WorldWideScience

Sample records for assistencia ao controle

  1. A program for assisting automatic generation control of the ELETRONORTE using artificial neural network; Um programa para assistencia ao controle automatico de geracao da Eletronorte usando rede neuronal artificial

    Energy Technology Data Exchange (ETDEWEB)

    Brito Filho, Pedro Rodrigues de; Nascimento Garcez, Jurandyr do [Para Univ., Belem, PA (Brazil). Centro Tecnologico; Charone Junior, Wady [Centrais Eletricas do Nordeste do Brasil S.A. (ELETRONORTE), Belem, PA (Brazil)

    1994-12-31

    This work presents an application of artificial neural network as a support to decision making in the automatic generation control (AGC) of the ELETRONORTE. It uses a software to auxiliary in the decisions in real time of the AGC. (author) 2 refs., 6 figs., 1 tab.

  2. Assistencia ao cancer entre criancas e adolescentes: mapeamento dos fluxos origem-destino no Brasil

    Directory of Open Access Journals (Sweden)

    Marilia Fornaciari Grabois

    2013-06-01

    Full Text Available OBJETIVO: Analisar os fluxos de viagens de crianças e adolescentes com câncer, entre os locais de residência e serviço de saúde. MÉTODOS: Foram analisados os fluxos de viagens de crianças e adolescentes com câncer entre os locais de residência e de serviço de saúde atendidos no Sistema Único de Saúde (SUS, de 2000 a 2007. A unidade de análise foi a regional de saúde. Utilizou-se o sistema de informações geográficas e metodologia de redes por tipo de tratamento recebido (quimioterapia e radioterapia e internações hospitalares. RESULTADOS: Foram emitidas 465.289 autorizações de quimioterapia, 29.151 de radioterapia e 383.568 de internações hospitalares de crianças e adolescentes com diagnóstico de câncer para tratamento no SUS. O fluxo dominante formou 48 redes para quimioterapia, 53 para radioterapia e 112 para internações hospitalares. A maior parte do volume de atendimento ocorreu nas regionais de saúde das 12 maiores metrópoles do País com grande relacionamento entre elas e extensa área de influência direta acompanhando a estrutura da rede urbana brasileira. CONCLUSÕES: A identificação das redes estabelecidas no âmbito do SUS para o atendimento de crianças e adolescentes com câncer mostra que a maioria dos pacientes está contemplada pelas redes estruturadas. Cerca de 10% das viagens ocorrem fora do fluxo dominante, indicando a necessidade de regionalização alternativa. Os resultados evidenciam a importância do planejamento da distribuição dos serviços de acordo com as necessidades da população usuária.

  3. Posicionamentos skinnerianos quanto ao uso do controle aversivo pelas agências de controle

    OpenAIRE

    Bruna Del Giudice Machado Godinho

    2011-01-01

    O campo de estudo, denominado controle aversivo, é constituído pelas contingências de reforçamento negativo e de punição positiva e negativa. O uso do controle aversivo tem sido alvo de muitas críticas dentro da comunidade científica. As críticas às contingências aversivas, normalmente, são dirigidas aos subprodutos emocionais que se mostram prejudiciais às pessoas controladas e ao poder positivamente reforçador que essas contingências exercem sobre os controladores. Por isso, Skinner normalm...

  4. A contabilidade gerencial como ferramenta de apoio ao planejamento e ao controle: um estudo sobre duas empresas de grande porte do setor automotivo

    OpenAIRE

    Quintairos, Paulo César Ribeiro; Andrade, Alequexandre Galvez de; Oliveira, Edson Aparecida de Araújo Querido

    2011-01-01

    A contabilidade gerencial é uma importante ferramenta para o planejamento e controle das organizações, pois integra medidas financeiras e não financeiras. O conjunto dessas informações forma um sistema integrado cuja finalidade é avaliar o alinhamento da produção de uma empresa aos seus objetivos estratégicos. Neste trabalho será apresentado um estudo sobre o uso da contabilidade gerencial como ferramenta de apoio ao planejamento e ao controle de duas empresas de grande porte do setor automob...

