclides (i.e... Commission as high-level radioactive waste in accordance with part B of the definition of high-level waste in... PROGRAMS ENVIRONMENTAL RADIATION PROTECTION STANDARDS FOR MANAGEMENT AND DISPOSAL OF SPENT NUCLEAR FUEL...

  19. 19 CFR 191.91 - Waiver of prior notice of intent to export.

    Science.gov (United States)

    2010-04-01

    ... Service (IRS) number (with suffix) of applicant; (B) Name, address, and Internal Revenue Service (IRS... by this application; (D) Commodity/product lines of imported and exported merchandise covered by this... will take effect after completion of the challenge procedures in paragraph (g) of this section unless...

  20. 19 CFR 191.14 - Identification of merchandise or articles by accounting method.

    Science.gov (United States)

    2010-04-01

    ... applies to identification of merchandise or articles in inventory or storage, as well as identification of... identified as being received into and withdrawn from the same inventory. Even if merchandise or articles are... or articles under this section, subject to the conditions of this section. If any such inventory...

  1. 19 CFR Appendix A to Part 191 - General Manufacturing Drawback Rulings

    Science.gov (United States)

    2010-04-01

    ... The date of production is the date an article is completed. I. Inventory Procedures The inventory... 19 U.S.C. 1313(a) for Fur Skins or Fur Skin Articles (T.D. 83-77) VIII. General Manufacturing... operate; 6. Description of the merchandise and articles, unless specifically described in the general...

  2. Asie du sud | Page 191 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Based on a survey of more than 400 women, this book exposes the ... recognize community property, the nature of productive work, and the right to recover dowries ... by IDRC, created an innovative research capacity-building program, SIRCA.

  3. SU-E-J-191: Motion Prediction Using Extreme Learning Machine in Image Guided Radiotherapy

    Energy Technology Data Exchange (ETDEWEB)

    Jia, J; Cao, R; Pei, X; Wang, H; Hu, L [Key Laboratory of Neutronics and Radiation Safety, Institute of Nuclear Energy Safety Technology, Chinese Academy of Sciences, Hefei, Anhui, 230031 (China); Engineering Technology Research Center of Accurate Radiotherapy of Anhui Province, Hefei 230031 (China); Collaborative Innovation Center of Radiation Medicine of Jiangsu Higher Education Institutions, SuZhou (China)

    2015-06-15

    Purpose: Real-time motion tracking is a critical issue in image guided radiotherapy due to the time latency caused by image processing and system response. It is of great necessity to fast and accurately predict the future position of the respiratory motion and the tumor location. Methods: The prediction of respiratory position was done based on the positioning and tracking module in ARTS-IGRT system which was developed by FDS Team (www.fds.org.cn). An approach involving with the extreme learning machine (ELM) was adopted to predict the future respiratory position as well as the tumor’s location by training the past trajectories. For the training process, a feed-forward neural network with one single hidden layer was used for the learning. First, the number of hidden nodes was figured out for the single layered feed forward network (SLFN). Then the input weights and hidden layer biases of the SLFN were randomly assigned to calculate the hidden neuron output matrix. Finally, the predicted movement were obtained by applying the output weights and compared with the actual movement. Breathing movement acquired from the external infrared markers was used to test the prediction accuracy. And the implanted marker movement for the prostate cancer was used to test the implementation of the tumor motion prediction. Results: The accuracy of the predicted motion and the actual motion was tested. Five volunteers with different breathing patterns were tested. The average prediction time was 0.281s. And the standard deviation of prediction accuracy was 0.002 for the respiratory motion and 0.001 for the tumor motion. Conclusion: The extreme learning machine method can provide an accurate and fast prediction of the respiratory motion and the tumor location and therefore can meet the requirements of real-time tumor-tracking in image guided radiotherapy.

  4. 15 CFR 19.1 - What definitions apply to the regulations in this Part?

    Science.gov (United States)

    2010-01-01

    ... bureaus currently include the Bureau of Industry and Security, the Economics and Statistics Administration... applicable agreement or instrument (including a post-delinquency payment agreement) unless other satisfactory...

  5. http://www.economistascoruna.org/eawp/eawp.asp?qsa=ES&qsb=1&qsc=191&qsd=199

    Directory of Open Access Journals (Sweden)

    Martín Montalva Paredes

    2007-04-01

    Full Text Available Las Tecnologías de Información y Comunicaciones (TIC´s están redefiniendo parte de los patrones conductuales que regulan la interacción social. El tiempo y el espacio han dejado de ser un límite en el accionar tanto de las personas, empresas y gobiernos. A nivel mundial la brecha entre los países desarrollados y en vías de desarrollo se ha ampliado en los últimos años, debido en gran parte a la masificación del uso de tecnologías. En empresas TIC´s, específicamente empresas desarrolladoras de software, tanto chilenas como canadienses, se verificó el uso que hacen éstas del Marketing Estratégico como una herramienta competitiva, a la hora de planificar la operación y continuidad.

  6. 191 bacterial agents of otitis media and their sensitivity to some ...

    African Journals Online (AJOL)

    DR. AMINU

    2010-06-01

    Shamsuddeen, U., Usman A. D., Bukar, ... Key Words: Bacterial agents, otitis media, sensitivity, antibiotics, AKTH. INTRODUCTION. Otitis media is an .... Atlas R.M (1998) Microbiology Fundamentals and. Applications. Second edition ...

  7. Health (Radiation Safety) Regulations 1984 (Victoria), No. 191 of 8 May 1984

    International Nuclear Information System (INIS)

    1984-01-01

    These Regulations promulgated pursuant to the Health Act 1958, as amended, repeal the Irradiating Apparatus and Radioactive Substances Regulations 1959. The provisions of the Regulations are designed to safeguard the public, patients and employees of registered premises from harmful effects of radiation. (NEA) [fr

  8. 191 Students' Self-Concept and Their Achievement in Basic Science ...

    African Journals Online (AJOL)

    User

    2011-07-21

    Jul 21, 2011 ... Achievement Test in Basic showed Science (SATBS) were employed as .... Higher Studies; Teacher-Students opinion and found out that students .... Factors and Pupils Leaning Outcome in Bended Primary Science Project,.

  9. 19 CFR Appendix B to Part 191 - Sample Formats for Applications for Specific Manufacturing Drawback Rulings

    Science.gov (United States)

    2010-04-01

    ... rulings must be submitted to and reviewed and approved by CBP Headquarters. A specific manufacturing... Ruling Under 19 U.S.C. 1313(a) and 1313(b) (Combination) COMPANY LETTERHEAD (Optional) U.S. Customs and.... Customs will not approve an application which shows an unincorporated division or company as the applicant...

  10. 19 CFR 191.194 - Action on application to participate in compliance program.

    Science.gov (United States)

    2010-04-01

    ... to coordinate its decision making on the package both with CBP Headquarters and with the other field drawback offices as appropriate. CBP processing of the package will consist of the review of the information contained therein as well as any additional information requested (see paragraph (a)(2) of this...

  11. People and things. CERN Courier, Mar 1979, v. 19(1)

    International Nuclear Information System (INIS)

    Anon.

    1979-01-01

    The article reports on various achievements of CERN staff members and gives news updates on upcoming or past events, for example the First Workshop on Ultra-Relativistic Nuclear Collisions, or the CERN 25th Anniversary Celebrations

  12. http://www.economistascoruna.org/eawp/eawp.asp?qsa=ES&qsb=1&qsc=191&qsd=199

    OpenAIRE

    Martín Montalva Paredes

    2007-01-01

    Las Tecnologías de Información y Comunicaciones (TIC´s) están redefiniendo parte de los patrones conductuales que regulan la interacción social. El tiempo y el espacio han dejado de ser un límite en el accionar tanto de las personas, empresas y gobiernos. A nivel mundial la brecha entre los países desarrollados y en vías de desarrollo se ha ampliado en los últimos años, debido en gran parte a la masificación del uso de tecnologías. En empresas TIC´s, específicamente empresas desarrolladoras d...

  13. : tous les projets | Page 191 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    La pleuropneumonie contagieuse des bovins est une maladie d'origine bactérienne qui a de graves conséquences sur l'économie et le commerce en Afrique subsaharienne. Date de début : 1 mars 2012. End Date: 31 octobre 2014. Sujet: AFRICA SOUTH OF SAHARA, BIOTECHNOLOGY, AGRICULTURAL INNOVATIONS ...

  14. Environmental Radiation Protection Standards for Management and Disposal of Spent Nuclear Fuel and Transuranic Radioactive Wastes (40 CFR Part 191)

    Science.gov (United States)

    This regulation sets environmental standards for public protection from the management and disposal of spent nuclear fuel, high-level wastes and wastes that contain elements with atomic numbers higher than uranium (transuranic wastes).

  15. Draft Title 40 CFR 191 compliance certification application for the Waste Isolation Pilot Plant. Volume 6: Appendix GCR Volume 1

    International Nuclear Information System (INIS)

    1995-01-01

    The Geological Characterization Report (GCR) for the WIPP site presents, in one document, a compilation of geologic information available to August, 1978, which is judged to be relevant to studies for the WIPP. The Geological Characterization Report for the WIPP site is neither a preliminary safety analysis report nor an environmental impact statement; these documents, when prepared, should be consulted for appropriate discussion of safety analysis and environmental impact. The Geological Characterization Report of the WIPP site is a unique document and at this time is not required by regulatory process. An overview is presented of the purpose of the WIPP, the purpose of the Geological Characterization Report, the site selection criteria, the events leading to studies in New Mexico, status of studies, and the techniques employed during geological characterization

  16. Draft Title 40 CFR 191 compliance certification application for the Waste Isolation Pilot Plant. Volume 3: Appendix BIR Volume 1

    International Nuclear Information System (INIS)

    1995-01-01

    The Waste Isolation Pilot Plant (WIPP) Transuranic Waste Baseline Inventory Report (WTWBIR) establishes a methodology for grouping wastes of similar physical and chemical properties, from across the US Department of Energy (DOE) transuranic (TRU) waste system, into a series of ''waste profiles'' that can be used as the basis for waste form discussions with regulatory agencies. The majority of this document reports TRU waste inventories of DOE defense sites. An appendix is included which provides estimates of commercial TRU waste from the West Valley Demonstration Project. The WIPP baseline inventory is estimated using waste streams identified by the DOE TRU waste generator/storage sites, supplemented by information from the Mixed Waste Inventory Report (MWIR) and the 1994 Integrated Data Base (IDB). The sites provided and/or authorized all information in the Waste Stream Profiles except the EPA (hazardous waste) codes for the mixed inventories. These codes were taken from the MWIR (if a WTWBIR mixed waste stream was not in MWIR, the sites were consulted). The IDB was used to generate the WIPP radionuclide inventory. Each waste stream is defined in a waste stream profile and has been assigned a waste matrix code (WMC) by the DOE TRU waste generator/storage site. Waste stream profiles with WMCs that have similar physical and chemical properties can be combined into a waste matrix code group (WMCG), which is then documented in a site-specific waste profile for each TRU waste generator/storage site that contains waste streams in that particular WMCG

  17. Draft Title 40 CFR 191 compliance certification application for the Waste Isolation Pilot Plant. Volume 2: Appendices, AAC, BECR, BH

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-03-31

    This report describes the conceptual design of a system the Department of Energy (DOE) may implement for compliance with the requirement to control access to the disposal site. In addition, this report addresses the scheduling process for control of inspection, maintenance, and periodic reporting related to Long Term Monitoring which addresses the monitoring of disposal system performance, environmental monitoring in accordance with the Consultation and Cooperation Agreement between the DOE and the state of New Mexico, and evaluation of testing activities related to the Permanent Marker System design. In addition to access control addressed by this report, the controlling or cleaning up of releases from the site is addressed in the Conceptual Decontamination and Decommissioning Plan. The monitoring of parameters related to disposal system performance is addressed in the Long Term Monitoring Design Concept Description. Together, these three documents address the full range of active institutional controls planned after disposal of the TRU waste in the WIPP repository.

  18. Vol. 4(1), S/No 13, January, 2015:191-206 ISSN: 2225-8590 (Print ...

    African Journals Online (AJOL)

    DR Nneka

    2015-01-13

    Jan 13, 2015 ... government to generate funds through taxation, mineral resources exploitation and interdependence .... translate into 24 Generally Accepted Principles and Practices: Principle 1: .... Malaysia Khazanah Nasional. 40.5. 1993.

  19. Extreme ultraviolet observations of G191-B2B and the local interstellar medium with the Hopkins Ultraviolet Telescope

    Science.gov (United States)

    Kimble, Randy A.; Davidsen, Arthur F.; Blair, William P.; Bowers, Charles W.; Van Dyke Dixon, W.; Durrance, Samuel T.; Feldman, Paul D.; Ferguson, Henry C.; Henry, Richard C.; Kriss, Gerard A.

    1993-01-01

    During the Astro-l mission in 1990 December, the Hopkins Ultraviolet Telescope (HUT) was used to observe the extreme ultraviolet spectrum (415-912 A) of the hot DA white dwarf GI91-B2B. Absorption by neutral helium shortward of the 504 A He I absorption edge is clearly detected in the raw spectrum. Model fits to the observed spectrum require interstellar neutral helium and neutral hydrogen column densities of 1.45 +/- 0.065 x 10 exp 17/sq cm and 1.69 +/- 0.12 x 10 exp 18/sq cm, respectively. Comparison of the neutral columns yields a direct assessment of the ionization state of the local interstellar cloud surrounding the Sun. The neutral hydrogen to helium ratio of 11.6 +/- 1.0 observed by HUT strongly contradicts the widespread view that hydrogen is much more ionized than helium in the local interstellar medium, a view which has motivated some exotic theoretical explanations for the supposed high ionization.

  20. Draft Title 40 CFR 191 compliance certification application for the Waste Isolation Pilot Plant. Volume 6: Appendix GCR Volume 1

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-03-31

    The Geological Characterization Report (GCR) for the WIPP site presents, in one document, a compilation of geologic information available to August, 1978, which is judged to be relevant to studies for the WIPP. The Geological Characterization Report for the WIPP site is neither a preliminary safety analysis report nor an environmental impact statement; these documents, when prepared, should be consulted for appropriate discussion of safety analysis and environmental impact. The Geological Characterization Report of the WIPP site is a unique document and at this time is not required by regulatory process. An overview is presented of the purpose of the WIPP, the purpose of the Geological Characterization Report, the site selection criteria, the events leading to studies in New Mexico, status of studies, and the techniques employed during geological characterization.

  1. Draft Title 40 CFR 191 compliance certification application for the Waste Isolation Pilot Plant. Volume 7: Appendix GCR Volume 2

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-03-31

    This report contains the second part of the geological characterization report for the Waste Isolation Pilot Plant. Both hydrology and geochemistry are evaluated. The following aspects of hydrology are discussed: surface hydrology; ground water hydrology; and hydrology drilling and testing. Hydrologic studies at the site and adjacent site areas have concentrated on defining the hydrogeology and associated salt dissolution phenomena. The geochemical aspects include a description of chemical properties of geologic media presently found in the surface and subsurface environments of southeastern New Mexico in general, and of the proposed WIPP withdrawal area in particular. The characterization does not consider any aspect of artificially-introduced material, temperature, pressure, or any other physico-chemical condition not native to the rocks of southeastern New Mexico.

  2. Identification of protein-damaging mutations in 10 swine taste receptors and 191 appetite-reward genes

    DEFF Research Database (Denmark)

    Clop, Alex; Sharaf, Abdoallah; Castelló, Anna

    2016-01-01

    . In the intestine, they regulate nutrient absorption and gut motility. Upon ligand binding, TASRs activate the appetite-reward circuitry to signal the nervous system and keep body homeostasis. With the aim to identify genetic variation in the swine TASRs and in the genes from the appetite and the reward pathways......, we have sequenced the exons of 201 TASRs and appetite-reward genes from 304 pigs belonging to ten breeds, wild boars and to two phenotypically extreme groups from a F2 resource with data on growth and fat deposition. RESULTS: We identified 2,766 coding variants 395 of which were predicted to have...... in the appetite and the reward mechanisms. Some of these genes have been already associated to taste preferences, appetite or behaviour in humans and mouse. We have also detected indications of a potential relationship of some of these genes with growth and fat deposition, which could have been caused by changes...

  3. Draft Title 40 CFR 191 compliance certification application for the Waste Isolation Pilot Plant. Volume 4: Appendix BIR Volume 2

    International Nuclear Information System (INIS)

    1995-01-01

    This report consists of the waste stream profile for the WIPP transuranic waste baseline inventory at Lawrence Livermore National Laboratory. The following assumptions/modifications were made by the WTWBIR team in developing the LL waste stream profiles: since only current volumes were provided by LL, the final form volumes were assumed to be the same as the current volumes; the WTWBIR team had to assign identification numbers (IDs) to those LL waste streams not given an identifier by the site, the assigned identification numbers are consistent with the site reported numbers; LL Final Waste Form Groups were modified to be consistent with the nomenclature used in the WTWBID, these changes included word and spelling changes, the assigned Final Waste Form Groups are consistent with the information provided by LL; the volumes for the year 1993 were changed from an annual rate of generation (m 3 /year) to a cumulative value (m 3 )

  4. CNV-association meta-analysis in 191,161 European adults reveals new loci associated with anthropometric traits

    DEFF Research Database (Denmark)

    Macé, Aurélien; Tuke, Marcus A; Deelen, Patrick

    2017-01-01

    at 1q21.1, 3q29, 7q11.23, 11p14.2, and 18q21.32 and confirms two known loci at 16p11.2 and 22q11.21, implicating at least one anthropometric trait. The discovered CNVs are recurrent and rare (0.01-0.2%), with large effects on height (>2.4 cm), weight (>5 kg), and body mass index (BMI) (>3.5 kg/m(2...

  5. SU-E-T-191: PITSTOP: Process Improvement Techniques, Software Tools, and Operating Principles for a Quality Initiative Discovery Framework.

    Science.gov (United States)

    Siochi, R

    2012-06-01

    To develop a quality initiative discovery framework using process improvement techniques, software tools and operating principles. Process deviations are entered into a radiotherapy incident reporting database. Supervisors use an in-house Event Analysis System (EASy) to discuss incidents with staff. Major incidents are analyzed with an in-house Fault Tree Analysis (FTA). A meta-Analysis is performed using association, text mining, key word clustering, and differential frequency analysis. A key operating principle encourages the creation of forcing functions via rapid application development. 504 events have been logged this past year. The results for the key word analysis indicate that the root cause for the top ranked key words was miscommunication. This was also the root cause found from association analysis, where 24% of the time that an event involved a physician it also involved a nurse. Differential frequency analysis revealed that sharp peaks at week 27 were followed by 3 major incidents, two of which were dose related. The peak was largely due to the front desk which caused distractions in other areas. The analysis led to many PI projects but there is still a major systematic issue with the use of forms. The solution we identified is to implement Smart Forms to perform error checking and interlocking. Our first initiative replaced our daily QA checklist with a form that uses custom validation routines, preventing therapists from proceeding with treatments until out of tolerance conditions are corrected. PITSTOP has increased the number of quality initiatives in our department, and we have discovered or confirmed common underlying causes of a variety of seemingly unrelated errors. It has motivated the replacement of all forms with smart forms. © 2012 American Association of Physicists in Medicine.

  6. Draft Title 40 CFR 191 compliance certification application for the Waste Isolation Pilot Plant. Volume 2: Appendices, AAC, BECR, BH

    International Nuclear Information System (INIS)

    1995-01-01

    This report describes the conceptual design of a system the Department of Energy (DOE) may implement for compliance with the requirement to control access to the disposal site. In addition, this report addresses the scheduling process for control of inspection, maintenance, and periodic reporting related to Long Term Monitoring which addresses the monitoring of disposal system performance, environmental monitoring in accordance with the Consultation and Cooperation Agreement between the DOE and the state of New Mexico, and evaluation of testing activities related to the Permanent Marker System design. In addition to access control addressed by this report, the controlling or cleaning up of releases from the site is addressed in the Conceptual Decontamination and Decommissioning Plan. The monitoring of parameters related to disposal system performance is addressed in the Long Term Monitoring Design Concept Description. Together, these three documents address the full range of active institutional controls planned after disposal of the TRU waste in the WIPP repository

  7. Effect of Prior Aging on Fatigue Behavior of IM7/BMI 5250-4 Composite at 191 C

    National Research Council Canada - National Science Library

    Ladrido, Christine G

    2007-01-01

    .... The weight loss was analyzed during the aging process. Tension to failure tests were performed on both the unaged and aged specimens to establish a baseline for the Ultimate Tensile Strengths and Young's Modulus...

  8. 40 CFR 267.191 - What are the required design and construction standards for new tank systems or components?

    Science.gov (United States)

    2010-07-01

    ... of the tank system will be in contact with the soil or with water, a determination by a corrosion expert of: (1) Factors affecting the potential for corrosion, such as: (i) Soil moisture content. (ii) Soil pH. (iii) Soil sulfides level. (iv) Soil resistivity. (v) Structure to soil potential. (vi...

  9. Draft Title 40 CFR 191 compliance certification application for the Waste Isolation Pilot Plant. Volume 7: Appendix GCR Volume 2

    International Nuclear Information System (INIS)

    1995-01-01

    This report contains the second part of the geological characterization report for the Waste Isolation Pilot Plant. Both hydrology and geochemistry are evaluated. The following aspects of hydrology are discussed: surface hydrology; ground water hydrology; and hydrology drilling and testing. Hydrologic studies at the site and adjacent site areas have concentrated on defining the hydrogeology and associated salt dissolution phenomena. The geochemical aspects include a description of chemical properties of geologic media presently found in the surface and subsurface environments of southeastern New Mexico in general, and of the proposed WIPP withdrawal area in particular. The characterization does not consider any aspect of artificially-introduced material, temperature, pressure, or any other physico-chemical condition not native to the rocks of southeastern New Mexico

  10. Odd and even partial waves of eta pi(-) and eta 'pi(-) in pi(-) p -> eta(('))pi(-)p at 191 GeV/c

    Czech Academy of Sciences Publication Activity Database

    Adolph, C.; Akhunzyanov, R.; Alexeev, M. G.; Alexeev, G. D.; Amoroso, A.; Andrieux, V.; Anosov, V.; Austregesilo, A.; Badelek, B.; Balestra, F.; Barth, J.; Baum, G.; Beck, R.; Bedfer, Y.; Berlin, A.; Bernhard, J.; Bicker, K.; Bielert, E. R.; Bieling, J.; Birsa, R.; Bisplinghoff, J.; Bodlak, M.; Boer, M.; Bordalo, P.; Bradamante, F.; Braun, C.; Bressan, A.; Büchele, M.; Burtin, E.; Capozza, L.; Chiosso, M.; Chung, S. U.; Cicuttin, A.; Crespo, M.; Curiel, Q.; Dalla Torre, S.; Dasgupta, S. S.; Dasgupta, S.; Denisov, O. Yu.; Donskov, S. V.; Doshita, N.; Duic, V.; Dünnweber, W.; Dziewiecki, M.; Efremov, A.; Elia, C.; Eversheim, P.D.; Eyrich, W.; Faessler, M.; Ferrero, A.; Finger jr., M.; Fischer, A.; Franco, C.; Fresne von Hohenesche, N.; Friedrich, J. M.; Frolov, V.; Gautheron, F.; Gavrichtchouk, O. P.; Gerassimov, S.; Geyer, R.; Gnesi, I.; Gobbo, B.; Goertz, S.; Gorzellik, M.; Grabmüller, S.; Grasso, A.; Grube, B.; Grussenmeyer, T.; Guskov, A.; Haas, F.; von Harrach, D.; Hahne, D.; Hashimoto, R.; Heinsius, F. H.; Herrmann, F.; Hinterberger, F.; Höppner, Ch.; Horikawa, N.; d´Hose, N.; Huber, S.; Ishimoto, S.; Ivanov, A.; Ivanshin, Yu.; Iwata, T.; Jahn, R.; Jary, V.; Jasinski, P.; Jörg, P.; Joosten, R.; Kabuss, E.; Ketzer, B.; Khaustov, G. V.; Khokhlov, Yu. A.; Kisselev, Y.; Klein, F.; Klimaszewski, A. D.; Koivuniemi, J. H.; Kolosov, V. N.; Kondo, K.; Königsmann, K.; Konorov, I.; Konstantinov, V. F.; Kotzinian, A. M.; Kouznetsov, O.; Krämer, M.; Kroumchtein, Z. V.; Kuchinski, N.; Kunne, F.; Kurek, K.; Kurjata, R. P.; Lednev, A. A.; Lehmann, A.; Levillain, M.; Levorato, S.; Lichtenstadt, J.; Maggiora, A.; Magnon, A.; Makke, N.; Mallot, G. K.; Marchand, C.; Martin, A.; Marzec, J.; Matoušek, J.; Matsuda, H.; Matsuda, T.; Meshcheryakov, G.; Meyer, W.; Michigami, T.; Mikhailov, Yu. V.; Miyachi, Y.; Nagaytsev, A.; Nagel, T.; Nerling, F.; Neubert, S.; Neyret, D.; Nový, J.; Nowak, W. D.; Nunes, A.S.; Olshevsky, A. G.; Orlov, I.; Ostrick, M.; Panknin, R.; Panzieri, D.; Parsamyan, B.; Paul, S.; Peshekhonov, D. V.; Platchkov, S.; Pochodzalla, J.; Polyakov, V.; Pretz, J.; Quaresma, M.; Quintans, C.; Ramos, S.; Regali, C.; Reicherz, G.; Rocco, E.; Rossiyskaya, N. S.; Ryabchikov, D.; Rychter, A.; Samoylenko, V. D.; Sandacz, A.; Sarkar, S.; Savin, I. A.; Sbrizzai, G.; Schiavon, P.; Schill, C.; Schlüter, T.; Schmidt, K.; Schmieden, H.; Schönning, K.; Schopferer, S.; Schott, M.; Shevchenko, O. Yu.; Silva, L.; Sinha, L.; Sirtl, S.; Slunecka, M.; Sosio, S.; Sozzi, F.; Srnka, Aleš; Steiger, L.; Stolarski, M.; Sulc, M.; Sulej, R.; Suzuki, H.; Szabelski, A.; Szameitat, T.; Sznajder, P.; Takekawa, S.; Ter Wolbeek, J.; Tessaro, S.; Tessarotto, F.; Thibaud, F.; Uhl, S.; Uman, I.; Virius, M.; Wang, L.; Weisrock, T.; Wilfert, M.; Windmolders, R.; Wollny, H.; Zaremba, K.; Zavertyaev, M.; Zemlyanichkina, E.; Ziembicki, M.; Zink, A.

    2015-01-01

    Roč. 740, 5 JAN (2015), s. 303-311 ISSN 0370-2693 R&D Projects: GA MŠk(CZ) LO1212 Institutional support: RVO:68081731 Keywords : eta-pi * annihilation * resonance * systems * state * rest Subject RIV: BH - Optics, Masers, Lasers Impact factor: 4.787, year: 2015

  11. Decree of the Czechoslovak Atomic Energy Commission No. 191/1989 on procedures, terms and conditions for examining special professional qualification and competence of selected nuclear facility personnel

    International Nuclear Information System (INIS)

    1995-01-01

    The procedures, terms and conditions for examining special professional competence of selected nuclear facility personnel are specified, including conditions for professional training and for issuing licenses qualifying the personnel for their work. Nuclear safety-related jobs at nuclear facilities are listed. Professional licenses with a two-year term of validity are granted by the Czechoslovak Atomic Energy Agency (CSAEC) to candidates who have passed examination before the State Examination Commission. Personnel training may only be performed by bodies authorized for that by the CSAEC. The Decree entered into force on 1 January 1990. (J.B.)

  12. Environmental standards for management and disposal of spent nuclear fuel, high-level and transuranic radioactive wastes, 40 CFR part 191: draft environmental impact statement

    International Nuclear Information System (INIS)

    Anon.

    1982-01-01

    The establishment of environmental standards for management and disposal of spent nuclear reactor fuel and high-level and transuranic radioactive wastes is proposed. The standards would require that maximum individual doses from all normal operations be limited to 25 millirem to the whole body, 75 millirem to the thyroid, and 25 millirem to any other organ. Regarding disposal of subject materials in geologic sites, the standards would include numerical containment requirements for the first 10,000 years following disposal, assurance requirements, and procedural requirements. The assurance requirements would provide seven principles necessary for developing confidence that long-term containment requirements would be upheld. The principles would call for well-designed, multiple-barrier disposal systems that would not rely on future generations for maintenance and would not be located near potential valuable resources. The principles would also require that future generations be provided with information about the location and dangers of the wastes and an option to recover the wastes if necessary. Procedural requirements would be developed to assure that the containment requirements were upheld. The implementation of the standards would protect public health and the environment against emissions of radioactivity. The maximum impact expected from a disposal system complying with the proposed standards would be less than 1000 premature cancer deaths over the first 10,000 years for disposal of high-level wastes produced by all currently operating reactors over their lifetime

  13. (Unsettlement: political parody and the Northern Irish peace processDOI:10.5007/2175-8026.2010n58p191

    Directory of Open Access Journals (Sweden)

    Mark Phelan

    2010-01-01

    Full Text Available This essay examines Tim Loane's political comedies, Caught Red-Handed and To Be Sure, and their critique of the Northern Irish peace process. As "parodies of esteem", both plays challenge the ultimate electoral victors of the peace process (the Democratic Unionist Party and Sinn Féin as well as critiquing the cant, chicanery and cynicism that have characterised their political rhetoric and the peace process as a whole. This essay argues that Loane's transformation of these comedic pantomime horses into Trojan ones loaded with a ruthless polemical critique of our ruling political elites is all the more important in the context of a self-censoring media that has stifled dissent and debate by protecting the peace process from inconvenient truths. From these close and contextual readings of Loane's plays, wider issues relating to the political efficacy of comedy and its canonical relegation below 'higher forms' in Irish theatre historiography will also be considered.

  14. Draft Title 40 CFR 191 compliance certification application for the Waste Isolation Pilot Plant. Volume 9: Appendices RM, SCR, SER, SUM, WRAC

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-03-31

    The Rock Mechanics Program is important to the establishment of a radioactive waste repository in salt because rock mechanics deals with the prediction of creep closure and eventual encapsulation of the waste. The intent of this paper is to give the current status of the program. This program consists of three major modeling efforts: continuum creep, fracture, and the disturbed rock zone. These models, together with laboratory material parameters, plastic flow potentials, initial and boundary input data, and other peripheral information forms the predictive technology. The extent to which the predictive technology is validated against in situ test data adds certainty to the method. Application of the technology is through simulations of the test results, design, or performance using numerical codes. In summary, the predictive capabilities are technically sound and reasonable. The current status of the program is that which would be advanced for compliance.

  15. Worldwide trends in blood pressure from 1975 to 2015: a pooled analysis of 1479 population-based measurement studies with 19.1 million participants

    NARCIS (Netherlands)

    Zhou, Bin; Bentham, James; Di Cesare, Mariachiara; Bixby, Honor; Danaei, Goodarz; Cowan, Melanie J.; Paciorek, Christopher J.; Singh, Gitanjali; Hajifathalian, Kaveh; Bennett, James E.; Taddei, Cristina; Bilano, Ver; Carrillo-Larco, Rodrigo M.; Djalalinia, Shirin; Khatibzadeh, Shahab; Lugero, Charles; Peykari, Niloofar; Zhang, Wan Zhu; Lu, Yuan; Stevens, Gretchen A.; Riley, Leanne M.; Bovet, Pascal; Elliott, Paul; Gu, Dongfeng; Ikeda, Nayu; Jackson, Rod T.; Joffres, Michel; Kengne, Andre Pascal; Laatikainen, Tiina; Lam, Tai Hing; Laxmaiah, Avula; Liu, Jing; Miranda, J. Jaime; Mondo, Charles K.; Neuhauser, Hannelore K.; Sundstrom, Johan; Smeeth, Liam; Soric, Maroje; Woodward, Mark; Ezzati, Majid; Abarca-Gomez, Leandra; Abdeen, Ziad A.; Rahim, Hanan Abdul; Abu-Rmeileh, Niveen M.; Acosta-Cazares, Benjamin; Adams, Robert; Aekplakorn, Wichai; Afsana, Kaosar; Aguilar-Salinas, Carlos A.; Agyemang, Charles; Ahmadvand, Alireza; Ahrens, Wolfgang; Al Raddadi, Rajaa; Al Woyatan, Rihab; Ali, Mohamed M.; Alkerwi, Ala'a; Aly, Eman; Amouyel, Philippe; Amuzu, Antoinette; Andersen, Lars Bo; Anderssen, Sigmund A.; Angquist, Lars; Anjana, Ranjit Mohan; Ansong, Daniel; Aounallah-Skhiri, Hajer; Araujo, Joana; Ariansen, Inger; Aris, Tahir; Arlappa, Nimmathota; Aryal, Krishna; Arveiler, Dominique; Assah, Felix K.; Assuncao, Maria Cecilia F.; Avdicova, Maria; Azevedo, Ana; Azizi, Fereidoun; Babu, Bontha V.; Bahijri, Suhad; Balakrishna, Nagalla; Bandosz, Piotr; Banegas, Jose R.; Barbagallo, Carlo M.; Barcelo, Alberto; Barkat, Amina; Barros, Aluisio J. D.; Barros, Mauro V.; Bata, Iqbal; Batieha, Anwar M.; Baur, Louise A.; Beaglehole, Robert; Ben Romdhane, Habiba; Benet, Mikhail; Benson, Lowell S.; Bernabe-Ortiz, Antonio; Bernotiene, Gailute; Bettiol, Heloisa; Bhagyalaxmi, Aroor; Bharadwaj, Sumit; Bhargava, Santosh K.; Bi, Yufang; Bikbov, Mukharram; Bjerregaard, Peter; Bjertness, Espen; Bjokelund, Cecilia; Blokstra, Anneke; Bo, Simona; Bobak, Martin; Boeing, Heiner; Boggia, Jose G.; Boissonnet, Carlos P.; Bongard, Vanina; Braeckman, Lutgart; Brajkovich, Imperia; Branca, Francesco; Breckenkamp, Juergen; Brenner, Hermann; Brewster, Lizzy M.; Bruno, Graziella; Bueno-de-Mesquita, H. B. (as); Bugge, Anna; Burns, Con; Bursztyn, Michael; de Leon, Antonio Cabrera; Cameron, Christine; Can, Gunay; Candido, Ana Paula C.; Capuano, Vincenzo; Cardoso, Viviane C.; Carlsson, Axel C.; Carvalho, Maria J.; Casanueva, Felipe F.; Casas, Juan-Pablo; Caserta, Carmelo A.; Chamukuttan, Snehalatha; Chan, Angelique W.; Chan, Queenie; Chaturvedi, Himanshu K.; Chaturvedi, Nishi; Chen, Chien-Jen; Chen, Fangfang; Chen, Huashuai; Chen, Shuohua; Chen, Zhengming; Cheng, Ching-Yu; Dekkaki, Imane Cherkaoui; Chetrit, Angela; Chiolero, Arnaud; Chiou, Shu-Ti; Chirita-Emandi, Adela; Cho, Belong; Cho, Yumi; Chudek, Jerzy; Cifkova, Renata; Claessens, Frank; Clays, Els; Concin, Hans; Cooper, Cyrus; Cooper, Rachel; Coppinger, Tara C.; Costanzo, Simona; Cottel, Dominique; Cowell, Chris; Craig, Cora L.; Crujeiras, Ana B.; Cruz, Juan J.; D'Arrigo, Graziella; d'Orsi, Eleonora; Dallongeville, Jean; Damasceno, Albertino; Dankner, Rachel; Dantoft, Thomas M.; Dauchet, Luc; de Backer, Guy; de Gaetano, Giovanni; de Henauw, Stefaan; de Smedt, Delphine; Deepa, Mohan; Dehghan, Abbas; Delisle, Helene; Deschamps, Valerie; Dhana, Klodian; Di Castelnuovo, Augusto F.; Dias-da-Costa, Juvenal Soares; Diaz, Alejandro; Dickerson, Ty T.; Do, Ha T. P.; Dobson, Annette J.; Donfrancesco, Chiara; Donoso, Silvana P.; Doering, Angela; Doua, Kouamelan; Drygas, Wojciech; Dulskiene, Virginija; Dzakula, Aleksandar; Dzerve, Vilnis; Dziankowska-Zaborszczyk, Elzbieta; Eggertsen, Robert; Ekelund, Ulf; El Ati, Jalila; Ellert, Ute; Elosua, Roberto; Erasmus, Rajiv T.; Erem, Cihangir; Eriksen, Louise; Escobedo-de la Pena, Jorge; Evans, Alun; Faeh, David; Fall, Caroline H.; Farzadfar, Farshad; Felix-Redondo, Francisco J.; Ferguson, Trevor S.; Fernandez-Berges, Daniel; Ferrante, Daniel; Ferrari, Marika; Ferreccio, Catterina; Ferrieres, Jean; Finn, Joseph D.; Fischer, Krista; Foeger, Bernhard; Foo, Leng Huat; Forslund, Ann-Sofie; Forsner, Maria; Fortmann, Stephen P.; Fouad, Heba M.; Francis, Damian K.; Franco, Maria do Carmo; Franco, Oscar H.; Frontera, Guillermo; Fuchs, Flavio D.; Fuchs, Sandra C.; Fujita, Yuki; Furusawa, Takuro; Gaciong, Zbigniew; Gareta, Dickman; Garnett, Sarah P.; Gaspoz, Jean-Michel; Gasull, Magda; Gates, Louise; Gavrila, Diana; Geleijnse, Johanna M.; Ghasemian, Anoosheh; Ghimire, Anup; Giampaoli, Simona; Gianfagna, Francesco; Giovannelli, Jonathan; Goldsmith, Rebecca A.; Goncalves, Helen; Gonzalez Gross, Marcela; Gonzalez Rivas, Juan P.; Gottrand, Frederic; Graff-Iversen, Sidsel; Grafnetter, Dusan; Grajda, Aneta; Gregor, Ronald D.; Grodzicki, Tomasz; Grontved, Anders; Gruden, Grabriella; Grujic, Vera; Guan, Ong Peng; Gudnason, Vilmundur; Guerrero, Ramiro; Guessous, Idris; Guimaraes, Andre L.; Gulliford, Martin C.; Gunnlaugsdottir, Johanna; Gunter, Marc; Gupta, Prakash C.; Gureje, Oye; Gurzkowska, Beata; Gutierrez, Laura; Gutzwiller, Felix; Hadaegh, Farzad; Halkjaer, Jytte; Hambleton, Ian R.; Hardy, Rebecca; Harikumar, Rachakulla; Hata, Jun; Hayes, Alison J.; He, Jiang; Hendriks, Marleen Elisabeth; Henriques, Ana; Hernandez Cadena, Leticia; Herqutanto, N. N.; Herrala, Sauli; Heshmat, Ramin; Hihtaniemi, Ilpo Tapani; Ho, Sai Yin; Ho, Suzanne C.; Hobbs, Michael; Hofman, Albert; Dinc, Gonul Horasan; Hormiga, Claudia M.; Horta, Bernardo L.; Houti, Leila; Howitt, Christina; Htay, Thein Thein; Htet, Aung Soe; Hu, Yonghua; Maria Huerta, Jose; Husseini, Abdullatif S.; Huybrechts, Inge; Hwalla, Nahla; Iacoviello, Licia; Iannone, Anna G.; Ibrahim, M. Mohsen; Ikram, M. Arfan; Irazola, Vilma E.; Islam, Muhammad; Ivkovic, Vanja; Iwasaki, Masanori; Jacobs, Jeremy M.; Jafar, Tazeen; Jamrozik, Konrad; Janszky, Imre; Jasienska, Grazyna; Jelakovic, Bojan; Jiang, Chao Qiang; Johansson, Mattias; Jonas, Jost B.; Jorgensen, Torben; Joshi, Pradeep; Juolevi, Anne; Jurak, Gregor; Juresa, Vesna; Kaaks, Rudolf; Kafatos, Anthony; Kalter-Leibovici, Ofra; Kamaruddin, Nor Azmi; Kasaeian, Amir; Katz, Joanne; Kauhanen, Jussi; Kaur, Prabhdeep; Kavousi, Maryam; Kazakbaeva, Gyulli; Keil, Ulrich; Boker, Lital Keinan; Keinanen-Kiukaanniemi, Sirkka; Kelishadi, Roya; Kemper, Han C. G.; Kersting, Mathilde; Key, Timothy; Khader, Yousef Saleh; Khalili, Davood; Khang, Young-Ho; Khaw, Kay-Tee; Kiechl, Stefan; Killewo, Japhet; Kim, Jeongseon; Klumbiene, Jurate; Kolle, Elin; Kolsteren, Patrick; Korrovits, Paul; Koskinen, Seppo; Kouda, Katsuyasu; Koziel, Slawomir; Kristensen, Peter Lund; Krokstad, Steinar; Kromhout, Daan; Kruger, Herculina S.; Kubinova, Ruzena; Kuciene, Renata; Kuh, Diana; Kujala, Urho M.; Kula, Krzysztof; Kulaga, Zbigniew; Kumar, R. Krishna; Kurjata, Pawel; Kusuma, Yadlapalli S.; Kuulasmaa, Kari; Kyobutungi, Catherine; Lachat, Carl; Landrove, Orlando; Lanska, Vera; Lappas, Georg; Larijani, Bagher; Laugsand, Lars E.; Le, Nguyen Bao Khanh; Le, Tuyen D.; Leclercq, Catherine; Lee, Jeannette; Lee, Jeonghee; Lehtimaki, Terho; Lekhraj, Rampal; Leon-Munoz, Luz M.; Levitt, Naomi S.; Li, Yanping; Lilly, Christa L.; Lim, Wei-Yen; Fernanda Lima-Costa, M.; Lin, Hsien-Ho; Lin, Xu; Linneberg, Allan; Lissner, Lauren; Litwin, Mieczyslaw; Lorbeer, Roberto; Lotufo, Paulo A.; Eugenio Lozano, Jose; Luksiene, Dalia; Lundqvist, Annamari; Lunet, Nuno; Lytsy, Per; Ma, Guansheng; Ma, Jun; Machado-Coelho, George L. L.; Machi, Suka; Maggi, Stefania; Magliano, Dianna J.; Majer, Marjeta; Makdisse, Marcia; Malekzadeh, Reza; Malhotra, Rahul; Rao, Kodavanti Mallikharjuna; Malyutina, Sofia; Manios, Yannis; Mann, Jim I.; Manzato, Enzo; Margozzini, Paula; Marques-Vidal, Pedro; Marrugat, Jaume; Martorell, Reynaldo; Mathiesen, Ellisiv B.; Matijasevich, Alicia; Matsha, Tandi E.; Mbanya, Jean Claude N.; Posso, Anselmo J. Mc Donald; McFarlane, Shelly R.; McGarvey, Stephen T.; McLachlan, Stela; McLean, Rachael M.; McNulty, Breige A.; Khir, Amir Sharifuddin Md; Mediene-Benchekor, Sounnia; Medzioniene, Jurate; Meirhaeghe, Aline; Meisinger, Christa; Menezes, Ana Maria B.; Menon, Geetha R.; Meshram, Indrapal I.; Metspalu, Andres; Mi, Jie; Mikkel, Kairit; Miller, Jody C.; Francisco Miquel, Juan; Jaime Miranda, J.; Misigoj-Durakovic, Marjeta; Mohamed, Mostafa K.; Mohammad, Kazem; Mohammadifard, Noushin; Mohan, Viswanathan; Yusoff, Muhammad Fadhli Mohd; Moller, Niels C.; Molnar, Denes; Momenan, Amirabbas; Monyeki, Kotsedi Daniel K.; Moreira, Leila B.; Morejon, Alain; Moreno, Luis A.; Morgan, Karen; Moschonis, George; Mossakowska, Malgorzata; Mostafa, Aya; Mota, Jorge; Motlagh, Mohammad Esmaeel; Motta, Jorge; Muiesan, Maria L.; Mueller-Nurasyid, Martina; Murphy, Neil; Mursu, Jaakko; Musil, Vera; Nagel, Gabriele; Naidu, Balkish M.; Nakamura, Harunobu; Namsna, Jana; Nang, Ei Ei K.; Nangia, Vinay B.; Narake, Sameer; Maria Navarrete-Munoz, Eva; Ndiaye, Ndeye Coumba; Neal, William A.; Nenko, Ilona; Nervi, Flavio; Nguyen, Nguyen D.; Nguyen, Quang Ngoc; Nieto-Martinez, Ramfis E.; Niiranen, Teemu J.; Ning, Guang; Ninomiya, Toshiharu; Nishtar, Sania; Noale, Marianna; Noboa, Oscar A.; Noorbala, Ahmad Ali; Norat, Teresa; Noto, Davide; Al Nsour, Mohannad; O'Reilly, Dermot; Oh, Kyungwon; Olinto, Maria Teresa A.; Oliveira, Isabel O.; Omar, Mohd Azahadi; Onat, Altan; Ordunez, Pedro; Osmond, Clive; Ostojic, Sergej M.; Otero, Johanna A.; Overvad, Kim; Owusu-Dabo, Ellis; Paccaud, Fred Michel; Padez, Cristina; Pahomova, Elena; Pajak, Andrzej; Palli, Domenico; Palmieri, Luigi; Panda-Jonas, Songhomitra; Panza, Francesco; Papandreou, Dimitrios; Parnell, Winsome R.; Parsaeian, Mahboubeh; Pecin, Ivan; Pednekar, Mangesh S.; Peer, Nasheeta; Peeters, Petra H.; Peixoto, Sergio Viana; Pelletier, Catherine; Peltonen, Markku; Pereira, Alexandre C.; Marina Perez, Rosa; Peters, Annette; Petkeviciene, Janina; Pham, Son Thai; Pigeot, Iris; Pikhart, Hynek; Pilav, Aida; Pilotto, Lorenza; Pitakaka, Freda; Plans-Rubio, Pedro; Polakowska, Maria; Polasek, Ozren; Porta, Miquel; Portegies, Marileen L. P.; Pourshams, Akram; Pradeepa, Rajendra; Prashant, Mathur; Price, Jacqueline F.; Puiu, Maria; Punab, Margus; Qasrawi, Radwan F.; Qorbani, Mostafa; Radic, Ivana; Radisauskas, Ricardas; Rahman, Mahfuzar; Raitakari, Olli; Raj, Manu; Rao, Sudha Ramachandra; Ramos, Elisabete; Rampal, Sanjay; Rangel Reina, Daniel A.; Rasmussen, Finn; Redon, Josep; Reganit, Paul Ferdinand M.; Ribeiro, Robespierre; Riboli, Elio; Rigo, Fernando; de Wit, Tobias F. Rinke; Ritti-Dias, Raphael M.; Robinson, Sian M.; Robitaille, Cynthia; Rodriguez-Artalejo, Fernando; Rodriguez-Villamizar, Laura A.; Rojas-Martinez, Rosalba; Rosengren, Annika; Rubinstein, Adolfo; Rui, Ornelas; Sandra Ruiz-Betancourt, Blanca; Russo Horimoto, Andrea R. V.; Rutkowski, Marcin; Sabanayagam, Charumathi; Sachdev, Harshpal S.; Saidi, Olfa; Sakarya, Sibel; Salanave, Benoit; Salazar Martinez, Eduardo; Salmeron, Diego; Salomaa, Veikko; Salonen, Jukka T.; Salvetti, Massimo; Sanchez-Abanto, Jose; Sans, Susana; Santos, Diana; Santos, Ina S.; dos Santos, Renata Nunes; Santos, Rute; Saramies, Jouko L.; Sardinha, Luis B.; Margolis, Giselle Sarganas; Sarrafzadegan, Nizal; Saum, Kai-Uwe; Savva, Savvas C.; Scazufca, Marcia; Schargrodsky, Herman; Schneider, Ione J.; Schultsz, Constance; Schutte, Aletta E.; Sen, Abhijit; Senbanjo, Idowu O.; Sepanlou, Sadaf G.; Sharma, Sanjib K.; Shaw, Jonathan E.; Shibuya, Kenji; Shin, Dong Wook; Shin, Youchan; Siantar, Rosalynn; Sibai, Abla M.; Santos Silva, Diego Augusto; Simon, Mary; Simons, Judith; Simons, Leon A.; Sjotrom, Michael; Skovbjerg, Sine; Slowikowska-Hilczer, Jolanta; Slusarczyk, Przemyslaw; Smith, Margaret C.; Snijder, Marieke B.; So, Hung-Kwan; Sobngwi, Eugene; Soderberg, Stefan; Solfrizzi, Vincenzo; Sonestedt, Emily; Song, Yi; Sorensen, Thorkild I. A.; Jerome, Charles Sossa; Soumare, Aicha; Staessen, Jan A.; Starc, Gregor; Stathopoulou, Maria G.; Stavreski, Bill; Steene-Johannessen, Jostein; Stehle, Peter; Stein, Aryeh D.; Stergiou, George S.; Stessman, Jochanan; Stieber, Jutta; Stoeckl, Doris; Stocks, Tanja; Stokwiszewski, Jakub; Stronks, Karien; Strufaldi, Maria Wany; Sun, Chien-An; Sung, Yn-Tz; Suriyawongpaisal, Paibul; Sy, Rody G.; Tai, E. Shyong; Tammesoo, Mari-Liis; Tamosiunas, Abdonas; Tang, Line; Tang, Xun; Tanser, Frank; Tao, Yong; Tarawneh, Mohammed Rasoul; Tarqui-Mamani, Carolina B.; Taylor, Anne; Theobald, Holger; Thijs, Lutgarde; Thuesen, Betina H.; Tjonneland, Anne; Tolonen, Hanna K.; Topbas, Murat; Topor-Madry, Roman; Jose Tormo, Maria; Torrent, Maties; Traissac, Pierre; Trichopoulos, Dimitrios; Trichopoulou, Antonia; Trinh, Oanh T. H.; Trivedi, Atul; Tshepo, Lechaba; Tulloch-Reid, Marshall K.; Tuomainen, Tomi-Pekka; Turley, Maria L.; Tynelius, Per; Tzourio, Christophe; Ueda, Peter; Ugel, Eunice; Ulmer, Hanno; Uusitalo, Hannu M. T.; Valdivia, Gonzalo; Valvi, Damaskini; van der Schouw, Yvonne T.; van Herck, Koen; van Rossem, Lenie; van Valkengoed, Irene G. M.; Vanderschueren, Dirk; Vanuzzo, Diego; Vatten, Lars; Vega, Tomas; Velasquez-Melendez, Gustavo; Veronesi, Giovanni; Verschuren, W. M. Monique; Verstraeten, Roosmarijn; Victora, Cesar G.; Viet, Lucie; Viikari-Juntura, Eira; Vineis, Paolo; Vioque, Jesus; Virtanen, Jyrki K.; Visvikis-Siest, Sophie; Viswanathan, Bharathi; Vollenweider, Peter; Vrdoljak, Ana; Vrijheid, Martine; Wade, Alisha N.; Wagner, Aline; Walton, Janette; Mohamud, Wan Nazaimoon Wan; Wang, Ming-Dong; Wang, Qian; Wang, Ya Xing; Wannamethee, S. Goya; Wareham, Nicholas; Wederkopp, Niels; Weerasekera, Deepa; Whincup, Peter H.; Widhalm, Kurt; Widyahening, Indah S.; Wiecek, Andrzej; Wijga, Alet H.; Wilks, Rainford J.; Willeit, Peter; Williams, Emmanuel A.; Wilsgaard, Tom; Wojtyniak, Bogdan; Wong, Tien Yin; Wong-McClure, Roy A.; Woo, Jean; Wu, Aleksander Giwercman; Wu, Frederick C.; Wu, Shou Ling; Xu, Haiquan; Yan, Weili; Yang, Xiaoguang; Ye, Xingwang; Yiallouros, Panayiotis K.; Yoshihara, Akihiro; Younger-Coleman, Novie O.; Yusoff, Ahmad F.; Zambon, Sabina; Zdrojewski, Tomasz; Zeng, Yi; Zhao, Dong; Zhao, Wenhua; Zheng, Yingffeng; Zhu, Dan; Zimmermann, Esther; Zuniga Cisneros, Julio