  5. Sistematizacao da Assistencia de Enfermagem para acompanhamento ambulatorial de pacientes com esclerose multipla

    Directory of Open Access Journals (Sweden)

    Nair Assunta Antonia Corso

    2013-06-01

    Full Text Available Relato da experiência de enfermeiros na implementação da sistematização da assistência de enfermagem para acompanhamento ambulatorial em um centro interdisciplinar de atendimento a pacientes com esclerose múltipla de um hospital público de Fortaleza, Ceará. Essa implementação é baseada nas classificações da North American Nursing Diagnosis Association International, Classificação das Intervenções de Enfermagem e Classificação dos Resultados de Enfermagem. Um dos resultados diz respeito à sistematização do cuidado de enfermagem, partindo da identificação e da compreensão das respostas dos pacientes com esclerose múltipla aos problemas de saúde reais e potenciais. A sistematização enseja ampliar os conhecimentos por meio de uma prática pautada em evidências científicas, além de favorecer a atuação do enfermeiro em uma abordagem integral e fomentar outras investigações.

  6. Novel algorithm implementations in DARC: the Durham AO real-time controller

    Science.gov (United States)

    Basden, Alastair; Bitenc, Urban; Jenkins, David

    2016-07-01

    The Durham AO Real-time Controller has been used on-sky with the CANARY AO demonstrator instrument since 2010, and is also used to provide control for several AO test-benches, including DRAGON. Over this period, many new real-time algorithms have been developed, implemented and demonstrated, leading to performance improvements for CANARY. Additionally, the computational performance of this real-time system has continued to improve. Here, we provide details about recent updates and changes made to DARC, and the relevance of these updates, including new algorithms, to forthcoming AO systems. We present the computational performance of DARC when used on different hardware platforms, including hardware accelerators, and determine the relevance and potential for ELT scale systems. Recent updates to DARC have included algorithms to handle elongated laser guide star images, including correlation wavefront sensing, with options to automatically update references during AO loop operation. Additionally, sub-aperture masking options have been developed to increase signal to noise ratio when operating with non-symmetrical wavefront sensor images. The development of end-user tools has progressed with new options for configuration and control of the system. New wavefront sensor camera models and DM models have been integrated with the system, increasing the number of possible hardware configurations available, and a fully open-source AO system is now a reality, including drivers necessary for commercial cameras and DMs. The computational performance of DARC makes it suitable for ELT scale systems when implemented on suitable hardware. We present tests made on different hardware platforms, along with the strategies taken to optimise DARC for these systems.

  7. Optimal control strategy to reduce the temporal wavefront error in AO systems

    Science.gov (United States)

    Doelman, Niek J.; Hinnen, Karel J. G.; Stoffelen, Freek J. G.; Verhaegen, Michel H.

    2004-10-01

    An Adaptive Optics (AO) system for astronomy is analysed from a control point of view. The focus is put on the temporal error. The AO controller is identified as a feedback regulator system, operating in closed-loop with the aim of rejecting wavefront disturbances. Limitations on the performance of feedback regulator systems are discussed. The concept of optimal control is proposed to minimise the temporal error. The issue of closed-loop feedback controller design is made transparent by using the principle of Internal Model Control. The central issue in reducing the temporal wavefront is the design of a feedforward prediction filter. In three separate tests - a numerical simulation example, measured data from an AO test bench and open-loop telescope data - the advantage of optimal control over the common approach of integral control is demonstrated. Optimal control of the temporal error yields a smaller temporal error, enables a longer integration time in the wavefront sensor, or the use of fainter natural guide stars.