    2017-01-01

    Background Raised blood pressure is an important risk factor for cardiovascular diseases and chronic kidney disease. We estimated worldwide trends in mean systolic and mean diastolic blood pressure, and the prevalence of, and number of people with, raised blood pressure, defined as systolic blood

  16. Draft Title 40 CFR 191 compliance certification application for the Waste Isolation Pilot Plant. Volume 9: Appendices RM, SCR, SER, SUM, WRAC

    International Nuclear Information System (INIS)

    1995-01-01

    The Rock Mechanics Program is important to the establishment of a radioactive waste repository in salt because rock mechanics deals with the prediction of creep closure and eventual encapsulation of the waste. The intent of this paper is to give the current status of the program. This program consists of three major modeling efforts: continuum creep, fracture, and the disturbed rock zone. These models, together with laboratory material parameters, plastic flow potentials, initial and boundary input data, and other peripheral information forms the predictive technology. The extent to which the predictive technology is validated against in situ test data adds certainty to the method. Application of the technology is through simulations of the test results, design, or performance using numerical codes. In summary, the predictive capabilities are technically sound and reasonable. The current status of the program is that which would be advanced for compliance

  17. A plan for the implementation of assurance requirements in compliance with 40 CFR 191.14 at the Waste Isolation Pilot Plant

    International Nuclear Information System (INIS)

    1987-12-01

    The purpose of this document is to describe the Assurance Requirements Implementation Plan for the Waste Isolation Pilot Plant (WIPP). This Plan addresses the requirements that have been promulgated by the US Environmental Protection Agency (EPA) standard ''Environmental Standards for the Management and Disposal of Spent Nuclear Fuel, High-Level and Transuranic Radioactive Wastes; Final Rule'' (The Standard). It should be pointed out that portions of this standard have been vacated and remanded to the EPA by the First Circuit Court (NRDC vs EPA). The reasons for remanding were unrelated to the Assurance Requirement provisions. As a result, it is anticipated that when a new Standard is promulgated, the Assurance Requirements in the current Standard will remain intact. The Second Modification to the Consultation and Cooperation Agreement with the State of New Mexico acknowledges the necessity for continuing ''as though the provisions remain applicable''. The Plan will be revised as necessary in response to any changes in the Standard resulting from the court's decision. The WIPP Project was authorized by Public Law as a defense activity of the US Department of Energy (DOE) with the express purpose of providing a research and development facility to demonstrate the safe disposal of radioactive wastes that result from defense activities of the US. The WIPP Project is exempted from regulation by the Nuclear Regulatory Commission (NRC). The mission of the WIPP Project is to conduct research, demonstration, and siting studies relevant to permanent disposal of transuranic (TRU) wastes. 4 refs

  18. Draft Title 40 CFR 191 compliance certification application for the Waste Isolation Pilot Plant. Volume 5: Appendices D and D, DEF, FAC

    International Nuclear Information System (INIS)

    1995-01-01

    This plan serves to describe the objectives of decommissioning for the Waste Isolation Pilot Plant (WIPP), identifies the elements necessary to accomplish the decommissioning, and defines the steps to execute those elements in a safe and environmentally sound manner. The plan provides a strategy for progressing from the final actions of the Disposal Phase, through the Decontamination and Decommissioning Phase, and into the initiation of the Long-Term Monitoring Phase. This plan describes a sequence of events for decontamination of the WIPP facilities and structures used to manage and contain TRU and TRU mixed waste during the receipt and emplacement operations. Alternative methods of decontamination are provided where practical. The methods for packaging and disposal of the waste generated (derived waste) during this process are discussed. The best available technology at the time of this plan's development, may become outmoded by future technology and alternative strategies. If alternative technologies are identified the affected stakeholder(s), the Secretary of the Interior and the State will be consulted prior to implementation

  19. Preliminary comparison with 40 CFR Part 191, Subpart B for the Waste Isolation Pilot Plant, December 1991. Vol. 4: Uncertainty and sensitivity analysis results

    Energy Technology Data Exchange (ETDEWEB)

    Helton, J C [Arizona State University, Department of Mathematics, Tempe, AZ (United States); Garner, J W [Applied Physics Inc., Albuquerque, NM (United States); Rechard, R P; Rudeen, D K [New Mexico Engineering Research Institute, Albuquerque, NM (United States); Swift, P N [Tech Reps Inc., Albuquerque, NM (United States)

    1992-04-15

    The most appropriate conceptual model for performance assessment at the Waste Isolation Pilot Plant (WIPP) is believed to include gas generation due to corrosion and microbial action in the repository and a dual-porosity (matrix and fracture porosity) representation for solute transport in the Culebra Dolomite Member of the Rustler Formation. Under these assumptions, complementary cumulative distribution functions (CCDFs) summarizing radionuclide releases to the accessible environment due to both cuttings removal and groundwater transport fall substantially below the release limits promulgated by the Environmental Protection Agency (EPA). This is the case even when the current estimates of the uncertainty in analysis inputs are incorporated into the performance assessment. The best-estimate performance-assessment results are dominated by cuttings removal. The releases to the accessible environment due to groundwater transport make very small contributions to the total release. The variability in the distribution of CCDFs that must be considered in comparisons with the EPA release limits is dominated by the variable LAMBDA (rate constant in Poisson model for drilling intrusions). The variability in releases to the accessible environment due to individual drilling intrusions is dominated by DBDIAM (drill bit diameter). Most of the imprecisely known variables considered in the 1991 WIPP performance assessment relate to radionuclide releases to the accessible environment due to groundwater transport. For a single borehole (i.e., an E2-type scenario), whether or not a release from the repository to the Culebra even occurs is controlled by the variable SALPERM (Salado permeability), with no releases for small values (i.e., < 5 x 10{sup -21} m{sup 2}) of this variable. When SALPERM is small, the repository never fills with brine and so there is no flow up an intruding borehole that can transport radionuclides to the Culebra. Further, releases that do reach the Culebra for larger values of SALPERM are small and usually do not reach the accessible environment. A potentially important scenario for the WIPP involves two or more boreholes through the same waste panel, of which at least one penetrates a pressurized brine pocket and at least one does not (i.e., an ElE2-type scenario). For these scenarios, the uncertainty in release to the Culebra is dominated by the variables BHPERM (borehole permeability), BPPRES (brine pocket pressure), and the solubilities for the individual elements (i.e., Am, Np, Pu, Th, U) in the projected radionuclide inventory for the WIPP. Once a release reaches the Culebra, the matrix distribution coefficients for the individual elements are important, with releases to the Culebra often failing to reach the accessible environment over the 10,000-yr period specified in the EPA regulations. To provide additional perspective, the following variants of the 1991 WIPP performance assessment have also been considered: (1) no gas generation in the repository and a dual-porosity transport model in the Culebra; (2) gas generation in the repository and a single-porosity (fracture porosity) transport model in the Culebra; (3) no gas generation in the repository and a single-porosity transport model in the Culebra; (4) gas generation in the repository and a dual-porosity transport model in the Culebra without chemical retardation; and (5) gas generation in the repository, a dual-porosity transport model in the Culebra, and extremes of climatic variation. All of these variations relate to groundwater transport and thus do not affect releases due to cuttings removal, which were found to dominate the results of the 1991 WIPP performance assessment. However, these variations do have the potential to increase the importance of releases due to groundwater transport relative to releases due to cuttings removal. (author)

  20. Development of Optical Fiber Technology in Poland, International Journal of Electronics and Telecommunication, vol. 57, no 2, pp.191-197, July 2011

    CERN Document Server

    Dorosz, J

    2011-01-01

    In this paper, the authors, chairmen of the 13th Conference on Optical Fibers and Their Applications OFA2011, and editors of the conference proceedings summarize the development of optical fiber technology in Poland (during the period of 2009- 2011) on the basis of papers presented there and consecutively published in this volume. The digest is thus not full but covers the periodically presented material every 18 months during the meetings on optical fibers in Białystok-Białowie˙za and Lublin- Krasnobród. OFC systems are developed for HEP experiments and accelerators. OFC systems are also developed for virtual atomic clocks. EuCARD information presentation was organized during this meeting. Keywords— optical fibers, optical communication systems, photonic sources and detectors, photonic sensors, integrated optics, photonics applications, photonic materials.

  1. 40 CFR Appendix A to Part 194 - Certification of the Waste Isolation Pilot Plant's Compliance With the 40 CFR Part 191 Disposal...

    Science.gov (United States)

    2010-07-01

    ... Department shall use Salado mass concrete (consistent with that proposed for the shaft seal system, and as described in Appendix SEAL of Docket A-93-02, Item II-G-1) instead of fresh water concrete. Condition 2... shall implement the panel seal design designated as Option D in Docket A-93-02, Item II-G-1 (October 29...

  2. Rapid needle-out patient-rollover approach after cone beam CT-guided lung biopsy: effect on pneumothorax rate in 1,191 consecutive patients

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Jung Im [Seoul National University College of Medicine, Department of Radiology, Jongno-gu, Seoul (Korea, Republic of); Seoul National University Medical Research Center, Institute of Radiation Medicine, Seoul (Korea, Republic of); Kyung Hee University Hospital at Gangdong, Kyung Hee University College of Medicine, Department of Radiology, Seoul (Korea, Republic of); Park, Chang Min; Goo, Jin Mo [Seoul National University College of Medicine, Department of Radiology, Jongno-gu, Seoul (Korea, Republic of); Seoul National University, Cancer Research Institute, Seoul (Korea, Republic of); Lee, Sang Min [Seoul National University College of Medicine, Department of Radiology, Jongno-gu, Seoul (Korea, Republic of)

    2015-07-15

    To investigate the effect of rapid needle-out patient-rollover approach on the incidence of pneumothorax and drainage catheter placement due to pneumothorax in C-arm Cone-beam CT (CBCT)-guided percutaneous transthoracic needle biopsy (PTNB) of lung lesions. From May 2011 to December 2012, 1227 PTNBs were performed in 1191 patients with a 17-gauge coaxial needle. 617 biopsies were performed without (conventional-group) and 610 with rapid-rollover approach (rapid-rollover-group). Overall pneumothorax rates and incidences of pneumothorax requiring drainage catheter placement were compared between two groups. There were no significant differences in overall pneumothorax rates between conventional and rapid-rollover groups (19.8 % vs. 23.1 %, p = 0.164). However, pneumothorax rate requiring drainage catheter placement was significantly lower in rapid-rollover-group (1.6 %) than conventional-group (4.2 %) (p = 0.010). Multivariate analysis revealed male, age > 60, bulla crossed, fissure crossed, pleura to target distance > 1.3 cm, emphysema along needle tract, and pleural punctures ≥ 2 were significant risk factors of pneumothorax (p < 0.05). Regarding pneumothorax requiring drainage catheter placement, fissure crossed, bulla crossed, and emphysema along needle tract were significant risk factors (p < 0.05), whereas rapid-rollover approach was an independent protective factor (p = 0.002). The rapid needle-out patient-rollover approach significantly reduced the rate of pneumothorax requiring drainage catheter placement after CBCT-guided PTNB. (orig.)

  3. Draft Title 40 CFR 191 compliance certification application for the Waste Isolation Pilot Plant. Volume 8: Appendices HYDRO, IRD, LTM, NUTS, PAR, PMR, QAPD, RBP

    International Nuclear Information System (INIS)

    1995-01-01

    Geohydrologic data have been collected in the Los Medanos area at the US Department of Energy's proposed Waste Isolation Pilot Plant (WIPP) site in southeastern New Mexico since 1975 as part of a study evaluating the feasibility of storing defense-associated nuclear wastes within the bedded salt of the Salado Formation of Permian age. Drilling and hydrologic testing have identified three principal water-bearing zones above the Salado Formation and one below that could potentially transport wastes to the biosphere if the proposed facility were breached. The zones above the Salado are the contact between the Rustler and Salado Formations and the Culebra and Magenta Dolomite Members of the Rustler Formation of Permian age. The zone below the Salado Formation consists of channel sandstones in the Bell Canyon Formation of the Permian Delaware Mountain Group. Determinations of hydraulic gradients, directions of flow, and hydraulic properties were hindered because of the negligible permeability of the water-bearing zones. Special techniques in drilling, well completion, and hydraulic testing have been developed to determine the hydrologic characteristics of these water-producing zones

  4. Preliminary comparison with 40 CFR Part 191, Subpart B for the Waste Isolation Pilot Plant, December 1991. Vol. 4: Uncertainty and sensitivity analysis results

    International Nuclear Information System (INIS)

    Helton, J.C.; Garner, J.W.; Rechard, R.P.; Rudeen, D.K.; Swift, P.N.

    1992-04-01

    The most appropriate conceptual model for performance assessment at the Waste Isolation Pilot Plant (WIPP) is believed to include gas generation due to corrosion and microbial action in the repository and a dual-porosity (matrix and fracture porosity) representation for solute transport in the Culebra Dolomite Member of the Rustler Formation. Under these assumptions, complementary cumulative distribution functions (CCDFs) summarizing radionuclide releases to the accessible environment due to both cuttings removal and groundwater transport fall substantially below the release limits promulgated by the Environmental Protection Agency (EPA). This is the case even when the current estimates of the uncertainty in analysis inputs are incorporated into the performance assessment. The best-estimate performance-assessment results are dominated by cuttings removal. The releases to the accessible environment due to groundwater transport make very small contributions to the total release. The variability in the distribution of CCDFs that must be considered in comparisons with the EPA release limits is dominated by the variable LAMBDA (rate constant in Poisson model for drilling intrusions). The variability in releases to the accessible environment due to individual drilling intrusions is dominated by DBDIAM (drill bit diameter). Most of the imprecisely known variables considered in the 1991 WIPP performance assessment relate to radionuclide releases to the accessible environment due to groundwater transport. For a single borehole (i.e., an E2-type scenario), whether or not a release from the repository to the Culebra even occurs is controlled by the variable SALPERM (Salado permeability), with no releases for small values (i.e., -21 m 2 ) of this variable. When SALPERM is small, the repository never fills with brine and so there is no flow up an intruding borehole that can transport radionuclides to the Culebra. Further, releases that do reach the Culebra for larger values of SALPERM are small and usually do not reach the accessible environment. A potentially important scenario for the WIPP involves two or more boreholes through the same waste panel, of which at least one penetrates a pressurized brine pocket and at least one does not (i.e., an ElE2-type scenario). For these scenarios, the uncertainty in release to the Culebra is dominated by the variables BHPERM (borehole permeability), BPPRES (brine pocket pressure), and the solubilities for the individual elements (i.e., Am, Np, Pu, Th, U) in the projected radionuclide inventory for the WIPP. Once a release reaches the Culebra, the matrix distribution coefficients for the individual elements are important, with releases to the Culebra often failing to reach the accessible environment over the 10,000-yr period specified in the EPA regulations. To provide additional perspective, the following variants of the 1991 WIPP performance assessment have also been considered: (1) no gas generation in the repository and a dual-porosity transport model in the Culebra; (2) gas generation in the repository and a single-porosity (fracture porosity) transport model in the Culebra; (3) no gas generation in the repository and a single-porosity transport model in the Culebra; (4) gas generation in the repository and a dual-porosity transport model in the Culebra without chemical retardation; and (5) gas generation in the repository, a dual-porosity transport model in the Culebra, and extremes of climatic variation. All of these variations relate to groundwater transport and thus do not affect releases due to cuttings removal, which were found to dominate the results of the 1991 WIPP performance assessment. However, these variations do have the potential to increase the importance of releases due to groundwater transport relative to releases due to cuttings removal. (author)

  5. Intellectual property policy on pharmaceutical products: a view in the beginning of the 2000 decade - DOI: 10.3395/reciis.v2i2.191en

    Directory of Open Access Journals (Sweden)

    Sergio M Paulino de Carvalho

    2009-03-01

    Full Text Available This paper aims at an analysis of the intellectual property policy in the health field by emphasizing the program of production and distribution of antiretrovirals and the generic drugs market, also reviewing the process of articulation and implementation of the intellectual property policy in this sector. From a methodological viewpoint, the paper favors the analysis of data related to the structuring of the pharmaceutical products market and of impacts both from the new institutionality and the intellectual property policies developed by the Ministry of Health in the first half of the 2000’s decade.

  6. Draft Title 40 CFR 191 compliance certification application for the Waste Isolation Pilot Plant. Volume 5: Appendices D and D, DEF, FAC

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-03-31

    This plan serves to describe the objectives of decommissioning for the Waste Isolation Pilot Plant (WIPP), identifies the elements necessary to accomplish the decommissioning, and defines the steps to execute those elements in a safe and environmentally sound manner. The plan provides a strategy for progressing from the final actions of the Disposal Phase, through the Decontamination and Decommissioning Phase, and into the initiation of the Long-Term Monitoring Phase. This plan describes a sequence of events for decontamination of the WIPP facilities and structures used to manage and contain TRU and TRU mixed waste during the receipt and emplacement operations. Alternative methods of decontamination are provided where practical. The methods for packaging and disposal of the waste generated (derived waste) during this process are discussed. The best available technology at the time of this plan`s development, may become outmoded by future technology and alternative strategies. If alternative technologies are identified the affected stakeholder(s), the Secretary of the Interior and the State will be consulted prior to implementation.

  7. Draft Title 40 CFR 191 compliance certification application for the Waste Isolation Pilot Plant. Volume 8: Appendices HYDRO, IRD, LTM, NUTS, PAR, PMR, QAPD, RBP

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-03-31

    Geohydrologic data have been collected in the Los Medanos area at the US Department of Energy`s proposed Waste Isolation Pilot Plant (WIPP) site in southeastern New Mexico since 1975 as part of a study evaluating the feasibility of storing defense-associated nuclear wastes within the bedded salt of the Salado Formation of Permian age. Drilling and hydrologic testing have identified three principal water-bearing zones above the Salado Formation and one below that could potentially transport wastes to the biosphere if the proposed facility were breached. The zones above the Salado are the contact between the Rustler and Salado Formations and the Culebra and Magenta Dolomite Members of the Rustler Formation of Permian age. The zone below the Salado Formation consists of channel sandstones in the Bell Canyon Formation of the Permian Delaware Mountain Group. Determinations of hydraulic gradients, directions of flow, and hydraulic properties were hindered because of the negligible permeability of the water-bearing zones. Special techniques in drilling, well completion, and hydraulic testing have been developed to determine the hydrologic characteristics of these water-producing zones.

  8. Worldwide trends in blood pressure from 1975 to 2015 : a pooled analysis of 1479 population-based measurement studies with 19.1 million participants

    NARCIS (Netherlands)

    Zhou, Bin; Bentham, James; Di Cesare, Mariachiara; Bixby, Honor; Danaei, Goodarz; Cowan, Melanie J.; Paciorek, Christopher J.; Singh, Gitanjali M; Hajifathalian, Kaveh; Bennett, James E.; Taddei, Cristina; Bilano, Ver; Carrillo-Larco, Rodrigo M.; Djalalinia, Shirin; Khatibzadeh, Shahab; Lugero, Charles; Peykari, Niloofar; Zhang, Wan Zhu; Lu, Yuan; Stevens, Gretchen A.; Riley, Leanne M.; Bovet, Pascal; Elliott, Paul; Gu, Dongfeng; Ikeda, Nayu; Jackson, Rod T.; Joffres, Michel; Kengne, Andre-Pascal; Laatikainen, Tiina; Lam, Tai Hing; Laxmaiah, Avula; Liu, Jing; Miranda, J. Jaime; Mondo, Charles K.; Neuhauser, Hannelore K.; Sundstrom, Johan; Smeeth, Liam; Soric, Maroje; Woodward, Mark; Ezzati, Majid; Abarca-Gomez, Leandra; Abdeen, Ziad A.; Rahim, Hanan Abdul; Abu-Rmeileh, Niveen Me; Acosta-Cazares, Benjamin; Adams, Robert; Aekplakorn, Wichai; Afsana, Kaosar; Aguilar-Salinas, Carlos A; Kromhout, Daan

    2017-01-01

    Background Raised blood pressure is an important risk factor for cardiovascular diseases and chronic kidney disease. We estimated worldwide trends in mean systolic and mean diastolic blood pressure, and the prevalence of, and number of people with, raised blood pressure, defined as systolic blood

  9. SU-F-J-191: Dosimetric Evaluation of a Left Chestwall Patient Treated with a Compact Proton Pencil Beam Gantry Utilizing Daily Setup CBCT

    Energy Technology Data Exchange (ETDEWEB)

    Maynard, M; Chen, K; Rosen, L; Wu, H [Willis-Knighton Medical Center, Shreveport, LA (United States)

    2016-06-15

    Purpose: To evaluate the robustness of the gradient technique for treating a multi-isocenter left chest wall patient with a compact proton pencil beam gantry. Both CBCT and stereoscopic imaging are used to facilitate daily treatment setup. Methods: To treat the elongated chest wall planning target volume (PTV) with the compact PBS system, a 28 fraction (5040 CcGE) treatment plan was created using two fields with gradient matching technique. Daily table shifts between treatment field isocenters were obtained from the record and verify system for each treatment fraction. Copies of the initial treatment plan were made for each fraction and the field isocenter coordinates for each plan copy were adjusted to reflect daily table shifts. Doses were re-calculated for each fraction, summed, and compared against the initial plan. Results: The table shifts (average and range) were 2.2 (−5.1–+3.9), 3.0 (−6.0–+4.0) and 3.0 (−10.1–+1.9) millimeters in the anterior-posterior, superior-inferior and right-left directions, respectively. Dose difference to the PTV, heart and ipsilateral lung were evaluated. The percentage of the PTV receiving the prescription dose decreased from 94.6% to 89.1%. The D95 of the PTV increased from 99.6% to 99.9%. The maximum dose in PTV increased from 106.6% to 109.2% and V105 increased from 1.0% to 16.5%. The V20 of the ipsilateral lung increased from 18.5% to 21.0%. The mean heart dose difference was negligible. Conclusion: Observed dose differences to lung and heart tissues due to daily setup variations remained acceptably low while maintaining sufficient dose coverage to the PTV. This initial case study demonstrates the robustness of the gradient technique to treat a large target, multi-isocenter plan with a compact proton pencil beam gantry equipped with CBCT and stereoscopic imaging modalities.

  10. SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

    International Nuclear Information System (INIS)

    Jaszczak, R.J.

    1995-12-01

    Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons

  11. SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

    Energy Technology Data Exchange (ETDEWEB)

    Jaszczak, R.J.

    1995-12-01

    Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons.

  12. Negative Ion Source Development and Photodetachment Studies at ISOLDE

    CERN Document Server

    AUTHOR|(CDS)2254068; Hanstorp, Dag; Rothe, Sebastian

    Astatine is one of the rarest elements on earth. The small amount of existing astatine is either created in decay chains of heavier elements or artificially. One of its longer lived isotopes, 211At, is of interest for targeted alpha therapy, a method of treating cancer by using the alpha decay of radioactive elements directly at the location of a tumor. However, its chemical properties are yet to be determined due to the short life time of astatine. A milestone towards the determination of the electronegativity of astatine was the measurement of its ionization potential (IP) at CERN-ISOLDE. However, its electron affinity (EA, the binding energy of the additional electron in a negative ion), is still to be measured. In order to determine the EA of radioisotopes by laser photodetachment spectroscopy, the Gothenburg ANion Detector for Affinity measurements by Laser Photodetachment (GANDALPH) has been built in recent years. As a proof-of-principle, the EA of the 128I negative ion, produced at the CERN-ISOLDE rad...

  13. An Expert System for Managing Storage Space Constraints Aboard United States Naval Vessels

    Science.gov (United States)

    1991-12-01

    d. solvents, thinners, primers, cmpounds, varnishes , and lacquers i e. alcohol, acetone, ether, and naphtha; f. greases * nd pastes Except for...suffocation. Malocarbon liquids are compounds of carbon containing any of the halogen elements ( fluorine , chlorine, bromine, iodine, or astatine. (Examples are

  14. Workshop on selected aspects of radiochemistry

    International Nuclear Information System (INIS)

    1991-11-01

    The aspects chosen for the workshop are: isotope preparation, separation methods; radiochemical methods and analyses; environmental protection and radiochemistry; the chemistry of the fifth halogen, astatine. From the 28 contributions presented at the workshop, 24 are of relevance in the INIS and EDB scope and are separately retrievable from the database. (BBR) [de

  15. Development and therapeutic application of internally emitting radiopharmaceuticals

    International Nuclear Information System (INIS)

    Adelstein, S.J.; Bloomer, W.D.

    1980-01-01

    This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Among the available α-emitters, astatine-211 appears most promising for testing the efficacy of α-emitters for therapeutic applications because: (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides; (2) it has a half life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells; and (3) α-emission is associated with 100% of its decays. If appropriate biological carriers can be labeled with an alpha emitter such as 211 At, they could be of great utility in several areas of therapeutic medicine where elimination of specific cell populations is desired. While previous attempts to astatinate proteins using standard iodination techniques have been unsuccessful, effective labeling of proteins with astatine by first synthesizing an aryl astatide and then coupling this compound to the protein via an acylation has been achieved. Undergoing current investigation are several different aryl astatide-followed-by-acylation approaches including an astatinated Bolton-Hunter type reagent using concanavalin A (ConA) and melanocyte stimulating hormone (MSH) as model compounds

  16. $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with radioactive At beams

    CERN Multimedia

    We propose to study the $\\beta$-delayed fission, laser spectroscopy and radioactive decay of the newly available pure beams of neutron-deficient and neutron-rich astatine (Z=85) isotopes. The fission probability and the fission fragment distribution of the even-even isotopes $^{194,196}$Po following the $\\beta$-decay of the isotopes $^{194,196}$At will be studied with the Windmill setup. In-source laser spectroscopy will be performed on the entire astatine isotopic chain, using a combination of the Windmill setup, ISOLTRAP MR-ToF and ISOLDE Faraday. Radioactive decay data will be acquired at the Windmill setup throughout those studies and contribute to the global understanding of the phenomenon of shape coexistence in the neutron-deficient lead region.