  8. Medo, ansiedade e controle relacionados ao tratamento odontológico

    Directory of Open Access Journals (Sweden)

    SINGH Kira Anayansi

    2000-01-01

    Full Text Available Nosso objetivo foi avaliar medo, ansiedade e controle relacionados ao tratamento odontológico. Os sujeitos foram 364 crianças da faixa etária de 7 a 13 anos. Três questionários com questões de múltipla escolha foram aplicados em grupos de 10 crianças. O primeiro questionário destinou-se à avaliação do medo ao tratamento odontológico e outras situações. Foi traduzido e adaptado do "Child's Fear Survey Schedule"9 e contém 15 itens. O segundo questionário contém 20 itens relacionados as situações potencialmente produtoras de ansiedade. Foi traduzido e adaptado do "State Trait Anxiety Inventory for Children"16. O terceiro questionário contém 40 itens sendo 20 relacionados ao controle percebido e 20 ao controle desejado e foi traduzido e adaptado do "Child Dental Control Assessment"19. Em relação ao medo e ansiedade, a média dos escores foi mais elevada para o sexo feminino do que para o sexo masculino (P < 0,05. Em relação a idade, as crianças da faixa de 11 a 13 anos revelaram-se em média mais temerosas que as de 7 a 9 anos. Quanto ao controle percebido as crianças mais novas percebem mais controle do que as mais velhas. Em geral os dados indicam que valores mais altos de medo relacionam-se com valores mais baixos de controle percebido. As crianças que tinham realizado tratamento odontológico com anestesia mostraram-se mais temerosas do que aquelas que não foram submetidas a anestesia, o que permite inferir que a etiologia de medo pode relacionar-se a esse procedimento que pode envolver a percepção de incontrolabilidade.

  9. Closed-loop focal plane wavefront control with the SCExAO instrument

    Science.gov (United States)

    Martinache, Frantz; Jovanovic, Nemanja; Guyon, Olivier

    2016-09-01

    Aims: This article describes the implementation of a focal plane based wavefront control loop on the high-contrast imaging instrument SCExAO (Subaru Coronagraphic Extreme Adaptive Optics). The sensor relies on the Fourier analysis of conventional focal-plane images acquired after an asymmetric mask is introduced in the pupil of the instrument. Methods: This absolute sensor is used here in a closed-loop to compensate for the non-common path errors that normally affects any imaging system relying on an upstream adaptive optics system.This specific implementation was used to control low-order modes corresponding to eight zernike modes (from focus to spherical). Results: This loop was successfully run on-sky at the Subaru Telescope and is used to offset the SCExAO deformable mirror shape used as a zero-point by the high-order wavefront sensor. The paper details the range of errors this wavefront-sensing approach can operate within and explores the impact of saturation of the data and how it can be bypassed, at a cost in performance. Conclusions: Beyond this application, because of its low hardware impact, the asymmetric pupil Fourier wavefront sensor (APF-WFS) can easily be ported in a wide variety of wavefront sensing contexts, for ground- as well space-borne telescopes, and for telescope pupils that can be continuous, segmented or even sparse. The technique is powerful because it measures the wavefront where it really matters, at the level of the science detector.

  10. O Controle Externo das Obras Públicas: Um Panorama Sobre os Principais Aspectos Relacionados ao Tema

    Directory of Open Access Journals (Sweden)

    Glinton José Bezerra de Carvalho Ferreira

    2011-12-01

    Full Text Available O forte avanço das obras públicas nos dias atuais se constitui em elemento propulsor da economia nacional, contribuindo para o desenvolvimento da infraestrutura e favorecendo o crescimento do país. Na contramão da história, permanecemos ainda contaminados pela ganância de alguns gestores, que se utilizam indevidamente do poder publico para a satisfação de interesses particulares, quando deveriam administrar buscando a proteção do patrimônio publico e do interesse social, haja vista estar sob a responsabilidade coletiva o pagamento dos tributos que garantem a receita estatal. Os mecanismos de controle surgem como uma das esperanças da sociedade para manter a predominância do interesse publico sobre o particular. No âmbito do controle externo, os Tribunais de Contas começam a ganhar maior notoriedade e respeito social, em razão do trabalho técnico, ético e fundamentado com que avaliam os atos dos gestores concernentes aos dispêndios públicos realizados, em especial no que se refere as obras públicas, em razão das vultosas cifras aplicadas. Neste contexto, o presente trabalho pretende mostrar um panorama dos principais aspectos relacionados a atuação do controle externo na fiscalização das obras públicas.