  17. A simple method for labelling proteins with 211At via diazotized aromatic diamine

    International Nuclear Information System (INIS)

    Wunderlich, G.; Franke, W.-G.; Fischer, S.; Dreyer, R.

    1987-01-01

    A simple and rapid method for labelling proteins with 211 At by means of a 1,4-diaminobenzene link is described. This link is transformed into the diazonium salt and subsequently reactions of both 211 At and proteins with the diazonium salt take place simultaneously. For possibly high yields of astatized protein an appropriate temperature of 273 K was found. The results demonstrate the difference between the reaction mechanisms of iodine and astatine with proteins. (author)

  18. The Installation Restoration Program Toxicology Guide. Volume 2

    Science.gov (United States)

    1987-05-01

    Periodic Table: fluorine , chlorine, bromine, iodine, and astatine. Fluorine is the most active of all chemical elements. 5/87 LIST OF ABBREVIATIONS...fire- retardant varnishes and as an aminizing agent for cotton fabric (901). 37.2 ENVIRONMENTAL FATE A1D EXPOSURE PATHWAYS 37.2.1 Transport in Soil...subject to packaging and labeling regulations. Directive on Paints, Varnishes . Printing Inks. Adhesives and Similar Product; (1334) Pentachlorophenol

  19. SU-F-T-191: 4D Dose Reconstruction of Intensity Modulated Proton Therapy (IMPT) Based On Breathing Probability Density Function (PDF) From 4D Cone Beam Projection Images: A Study for Lung Treatment

    International Nuclear Information System (INIS)

    Zhou, J; Ding, X; Liang, J; Zhang, J; Wang, Y; Yan, D

    2016-01-01

    Purpose: With energy repainting in lung IMPT, the dose delivered is approximate to the convolution of dose in each phase with corresponding breathing PDF. This study is to compute breathing PDF weighted 4D dose in lung IMPT treatment and compare to its initial robust plan. Methods: Six lung patients were evaluated in this study. Amsterdam shroud image were generated from pre-treatment 4D cone-beam projections. Diaphragm motion curve was extract from the shroud image and the breathing PDF was generated. Each patient was planned to 60 Gy (12GyX5). In initial plans, ITV density on average CT was overridden with its maximum value for planning, using two IMPT beams with robust optimization (5mm uncertainty in patient position and 3.5% range uncertainty). The plan was applied to all 4D CT phases. The dose in each phase was deformed to a reference phase. 4D dose is reconstructed by summing all these doses based on corresponding weighting from the PDF. Plan parameters, including maximum dose (Dmax), ITV V100, homogeneity index (HI=D2/D98), R50 (50%IDL/ITV), and the lung-GTV’s V12.5 and V5 were compared between the reconstructed 4D dose to initial plans. Results: The Dmax is significantly less dose in the reconstructed 4D dose, 68.12±3.5Gy, vs. 70.1±4.3Gy in the initial plans (p=0.015). No significant difference is found for the ITV V100, HI, and R50, 92.2%±15.4% vs. 96.3%±2.5% (p=0.565), 1.033±0.016 vs. 1.038±0.017 (p=0.548), 19.2±12.1 vs. 18.1±11.6 (p=0.265), for the 4D dose and initial plans, respectively. The lung-GTV V12.5 and V5 are significantly high in the 4D dose, 13.9%±4.8% vs. 13.0%±4.6% (p=0.021) and 17.6%±5.4% vs. 16.9%±5.2% (p=0.011), respectively. Conclusion: 4D dose reconstruction based on phase PDF can be used to evaluate the dose received by the patient. A robust optimization based on the phase PDF may even further improve patient care.

  20. Catherine Halpern, Michèle Bitton, Lilith, l’épouse de Satan, Paris, Larousse, coll. « Dieux, Mythes et Héros », 2010, 191 p.

    Directory of Open Access Journals (Sweden)

    Guillaume Roucoux

    2011-10-01

    Full Text Available Lilith, l’épouse de Satan est la quatrième figure féminine à s’inscrire dans la collection de « Dieux, Mythes & Héros » qui ne cache pas « le caractère profondément masculin de la mythologique en général » (p. 167, pour mieux lui résister. Ce portrait en six chapitres, dressé par la journaliste Catherine Halpern et la sociologue Michèle Bitton à partir de textes théologiques judéo-chrétiens et d’analyses scientifiques, nous donne à voir une Lilith plurielle mais dont « la plus grande partie ...

  1. Estudo comparativo do desenvolvimento sensório-motor de recém-nascidos prematuros da unidade de terapia intensiva neonatal e do método canguru - doi:10.5020/18061230.2005.p191

    Directory of Open Access Journals (Sweden)

    Luciana Andrade da Mota

    2012-01-01

    Full Text Available O Método Canguru é uma alternativa ao método tradicional de assistência a bebês prematuros de baixo peso, que preconiza o contato pele a pele precoce, entre mãe e filho, 24 horas por dia, garantindo-lhes estímulos sensoriais e motores e maior participação dos pais no cuidado de seu bebê. A Unidade de Terapia Intensiva (UTI Neonatal é destinada ao tratamento de recém-nascidos prematuros com algum problema ao nascer. Objetivou-se comparar o desenvolvimento sensório-motor de recém-nascidos prematuros (RNPt da UTI Neonatal e do Método Canguru. Realizou-se um estudo comparativo, prospectivo e observacional, no Hospital Geral Dr. César Cals, em Fortaleza – CE, de agosto a outubro de 2004, com 14 RNPt, sendo 07 de cada grupo, com peso inferior a 2000g e idade gestacional entre 30 e 37 semanas. A avaliação foi semanal até a alta hospitalar ou até completarem a idade corrigida de 40 semanas, pelo método Dubowitz e Amiel-Tison, com análise de tônus muscular, respostas sensório-motoras, ganho de peso e tempo de internação. Como resultado, observou-se que os bebês do Método Canguru apresentaram melhores respostas sensório-motoras, comprovadas a partir da constatação de um menor grau de estresse, melhores respostas reflexas, movimentação espontânea e tônus muscular, e menor tempo de internação, permanecendo mais tempo em estado de alerta e interagindo bem com o ambiente e a mãe. Conclui-se que o Método Canguru mostrou-se uma alternativa mais eficaz de assistência a RNPt de baixo peso, pois proporcionou melhores resultados quanto às atividades sensório-motor dos bebês, se comparados à UTI Neonatal.

  2. Physical trajectory profile data from glider unit_191 deployed by University of Alaska - Fairbanks in the Southern Oceans from 2015-01-05 to 2015-02-26 (NCEI Accession 0145717)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The purpose of this glider mission is to do along canyon transects of Palmer Deep within the operating CODAR fields off of Anvers Island. This multi-platform field...

  3. Comment to “qS-waves in a vicinity of the axis of symmetry of homogeneous transversely isotropic media”, by M. Popov, G.F. Passos, and M.A. Botelho [Wave Motion 42 (2005) 191–201

    Czech Academy of Sciences Publication Activity Database

    Vavryčuk, Václav

    2006-01-01

    Roč. 44, č. 2 (2006), s. 128-136 ISSN 0165-2125 R&D Projects: GA AV ČR IAA3012309 Institutional research plan: CEZ:AV0Z30120515 Keywords : seismic waves * transversely isotropic media * ray theory Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 1.178, year: 2006

  4. A summary of the models used for the mechanical response of disposal rooms in the Waste Isolation Pilot Plant with regard to compliance with 40 CFR 191, Subpart B

    International Nuclear Information System (INIS)

    Butcher, B.M.; Mendenhall, F.T.

    1993-08-01

    A summary is presented of the results of a number of studies conducted prior to March 1992 that have led to a conceptual model describing how the porosity (and therefore the permeability) of waste and backfill in a Waste Isolation Pilot Plant disposal room changes with time and also describes how results from calculations involving mathematical models of these processes are used to provide input into performance assessment of the repository. Included in the report are descriptions of essential material response or constitutive models that include the influence of gas generation and the response of simple gas-pressurized cracks and fractures in salt, marker beds, and clay seams. Two-dimensional versus three-dimensional disposal room configurations and descriptions of the differences between numerical codes are also discussed. Calculational results using the mathematical models for disposal room response are described, beginning with closure of empty rooms and becoming progressively more complex. More recent results address some of the effects of gas generation in a room containing waste and backfill and intersected by a gas permeable marker bed. Developments currently in progress to improve the evaluation of the disposal room performance are addressing the coupling between brine flow and closure and the two-dimensional capability for analyzing a complete panel of rooms. Next, a method is described for including disposal room closure results into performance assessment analyses that determine if the repository is in compliance with regulatory standards. The coupling is accomplished using closure surfaces that describe the relationship among porosity, total amount of gas in the repository, and time. A number of conclusions about room response and recommendations for further work are included throughout the report

  5. From resource to valorisation: the long way of renewable energies - ADeus' Notes Nr 191. Renewable energies - To support sectors at the heart of energy transition - ADeus' Notes Nr 192. December 2015

    International Nuclear Information System (INIS)

    Pons, Anne; Gendron, Yves; Isenmann, Jean; Ruff, Valentine; Berlet, Jessica; Jeanniard, Myriam; Martin, Stephanie; Vigneron, Fabienne; Masse, Camille

    2015-12-01

    A first issue of this publication discusses the various technical, regulatory, economic or social barriers or brakes which may impede or slow down the development of renewable energies from a theoretical potential to an available one. It outlines that various planning tools are available to local communities to plan such a development, and to manage the valorisation of various resources, to choose the right equipment at the right place, and to manage social acceptance issues through a well planned process. It also discusses the relationship between resources and usages, and the need to integrate local renewable energies to their consumption locations. The second issue of this publication proposes an overview of the differences which can be noticed between local resources in terms of exploitation capacities. It outlines that the different renewable energy sectors display different levels of organisation, and that the diversification of firms, professions and training is still on its way. The next article highlights the promising context for costs and technologies: higher efficiencies, better distribution of installations, progressive reduction of cost differences between renewable energies on the one hand and fossil and nuclear energies on the other hand. Potential courses of action are discussed: a better readability of public supports, guaranteed supply and outputs, promotion of acceptability, support of new actor configurations and integration to the grid

  6. 2-(4-Methylphenyl-7-(2-methylpropoxy-4H-chromen-4-one–6-chloro-2-(4-methylphenyl-7-(2-methylpropoxy-4H-chromen-4-one (19/1

    Directory of Open Access Journals (Sweden)

    Vijay M. Barot

    2012-08-01

    Full Text Available The title co-crystal, 0.95C20H20O3·0.05C20H19ClO3, arises as the chloride carried over during the synthesis shares a position with an aromatic H atom; the partial occupancies are 0.947 (2 and 0.053 (2 for H and Cl, respectively. The molecular structure is stabilized by intramolecular C—H...O contacts, forming pseudo five- and six-membered rings with S(5 and S(6 graph-set motifs, respectively. The crystal structure features π–π stacking interactions between the centroids of the central fused ring systems [centroid–centroid distance = 3.501 (2 Å].

  7. Radiohalogenation of biomolecules. An experimental study on radiohalogen preparation, precursor synthesis, radiolabeling and biodistribution

    International Nuclear Information System (INIS)

    Koziorowski, J.

    1998-01-01

    Radiohalogens are widely used in nuclear medicine, both as tool for diagnostic in vivo imaging, and in radionuclide therapy. This study deals with the use of radiohalogens; separation, precursor synthesis, labeling and biological behavior. The focus is on 211 At and 124 I, the former being a candidate for nuclide therapy and the latter potentially useful for diagnostic imaging and Auger-electron based radiotherapy. For astatine the separation, labeling and some biological behavior is described, and for iodine the latter two. Astatine was separated from an irradiated bismuth target by dry distillation. A novel cryotrap was developed for the isolation of astatine and subsequent synthesis of radiolabeled compounds. 5-[ 211 At]astato-2'-deoxyuridine (AUdR) and N-succinimidyl-4-[ 211 At]astatobenzoate (SAB) were synthesized in 95% respectively 90% radiochemical yields. The former is incorporated into DNA of proliferating cells and can therefore be used as an endoradiotherapeutic agent. The latter is a conjugate for the astatination of proteins. Human epidermal growth factor (hEGF) was tagged with astatine using three approaches: a) direct labeling of native hEGF, b) conjugation with SAB, and c) direct labeling of an hEGF - 7-(3-aminopropyl)-7,8-dicarba-nido-undecaborate(1-) conjugate. The overall labeling yields were 3.5% for direct labeling, 44% for SAB and 70% for the hEGF-nido-carborane conjugate. A new route to N-succinimidyl 3- and 4- [ 124 I]iodobenzoate, two reagents for radioiodination of proteins is described affording 90% radiochemical yield. Three radioiodinated analogs of PK11195, 1-(2-chlorophenyl)-N-methyl-N-(1-methylpropyl)isoquinoline-3-carboxyam ide, a peripheral-type benzodiazepine receptor antagonist, were synthesized. All three analogs were obtained in >90% radiochemical yield. Synthesis and application of 5-[ 124 I]iodo-2'-deoxyuridine (IUdR) is presented. The closo-dodecaborate anion was evaluated as prosthetic group for radioiodination of

  8. Charge radii and electromagnetic moments of At-211195

    Science.gov (United States)

    Cubiss, J. G.; Barzakh, A. E.; Seliverstov, M. D.; Andreyev, A. N.; Andel, B.; Antalic, S.; Ascher, P.; Atanasov, D.; Beck, D.; Bieroń, J.; Blaum, K.; Borgmann, Ch.; Breitenfeldt, M.; Capponi, L.; Cocolios, T. E.; Day Goodacre, T.; Derkx, X.; De Witte, H.; Elseviers, J.; Fedorov, D. V.; Fedosseev, V. N.; Fritzsche, S.; Gaffney, L. P.; George, S.; Ghys, L.; Heßberger, F. P.; Huyse, M.; Imai, N.; Kalaninová, Z.; Kisler, D.; Köster, U.; Kowalska, M.; Kreim, S.; Lane, J. F. W.; Liberati, V.; Lunney, D.; Lynch, K. M.; Manea, V.; Marsh, B. A.; Mitsuoka, S.; Molkanov, P. L.; Nagame, Y.; Neidherr, D.; Nishio, K.; Ota, S.; Pauwels, D.; Popescu, L.; Radulov, D.; Rapisarda, E.; Revill, J. P.; Rosenbusch, M.; Rossel, R. E.; Rothe, S.; Sandhu, K.; Schweikhard, L.; Sels, S.; Truesdale, V. L.; Van Beveren, C.; Van den Bergh, P.; Wakabayashi, Y.; Van Duppen, P.; Wendt, K. D. A.; Wienholtz, F.; Whitmore, B. W.; Wilson, G. L.; Wolf, R. N.; Zuber, K.

    2018-05-01

    Hyperfine-structure parameters and isotope shifts of At-211195 have been measured for the first time at CERN-ISOLDE, using the in-source resonance-ionization spectroscopy method. The hyperfine structures of isotopes were recorded using a triad of experimental techniques for monitoring the photo-ion current. The Multi-Reflection Time-of-Flight Mass Spectrometer, in connection with a high-resolution electron multiplier, was used as an ion-counting setup for isotopes that either were affected by strong isobaric contamination or possessed a long half-life; the ISOLDE Faraday cups were used for cases with high-intensity beams; and the Windmill decay station was used for short-lived, predominantly α -decaying nuclei. The electromagnetic moments and changes in the mean-square charge radii of the astatine nuclei have been extracted from the measured hyperfine-structure constants and isotope shifts. This was only made possible by dedicated state-of-the-art large-scale atomic computations of the electronic factors and the specific mass shift of atomic transitions in astatine that are needed for these extractions. By comparison with systematics, it was possible to assess the reliability of the results of these calculations and their ascribed uncertainties. A strong deviation in the ground-state mean-square charge radii of the lightest astatine isotopes, from the trend of the (spherical) lead isotopes, is interpreted as the result of an onset of deformation. This behavior bears a resemblance to the deviation observed in the isotonic polonium isotopes. Cases for shape coexistence have been identified in At,199197, for which a significant difference in the charge radii for ground (9 /2- ) and isomeric (1 /2+ ) states has been observed.

  9. Human radiation studies: Remembering the early years: Oral history of Dr. Patricia Wallace Durbin, Ph.D., conducted November 11, 1994

    International Nuclear Information System (INIS)

    1995-07-01

    This report is a transcript of an interview of Dr. Patricia Wallace Durbin by representatives of the US DOE Office of Human Radiation Research. Dr. Durbin was selected for this interview because of her knowledge of the human plutonium injections and her recollections of key figures, especially Joseph Hamilton. After a brief biographical sketch Dr. Durbin discusses her loss of research funding from DOE, her recollections concerning research into strontium metabolism as part of Project Sunshine, her recollections relating to the rationale for studies of human metabolism of radionuclides, her remembrances of Dr. Hamilton's Astatine and Plutonium research, and her experiences in gathering archival records concerning these researches

  10. Retention Initiatives are Employed in Academic Libraries, Although not Necessarily for this Purpose. A Review of: Strothmann, M., & Ohler, L. A. (2011. Retaining academic librarians: By chance or by design? Library Management, 32(3, 191-208. doi: 10.1108/01435121111112907

    Directory of Open Access Journals (Sweden)

    Laura Newton Miller

    2011-09-01

    Full Text Available Objective – To study methods that support retention of academic librarians.Design – Exploratory research using an online survey; non-random sample.Setting – Academic libraries, nearly all located within the U.S. (97.2%. Subjects – A total of 895 professional academic librarians.Methods – The researchers sent an online survey link to professional electronic mail lists and directly to heads of Association of Research Libraries (ARL member libraries. The 23-item survey was available from February 19, 2007, through March 9, 2007, and contained questions about the professional experience of respondents, their libraries, and their universities. Subjects were asked to identify retention activities that were currently offered at their workplaces (both library-specific and university-wide and to rate their satisfaction for each available initiative. The list contained fifteen initiatives based on the researchers’ literature review.Main Results – Almost half (46.3% of respondents were 50 or older and 7.5% under 30 years old, leaving 46.2% between the ages of 30-50 years old (although this percentage is not explicitly stated in the paper except in a table. Nearly half of the subjects were in the first ten years of their careers. 80.2% had held between one and four professional positions in their careers, and even when length of professional experience was factored out, age had no effect on the number of positions held. Most job turnover within the past three years (3 or fewer open positions was in public service, while other areas of the library (i.e., technical services, systems, and administration reported zero open positions. Only 11.3% of respondents noted that their libraries have deliberate, formal retention programs in place. Despite this, there are several library- and university-based initiatives that can be considered to help with retention. The most reported available library-based retention initiative was the provision of funding to attend conferences (86.8%. Librarians also frequently reported flexible schedules, support and funding for professional development and access to leadership programs. University-based retention programs included continuing education funding, new employee orientations, faculty status, and the chance to teach credit-bearing courses. Only 22.2% of subjects reported formal mentoring programs as a retention strategy. Librarians were very or somewhat satisfied with schedule flexibility (79.6%. They were generally satisfied with other initiatives reported. In response to 22 five-point Likert scale descriptions of positive library work environments, subjects most agreed with statements that allowed librarians to have control of their professional duties, that allowed for personal or family obligations, and that supported professional development. Librarians agreed less often regarding statements about salaries, research support, and opportunities for advancement.Conclusion – Academic librarians are involved in and are benefitting from some library and university-based retention initiatives, even though retention may not be the primary strategic goal.

  11. Germán Giraldo. Canje para la paz. Intercambio de prisioneros de guerra en los conflictos de Colombia y Centroamérica ¿Qué lecciones nos dejan?. Bogotá: Editorial Universidad Autónoma de Colombia, 2014. 191 páginas

    Directory of Open Access Journals (Sweden)

    Juan Manuel Martínez Fonseca

    2015-07-01

    Full Text Available El libro del historiador Germán Giraldo, dedicado al tema del canje, se suma a una nueva oleada de análisis, inscrita en el contexto marcado por los diálogos paz, en La Habana, entre delegados del Gobierno y las Fuerzas Armadas de Colombia —FARC—. Aparte de la vigencia y pertinencia de la problemática abordada, se resalta el esfuerzo del autor por mantenerse en su objeto de estudio, pues dada la amplitud de la cuestión, perfectamente pudo haber terminado dando cuenta de otros procesos como la historia de las guerrillas o los diálogos de paz. Si bien el canje y las negociaciones con la insurgencia y, específicamente, con las FARC no cuentan con un buen recuerdo en el colectivo, es interesante la manera como en esta obra se busca superar el énfasis en el análisis de carácter coyuntural y local para dar paso al planteamiento de una investigación de largo alcance, que subraye la importancia de ver el intercambio de prisioneros, con un enfoque estructural y que incorpore la historia comparada.

  12. Germán Giraldo. Canje para la paz. Intercambio de prisioneros de guerra en los conflictos de Colombia y Centroamérica ¿Qué lecciones nos dejan?. Bogotá: Editorial Universidad Autónoma de Colombia, 2014. 191 páginas

    OpenAIRE

    Juan Manuel Martínez Fonseca

    2015-01-01

    El libro del historiador Germán Giraldo, dedicado al tema del canje, se suma a una nueva oleada de análisis, inscrita en el contexto marcado por los diálogos paz, en La Habana, entre delegados del Gobierno y las Fuerzas Armadas de Colombia —FARC—. Aparte de la vigencia y pertinencia de la problemática abordada, se resalta el esfuerzo del autor por mantenerse en su objeto de estudio, pues dada la amplitud de la cuestión, perfectamente pudo haber terminado dando cuenta de otros procesos como la...

  13. Ruminal bacterial community changes during adaptation of goats to fresh alfalfa forage

    Czech Academy of Sciences Publication Activity Database

    Grilli, D. J.; Mrázek, Jakub; Fliegerová, Kateřina; Kopečný, Jan; Lama, S. P.; Cucchi, M. E. C.; Sosa, M. A.; Arenas, G. N.

    2016-01-01

    Roč. 191, č. 2 (2016), s. 191-195 ISSN 1871-1413 Institutional support: RVO:67985904 Keywords : bacteria * creole goats * QPCR Subject RIV: EE - Microbiology, Virology Impact factor: 1.377, year: 2016

  14. DMPD: Heterogeneity of TLR-induced responses in dendritic cells: from innate toadaptive immunity. [Dynamic Macrophage Pathway CSML Database

    Lifescience Database Archive (English)

    Full Text Available daptive immunity. Re F, Strominger JL. Immunobiology. 2004;209(1-2):191-8. (.png) (.svg) (.html) (.csml) Sho...toadaptive immunity. Authors Re F, Strominger JL. Publication Immunobiology. 2004;209(1-2):191-8. Pathway -

  15. ORF Alignment: NC_004663 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... [Bacteroides thetaiotaomicron VPI-5482] ... Length = 48 ... Query: 191 TSECIGCKRCEKSCPVGNITM...KERRPVWGKNCTACLACYHVCPQHAVQ 238 ... TSECIGCKRCEKSCPVGNITMKERRPVWGKNCTACLACYHVCPQHAVQ Sbjct: 1 ... TSECIGCKRCEKSCPVGNITMKERRPVWGKNCTACLACYHVCPQHAVQ 48

  16. EST Table: FS731731 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS731731 E_FL_bmmt_24I23_F_0 10/09/28 44 %/191 aa ref|XP_001869607.1| monocarboxyla...10/09/03 39 %/191 aa FBpp0160203|DmojGI10986-PA 10/08/28 low homology 10/09/10 44 %/191 aa AGAP002587-PA Pro

  17. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC191 (Link to dictyBase) - - - Contig-U16281-1 VFC191F (Link... to Original site) VFC191F 350 - - - - - - Show VFC191 Library VF (Link to library) Clone ID VFC191 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16281-1 Original site URL http://dict...ts) Value N AC116305 |AC116305.2 Dictyostelium discoideum chromosome 2 map 1005175-1418323 strain AX4, compl... 186 3e-46 AC116305_8( AC116305 |pid:none) Dictyostelium discoideum chromosom...

  18. Glomerular filtration rate after alpha-radioimmunotherapy with 211At-MX35-F(ab')2: a long-term study of renal function in nude mice

    DEFF Research Database (Denmark)

    Back, T.; Haraldsson, B.; Hultborn, R

    2009-01-01

    of the glomerular filtration rate (GFR). The renal toxicity was evaluated at levels close to the dose limit for the bone marrow and well within the range for therapeutic efficacy on tumors. Astatinated MX35-F(ab')(2) monoclonal antibodies were administered intravenously to nude mice. Both non-tumor-bearing animals...... manifested late. Examination of the kidney sections showed histologic changes that were overall subdued. Following alpha-RIT with (211)At-MX35-F(ab')(2) at levels close to the dose limit of severe myelotoxicity, the effects found on renal function were relatively small, with only minor to moderate reductions...... in GFR. These results suggest that a mean absorbed dose to the kidneys of approximately 10 Gy is acceptable, and that the kidneys would not be the primary dose-limiting organ in systemic alpha-RIT when using (211)At-MX35-F(ab')(2) Udgivelsesdato: 2009/12...

  19. New developments of the in-source spectroscopy method at RILIS/ISOLDE

    CERN Document Server

    Marsh, B A; Imai, N; Seliverstov, M D; Rothe, S; Sels, S; Capponi, L; Rossel, R E; Franchoo, S; Wendt, K; Focker, G J; Kalaninova, Z; Sjoedin, A M; Popescu, L; Nicol, T; Huyse, M; Radulov, D; Atanasov, D; Kesteloot, N; Borgmann, Ch; Cocolios, T E; Lecesne, N; Ghys, L; Pauwels, D; Rapisarda, E; Kreim, S; Liberati, V; Wolf, R N; Andel, B; Schweikhard, L; Lane, J; Derkx, X; Kudryavtsev, Yu; Zemlyanoy, S G; Fedosseev, V N; Lynch, K M; Rosenbusch, M; Van Duppen, P; Lunney, D; Manea, V; Barzakh, A E; Andreyev, A N; Truesdale, V; Flanagan, K T; Molkanov, P L; Koester, U; Van Beveren, C; Wienholtz, F; Goodacre, T Day; Antalic, S; Bastin, B; De Witte, H; Fink, D A; Fedorov, D V

    2013-01-01

    At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar fr...