  11. Da ortopedia ao controle do corpo: o discurso da saúde na publicidade

    Directory of Open Access Journals (Sweden)

    Luciane Lucas

    2008-09-01

    Full Text Available RESUMO Este artigo aborda as transformações da concepção de corpo da sociedade disciplinar – Foucault – para a de controle – Deleuze –, com base na análise das representações de corpo presentes em anúncios3 de medicamentos e cosméticos em dois momentos da publicidade brasileira: a década de 1920 e a atualidade – segunda metade da década de 1990 até o presente momento. Embora os cuidados com o corpo tenham se transformado significativamente ao longo do século passado, observa-se, nas campanhas e peças analisadas, que a noção de imperfeição e a necessidade de aprimoramento permanecem como traço constitutivo do imaginário de corpo. Palavras-chave: Corpo; publicidade brasileira; medicamento; cosmético. ABSTRACT This article deals with the transformations undergone by the conception of body, from the disciplinary society – Foucault – to the society of control – Deleuze –, using as our starting point representations of the body found in advertisements for medicines and cosmetics in two moments of Brazilian publicity: the 1920’s and now – from the second half of the 1990’s to the present day. In spite of significant changes in body care throughout the 20th century, we can notice in the campaigns and advertisements under analysis that the notions of imperfection and the need of improvement are still constituent features in the cultural imaging of the body. Keywords: Body; Brazilian advertising; medicine; cosmetic.

  12. Fatores associados ao controle da asma em pacientes pediátricos em centro de referência

    OpenAIRE

    Kinchoku, Vanessa Mika; Oliveira, Irai Santana; Watanabe, Letícia Abe; Fomin, Ângela Bueno F; Castro, Ana Paula B. M; Jacob, Cristina Miuki A; Pastorino, Antonio Carlos

    2011-01-01

    OBJETIVO: Descrever os dados epidemiológicos, clínicos e os fatores associados ao controle da asma em pacientes asmáticos seguidos em um ambulatório pediátrico especializado. MÉTODOS: Estudo transversal de pacientes asmáticos ambulatoriais, para os quais eram fornecidas medicações profiláticas. A classificação da asma, as etapa de tratamento e a avaliação do controle seguiram a IV Diretrizes Brasileiras para o Manejo da Asma, de 2006. Os fatores avaliados foram: outras alergias, obesidade, im...

  13. Da Disciplina ao Controle: Contribuições de Focault e Deleuze para Pensar o Trabalho na Contemporaneidade

    OpenAIRE

    Alves,Daniela Alves de; Benites, Luiz Felipe Rocha

    2010-01-01

    Este artigo propõe fazer uma interlocução entre algumas teorias que dão conta das configurações de poder na sociedade contemporânea bem como articulá-las com as transformações mais recentes no mundo do trabalho. Parte da vigência da sociedade disciplinar, explorada por Michel Focault e direciona-se à passagem histórica para a sociedade de controle, apontada timidamente por Focault e desenvolvida por Gilles Deleuze e Michael Hardt. Quanto ao trabalho na sociedade contemporânea, aponta as trans...

  14. Controle dos recursos locals através da contabilidade pública: a transformalçao do processo do antigo ao novo regime

    OpenAIRE

    Campos Luceno, María Soledad

    2012-01-01

    Durante muito  tempo, a precariedade firlanceira do Eslado colidia com a prosperidade dos recursos locais. Isto se viu agravado no ultimo périodo do Antigo Regime com a perda das colonias, principal fonte de ingressos do Estado, assim como pelos conflitos bélicos nos que o pais esteve imerso, que aumentaram os gastos. Esta situaçao levou a que os distintos governos que se sueederam na Espallha desde a metade do seculo XVII ate o final do XIX. tivessem um objetivo comun, o comtrole dos recurso...