  20. Chemical concentration of a new natural spontaneously fissionable nuclide from solutions with low salt background

    International Nuclear Information System (INIS)

    Korotkin, Yu.S.; Ter-Akop'yan, G.M.; Popeko, A.G.; Drobina, T.P.; Zhuravleva, E.L.

    1982-01-01

    The results of experiments on further concentration of a new natural spontaneously fissionable nuclide, the concentrates of which form the Cheleken geothermal brines have been obtained, are presented. The conclusions are drown about the chemical nature of a new spontaneously fissionable nuclide. It is a chalcophile element which copreipitates with sulphides of copper, lead, arsenic and mercury from weakly acid solutions. The behaviour of the new nuclide in sulphide systems in many respects is similar to the behaviour of polonium, astatine and probably of bismuth. The most probable stable valence of the new nuclide varies from +1 up to +3. The data available on the chemical behaviour of the new nuclide as well as the analysis over contamination by spontaneously fissionable isotopes permit to state that the new natural spontaneously fissionable nuclide does not relate to the known isotopes

  1. Is Electronegativity a Useful Descriptor for the 'Pseudo-Alkali-Metal' NH4?

    International Nuclear Information System (INIS)

    Whiteside, Alexander; Xantheas, Sotiris S.; Gutowski, Maciej S.

    2011-01-01

    Molecular ions in the form of 'pseudo-atoms' are common structural motifs in chemistry, with properties that are transferrable between different compounds. We have determined the electronegativity of the 'pseudo-alkali metal' ammonium (NH4) and evaluated its reliability as a descriptor in comparison to the electronegativities of the alkali metals. The computed properties of its binary complexes with astatine and of selected borohydrides confirm the similarity of NH4 to the alkali metal atoms, although the electronegativity of NH4 is relatively large in comparison to its cationic radius. We paid particular attention to the molecular properties of ammonium (angular anisotropy, geometric relaxation, and reactivity), which can cause deviations from the behaviour expected of a conceptual 'true alkali metal' with this electronegativity. These deviations allow for the discrimination of effects associated with the polyatomic nature of NH4.

  2. Boiling points of the superheavy elements 117 and 118

    International Nuclear Information System (INIS)

    Takahashi, N.

    2001-01-01

    It has been shown that the relativistic effect on the electrons reveal in the heavy element region. What kind of changes will appear in the heavy elements because of the relativistic effects? Can we observe the changes? We observed that the boiling points of astatine and radon are lower than that extrapolated values from lighter elements in the same groups. Systematic behavior of the elements on the boiling point was examined and a new method for the estimation of the boiling points of the superheavy elements in the halogen and rare gases has been found. The estimated values of the elements 117 and 118 are 618 and 247 K, respectively which are considerably lower than those obtained until now. If these values are correct the production of the superheavy elements with heavy ions reaction may be affected. Further, the chemical properties may be fairly different from the lighter elements. (author)

  3. Alpha particle induced DNA damage and repair in normal cultured thyrocytes of different proliferation status

    DEFF Research Database (Denmark)

    Lyckesvärd, Madeleine Nordén; Delle, Ulla; Kahu, Helena

    2014-01-01

    Childhood exposure to ionizing radiation increases the risk of developing thyroid cancer later in life and this is suggested to be due to higher proliferation of the young thyroid. The interest of using high-LET alpha particles from Astatine-211 ((211)At), concentrated in the thyroid by the same...... mechanism as (131)I [1], in cancer treatment has increased during recent years because of its high efficiency in inducing biological damage and beneficial dose distribution when compared to low-LET radiation. Most knowledge of the DNA damage response in thyroid is from studies using low-LET irradiation...... and much less is known of high-LET irradiation. In this paper we investigated the DNA damage response and biological consequences to photons from Cobolt-60 ((60)Co) and alpha particles from (211)At in normal primary thyrocytes of different cell cycle status. For both radiation qualities the intensity...

  4. Bibliography of Books and Published Reports on Gas Turbines, Jet Propulsion, and Rocket Power Plants, January 1950 through December 1953

    Science.gov (United States)

    1953-12-01

    75. Aeronautics In 1950. Engineer 191,67 and 100. Critical review of gas turbine progress in 1950. Engineer 191, 50. Gas turbines in 1950. Engineer 191...1952) ; Trans. ASME 75,121. A critical review of gas turbine progress, 1952. Engineer 195, 124. Aeronautics in 1952. Engineer 195, 24, 55 and 91...Physical fundamentals of jet propulsion. Forsch. Gebiete Ingenieurw. B19, Forschungaheft 437, p 5. 0. Santangelo, Metodo di calcolo delle

  5. Diagnosis of gastroesophageal reflux in adult patients by radiology and isotope-imaging techniques

    International Nuclear Information System (INIS)

    Trigo, J.E.; Gutierrez Amares, M.T.; Bascuas, A.; Bueno Becerra, A.; Sousa, R.; Conde, M.A.; Bascuas, J.L.

    1987-01-01

    A comparative radiological and nuclear medicine in 191 adult patients, with a clinical diagnosis of gastroesophageal reflex, emphatizing the radiological role in diagnosis of gastroesophageal reflex. (author)

  6. ORF Alignment: NC_005363 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... [Bdellovibrio bacteriovorus HD100] ... Length = 112 ... Query: 191 SERAHVTXXXXXXXXGKNSEAETAYQSILAR...WPQSLAAYVGLGNIHYSRKQYSLAINNLQ 250 ... SERAHVT ... GKNSEAETAYQSILARWP...QSLAAYVGLGNIHYSRKQYSLAINNLQ Sbjct: 1 ... SERAHVTAAAALEALGKNSEAETAYQSILARWPQSLAAYVGLGNIHYSRKQYSLAINNLQ 60 ...

  7. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 22; Issue 3. Issue front cover thumbnail Issue back cover thumbnail. Volume 22, Issue 3. March 2017, pages 191-333. pp 191-192 Editorial. Editorial · More Details Abstract Fulltext PDF. pp 193-197 Article-in-a-Box. Lise Meitner (1878–1968): A Physicist ...

  8. Integrated Detection of Pathogens and Host Biomarkers for Wounds

    Science.gov (United States)

    2012-04-01

    None None TN631B Enterococcus faecium None ZB191B Enterobacter cloacae Acinetobacter baumannii Enterobacter cloacae plasmid pEC01 These initial...Streptomyces roseosporus HERV K113 ZB191B Enterobacter cloacae Enterobacter cloacae plasmid pEC01 Escherichia coli plasmid pIGRW12 Plasmid

  9. NCBI nr-aa BLAST: CBRC-MLUC-01-0516 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0516 ref|YP_001875573.1| hypothetical protein Emin_0681 [Elusimicrobium... minutum Pei191] gb|ACC98236.1| hypothetical protein Emin_0681 [Elusimicrobium minutum Pei191] YP_001875573.1 1e-08 21% ...

  10. NCBI nr-aa BLAST: CBRC-TTRU-01-1329 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-1329 ref|YP_001876264.1| cell cycle protein [Elusimicrobium minutum Pe...i191] gb|ACC98927.1| cell cycle protein [Elusimicrobium minutum Pei191] YP_001876264.1 0.004 25% ...

  11. NCBI nr-aa BLAST: CBRC-MLUC-01-0516 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0516 ref|YP_001875427.1| hypothetical protein Emin_0535 [Elusimicrobium... minutum Pei191] gb|ACC98090.1| hypothetical protein Emin_0535 [Elusimicrobium minutum Pei191] YP_001875427.1 6e-07 22% ...

  12. NCBI nr-aa BLAST: CBRC-TTRU-01-1038 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-1038 ref|YP_001876264.1| cell cycle protein [Elusimicrobium minutum Pe...i191] gb|ACC98927.1| cell cycle protein [Elusimicrobium minutum Pei191] YP_001876264.1 0.009 22% ...

  13. NCBI nr-aa BLAST: CBRC-MLUC-01-0516 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0516 ref|YP_001875823.1| hypothetical protein Emin_0933 [Elusimicrobium... minutum Pei191] gb|ACC98486.1| hypothetical protein Emin_0933 [Elusimicrobium minutum Pei191] YP_001875823.1 5e-11 24% ...

  14. 76 FR 72124 - Internet-Based Telecommunications Relay Service Numbering

    Science.gov (United States)

    2011-11-22

    ... Docket No. 10-191; FCC 11-123] Internet-Based Telecommunications Relay Service Numbering AGENCY: Federal..., the information collection associated with the Commission's Internet- Based Telecommunications Relay... Telecommunications Relay Service Numbering, CG Docket No. 03-123; WC Docket No. 05-196; WC Docket No. 10-191; FCC 11...

  15. 7 CFR 247.29 - Reports and recordkeeping.

    Science.gov (United States)

    2010-01-01

    .... All records must be available during normal business hours for use in management reviews, audits... obligated, and the amount remaining unobligated. (3) FNS-191, Racial/Ethnic Group Participation. Local agencies must submit a report of racial/ethnic participation each year, using the FNS-191. (c) Is there any...

  16. Seven years of radionuclide laboratory at IMC – important achievements

    Czech Academy of Sciences Publication Activity Database

    Hrubý, Martin; Kučka, Jan; Pánek, Jiří; Štěpánek, Petr

    2016-01-01

    Roč. 65, Suppl. 2 (2016), S191-S201 ISSN 0862-8408 R&D Projects: GA MŠk(CZ) LO1507 Institutional support: RVO:61389013 Keywords : radionuclide * radiopharmaceutical * polymer Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.461, year: 2016 http://www.biomed.cas.cz/physiolres/pdf/65%20Suppl%202/65_S191.pdf

  17. Nucleotide binding to Na+/K+-ATPase

    Czech Academy of Sciences Publication Activity Database

    Kubala, Martin; Lánský, Zdeněk; Ettrich, R.; Plášek, J.; Teisinger, Jan; Amler, Evžen

    2005-01-01

    Roč. 272, č. S1 (2005), s. 191-191 E-ISSN 1742-4658. [FEBS Congress /30./ and IUBMB Conference /9./. 02.07.2005-07.07.2005, Budapest] Keywords : Na+/K+- ATPase * ATP binding * TNP-ATP Subject RIV: BO - Biophysics

  18. Quartz and feldspar distribution in continental shelf sediments of east coast of India

    Digital Repository Service at National Institute of Oceanography (India)

    Rao, V.P.; VijayKumar, B

    stream_size 5 stream_content_type text/plain stream_name Indian_J_Mar_Sci_19_191.pdf.txt stream_source_info Indian_J_Mar_Sci_19_191.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  19. On the theory of time dilation in chemical kinetics

    Science.gov (United States)

    Baig, Mirza Wasif

    2017-10-01

    The rates of chemical reactions are not absolute but their magnitude depends upon the relative speeds of the moving observers. This has been proved by unifying basic theories of chemical kinetics, which are transition state theory, collision theory, RRKM and Marcus theory, with the special theory of relativity. Boltzmann constant and energy spacing between permitted quantum levels of molecules are quantum mechanically proved to be Lorentz variant. The relativistic statistical thermodynamics has been developed to explain quasi-equilibrium existing between reactants and activated complex. The newly formulated Lorentz transformation of the rate constant from Arrhenius equation, of the collision frequency and of the Eyring and Marcus equations renders the rate of reaction to be Lorentz variant. For a moving observer moving at fractions of the speed of light along the reaction coordinate, the transition state possess less kinetic energy to sweep translation over it. This results in the slower transformation of reactants into products and in a stretched time frame for the chemical reaction to complete. Lorentz transformation of the half-life equation explains time dilation of the half-life period of chemical reactions and proves special theory of relativity and presents theory in accord with each other. To demonstrate the effectiveness of the present theory, the enzymatic reaction of methylamine dehydrogenase and radioactive disintegration of Astatine into Bismuth are considered as numerical examples.

  20. Effect of cetuximab in combination with alpha-radioimmunotherapy in cultured squamous cell carcinomas

    Energy Technology Data Exchange (ETDEWEB)

    Nestor, Marika, E-mail: marika.nestor@bms.uu.s [Unit of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Unit of Biomedical Radiation Sciences, Department of Oncology, Radiology and Clinical Immunology, Uppsala University, S-751 85 Uppsala (Sweden); Sundstroem, Magnus [Unit of Molecular Pathology, Department of Genetics and Pathology, Uppsala University (Sweden); Anniko, Matti [Unit of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Tolmachev, Vladimir [Unit of Biomedical Radiation Sciences, Department of Oncology, Radiology and Clinical Immunology, Uppsala University, S-751 85 Uppsala (Sweden)

    2011-01-15

    Aim: The monoclonal antibody cetuximab, targeting the epidermal growth factor receptor (EGFR), is a promising molecular targeting agent to be used in combination with radiation for anticancer therapy. In this study, effects of cetuximab in combination with alpha-emitting radioimmunotherapy (RIT) in a panel of cultured human squamous cell carcinomas (SCCs) were assessed. Methods: SCC cell lines were characterized and treated with cetuximab in combination with anti-CD44v6 RIT using the astatinated chimeric monoclonal antibody U36 ({sup 211}At-cMAb U36). Effects on {sup 211}At-cMAb U36 uptake, internalization and cell proliferation were then assessed in SCC cells. Results: Cetuximab in combination with {sup 211}At-cMAb U36 mediated increased growth inhibition compared to RIT or cetuximab alone in two cell lines. However, cetuximab also mediated radioprotective effects compared to RIT alone in two cell lines. The radioprotective effects occurred in the cell lines in which cetuximab clearly inhibited cell growth during radiation exposure. Cetuximab treatment also influenced {sup 211}At-cMAb-U36 uptake and internalization, suggesting interactions between CD44v6 and EGFR. Conclusions: Results from this study demonstrate the vast importance of further clarifying the mechanisms of cetuximab and radiation response, and the relationship between EGFR and suitable RIT targets. This is important not only in order to avoid potential radioprotective effects, but also in order to find and utilize potential synergistic effects from these combinations.

  1. Study of Neutron-Deficient $^{202-205}$Fr Isotopes with Collinear Resonance Ionization Spectroscopy

    CERN Document Server

    De Schepper, Stijn; Cocolios, Thomas; Budincevic, Ivan

    The scope of this master’s thesis is the study of neutron-deficient $^{202−205}$Fr isotopes. These isotopes are inside the neutron-deficient lead region, a region that has shown evidence of shape coexistence. For this thesis, this discussion is limited to the phenomenon where a low lying excited state has a different shape than the ground state. Shape coexistence is caused by intruder states. These are single-particle Shell Model states that are perturbed in energy due to the interaction with a deformed core. In the neutron-deficient lead region the main proton intruder orbit is the 3s$_{1/2}$orbit. When going towards more neutron-deficient isotopes, deformation increases. The $\\pi3s_{1/2}$orbit will rise in energy and will eventually become the ground state in odd- A bismuth (Z=83) isotopes. It is also observed in odd-A astatine (Z=85) isotopes, already in less neutron-deficient nuclei. The same phenomenon is expected to be present francium (Z=87) isotopes already at $^{199}$Fr. Although it is currently ...

  2. Development and radiotherapeutic application of 211At-labeled radiopharmaceuticals. Progress report, March 1, 1981-February 28, 1982

    International Nuclear Information System (INIS)

    Adelstein, S.J.; Zalutsky, M.; Bloomer, W.

    1981-01-01

    This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Alpha-emitters seem ideally suited for his application because their high linear energy transfer and short range permit the deposition of considerable energy in a very small volume of tissue. Unlike the beta particles of 131 I which have a range of about 1 to 2 mm in tissue, 5 to 7 MeV alpha particles would traverse only a few cell diameters. Among the available alpha-emitters, 211 At appears most promising for therapeutic applications because, (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides, (2) it has a half-life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells due to degradation of the label over time, (3) it can be produced conveniently using a cyclotron, and (4) alpha emission is associated with 100% of its decays with no accompanying beta emission. In the past year the evaluation of an astatine-tellurium colloid as an agent for the destruction of malignant ascites has been completed. The therapeutic efficacy of 211 At-tellurium colloid has been compared with that of several beta-emitting radiocolloids. Studies on the application of monoclonal antibodies as carriers for selective delineation and destruction of malignant cell populations have also been initiated

  3. Development and radiotherapeutic application of /sup 211/At-labeled radiopharmaceuticals. Progress report, March 1, 1981-February 28, 1982

    Energy Technology Data Exchange (ETDEWEB)

    Adelstein, S.J.; Zalutsky, M.; Bloomer, W.

    1981-01-01

    This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Alpha-emitters seem ideally suited for his application because their high linear energy transfer and short range permit the deposition of considerable energy in a very small volume of tissue. Unlike the beta particles of /sup 131/I which have a range of about 1 to 2 mm in tissue, 5 to 7 MeV alpha particles would traverse only a few cell diameters. Among the available alpha-emitters, /sup 211/At appears most promising for therapeutic applications because, (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides, (2) it has a half-life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells due to degradation of the label over time, (3) it can be produced conveniently using a cyclotron, and (4) alpha emission is associated with 100% of its decays with no accompanying beta emission. In the past year the evaluation of an astatine-tellurium colloid as an agent for the destruction of malignant ascites has been completed. The therapeutic efficacy of /sup 211/At-tellurium colloid has been compared with that of several beta-emitting radiocolloids. Studies on the application of monoclonal antibodies as carriers for selective delineation and destruction of malignant cell populations have also been initiated.

  4. Alpha particle emitters in medicine

    International Nuclear Information System (INIS)

    Fisher, D.R.

    1989-09-01

    Radiation-induced cancer of bone, liver and lung has been a prominent harmful side-effect of medical applications of alpha emitters. In recent years, however, the potential use of antibodies labeled with alpha emitting radionuclides against cancer has seemed promising because alpha particles are highly effective in cell killing. High dose rates at high LET, effectiveness under hypoxic conditions, and minimal expectancy of repair are additional advantages of alpha emitters over antibodies labeled with beta emitting radionuclides for cancer therapy. Cyclotron-produced astatine-211 ( 211 At) and natural bismuth-212 ( 212 Bi) have been proposed and are under extensive study in the United States and Europe. Radium-223 ( 223 Ra) also has favorable properties as a potential alpha emitting label, including a short-lived daughter chain with four alpha emissions. The radiation dosimetry of internal alpha emitters is complex due to nonuniformly distributed sources, short particle tracks, and high relative specific ionization. The variations in dose at the cellular level may be extreme. Alpha-particle radiation dosimetry, therefore, must involve analysis of statistical energy deposition probabilities for cellular level targets. It must also account fully for nonuniform distributions of sources in tissues, source-target geometries, and particle-track physics. 18 refs., 4 figs

  5. Studies of Stable Octupole Deformations in the Radium Region

    CERN Multimedia

    2002-01-01

    The purpose of the present project is to locate and identify states in the atomic nuclei possessing stable pearshaped octupole deformation. Such states, formally related to the structures known in molecular physics, manifest themselves as families of parity doublets in odd nuclei.\\\\ \\\\ The best possibilities for observing stable octupole deformations are offered in the Ra-region. Both theoretical calculations and experimental indications support such expectations. Such indications are the non-observation of two-phonon octupole vibrational states in the ISOLDE studies of the even-even radium nuclei, and the reversed sign of the decoupling factor of the ground state band in |2|2|5Ra observed in the single-neutron transfer reactions. In order to establish the predicted strong E1 and E3-transitions between the parity doublets in odd nuclei with stable octupole deformations it is proposed to study conversion electrons in odd-mass francium radium and radon isotopes following the @b-decay of francium and astatine. \\...

  6. The radiolabeled monoclonal antibodies in immunoscintigraphy and radioimmunotherapy: current state and perspectives

    International Nuclear Information System (INIS)

    Chatal, J. F.

    2000-01-01

    The antibodies can be satisfactorily labelled with technitium-99 m or indium-111 for tumor immunoscintigraphy. The immunoscintigraphy is not useful for the primary tumor diagnosis. It can be useful for the diagnosis of the some cancer extension and for recurrent tumor visualization. The immunoscintigraphy is widely competed with Positron Emission Tomography (PET) which gives accurate results. In the future the immunoscintigraphy, in pre-therapeutic stage, contribute to the estimation of the dose delivered to the tumor and to normal organs for adopting or not a radioimmunotherapy. The antibodies can also be labeled with Iodine-131 for an application in radioimmunotherapy (RIT). The RIT is efficient in the non-Hodgkin's lymphoma treatment because of their great radiosensitivity. Until now the results have been very modest in solid tumor treatment but methodological and biotechnological progresses have to improve the efficiency especially for the small tumors. In the future iodine-131 which requires the confinement (very expensive) of patients will be substituted by yttrium-90 beta emitter, more energetic than iodine-131 and can be injected in walking case. In the long term, the alpha emitter radionuclides (astatine-211 or bismuth-213) can be used for hematologic cancer treatment. In conclusion the future of radiolabeled monoclonal antibodies is essentially therapeutic. The radioimmunotherapy associated to the chemotherapy give promising perspectives for the radiosensitive cancer treatment and in general small solid tumor treatment (F.M.)

  7. Nuclear and chemical data for life sciences

    International Nuclear Information System (INIS)

    Moumita Maiti; Indian Institute of Technology Roorkee, Roorkee, Uttarakhand

    2013-01-01

    Use of reactor produced radionuclides is popular in life sciences. However, cyclotron production of proton rich radionuclides are being more focused in recent times. These radionuclides have already gained attention in various fields, including life sciences, provided they are obtained in pure form. This article is a representative brief of our contributions in generating nuclear data for the production of proton rich radionuclides of terbium, astatine, technetium, ruthenium, cadmium, niobium, zirconium, rhenium, etc., which may have application in clinical, biological, agriculture studies or in basic research. The chemical data required to separate the product isotopes from the corresponding target matrix have been presented along with a few propositions of radiopharmaceuticals. It also emphasizes on the development of simple empirical technique, based on the nuclear reaction model analysis, to generate reliable nuclear data for the estimation of yield and angular distribution of emitted neutrons and light charged particles from light as well as heavy ion induced reactions on thick stopping targets. These data bear utmost important in radiation dosimetry. (author)

  8. Radiobromination of humanized anti-HER2 monoclonal antibody trastuzumab using N-succinimidyl 5-bromo-3-pyridinecarboxylate, a potential label for immunoPET

    Energy Technology Data Exchange (ETDEWEB)

    Mume, Eskender [Organic Chemistry, Department of Chemistry, Uppsala University, S-751 24 Uppsala (Sweden); Orlova, Anna [Affibody AB, S-161 02 Bromma (Sweden); Malmstroem, Per-Uno [Division of Urology, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Lundqvist, Hans [Unit of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala University, S-751 85 Uppsala (Sweden); Sjoeberg, Stefan [Organic Chemistry, Department of Chemistry, Uppsala University, S-751 24 Uppsala (Sweden); Tolmachev, Vladimir [Unit of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala University, S-751 85 Uppsala (Sweden)]. E-mail: vladimir.tolmachev@bms.uu.se

    2005-08-01

    Combining the specificity of radioimmunoscintigraphy and the high sensitivity of PET in an in vivo detection technique could improve the quality of nuclear diagnostics. Positron-emitting nuclide {sup 76}Br (T {sub 1/2}=16.2 h) might be a possible candidate for labeling monoclonal antibodies (mAbs) and their fragments, provided that the appropriate labeling chemistry has been established. For internalizing antibodies, such as the humanized anti-HER2 monoclonal antibody, trastuzumab, radiobromine label should be residualizing, i.e., ensuring that radiocatabolites are trapped intracellularly after the proteolytic degradation of antibody. This study evaluated the chemistry of indirect radiobromination of trastuzumab using N-succinimidyl 5-(tributylstannyl)-3-pyridinecarboxylate. Literature data indicated that the use of this method provided residualizing properties for iodine and astatine labels on some antibodies. An optimized 'one-pot' procedure produced an overall labeling efficiency of 45.5{+-}1.2% over 15 min. The bromine label was stable under physiological and denaturing conditions. The labeled trastuzumab retained its capacity to bind specifically to HER2-expressing SKOV-3 ovarian carcinoma cells in vitro (immunoreactivity more than 75%). However, in vitro cell test did not demonstrate that the radiobromination of trastuzumab using N-succinimidyl 5-bromo-3-pyridinecarboxylate improves cellular retention of radioactivity in comparison with the use of N-succinimidyl 4-bromobenzoate.

  9. The in vivo fate of a 211At labelled monoclonal antibody with known specificity in a murine system

    International Nuclear Information System (INIS)

    Vaughan, A.T.M.; Bateman, W.J.; Fisher, D.R.

    1982-01-01

    A monoclonal antibody reactive against the human transferrin receptor has been labelled with the alpha and X ray emitting isotope Astatine 211. The labelling procedure does not affect the ability of the product to bind to the transferrin receptor on the human leukemic cell line HL60. Using a direct binding assay, 211 At labelled antibody can be specifically inhibited from binding to its target cells by excess unlabelled antibody. Furthermore, the binding inhibition demonstrated in this system correlates to enhanced clonogenic survival of these cells, indicating that very few atoms of 211 At/cell are required for cell death. Data obtained from labelled antibody injected into mice show that the labelled product in serum retains the ability to bind to HL60 cells in vitro, although tissue distributions of the injected activity implies that some of the radiolabel is lost from the protein. Despite this loss of label, preliminary experiments on the localization of labelled antibody to HL60 cells growing s/c in nude mice show that tumor tissue has a higher specific activity than all other tissues, other than blood, after 12 hours. This suggests that further work on the nature of label degradation in vivo is warranted in the context of potential therapeutic and diagnostic studies

  10. Effect of cetuximab in combination with alpha-radioimmunotherapy in cultured squamous cell carcinomas

    International Nuclear Information System (INIS)

    Nestor, Marika; Sundstroem, Magnus; Anniko, Matti; Tolmachev, Vladimir

    2011-01-01

    Aim: The monoclonal antibody cetuximab, targeting the epidermal growth factor receptor (EGFR), is a promising molecular targeting agent to be used in combination with radiation for anticancer therapy. In this study, effects of cetuximab in combination with alpha-emitting radioimmunotherapy (RIT) in a panel of cultured human squamous cell carcinomas (SCCs) were assessed. Methods: SCC cell lines were characterized and treated with cetuximab in combination with anti-CD44v6 RIT using the astatinated chimeric monoclonal antibody U36 ( 211 At-cMAb U36). Effects on 211 At-cMAb U36 uptake, internalization and cell proliferation were then assessed in SCC cells. Results: Cetuximab in combination with 211 At-cMAb U36 mediated increased growth inhibition compared to RIT or cetuximab alone in two cell lines. However, cetuximab also mediated radioprotective effects compared to RIT alone in two cell lines. The radioprotective effects occurred in the cell lines in which cetuximab clearly inhibited cell growth during radiation exposure. Cetuximab treatment also influenced 211 At-cMAb-U36 uptake and internalization, suggesting interactions between CD44v6 and EGFR. Conclusions: Results from this study demonstrate the vast importance of further clarifying the mechanisms of cetuximab and radiation response, and the relationship between EGFR and suitable RIT targets. This is important not only in order to avoid potential radioprotective effects, but also in order to find and utilize potential synergistic effects from these combinations.

  11. Biological toxicity of intracellular radionuclide decay. Part of a coordinated programme on radiation biology of Auger emitters and their therapeutic applications

    International Nuclear Information System (INIS)

    Hofer, K.G.

    1980-06-01

    Internal radiotherapy should be performed with short-lived radionuclides which emit high LET radiation and short ranged radiation, and accumulated within cancers. Based on these considerations, several radionuclides (tritium, copper-64, gallium-67, iodine-123, iodine 125, iodine-131 and astatine-211) were chosen and their toxicity was assessed using cell division in mammalian cultured cells as a criterion. It was apparent that the toxic effects obtained with 125 I greatly exceeded those observed in cells treated with any other radionuclides. The possible hypotheses to explain the excessive radiosensitivity of 125 I were discussed in relation to microdosimetry calculation. It was also found that the division delay induced by radionuclide decay is primarily due to damage to the cell nucleus but not to the plasma membrane. The key problem remains the development of agents which can serve as carriers for radionuclide accumulation within tumors. Although several promising approaches (Synkavit, tamoxifen, iododeoxyuridine, antibodies, liposomes) were investigated, only 125 I-labelled Synkavit would be desirable for clinical application

  12. 211At-labelling of polymer particles for radiotherapy: synthesis, purification and stability

    International Nuclear Information System (INIS)

    Larsen, R.H.; Hassfjell, S.P.; Hoff, P.; Alstad, J.; Bjoergum, J.

    1993-01-01

    Cyclotron-produced 211 At was distilled from a Bi metal target and coupled to N-succinimidyl-3-(trimethylstannyl)benzoate. The resulting N-succinimidyl-3-( 211 At)astatobenzoate was thereafter coupled to aminated monosized polymer particles with a diameter of 1.8 μm. The total time elapsed from the end of the cyclotron irradiation until the final product was prepared was about 2.5 hours. From 23 to 51% of the target activity at the end of bombardment was measured in the final conjugate. Solid-liquid extraction purification of the astatinated intermediate, using Sep-pak columns (Waters), gave more reproducible yields in the final conjugation step. The 211 At-labelled particles were incubated with fetal calf serum, human serum and human full blood at room temperature. The 211 At activity on the particles was measured before and after three times washing at 4, 24 and 48 hours. The stability was not significantly different from 100% for all media and for all time points. This indicates that 211 At-labelled particles can be stable under in vivo conditions, and may thereby be a promising agent for intracavitary radiotherapy on free-floating cancer cells or surface fixed cells. (Author)

  13. Silver impregnated nanoparticles of titanium dioxide as carriers for {sup 211}At

    Energy Technology Data Exchange (ETDEWEB)

    Cedrowska, Edyta; Lyczko, Monika; Piotrowska, Agata; Bilewicz, Aleksander [Institute of Nuclear Chemistry and Technology, Warsaw (Poland); Stolarz, Anna; Trcinska, Agnieszka [Warsaw Univ. (Poland). Heavy Ion Lab.; Szkliniarz, Katarzyna [Silesia Univ. Katowice (Poland). Inst. of Physics; Was, Bogdan [Polish Academy of Science, Cracow (Poland). Inst. of Nuclear Physics

    2016-08-01

    The {sup 211}At radioisotope exhibits very attractive nuclear properties for application in radionuclide therapy. Unfortunately use of {sup 211}At is limited, because astatine as the heaviest halogen forms weak bond with carbon atoms in the biomolecules which makes {sup 211}At bioconjugates unstable in physiological conditions. In our work we propose a new solution for binding of {sup 211}At which consists of using nanoparticles of titanium dioxide modified with silver atoms as carriers for {sup 211}At. Ag{sup +} cations have been absorbed on the nanometer-sized TiO{sub 2} particles (15 and 32 nm) through ion exchange process and were reduced in Tollens' reaction. The obtained TiO{sub 2}-Ag nanoparticles were labeled with {sup 211}At. It was found that labeling yields were almost quantitative under reducing conditions, while under oxidizing conditions they dropped to about 80%. The labeled nanoparticles exhibited very high stability in physiological salt, PBS buffer, solutions of peptides (0.001 M cysteine, 0.001 M glutathione) and in human blood serum. To make TiO{sub 2}/Ag nanoparticles well dispersed in water and biocompatible their surface was modified with a silane coupling agent containing poly(ethyleneglycol) molecules. The developed functionalization approach will allow us to attach biomolecules to the TiO{sub 2}/Ag surface.

  14. Development of Reagents for Application of At-211 to Targeted Radionuclide Therapy of Cancer

    International Nuclear Information System (INIS)

    Wilbur, D. Scott

    2011-01-01

    This grant covered only a period of 4 months as the major portion of the award was returned to DOE due to an award of funding from NIH that covered the same research objectives. A letter regarding the termination of the research is attached as the last page of the Final Report. The research conducted was limited due to the short period of this grant, but the results obtained in that period are outlined in the Final Report. The studies addressed in the research effort were directed at a problem that is of critical importance to the in vivo application of the alpha-particle emitting radionuclide At-211. That problem, low in vivo stability of many astatinated molecules, severely limits the use of At-211 in therapeutic applications. The advances sought in the studies were expected to expand the types of biomolecules that can be used as carriers of At-211, and provide improved in vivo targeting of the radiation dose compared with the dose delivered to normal tissue.

  15. Proceedings of transuranium elements

    International Nuclear Information System (INIS)

    Anon.

    1992-01-01

    The identification of the first synthetic elements was established by chemical evidence. Conclusive proof of the synthesis of the first artificial element, technetium, was published in 1937 by Perrier and Segre. An essential aspect of their achievement was the prediction of the chemical properties of element 43, which had been missing from the periodic table and which was expected to have properties similar to those of manganese and rhenium. The discovery of other artificial elements, astatine and francium, was facilitated in 1939-1940 by the prediction of their chemical properties. A little more than 50 years ago, in the spring of 1940, Edwin McMillan and Philip Abelson synthesized element 93, neptunium, and confirmed its uniqueness by chemical means. On August 30, 1940, Glenn Seaborg, Arthur Wahl, and the late Joseph Kennedy began their neutron irradiations of uranium nitrate hexahydrate. A few months later they synthesized element 94, later named plutonium, by observing the alpha particles emitted from uranium oxide targets that had been bombarded with deuterons. Shortly thereafter they proved that is was the second transuranium element by establishing its unique oxidation-reduction behavior. The symposium honored the scientists and engineers whose vision and dedication led to the discovery of the transuranium elements and to the understanding of the influence of 5f electrons on their electronic structure and bonding. This volume represents a record of papers presented at the symposium

  16. Evidence for idiotypic- and antiidiotypic B-B cellular interaction with the use of cloned antiidiotypic B cell line.

    Science.gov (United States)

    Bitoh, S; Fujimoto, S; Yamamoto, H

    1990-03-15

    Immunization of BALB/c mice with MOPC104E myeloma protein induces antiidiotypic B lymphocytes that have Id-specific enhancing activity on antibody production. The B-B cell interaction was restricted to both Igh and class II MHC. However, anti-Thy-1 and C-treated splenic B cells were maintained for more than 1 y in a mixture of Con A-stimulated splenocyte culture supernatant and synthetic medium. In applying the long term culture method, we have established a cloned B cell line named B19-1d, B19-1d cells are specific to MOPC104E or J558 cross-reactive Id and they express surface mu, lambda but no Ly-1. B19-1d do not spontaneously secrete Ig but produce them upon stimulation with bacterial LPS. The effect of B19-1d cell line on idiotypic antibody production was tested. Addition of only 10 to 100 B19-1d cells into dextran-immune B cell culture greatly enhanced the Id+ antidextran antibody responses. On the contrary, the antidextran antibody production was suppressed by the higher doses of B19-1d cells. The effective cooperation between dextran-immune B cells and B19-1d cloned B cells was restricted to class II MHC. The role of idiotypic- and antiidiotypic B-B cell interaction in immune regulation and repertoire generation was suggested.

  17. African Journal of Environmental Science and Technology - Vol 9 ...

    African Journals Online (AJOL)

    191 ... Seasonal variation of meteorological factors on air parameters and the impact of gas flaring on air quality of some cities in Niger Delta (Ibeno and its environs) · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL ...

  18. Publications | Page 20 | IDRC - International Development Research ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 191 - 200 of 6341 ... ... and offer free training materials to guide researchers and institutions. ... Improving citizen awareness and democratic elections in Peru ... Africa has achieved impressive economic growth in the past 15 years; from ...

  19. Publications | Page 20 | IDRC - International Development Research ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 191 - 200 of 6382 ... Food advertising to children in Argentinean television : a ... Use of Mobile Phones by the Rural Poor: Gender perspectives from ... food and nutrition security strategy that links agriculture to health and nutrition.

  20. ABO blood groups and pancreatic cancer risk and survival: Results from the PANcreatic Disease ReseArch (PANDoRA) consortium

    Czech Academy of Sciences Publication Activity Database

    Rizzato, C.; Campa, D.; Pezzilli, R.; Souček, P.; Greenhalf, W.; Capurso, G.; Talar-Wojnarowska, R.; Heller, A.; Jamroziak, K.; Khaw, K. T.; Key, T.; Bambi, F.; Landi, S.; Mohelníková-Duchoňová, B.; Vodičková, Ludmila; Buechler, M. W.; Bugert, P.; Vodička, Pavel; Neoptolemos, J. P.; Werner, J.; Hoheisel, J. D.; Bauer, A. S.; Giese, N.; Canzian, F.

    2013-01-01

    Roč. 29, č. 4 (2013), s. 1637-1644 ISSN 1021-335X Institutional support: RVO:68378041 Keywords : pancreatic cancer * genetic susceptibility * cancer risk Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.191, year: 2013

  1. Search Results | Page 20 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 191 - 200 of 1320 ... Home; Far East Asia .... TAX INCENTIVES ECONOMIES IN TRANSITION RESEARCH AND ... Towards effective policies for innovation financing in Asia : ... women entrepreneurship in MENA countries : across country ...

  2. The effect of lactose-in-saline infusion on packed cell volume ...

    African Journals Online (AJOL)

    STORAGESEVER

    2008-06-03

    Jun 3, 2008 ... concluded that lactose ameliorated anaemia, by inhibiting the sequestration of desialylated ..... lactose infusion further supports the conclusion that lactose played ... statistics. 3rd. Ed. Chapman and Hall, London, pp. 191-194.

  3. Search Results | Page 20 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 191 - 200 of 8494 ... HOST PARASITE RELATIONSHIPS NUTRITION POLICY CROP LOSSES ... team aims to protect human health and the environment by improving ... Research is finding ways to make their work sustainable and better ...

  4. Doktoritöö eesti värvinimetustest / Lembit Vaba

    Index Scriptorium Estoniae

    Vaba, Lembit

    2001-01-01

    Rets.: Oja, Vilja. Linguistic studies of Estonian colour terminology. Tartu : Tartu University Press, 2001. 191, [1] lk. : ill. (Dissertationes philologiae estonicae Universitatis Tartuensis. 1406-1325 ; 9). ISBN 9985565827

  5. TAA1-Mediated Auxin Biosynthesis Is Essential for Hormone Crosstalk and Plant Development

    Czech Academy of Sciences Publication Activity Database

    Stepanova, A.N.; Robertson-Hoyt, J.; Yun, J.; Benavente, L.M.; Xie, D.Y.; Doležal, Karel; Schlereth, A.; Jürgens, G.; Alonso, J.M.

    2008-01-01

    Roč. 133, č. 1 (2008), s. 177-191 ISSN 0092-8674 Institutional research plan: CEZ:AV0Z50380511 Keywords : CELLBIO * SIGNALING * DEVBIO Subject RIV: CE - Biochemistry Impact factor: 31.253, year: 2008

  6. Rings without a lord? Enigmatic fossils from the lower Palaeozoic of Bohemia and the Carnic Alps

    Czech Academy of Sciences Publication Activity Database

    Ferretti, A.; Cardini, A.; Crampton, J. S.; Serpagli, E.; Sheets, H. D.; Štorch, Petr

    2013-01-01

    Roč. 46, č. 2 (2013), s. 211-222 ISSN 0024-1164 Institutional support: RVO:67985831 Keywords : phosphatic rings * Problematica * Palaeozoic * morphometric analysis Subject RIV: DB - Geology ; Mineralogy Impact factor: 2.191, year: 2013

  7. Synthesis and catalytic activity of ruthenium complexes modified with chiral racemic per- and polyfluorooxaalkanoates

    Czech Academy of Sciences Publication Activity Database

    Lipovská, P.; Rathouská, L.; Šimůnek, O.; Hošek, J.; Kolaříková, V.; Rybáčková, M.; Cvačka, Josef; Svoboda, Martin; Kvíčala, J.

    2016-01-01

    Roč. 191, Nov (2016), s. 14-22 ISSN 0022-1139 Institutional support: RVO:61388963 Keywords : racemic * chiral * ruthenium complex * perfluorooxaalkanoate * polyfluorooxaalkanoate Subject RIV: CC - Organic Chemistry Impact factor: 2.101, year: 2016

  8. Tim Ingold and Jo Lee Vergunst, eds., . Aldershot, Ashgate ...

    African Journals Online (AJOL)

    ANBR

    gatherers; her ethnographic descriptions are ... (averaging two weeks per. Ways of walking: Ethnography and practice on foot. Department of Anthropology. Rhodes University. Grahamstown. South Africa content process. 191. BOOK REVIEWS. 0. 5. 25.

  9. Mayfly Burrows in Firmground of Recent Rivers from the Czech Republic and Poland, with Some Comments on Ephemeropteran Burrows in General

    Czech Academy of Sciences Publication Activity Database

    Uchman, A.; Mikuláš, Radek; Stachacz, M.

    2017-01-01

    Roč. 24, č. 3 (2017), s. 191-203 ISSN 1042-0940 Institutional support: RVO:67985831 Keywords : Ephemeroptera * ichnology * lebensspuren * fluvial environment Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Paleontology Impact factor: 1.182, year: 2016

  10. 75 FR 80515 - National Boating Safety Advisory Council

    Science.gov (United States)

    2010-12-22

    ... Advisory Council (NBSAC) and its subcommittees will meet on January 14-16, 2011, in Orlando, Florida. NBSAC... Suites Orlando--Downtown, 191 East Pine Street, Orlando, FL 32801. Please send written material, comments...

  11. Excitation of triplet states of hypericin in water mediated by hydrotropic cromolyn sodium salt

    Czech Academy of Sciences Publication Activity Database

    Keša, P.; Jančura, D.; Kudláčová, Júlia; Valušová, E.; Antalík, M.

    2018-01-01

    Roč. 193, 15 March (2018), s. 185-191 ISSN 1386-1425 Institutional support: RVO:61389013 Keywords : cromolyn * hydrotrope * hypericin Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science Impact factor: 2.536, year: 2016

  12. Search Results | Page 20 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 191 - 200 of 650 ... Filter by topic ... DNA barcoding is a new tool for taxonomic research. ... and advocacy organization based in Kampala, Uganda, with a reputation for producing good quality research to underpin its advocacy work.

  13. Fulltext PDF

    Indian Academy of Sciences (India)

    Unknown

    A four-element based transposon system for allele specific tagging in plants ... 191. BRCA1. Analysis of BRCA1 involvement in breast cancer in Indian women. 19. Brain ... Cortical tissue. Transfer of learning across the somatosensory cortex. 5.

  14. Search Results | Page 20 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 191 - 200 of 292 ... Dalit Women in Indian Politics: Making Impact through Parliament? ... Justice, Reparations and Accountability for Religious and Caste Massacres in India. The secular ... Establishing an IPS/UNCCP Information System.

  15. N-acetyl-3,4-dihydroxy-L-phenylalanine, a second identified bioactive metabolite produced by Streptomyces sp 8812

    Czech Academy of Sciences Publication Activity Database

    Solecka, J.; Rajnisz, A.; Postek, M.; Zajko, J.; Kawecki, R.; Havlíček, Vladimír; Bednarek, E.; Kozerski, L.

    2012-01-01

    Roč. 65, č. 4 (2012), s. 219-221 ISSN 0021-8820 Institutional support: RVO:61388971 Keywords : antimicrobial activity * DD-peptidase inhibitor * JS-2 Subject RIV: EE - Microbiology, Virology Impact factor: 2.191, year: 2012

  16. Search Results | Page 20 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 191 - 200 of 224 ... Asia-Pacific Research and Training Network on Trade (ARTNET) - Phase II ... 2004 to enhance the capacity of researchers and research institutions to deliver ... Business Regulations Evaluation Group in Latin America.

  17. 75 FR 71079 - Site Renumbering Notice; Foreign-Trade Zone 29-Louisville, KY

    Science.gov (United States)

    2010-11-22

    ... Interstate 65, Shepherdsville, Bullitt County; Site 7 (191 acres)--Henderson County Riverport Authority... Park, 376 Zappos Blvd., Shepherdsville, Bullitt County [formerly part of Site 6]; and, Site 13 (6 acres...

  18. 76 FR 28326 - Pipeline Safety: National Pipeline Mapping System Data Submissions and Submission Dates for Gas...

    Science.gov (United States)

    2011-05-17

    ... DEPARTMENT OF TRANSPORTATION Pipeline and Hazardous Materials Safety Administration 49 CFR 191... Reports AGENCY: Pipeline and Hazardous Materials Safety Administration (PHMSA), DOT. ACTION: Issuance of... Pipeline and Hazardous Materials Safety Administration (PHMSA) published a final rule on November 26, 2010...

  19. Teresa Zweifel, Medir lo inconmensurable. Los cambios en los procedimientos para relevar la pampa anterior (1796-1895

    Directory of Open Access Journals (Sweden)

    Sandra Szir

    2015-09-01

    Full Text Available Reseña bibliográfica del libro de Teresa Zweifel, Medir lo inconmensurable. Los cambios en los procedimientos para relevar la pampa anterior (1796-1895, Rosario, Prohistoria Ediciones, 2014, 191 pp.

  20. Plate Tectonics and Europa's Icy Shell

    Indian Academy of Sciences (India)

    defence of his theory with the 1915 publication of The Origin of Continents and Oceans. Wegener .... is one of the most promising places in our solar system to search .... Universe, Paperback Edition, Copernicus Books, pp.191–216, 2003.

  1. Search Results | Page 20 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 191 - 200 of 8517 ... Expanding women's financial inclusion: A win-win for women and financial institutions. Rose, an astute and driven business woman runs a “table banking” operation in the heart of Nairobi. Profile.

  2. Governance challenges in Tanzania's environmental impact ...

    African Journals Online (AJOL)

    EJIRO

    Cap 191. This Act promotes Environmental Assessment, gives it the legal support and defines the institutional set up for the management of the environment. However ..... Ministry of Natural Resources and Tourism, built along a very busy road ...

  3. Search Results | Page 20 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 191 - 200 of 8530 ... Taking control of air pollution in Mexico city. The United Nations described Mexico City's air as the most polluted on the planet. Story. Economics Development Social Policy WOMEN'S RIGHTS Gender Equity ...

  4. Kinetics of Inhibition of Xanthine Oxidase by Lycium arabicum and ...

    African Journals Online (AJOL)

    Induced Hyperuricemia and Renal Dysfunction in Mice ... Therefore, there is urgent need to develop new ..... Development of Research in Health (ANDRS). ... New. York: Academic Press; 1965 ; pp 32-191. 6. Markham KR. Techniques of ...

  5. Feasibility study for the redesign of MDOT's pavement management systems software.

    Science.gov (United States)

    2011-04-01

    In August of 2006 the Mississippi Department of Transportation (MDOT) initiated State Study No. 191, entitled Feasibility : Study for the Redesign of MDOTs Pavement Management System (PMS) Software. At the initiation of this study, the : Dep...

  6. Cloud amount/frequency, NITRATE and other data from PROSERPINA, XAUEN and other platforms from 1925-02-01 to 1990-05-23 (NODC Accession 9200049)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Ocean Serial data in this accession was collected as part of Global Ocean Data Archeaology and Rescue (GODAR) project from 2,138 stations and contains 19,191...

  7. Dolomitization in the diagenetic history of the Štramberg limestones

    Czech Academy of Sciences Publication Activity Database

    Lintnerová, O.; Knietl, M.; Reháková, D.; Skupien, P.; Vašíček, Zdeněk

    2008-01-01

    Roč. 34, 3/1 (2008), s. 191-192 ISSN 0138-0974 Institutional research plan: CEZ:AV0Z30860518 Keywords : Štramberk Limestone * dolomitization * dedolomitization Subject RIV: DB - Geology ; Mineralogy

  8. Negation and Affirmation: a critique of sociology in South Africa

    African Journals Online (AJOL)

    2013-12-17

    Dec 17, 2013 ... Eurocentrism, sociology of religion, inter-religious dialogue, Ibn. Khaldun, paper read at ... Unpublished Master's Thesis. University of South Africa. ... Journal of Investigative Psychology, 1(3): 191-206. Lebakeng, T.J., 2000.

  9. Search Results | Page 20 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 191 - 200 of 257 ... Involving urban communities in controlling dengue fever in Latin America ... For most countries, raising the minimum wage has long been considered a way ... Evaluating vocational training program for women in Brazil.

  10. Visit Itinerary

    CERN Multimedia

    2002-01-01

    The visit itinerary includes five area of halls 191 and 180:. End-Cap Toroid Integration Area . Barrel Toroid Integration Area . Cryogenic Test Facility for Toroid Magnets and Helium Pumps . Liquid Argon Cryostats Assembly Area . Central Solenoid Magnet Test Station

  11. Rethinking technologies

    National Research Council Canada - National Science Library

    Conley, Verena Andermatt

    1993-01-01

    .... Katherine Hayles 11. The Leap and the Lapse: Hacking a Private Site in Cyberspace Alberto Moreiras 12. Telefigures and Cyberspace Patrick Clancy 173 191 207 Works Cited 233 Contributors 241 Index 24...

  12. South African Journal of Animal Science - Vol 16, No 4 (1986)

    African Journals Online (AJOL)

    The effect of a dietary leucine excess on the immunoresponsiveness and growth of chickens · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Karen J. Tinker, RM Gous, 187-191 ...

  13. Functional identification of the non-specific nuclease from white spot syndrome virus

    International Nuclear Information System (INIS)

    Li Li; Lin Shumei; Yanga Feng

    2005-01-01

    The product encoded by the wsv191 gene from shrimp white spot syndrome virus (WSSV) is homologous with non-specific nucleases (NSN) of other organisms. To functionally identify the protein, the wsv191 gene was expressed in Escherichia coli as a glutathione S-transferase (GST) fusion protein with 6His-tag at C-terminal. The fusion protein (termed as rWSSV-NSN) was purified using Ni-NTA affinity chromatography under denatured conditions, renatured and characterized by three methods. The results showed that rWSSV-NSN could hydrolyze both DNA and RNA. 5'-RACE result revealed that the transcription initiation site of the wsv191 gene was located at nucleotide residue G of the predicted ATG triplet. Therefore, we concluded that the next ATG should be the genuine translation initiation codon of the wsv191 gene. Western blot analysis revealed that the molecular mass of natural WSSV-NSN was 37 kDa

  14. Evaluation of poultry processing practices, related public health laws ...

    African Journals Online (AJOL)

    ADEYEYE

    2015-02-16

    Feb 16, 2015 ... the Meat Law (1968), Food and Drug Act (1974) and Animal Diseases (Control) ... production and processing are coordinated for the benefits and health of the ..... Pp 191-210. ... Ouedraogo JB, Maikano I, Mbah PO, Kremer.

  15. Physiological and biochemical responses to low temperature stress ...

    African Journals Online (AJOL)

    ajl yemi

    2011-11-09

    Nov 9, 2011 ... Levels of electrolyte leak and MDA were lower than in UD189 or UD191. Poplar hybrid clones ... humidity, exposure, and water status and health conditions of ... consecutive low temperature treatment; and to detect variation ...

  16. Search Results | Page 20 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 191 - 200 of 875 ... Filter by type ... Perspectives filter · Training materials 1 Apply Training materials .... Resistance in plants against pathogen infection is defined as a ... susceptibility to a hypersensitive response (complete resistance).

  17. Případ tinea corporis vyvolaný Microsporum incurvatum, geofilním druhem příbuzným M. gypseum

    Czech Academy of Sciences Publication Activity Database

    Lysková, P.; Hubka, Vít; Bodnárová, J.

    2014-01-01

    Roč. 89, č. 4 (2014), s. 187-191 ISSN 0009-0514 Grant - others:Universita Karlova(CZ) 1344214 Institutional support: RVO:61388971 Keywords : tinea corporis * Microsporum incurvatum * Arthroderma Subject RIV: EE - Microbiology, Virology

  18. Genoprotective and Genotoxic Effects of Thymoquinone on ...

    African Journals Online (AJOL)

    was obtained from each blood donor prior to their participation. Chemicals ..... that protects against genetic damage with the least toxicity. ... traditional drugs sold in Israel at the end of the 20th century. J Ethnopharmacol 2000; 72: 191-205.

  19. Search Results | Page 20 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 191 - 200 of 1119 ... Supporting Biotechnology Regulatory Policy Processes in Southeast Asia ... Decreasing food availability for wildlife is likely to exacerbate the impacts of ... of unhealthy diets (including ultra-processed and fast foods).

  20. Search Results | Page 20 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2017-10-20

    Results 191 - 200 of 8492 ... Lessons about research to make cities safer and more inclusive. SAIC was a global research program that brought leading experts together to help understand the drivers of urban violence. Published date. October 20, 2017. Webpage.

  1. The comsumption and the supply of radioisotopes in Argentina

    International Nuclear Information System (INIS)

    Radicella, Renato.

    1975-07-01

    The isotopes consumption is analysed. The geographical distribution of the users and the use of radioactive material is also described. The local production in 1973 reached 191 Ci being the total consumption 232 Ci. (author) [es

  2. Risk factors for teenage pregnancy among sexually active black ...

    African Journals Online (AJOL)

    ... with 191 cases and 353 age-matched controls from the same school or neighbourhood. ... sex (risk ratio (RR) 30.81) without reliable contraceptive protection (RR 24.35), ... and broader social development and promotion of gender equality.

  3. A conceptual framework to model long-run qualitative change in the energy system

    OpenAIRE

    Ebersberger, Bernd

    2004-01-01

    A conceptual framework to model long-run qualitative change in the energy system / A. Pyka, B. Ebersberger, H. Hanusch. - In: Evolution and economic complexity / ed. J. Stanley Metcalfe ... - Cheltenham [u.a.] : Elgar, 2004. - S. 191-213

  4. Nové atomizátory těkavých specií založené na dielektrickém bariérovém výboji pro AAS a AFS

    Czech Academy of Sciences Publication Activity Database

    Svoboda, Milan; Šindelářová, V.; Kratzer, Jan; Michels, A.; Franzke, J.; Hraníček, J.; Dědina, Jiří

    2016-01-01

    Roč. 14, č. 5 (2016), s. 191-191 ISSN 2336-7202. [Sjezd chemických společností /68./. 04.09.2016-07.09.2016, Praha] R&D Projects: GA ČR GA14-23532S Institutional support: RVO:68081715 Keywords : dielectric barrier discharge * atomic spectrometry * hydride generation Subject RIV: CB - Analytical Chemistry, Separation

  5. The enigmatic wind of 55 Cygni

    Czech Academy of Sciences Publication Activity Database

    Haucke, M.; Kraus, Michaela; Venero, R.O.J.; Cidale, L.S.; Nickeler, Dieter Horst; Tomić, S.; Curé, M.

    2013-01-01

    Roč. 56, č. 1 (2013), s. 191-194 E-ISSN 1669-9521 R&D Projects: GA ČR(CZ) GAP209/11/1198 Institutional support: RVO:67985815 Keywords : line profiles * stellar wind * spectroscopic observin Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics http://www. astronomia argentina.org.ar/b56/2013baaa...56...191H.pdf

  6. Review: Donald Seekins: Burma and Japan since 1940. From ‘Co-Prosperity’ to ‘Quiet Dialogue’ (2008 Buchbesprechung: Donald Seekins: Burma and Japan since 1940. From ‘Co-Prosperity’ to ‘Quiet Dialogue’ (2008

    Directory of Open Access Journals (Sweden)

    Hans-Bernd Zöllner

    2009-04-01

    Full Text Available Review of the monograph: Donald Seekins: Burma and Japan since 1940. From ‘Co-Prosperity’ to ‘Quiet Dialogue’ Copenhagen: NIAS Press, 2008, ISBN 978 87 7694 017 1, 191 pages Besprechung der Monographie: Donald Seekins: Burma and Japan since 1940. From ‘Co-Prosperity’ to ‘Quiet Dialogue’ Kopenhagen: NIAS Press, 2008, ISBN 978 87 7694 017 1, 191 Seiten

  7. Prospects of using the second-order perturbation theory of the MP2 type in the theory of electron scattering by polyatomic molecules

    Czech Academy of Sciences Publication Activity Database

    Čársky, Petr

    2015-01-01

    Roč. 191, č. 2015 (2015), s. 191-192 ISSN 1551-7616 R&D Projects: GA MŠk OC09079; GA MŠk(CZ) OC10046; GA ČR GA202/08/0631 Grant - others:COST(XE) CM0805; COST(XE) CM0601 Institutional support: RVO:61388955 Keywords : electron-scattering * calculation of cross sections * second-order perturbation theory Subject RIV: CF - Physical ; Theoretical Chemistry

  8. Environmental stewardship practices of veterinary professionals and educators related to use and disposal of pharmaceuticals and personal care products.

    Science.gov (United States)

    Lam, Jennifer; Chan, Samuel S; Conway, Flaxen D L; Stone, David

    2018-03-01

    OBJECTIVE To document the environmental stewardship practices (decisions and actions regarding use and disposal) of pet and human pharmaceuticals and personal care products (PPCPs) among pet-owning veterinary-care professionals (practicing veterinarians, veterinary students, and veterinary technicians and trainees) and environmental educators. DESIGN Internet-based cross-sectional survey. SAMPLE 191 pet owners (103 veterinary-care professionals and 88 environmental educators). PROCEDURES Study participants were recruited by means of a 2-part internet survey distributed to veterinary-care professional and environmental educator networks of individuals residing in Washington state, Oregon, and southern California. Survey questions addressed motivators for environmental stewardship practices (ie, decisions and actions regarding use and disposal of pet and human PPCPs). RESULTS Data were collected from 191 respondents; the response rate for individuals who self-selected to opt in was 78% (191/246). Of the 191 respondents, 42 (22%) stored pet pharmaceuticals indefinitely. The most common disposal method was the garbage (88/191 [46%]). Veterinary-care professionals counseled clients infrequently regarding environmental stewardship practices for PPCPs. Fifty-five percent (105/191) of all respondents preferred more environmentally friendly and clinically effective PPCPs. CONCLUSIONS AND CLINICAL RELEVANCE Results of the present survey emphasized the urgent need for improved educational resources to minimize environmental contamination from improper disposal of PPCPs. Environmental and economic motivations among pet owners in the veterinary-care and education professions indicate further opportunities for outreach and institutional support.

  9. Immuno-vectorization of radioelements emitters of alpha particles: a new therapy in cancerology

    International Nuclear Information System (INIS)

    Bourgeois, M.

    2007-05-01

    The radio-immunotherapy is an anti cancerous therapy which consists in vectorising with immuno-specific agents very radio toxic radioelements on tumors or in their environment to destroy them. The first part of this report presents the different characteristics of antibodies as well as their means of production under monoclonal shapes specifically steered against a tumoral antigen of interest. The second part of this report replaces the importance of the immunological vectors in the context of the nuclear medicine. It is notably described that the different methods which allow to radio-label the vector, as well as the different ways of optimization which were envisaged to improve the targeting of radioelements on a tumor. These different developments allow to define the potential place of the alpha radio-immunotherapy in treatments and so re-place the interest of the experimental part. If the radio-immunotherapy, using beta emitters isotopes as the 131 iodine or the 90 yttrium, is today current in anti cancerous therapy, it finds limits because of the disintegration characteristics of the isotopes it uses. Indeed, compared with alpha particles, the beta particles deposit less energy by unit of length in the crossed material.The experimental part of this report aims at studying the feasibility of the coupling between an immunological vector and an alpha emitter isotope.The different tests led on the bismuth 213, the bismuth 212, the lead 212 and the astatine 211 demonstrated that the fixation of these radionuclides was possible. This research theme is strengthened by the construction in Nantes of a cyclotron with high energy ( A.R.R.O.N.A.X.) and the optimization of the obtained promising results should allow a therapeutic use in oncology of the alpha radio-immunotherapy. (N.C.)

  10. Cancer therapy with alpha-emitters labeled peptides.

    Science.gov (United States)

    Dadachova, Ekaterina

    2010-05-01

    Actively targeted alpha-particles offer specific tumor cell killing action with less collateral damage to surrounding normal tissues than beta-emitters. During the last decade, radiolabeled peptides that bind to different receptors on the tumors have been investigated as potential therapeutic agents both in the preclinical and clinical settings. Advantages of radiolabeled peptides over antibodies include relatively straightforward chemical synthesis, versatility, easier radiolabeling, rapid clearance from the circulation, faster penetration and more uniform distribution into tissues, and less immunogenicity. Rapid internalization of the radiolabeled peptides with equally rapid re-expression of the cell surface target is a highly desirable property that enhances the total delivery of these radionuclides into malignant sites. Peptides, such as octreotide, alpha-melanocyte-stimulating hormone analogues, arginine-glycine-aspartic acid-containing peptides, bombesin derivatives, and others may all be feasible for use with alpha-emitters. The on-going preclinical work has primarily concentrated on octreotide and octreotate analogues labeled with Bismuth-213 and Astatine-211. In addition, alpha-melanocyte-stimulating hormone analogue has been labeled with Lead-212/Bismuth-212 in vivo generator and demonstrated the encouraging therapeutic efficacy in treatment of experimental melanoma. Obstacles that continue to obstruct widespread acceptance of alpha-emitter-labeled peptides are primarily the supply of these radionuclides and concerns about potential kidney toxicity. New sources and methods for production of these medically valuable radionuclides and better understanding of mechanisms related to the peptide renal uptake and clearance should speed up the introduction of alpha-emitter-labeled peptides into the clinic. Copyright 2010 Elsevier Inc. All rights reserved.

  11. Selective targeting of tumour neovasculature by a radiohalogenated human antibody fragment specific for the ED-B domain of fibronectin

    International Nuclear Information System (INIS)

    Demartis, S.; Tarli, L.; Neri, D.; Borsi, L.; Zardi, L.

    2001-01-01

    Angiogenesis is a characteristic feature of many aggressive tumours and other disorders. Antibodies capable of binding to new blood vessels, but not to mature vessels, could be used as selective targeting agents for immunoscintigraphic and radioimmunotherapeutic applications. Here we show that scFv(L19), a recombinant human antibody fragment with sub-nanomolar affinity for the ED-B domain of fibronectin, a marker of angiogenesis, can be stably labelled with iodine-125 and astatine-211 with full retention of immunoreactivity, using a trimethyl-stannyl benzoate bifunctional derivative. Biodistribution studies in mice bearing two different types of tumour grafted subcutaneously, followed by ex vivo micro-autoradiographic analysis, revealed that scFv(L19) rapidly localises around tumour blood vessels, but not around normal vessels. Four hours after intravenous injection of the stably radioiodinated scFv(L19), tumour to blood ratios were 6:1 in mice bearing the F9 murine teratocarcinoma and 9:1 in mice bearing an FE8 rat sarcoma. As expected, all other organs (including kidney) contained significantly less radioactivity than the tumour. Since the ED-B domain of fibronectin has an identical sequence in mouse and man, scFv(L19) is a pan-species antibody and the results presented here suggest clinical utility of radiolabelled scFv(L19) for the scintigraphic detection of angiogenesis in vivo. Furthermore, it should now be possible to investigate scFv(L19) for the selective delivery of 211 At to the tumour neovasculature, causing the selective death of tumour endothelial cells and tumour collapse. (orig.)

  12. Preparation and in vivo evaluation of radioiodinated closo-decaborate(2-) derivatives to identify structural components that provide low retention in tissues

    International Nuclear Information System (INIS)

    Wilbur, D. Scott; Chyan, M.-K.; Hamlin, Donald K.; Perry, Matthew A.

    2010-01-01

    Introduction: In vivo deastatination of 211 At-labeled biomolecules can severely limit their use in endoradiotherapy. Our studies have shown that the use of closo-decaborate(2-) moiety for 211 At-labeling of biomolecules provides high in vivo stability towards deastatination. However, data from those studies have also been suggestive that some astatinated closo-decaborate(2-) catabolites may be retained in tissues. In this study, we investigated the in vivo distributions of several structurally simple closo-decaborate(2-) derivatives to gain information on the effects of functional groups if catabolites are released into the blood system from the carrier biomolecule. Methods: Thirteen closo-decaborate(2-) derivatives were synthesized and radioiodinated for evaluation. Tissue concentrations of the radioiodinated compounds were obtained in groups of five mice at 1 and 4 h postinjection (pi). Dual-label ( 125 I and 131 I) experiments permitted evaluation of two compounds in each set of mice. Results: All of the target compounds were readily synthesized. Radioiodination reactions were conducted with chloramine-T and Na[ 125/131 I]I in water to give high yields (75-96%) of the desired compounds. Biodistribution data at 1 and 4 h pi (representing catabolites released into the blood system) showed small differences in tissue concentrations for some compounds, but large differences for others. The results indicate that formal (overall) charge on the compounds could not be used as a predictor of tissue localization or retention. However, derivatives containing carboxylate groups generally had lower tissue concentrations. Acid cleavable hydrazone functionalities appeared to be the best candidates for further study. Conclusions: Further studies incorporating hydrazone functionalities into pendant groups for biomolecule radiohalogenation are warranted.

  13. Serotonin-related FEV gene variant in the sudden infant death syndrome is a common polymorphism in the African-American population.

    Science.gov (United States)

    Broadbelt, Kevin G; Barger, Melissa A; Paterson, David S; Holm, Ingrid A; Haas, Elisabeth A; Krous, Henry F; Kinney, Hannah C; Markianos, Kyriacos; Beggs, Alan H

    2009-12-01

    An important subset of the sudden infant death syndrome (SIDS) is associated with multiple serotonergic (5-HT) abnormalities in regions of the medulla oblongata. The mouse ortholog of the fifth Ewing variant gene (FEV) is critical for 5-HT neuronal development. A putatively rare intronic variant [IVS2-191_190insA, here referred to as c.128-(191_192)dupA] has been reported as a SIDS-associated mutation in an African-American population. We tested this association in an independent dataset: 137 autopsied cases (78 SIDS, 59 controls) and an additional 296 control DNA samples from Coriell Cell Repositories. In addition to the c.128-(191_192)dupA variant, we observed an associated single-base deletion [c.128-(301-306)delG] in a subset of the samples. Neither of the two FEV variants showed significant association with SIDS in either the African-American subgroup or the overall cohort. Although we found a significant association of c.128-(191_192)dupA with SIDS when San Diego Hispanic SIDS cases were compared with San Diego Hispanic controls plus Mexican controls (p = 0.04), this became nonsignificant after multiple testing correction. Among Coriell controls, 33 of 99 (33%) African-American and 0 of 197 (0%) of the remaining controls carry the polymorphism (c.128-(191_192)dupA). The polymorphism seems to be a common, likely nonpathogenic, variant in the African-American population.

  14. Predicting superdeformed rotational band-head spin in A ∼ 190 ...

    Indian Academy of Sciences (India)

    Table1 Shi2 ab3. Becker4 CBM5 SAM6 Zeng7. 191Au(b1). 187. 184.6. 1.5. 0.1185. 9.5. 9.5. 7.5. 7.5. –. 7.5. 7.5. 7.5. 191Au(b2). 398. 398.7. 8.4. 0.0928. 17.5. 17.5 17.5. 17.5. –. 17.5. 17.5 17.5. 191Au(b3). 383. 383.3. 7.4. 0.0916. 16.5. 16.5 17.5. 17.5. –. 16.5. 16.5 16.5. 190Hg(b1). 317. 316.8. 6.8. 0.0834. 12. 12. 13. 13. 12.

  15. Dicty_cDB: SLC409 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC409 (Link to dictyBase) - - - Contig-U14931-1 SLC409Z (Link... to Original site) - - SLC409Z 483 - - - - Show SLC409 Library SL (Link to library) Clone ID SLC409 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-A/SLC409Q.Seq.d/ Representative seq. ID SLC40...9Z (Link to Original site) Representative DNA sequence >SLC409 (SLC409Q) /CSM/SL/SLC4-A/SLC409Q.Seq.d/ XXXXX... SLH501 (SLH501Q) /CSM/SL/SLH5-A/SLH501Q.Seq.d/ 858 0.0 SLF191 (SLF191Q) /CSM/SL/SLF1-D/SLF191Q.Seq.d/ 858 0.0 SLC409 (SLC4

  16. 3K3A-activated protein C stimulates postischemic neuronal repair by human neural stem cells in mice

    DEFF Research Database (Denmark)

    Wang, Yaoming; Zhao, Zhen; Rege, Sanket V

    2016-01-01

    -APC (Lys191-193Ala) mutant in which three Lys residues (KKK191-193) were replaced with alanine, and/or its other mutants with reduced (>90%) anticoagulant activity, engineered to reduce APC-associated bleeding risk while retaining normal cell-signaling activity, have shown benefits in preclinical models...... of ischemic stroke, brain trauma, multiple sclerosis, amyotrophic lateral sclerosis, sepsis, ischemic and reperfusion injury of heart, kidney and liver, pulmonary, kidney and gastrointestinal inflammation, diabetes and lethal body radiation. On the basis of proof-of-concept studies and an excellent safety...

  17. Anticipating Viral Species Jumps: Bioinformatics and Data Needs

    Science.gov (United States)

    2011-06-01

    of the Defense Threat Reduction Agency (DTRA) is to safeguard America and its allies from weapons of mass destruction (chemical, biological...and colleagues are currently adding SF for dengue , hepatitis C and pox viruses by manually searching the literature; in the future they will begin...House Pvt Ltd, New Delhi, p. 191. http://books.google.com/books?id=6x2UmpU6grsC&pg=PA191&dq=%22evolutionary+driver%22&hl= en &ei=NyzmTZj0LsTr0gHy9PD3Cg& sa

  18. Problems Related to Use of Some Terms in System Reliability Analysis

    Directory of Open Access Journals (Sweden)

    Nadezda Hanusova

    2004-01-01

    Full Text Available The paper deals with problems of using dependability terms, defined in actual standard STN IEC 50 (191: International electrotechnical dictionary, chap. 191: Dependability and quality of service (1993, in a technical systems dependability analysis. The goal of the paper is to find a relation between terms introduced in the mentioned standard and used in the technical systems dependability analysis and rules and practices used in a system analysis of the system theory. Description of a part of the system life cycle related to reliability is used as a starting point. The part of a system life cycle is described by the state diagram and reliability relevant therms are assigned.

  19. On-line nuclear orientation

    International Nuclear Information System (INIS)

    Krane, K.S.

    1990-01-01

    This grant has as its overall goal the pursuit of on-line nuclear orientation experiments for the purpose of eliciting details of nuclear structure from the decays of neutron-deficient nuclei, such as those produced by the Holifield Heavy-Ion Research Facility at Oak Ridge and extracted by the UNISOR Isotope Separator. This paper discusses: refrigerator development; the decay of 184 Au; the decay of 191 Hg to 191 Au; the decay of 189 Pt to 189 Ir; the decays of 109,111 Pd; the decay of 172 Er; and solid angle corrections

  20. Role of histone deacetylases HDA6 and HDA19 in ABA and abiotic stress response

    OpenAIRE

    Chen, Li-Ting; Wu, Keqiang

    2010-01-01

    Our recent study revealed the involvement of the Arabidopsis histone deacetylase HDA6 in modulating ABA and salt stress responses. In this report, we further investigated the role of HDA19 in ABA and salt stress responses. The Arabidopsis HDA19 T-DNA insertion mutant, hda19-1, displayed a phenotype that was hypersensitive to ABA and salt stress. Compared with wild-type plants, the expression of ABA responsive genes, ABI1, ABI2, KAT1, KAT2 and RD29B, was decreased in hda19-1 plants when treate...

  1. Mr. Ansar Shamsi, Member Finance, Mr. Malik Adalat Khan, Director Finance, Pakistan Atomic Energy Commission

    CERN Multimedia

    Patrice Loïez

    2003-01-01

    Photo 01: Mr Ansar Shamsi, Member Finance, Pakistan Atomic Energy Commission (centre), visiting the ATLAS Tile Calorimeter in building 191 with, from left to right, Mr Syed Shaukat Hussain, Pakistan Mission in Geneva and Dr Peter Jenni, ATLAS Spokesperson. Photo 02: Mr Ansar Shamsi, Member Finance, Pakistan Atomic Energy Commission (2nd form left), visiting the ATLAS Tile Calorimeter in building 191 with, from left to right, Mr Syed Shaukat Hussain, Pakistan Mission in Geneva; Dr Peter Jenni, ATLAS Spokesperson; Dr David Jacobs and Dr Philip Bryant, Joint Pakistan-CERN Committee.

  2. Dicty_cDB: Contig-U03504-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Name: Full=Protoheme IX farnesyltransferase, mitocho... 60 8e-16 FM992692_191( FM992692 |pid:none) Candida dubliniensi...191( CT005262 |pid:none) Leishmania major strain Friedlin... 58 1e-13 CU633876_156( CU633876 |pid:none) Podospora ans... CP000934 |pid:none) Cellvibrio japonicus Ueda107, co... 45 1e-05 (Q15N01) RecName: Full=Protoheme IX farnesyltrans...ame: Full=Protoheme IX farnesyltransferase; ... 41 0.014 AP006725_1119( AP006725 |pid:none) Klebsiella pneumoni...sflstlssts*tiswcrl*nvisdsrkensgscfigscfiwysiafhl *lfl*fqrssnhshlygik*clfsitihh*nlsktfiyhilnif own upda

  3. Indirect Radiohalogenation of Targeting Proteins: Labelling Chemistry and Biological Characterisation

    Energy Technology Data Exchange (ETDEWEB)

    Orlova, Anna

    2003-03-01

    In about half of all newly diagnosed cancer cases, conventional treatment is not adequately curative, mainly due to the failure of conventional techniques to find and kill residual cells and metastases, which might consist of only a few malignant cells, without causing unacceptable complications to healthy tissue. To solve the problem a more selective delivery of cytotoxic substances to tumour cells is needed. The approach applied here is called 'tumour targeting' and implies the use of biomolecules that recognise specific molecular structures on the malignant cell surface. Such molecules are then used for a selective transport of toxic agents to the cancer cells. The use of radionuclides as cytotoxic substances has a number of advantages: 1) radiation does not cause severe resistance; 2) there is a cross-fire effect and 3) smaller amounts of nuclides are required than other cytotoxic substances to cause the same damage. Such an approach is called radionuclide tumour therapy. Several factors are important for the success of radionuclide therapy, such as the pharmacokinetics of the radiolabelled substance and its radiocatabolites, as well as the physical and chemical properties of the radiolabel used. Nuclear properties of the label should be consistent with the problem to be solved: primary diagnostics; quantification of pharmacokinetics and dose planning; or therapy. From this point of view, radiohalogens are an attractive group of radiolabels. Halogens have nuclides with a variety of physical properties while the chemical and biological properties of halogens are very similar. The same labelling procedures can be used for all heavy halogens, i.e. bromine, iodine and astatine. It has been demonstrated that the biodistribution of proteins labelled with different heavy halogens is quite similar. The main goal of the study was to develop protein radiohalogenation methods that provide a stable halogen-protein bond, convenient labelling chemistry that

  4. Radiostatine and radioiodine uptake characterization in sodium iodine symporter-expressing cell lines

    International Nuclear Information System (INIS)

    Petrich, T.; Helmeke, H.J.; Meyer, G.J.; Knapp, W.H.; Poetter, E.

    2002-01-01

    Full text: The sodium iodide symporter (NIS) has been recognized as an attractive target for cancer gene therapy. Here we investigated NIS-mediated transport of the high LET α-emitter astatine, 211 At, in comparison to radioiodine. A constitutive expression vector harbouring the human NIS cDNA was used in combination with reporter gene vectors for transient transfection of 13 different human cancer cell lines. Radioiodine uptake was measured as well as transfection efficiencies. Six stable NIS-expressing cell lines (3 derived from thyroid carcinomas, 2 colon carcinoma, 1 glioblastoma) were generated by antibiotic selection. NIS expression was monitored by immunohistochemistry and RT-PCR. Subsequently the radioastatine and radioiodine uptake characteristics of genetically modified cells were studied in comparison to the respective control cells. After xenotransplantation in nude mice in vivo tumor imaging by scintigraphy and biodistribution studies following organ removal were performed. Transient transfection of NIS cDNA led to high specific sodium perchlorate-sensitive radioiodine uptake in NIS-expressing cells that roughly correlates to transfection efficiencies. Similarly, stable NIS-expressing cell lines were able to concentrate high levels of radioiodine and in addition showed comparable transport capacity for radioastatine. Accumulation of 211 At was inhibited by sodium perchlorate like iodide uptake and displayed dependency an extracellular Na + - and I - -ions as well. Compared to wash-out experiments in cell culture the effective half life of radioiodine and radioastatine in vivo was significantly prolonged. Preliminary dose calculations by MIRD concepts indicated higher tumor radiation doses for 211 At compared to 131 I. Tumor cells of different origins transfected with the NIS-expression vector specifically and significantly take-up radioiodine and radioastatine in vitro and in vivo. The data provide direct evidence that the NIS efficiently transports

  5. α-Imaging Confirmed Efficient Targeting of CD₄₅-Positive Cells After ²¹¹At-Radioimmunotherapy for Hematopoietic Cell Transplantation

    Energy Technology Data Exchange (ETDEWEB)

    Frost, Sophia; Miller, Brian W.; Back, Tom; Santos, E. B.; Hamlin, Donald K.; Knoblaugh, E.; Frayo, Shani; Kenoyer, Aimee L.; Storb, Rainer; Press, O. W.; Wilbur, D. Scott; Pagel, John M.; Sandmaier, B. M.

    2015-09-03

    Alpha-radioimmunotherapy (α-RIT) targeting CD45 may substitute for total body irradiation in hematopoietic cell transplantation (HCT) preparative regimens for lymphoma. Our goal was to optimize the anti-CD45 monoclonal antibody (MAb; CA12.10C12) protein dose for astatine-²¹¹(²¹¹At)-RIT, extending the analysis to include intra-organ ²¹¹At activity distribution and α-imaging-based small-scale dosimetry, along with imunohistochemical staining. Methods: Eight normal dogs were injected with either 0.75 (n=5) or 1.00 mg/kg (n=3) of ²¹¹At-B10-CA12.10C12 (11.5–27.6 MBq/kg). Two were euthanized and necropsied 19–22 hours postinjection (p.i.), and six received autologous HCT three days after ²¹¹At-RIT, following lymph node and bone marrow biopsies at 2–4 and/or 19 hours p.i. Blood was sampled to study toxicity and clearance; CD45 targeting was evaluated by flow cytometry. ²¹¹At localization and small scale dosimetry were assessed using two α-imaging : α-camera and iQID. Results: Uptake of ²¹¹At was highest in spleen (0.31–0.61 %IA/g), lymph nodes (0.02–0.16 %IA/g), liver (0.11–0.12 %IA/g), and marrow (0.06–0.08 %IA/g). Lymphocytes in blood and marrow were efficiently targeted using either MAb dose. Lymph nodes remained unsaturated, but displayed targeted ²¹¹At localization in T lymphocyte-rich areas. Absorbed doses to blood, marrow, and lymph nodes were estimated at 3.9, 3.0, and 4.2 Gy/210 MBq, respectively. All transplanted dogs experienced transient hepatic toxicity. Liver enzyme levels were temporarily elevated in 5 of 6 dogs; 1 treated with 1.00 mg MAb/kg developed ascites and was euthanized 136 days after HCT. Conclusion: ²¹¹At-anti-CD45 RIT with 0.75 mg MAb/kg efficiently targeted blood and marrow without severe toxicity. Dosimetry calculations and observed radiation-induced effects indicated that sufficient ²¹¹At-B10-CA12.10C12 localization was achieved for efficient conditioning for HCT.

  6. Alpha particle induced DNA damage and repair in normal cultured thyrocytes of different proliferation status

    Energy Technology Data Exchange (ETDEWEB)

    Lyckesvärd, Madeleine Nordén, E-mail: madeleine.lyckesvard@oncology.gu.se [Department of Oncology, Sahlgrenska Academy, University of Gothenburg (Sweden); Delle, Ulla; Kahu, Helena [Department of Oncology, Sahlgrenska Academy, University of Gothenburg (Sweden); Lindegren, Sture [Department of Radiation Physics, Sahlgrenska Academy, University of Gothenburg (Sweden); Jensen, Holger [The PET and Cyclotron Unit Copenhagen University Hospital, Rigshospitalet (Denmark); Bäck, Tom [Department of Radiation Physics, Sahlgrenska Academy, University of Gothenburg (Sweden); Swanpalmer, John [Department of Medical Physics and Biomedical Engineering, Sahlgrenska University Hospital, Gothenburg (Sweden); Elmroth, Kecke [Department of Oncology, Sahlgrenska Academy, University of Gothenburg (Sweden)

    2014-07-15

    Highlights: • We study DNA damage response to low-LET photons and high-LET alpha particles. • Cycling primary thyrocytes are more sensitive to radiation than stationary cells. • Influence of radiation quality varies due to cell cycle status of normal cells. • High-LET radiation gives rise to a sustained DNA damage response. - Abstract: Childhood exposure to ionizing radiation increases the risk of developing thyroid cancer later in life and this is suggested to be due to higher proliferation of the young thyroid. The interest of using high-LET alpha particles from Astatine-211 ({sup 211}At), concentrated in the thyroid by the same mechanism as {sup 131}I [1], in cancer treatment has increased during recent years because of its high efficiency in inducing biological damage and beneficial dose distribution when compared to low-LET radiation. Most knowledge of the DNA damage response in thyroid is from studies using low-LET irradiation and much less is known of high-LET irradiation. In this paper we investigated the DNA damage response and biological consequences to photons from Cobolt-60 ({sup 60}Co) and alpha particles from {sup 211}At in normal primary thyrocytes of different cell cycle status. For both radiation qualities the intensity levels of γH2AX decreased during the first 24 h in both cycling and stationary cultures and complete repair was seen in all cultures but cycling cells exposed to {sup 211}At. Compared to stationary cells alpha particles were more harmful for cycling cultures, an effect also seen at the pChk2 levels. Increasing ratios of micronuclei per cell nuclei were seen up to 1 Gy {sup 211}At. We found that primary thyrocytes were much more sensitive to alpha particle exposure compared with low-LET photons. Calculations of the relative biological effectiveness yielded higher RBE for cycling cells compared with stationary cultures at a modest level of damage, clearly demonstrating that cell cycle status influences the relative

  7. Quantitative single-particle digital autoradiography with α-particle emitters for targeted radionuclide therapy using the iQID camera

    Energy Technology Data Exchange (ETDEWEB)

    Miller, Brian W., E-mail: brian.miller@pnnl.gov [Pacific Northwest National Laboratory, Richland, Washington 99354 and College of Optical Sciences, The University of Arizona, Tucson, Arizona 85719 (United States); Frost, Sofia H. L.; Frayo, Shani L.; Kenoyer, Aimee L.; Santos, Erlinda; Jones, Jon C.; Orozco, Johnnie J. [Fred Hutchinson Cancer Research Center, Seattle, Washington 98109 (United States); Green, Damian J.; Press, Oliver W.; Pagel, John M.; Sandmaier, Brenda M. [Fred Hutchinson Cancer Research Center, Seattle, Washington 98109 and Department of Medicine, University of Washington, Seattle, Washington 98195 (United States); Hamlin, Donald K.; Wilbur, D. Scott [Department of Radiation Oncology, University of Washington, Seattle, Washington 98195 (United States); Fisher, Darrell R. [Dade Moeller Health Group, Richland, Washington 99354 (United States)

    2015-07-15

    Purpose: Alpha-emitting radionuclides exhibit a potential advantage for cancer treatments because they release large amounts of ionizing energy over a few cell diameters (50–80 μm), causing localized, irreparable double-strand DNA breaks that lead to cell death. Radioimmunotherapy (RIT) approaches using monoclonal antibodies labeled with α emitters may thus inactivate targeted cells with minimal radiation damage to surrounding tissues. Tools are needed to visualize and quantify the radioactivity distribution and absorbed doses to targeted and nontargeted cells for accurate dosimetry of all treatment regimens utilizing α particles, including RIT and others (e.g., Ra-223), especially for organs and tumors with heterogeneous radionuclide distributions. The aim of this study was to evaluate and characterize a novel single-particle digital autoradiography imager, the ionizing-radiation quantum imaging detector (iQID) camera, for use in α-RIT experiments. Methods: The iQID camera is a scintillator-based radiation detection system that images and identifies charged-particle and gamma-ray/x-ray emissions spatially and temporally on an event-by-event basis. It employs CCD-CMOS cameras and high-performance computing hardware for real-time imaging and activity quantification of tissue sections, approaching cellular resolutions. In this work, the authors evaluated its characteristics for α-particle imaging, including measurements of intrinsic detector spatial resolutions and background count rates at various detector configurations and quantification of activity distributions. The technique was assessed for quantitative imaging of astatine-211 ({sup 211}At) activity distributions in cryosections of murine and canine tissue samples. Results: The highest spatial resolution was measured at ∼20 μm full width at half maximum and the α-particle background was measured at a rate as low as (2.6 ± 0.5) × 10{sup −4} cpm/cm{sup 2} (40 mm diameter detector area

  8. Quantitative single-particle digital autoradiography with α-particle emitters for targeted radionuclide therapy using the iQID camera.

    Science.gov (United States)

    Miller, Brian W; Frost, Sofia H L; Frayo, Shani L; Kenoyer, Aimee L; Santos, Erlinda; Jones, Jon C; Green, Damian J; Hamlin, Donald K; Wilbur, D Scott; Fisher, Darrell R; Orozco, Johnnie J; Press, Oliver W; Pagel, John M; Sandmaier, Brenda M

    2015-07-01

    Alpha-emitting radionuclides exhibit a potential advantage for cancer treatments because they release large amounts of ionizing energy over a few cell diameters (50-80 μm), causing localized, irreparable double-strand DNA breaks that lead to cell death. Radioimmunotherapy (RIT) approaches using monoclonal antibodies labeled with α emitters may thus inactivate targeted cells with minimal radiation damage to surrounding tissues. Tools are needed to visualize and quantify the radioactivity distribution and absorbed doses to targeted and nontargeted cells for accurate dosimetry of all treatment regimens utilizing α particles, including RIT and others (e.g., Ra-223), especially for organs and tumors with heterogeneous radionuclide distributions. The aim of this study was to evaluate and characterize a novel single-particle digital autoradiography imager, the ionizing-radiation quantum imaging detector (iQID) camera, for use in α-RIT experiments. The iQID camera is a scintillator-based radiation detection system that images and identifies charged-particle and gamma-ray/x-ray emissions spatially and temporally on an event-by-event basis. It employs CCD-CMOS cameras and high-performance computing hardware for real-time imaging and activity quantification of tissue sections, approaching cellular resolutions. In this work, the authors evaluated its characteristics for α-particle imaging, including measurements of intrinsic detector spatial resolutions and background count rates at various detector configurations and quantification of activity distributions. The technique was assessed for quantitative imaging of astatine-211 ((211)At) activity distributions in cryosections of murine and canine tissue samples. The highest spatial resolution was measured at ∼20 μm full width at half maximum and the α-particle background was measured at a rate as low as (2.6 ± 0.5) × 10(-4) cpm/cm(2) (40 mm diameter detector area). Simultaneous imaging of multiple tissue sections was

  9. 78 FR 27169 - Regulatory Flexibility Act Review

    Science.gov (United States)

    2013-05-09

    ... DEPARTMENT OF TRANSPORTATION Pipeline and Hazardous Materials Safety Administration 49 CFR Chapter... parts 174, 177, 191, and 192... 2013 2014 Transportation of Natural and Other Gas by Pipeline; Annual... review of some of 49 CFR parts 106, 107, 171. The full analysis document for the hazardous materials...

  10. 75 FR 54631 - Proposed Approval of the Central Characterization Project's Transuranic Waste Characterization...

    Science.gov (United States)

    2010-09-08

    ... determined that WIPP complies with the Agency's radioactive waste disposal regulations at 40 CFR part 191... Site in Richland, Washington. This waste is intended for disposal at the Waste Isolation Pilot Plant..., near Carlsbad in southeastern New Mexico, as a deep geologic repository for disposal of TRU radioactive...

  11. High School Timetabling: Modeling and solving a large number of cases in Denmark

    DEFF Research Database (Denmark)

    Sørensen, Matias; Stidsen, Thomas Riis

    2012-01-01

    for high school administration (available only for Danish high schools), which includes an embedded application for creating a weekly timetable. Currently, 230 high schools are customers of Lectio, and 191 have bought access to the timetabling software. This constitutes the majority of high schools...

  12. Morphology and mechanical properties of polypropylene/polystyrene blends compatibilized with styrene-butadiene block copolymers

    Czech Academy of Sciences Publication Activity Database

    Fortelný, Ivan; Minkova, L. I.; Kotek, Jiří; Lapčíková, Monika; Michálková, Danuše

    2012-01-01

    Roč. 52, č. 1 (2012), s. 191-204 ISSN 0032-3888 R&D Projects: GA ČR GA106/06/0729; GA AV ČR IAA200500903 Institutional research plan: CEZ:AV0Z40500505 Keywords : polymer blends * compatibilization * morphology Subject RIV: JI - Composite Materials Impact factor: 1.243, year: 2012

  13. Characterisation of oligosaccharides in vegetables by HPLC and MALDI-TOF MS

    Czech Academy of Sciences Publication Activity Database

    Štikarovská, M.; Chmelík, Josef

    96(S), - (2002), s. S189-S191 ISSN 0009-2770. [Meeting of Chemistry & Life /2./. Brno, 10.09.2002-11.09.2002] Institutional research plan: CEZ:AV0Z4031919 Keywords : oligosaccharides * HPLC * MALDI-TOF-MS Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 0.336, year: 2002

  14. Buškové z Velhartic. Historie pánů z Velhartic ve 14. století ve světle kartoték Augusta Sedláčka

    Czech Academy of Sciences Publication Activity Database

    Doležalová, Eva

    2015-01-01

    Roč. 18, č. 2 (2015), s. 181-191 ISSN 0862-979X R&D Projects: GA MK(CZ) DF12P01OVV019 Keywords : lord of Velhartice * 14th century * Czech lands * Charles IV * Bušek of Velhartice Subject RIV: AB - History

  15. Genetic analysis of Phytophthora infestans populations in the Nordic European countries reveals high genetic variability

    DEFF Research Database (Denmark)

    Brurberg, May Bente; Elameen, Abdelhameed; Le, Ving Hong

    2011-01-01

    different fields using nine simple-sequence repeat (SSR) markers. Forty-nine alleles were detected among the nine SSR loci and isolates from all four Nordic countries shared the most common alleles across the loci. In total 169 multilocus genotypes (based on seven loci) were identified among 191 isolates...

  16. 76 FR 78330 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2011-12-16

    ... powered parachute (PPC), experimental light-sport aircraft (ELSA), intended for flight operations and...'' PPC ELSA ``kit'' for operation at the same weight prescribed for LSA intended for operation on water... be converted to ELSA for operation in accordance with Sec. 21.191(i)(3). [FR Doc. 2011-32259 Filed 12...

  17. Increased steady-state VO2 and larger O2 deficit with CO2 inhalation during exercise

    DEFF Research Database (Denmark)

    Østergaard, Lars; Kjær, Kirsten; Jensen, Kurt

    2012-01-01

    respiratory acidosis with increases in PCO2 and decreases in capillary blood pH (P ... with hypercapnia in heavy exercise (2.24 ± 0.51 L vs. 1.91 ± 0.45 L; P respiratory acidosis increase steady-state in both light and heavy exercise and enlarges O2 deficit in heavy exercise....

  18. Targeted design of α-MnO2 based catalysts for oxygen reduction

    Czech Academy of Sciences Publication Activity Database

    Lehtimäki, M.; Hoffmannová, Hana; Boytsová, O.; Bastl, Zdeněk; Bush, M.; Halck, N. B.; Rossmeisl, J.; Krtil, Petr

    2016-01-01

    Roč. 191, FEB 2016 (2016), s. 452-461 ISSN 0013-4686 EU Projects: European Commission(XE) 214936 - ELCAT Institutional support: RVO:61388955 Keywords : electrocatalysis * oxygen reduction * MnO2 Subject RIV: CG - Electrochemistry Impact factor: 4.798, year: 2016

  19. The oldest Czech fishpond discovered? An interdisciplinary approach to reconstruction of local vegetation in mediaeval Prague suburbs

    Czech Academy of Sciences Publication Activity Database

    Pokorná, Adéla; Houfková, P.; Novák, J.; Bešta, T.; Kovačiková, L.; Nováková, K.; Zavřel, J.; Starec, P.

    2014-01-01

    Roč. 730, č. 1 (2014), s. 191-213 ISSN 0018-8158 Grant - others:GA ČR(CZ) GA13-11193S Institutional support: RVO:67985912 Keywords : archaeobotany * archaeozoology * environmental changes * human impact * fishpond * hydrobiology * Prague * the Middle Ages * vegetation diversity Subject RIV: AC - Archeology, Anthropology, Ethnology Impact factor: 2.275, year: 2014

  20. Duplication, balancing selection and trans-species evolution explain the high levels of polymorphism of the DQA MHC class II gene in voles (Arvicolinae)

    Czech Academy of Sciences Publication Activity Database

    Bryja, Josef; Galan, M.; Charbonnel, N.; Cosson, J.-F.

    2006-01-01

    Roč. 58, 2-3 (2006), s. 191-202 ISSN 0093-7711 EU Projects: European Commission(XE) 10284 - EDEN Institutional research plan: CEZ:AV0Z60930519 Keywords : Muridae * allelic diversity Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.852, year: 2006

  1. 27 CFR 41.194 - Articles of partnership or association.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Articles of partnership or... AND TUBES, AND PROCESSED TOBACCO Tobacco Products Importers § 41.194 Articles of partnership or..., must furnish with its application for permit required by § 41.191 a true copy of the articles of...

  2. Althusser, Marx a neempiristická teorie dějin

    Czech Academy of Sciences Publication Activity Database

    Kužel, Petr

    2013-01-01

    Roč. 10, č. 2 (2013), s. 191-208 ISSN 1214-7249 Institutional support: RVO:67985955 Keywords : empiricism * historical epistemology * Louis Althusser * Karl Marx Subject RIV: AA - Philosophy ; Religion http://www.dejinyteoriekritika.cz/Modules/ViewDocument.aspx?Did=410

  3. Šmakuláda

    Czech Academy of Sciences Publication Activity Database

    Ireinová, Martina

    2017-01-01

    Roč. 100, č. 3 (2017), s. 189-191 ISSN 0027-8203 R&D Projects: GA ČR(CZ) GA16-04648S Keywords : šmakuláda * šmak * Czech National Corpus * database Neomat * etymology Subject RIV: AI - Linguistics OBOR OECD: Linguistics

  4. Prehistoric dark soils/sediments of Central Sudan, case study from the Mesolithic landscape at the Sixth Nile Cataract

    Czech Academy of Sciences Publication Activity Database

    Lisá, Lenka; Bajer, A.; Pacina, J.; McCool, J-P.; Cílek, Václav; Rohovec, Jan; Matoušková, Šárka; Kallistová, Anna; Gottvald, Z.

    2017-01-01

    Roč. 149, č. 1 (2017), s. 273-282 ISSN 0341-8162 Institutional support: RVO:67985831 Keywords : climate change * micromorphology * sahel * saprolite * soil chemistry Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Geology Impact factor: 3.191, year: 2016

  5. Osmosis: membranes impermeable and permeable for solutes, mechanism of osmosis across porous membranes

    Czech Academy of Sciences Publication Activity Database

    Janáček, Karel; Sigler, Karel

    2000-01-01

    Roč. 49, - (2000), s. 191-195 ISSN 0862-8408 R&D Projects: GA ČR GA204/99/0488 Institutional research plan: CEZ:A53/98:Z5-020-9ii Subject RIV: EE - Microbiology, Virology Impact factor: 1.366, year: 2000

  6. Dicty_cDB: Contig-U13293-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 093214_1( AF093214 |pid:none) Hirtodrosophila pictiventris xanth... 206 6e-52 FB7...23 |pid:none) Sequence 7019 from Patent WO200903... 191 2e-47 AF058984_1( AF058984 |pid:none) Scaptodrosophila

  7. jfewr ©2016 - jfewr Publications

    African Journals Online (AJOL)

    umaru buba

    The Nigeria-Cameroon chimpanzee has been classified on the red list of threatened ... the habitat, tree felling (4 segments; 19.1 %) of the habitat and Non Timber ... Uganda in the East to Mali and Senegal in the West ... of biotypes such as evergreen and semi-deciduous ..... on ripe fruits and only between 18 – 21 % of their.

  8. Pollution distribution in floodplain structure visualised by electrical resistivity imaging in the floodplain of the Litavka River, the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Faměra, Martin; Kotková, Kristýna; Tůmová, Štěpánka; Elznicová, J.; Matys Grygar, Tomáš

    2018-01-01

    Roč. 165, JUN (2018), s. 157-172 ISSN 0341-8162 R&D Projects: GA ČR(CZ) GA15-00340S Institutional support: RVO:61388980 Keywords : Electric resistivity * Floodplain structure * Geophysical methods * Pollution chemostratigraphy * Post-depositional migration * Shallow subsurface Subject RIV: DD - Geochemistry OBOR OECD: Geology Impact factor: 3.191, year: 2016

  9. Translation and Short-Term L2 Vocabulary Retention: Hindrance or Help?

    Science.gov (United States)

    Hummel, Kirsten M.

    2010-01-01

    This study addresses the role that active translation may have in second language (L2) vocabulary learning. Some research suggests that translation might be an effective cognitive strategy for L2 vocabulary learning. Participants were 191 native French-speaking students enrolled in a TESL (Teaching English as a Second Language) program.The study…

  10. 77 FR 75196 - Proposed Collection, Comment Request

    Science.gov (United States)

    2012-12-19

    ... from the States' UI accounting files are sufficient for statistical purposes. However, such data are... BLS also has been working very closely with firms providing payroll and tax filing services for.... respondents Respondent responses per response (hours) BLS 3020 (MWR) 133,191 Non-Federal..... 532,764 22.2...

  11. Fulltext PDF

    Indian Academy of Sciences (India)

    Admin

    Donor-acceptor structure (1) 80 (FA). Downwash (2) 191 (SA). Drag (1) 32 (GA). Drypetes roxburghii (Wall.) ... Kodaikanal Observatory (11) 1032 (GA). Kolmogorov–Sinai entropy (8) 761 (GA). Landau theory (7) 704 (CR). Landing (9) 916 (SA). Languages (7) 682 (GA). Latent heat (8) 807 (CR). Lateral motion (11) 1071 (SA).

  12. Pattern of femoral fractures and associated injuries in a Nigerian ...

    African Journals Online (AJOL)

    2014-10-09

    Oct 9, 2014 ... The analysis was performed using descriptive statistics in Microsoft Excel 2007. Results: A total of ... using Microsoft Excel from Microsoft Office 2007 developed by Microsoft. and ..... J Midlife Health 2013;4:191‑4. 21. Adili A ...

  13. The Effectiveness of Healthy Start Home Visit Program: Cluster Randomized Controlled Trial

    Science.gov (United States)

    Leung, Cynthia; Tsang, Sandra; Heung, Kitty

    2015-01-01

    Purpose: The study reported the effectiveness of a home visit program for disadvantaged Chinese parents with preschool children, using cluster randomized controlled trial design. Method: Participants included 191 parents and their children from 24 preschools, with 84 dyads (12 preschools) in the intervention group and 107 dyads (12 preschools) in…

  14. Stomatal and pavement cell density linked to leaf internal CO2 concentration

    Czech Academy of Sciences Publication Activity Database

    Šantrůček, Jiří; Vráblová, M.; Šimková, Marie; Hronková, Marie; Drtinová, M.; Květoň, J.; Vrábl, D.; Kubásek, J.; Macková, J.; Wiesnerová, Dana; Neuwithová, J.; Schreiber, L.

    2014-01-01

    Roč. 114, č. 2 (2014), s. 191-202 ISSN 0305-7364 R&D Projects: GA ČR(CZ) GAP501/12/1261 Institutional support: RVO:60077344 Keywords : Stomatal density * Stomata development * Pavement cells Subject RIV: CE - Biochemistry Impact factor: 3.654, year: 2014

  15. Molecular mechanism for the action of the anti-CD44 monoclonal antibody MEM-85

    Czech Academy of Sciences Publication Activity Database

    Škerlová, Jana; Král, Vlastimil; Kachala, M.; Fábry, Milan; Bumba, Ladislav; Svergun, D.I.; Tosner, Z.; Veverka, V.; Řezáčová, Pavlína

    2015-01-01

    Roč. 191, č. 2 (2015), s. 214-223 ISSN 1047-8477 R&D Projects: GA ČR(CZ) GA15-11851S EU Projects: European Commission 264257 Institutional support: RVO:68378050 ; RVO:61388971 Keywords : CD44 * Epitope mapping * Monoclonal antibody * MEM-85 * SAXS * NMR Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.570, year: 2015

  16. Molecular mechanism for the action of the anti-CD44 monoclonal antibody MEM-85

    Czech Academy of Sciences Publication Activity Database

    Škerlová, Jana; Král, V.; Kachala, M.; Fábry, M.; Bumba, L.; Svergun, D. I.; Tošner, Z.; Veverka, Václav; Řezáčová, Pavlína

    2015-01-01

    Roč. 191, č. 2 (2015), s. 214-223 ISSN 1047-8477 R&D Projects: GA MŠk(CZ) LK11205; GA MŠk(CZ) LO1304 Institutional support: RVO:61388963 Keywords : CD44 * epitope mapping * monoclonal antibody * MEM-85 * NMR * SAXS Subject RIV: CE - Biochemistry Impact factor: 2.570, year: 2015

  17. 78 FR 66937 - Disease, Disability, and Injury Prevention and Control Special Emphasis Panel (SEP): Initial Review

    Science.gov (United States)

    2013-11-07

    ... DEPARTMENT OF HEALTH AND HUMAN SERVICES Centers for Disease Control and Prevention Disease, Disability, and Injury Prevention and Control Special Emphasis Panel (SEP): Initial Review Notice of... Volume 78, Number 191, Page 60877). This SEP, scheduled to convene on November 6, 2013, is canceled...

  18. Earth orientation and its excitation by atmosphere, oceans, and geomagnetic jerks

    Czech Academy of Sciences Publication Activity Database

    Vondrák, Jan; Ron, Cyril

    -, č. 191 (2015), s. 59-66 ISSN 1450-698X R&D Projects: GA ČR GA13-15943S Institutional research plan: CEZ:AV0Z1003909 Institutional support: RVO:67985815 Keywords : Earth * reference systems * time Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 0.429, year: 2015

  19. Search Results | Page 20 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2018-01-04

    Results 191 - 200 of 8530 ... The much anticipated GrowInclusive Platform now under construction. In response, the World Economic Forum, World Bank Group, and IDRC are building the GrowInclusive platform. Published date. January 4, 2018. Research in Action. Food and Agriculture Gender ...

  20. Aerospace Power in the Twenty-First Century: A Basic Primer

    Science.gov (United States)

    2001-07-01

    Linebacker geared up. The Navy started to mine Haiphong harbor under Operat ion Pocket Money . If that operat ion succeeded, then suppl ies would...for Galilee, 243 Pocket Money , 143 Pointblank, 93–94 Satura te , 137–38 S e e l ö w e (Sea Lion), 79–82, 86 Strangle, 133, 135–37 Vittles, 27, 191