  15. Resistência de biótipos de arroz-vermelho aos herbicidas imazapyr + imazapic e alternativas de controle

    Directory of Open Access Journals (Sweden)

    Rafael Salles Rubin

    2014-10-01

    Full Text Available O uso intenso de herbicidas com o mesmo mecanismo de ação na cultura do arroz (Oryza sativa L. tem selecionado biótipos resistentes, como, por exemplo, o arroz-vermelho (planta daninha resistente aos herbicidas imidazolinonas. Por essa razão, este trabalho foi desenvolvido com o objetivo de avaliar a resistência de arroz-vermelho ao herbicida imazapyr + imazapic, na região sul do Rio Grande do Sul, e o controle do biótipo resistente de arroz-vermelho com os herbicidas alternativos clethodim e glyphosate. Foram realizados três experimentos, em delineamento casualizado, arranjados em esquema fatorial. No primeiro experimento, o fator A testou biótipos de arroz-vermelho [ORYSA 184 (resistente e ORYSA 188 (susceptível], o fator B comparou herbicidas (imazapyr + imazapic, clethodim e glyphosate e o fator C avaliou doses dos herbicidas (0; 0,5; 1; 2; 4; 8; 16 e 32 vezes a dose recomendada. No segundo, compararam-se biótipos de arroz-vermelho e doses do herbicida imazapyr + imazapic (0; 0,5; 1; 2; 4; 8; 16; 32 e 64 vezes a dose recomendada. No terceiro, testaram-se biótipos de arroz-vermelho e doses diferentes do herbicida imazapyr + imazapic para cada biótipo. O biótipo ORYSA 184 é resistente ao imazapyr + imazapic, quando aplicada a dose máxima de registro e estádio indicado. Os herbicidas clethodim e glyphosate, detentores de mecanismos de ação alternativos, controlam o biótipo resistente ORYSA 184 de arroz-vermelho.

  16. Controle estatístico de processo aplicado ao monitoramento de envase da tintura de iodo

    Directory of Open Access Journals (Sweden)

    Paulo Alexandre Nunes Neto

    2010-06-01

    Full Text Available A aplicação do controle estatístico para monitorar o desempenho da etapa de envase de formas farmacêuticas líquidas consiste em obter informações e estabelecer estratégias para a validação do processo, assim como possibilitar o gerenciamento deste a partir da percepção do comportamento das variáveis críticas do produto durante a produção. Esta etapa do processo possui como variável crítica o volume de envase. Variações neste parâmetro fora dos limites de qualidade pré-estabelecidos pela legislação refletem ineficiências durante o processo podendo ocasionar a reprovação do produto. Para demonstrar de forma objetiva o grau de segurança requerida para este tipo de processo foram utilizadas ferramentas do controle estatístico de processo (CEP para estudar e validar o desempenho da etapa de envase da tintura de iodo fabricada pela indústria farmacêutica Lapon Química e Natural Ltda. (Limoeiro - PE, Brasil, bem como verificar a estabilidade estatística e capacidade do processo. As atividades de melhoria, através da identificação e eliminação das causas especiais de variação do processo, permitiram a redução de sua variabilidade, assegurando uma melhoria contínua da qualidade nos resultados da produção. Palavras-chave: Controle estatístico de processo. Monitoramento de envase. Validação de processo. Tintura de iodo. ABSTRACT Statistical process control applied to used in monitoring the iodine tincture fill phase Statistical control is used to monitor the performance of the fill phase in the manufacture of liquid pharmaceutical forms, to obtain information and establish criteria for process validation, as well as to enable control of the process, by observing the behavior of the critical variables during production. The critical variable at this stage of the process is the filling volume. Variations in this parameter outside the established legal quality limits reflect inefficiency in the process that may

  17. Da disciplina ao controle: novos processos de subjetivação no mundo do trabalho

    Directory of Open Access Journals (Sweden)

    Attila Magno e Silva Barbosa

    2012-12-01

    Full Text Available http://dx.doi.org/10.5007/2175-7984.2012v11n22p75 Partindo do pressuposto de que as relações de poder são contextuais, históricas e em constante transformação, este artigo tem como objetivo refletir sobre a passagem da chamada sociedade disciplinar para a sociedade de controle. Tomaremos como referência o “mundo do trabalho” por entendermos que nele testemunhamos a constituição de um novo processo de subjetivação em que a disciplina, antes circunscrita em um sistema fechado – no caso em questão, a fábrica –, deu lugar a formas de controle que se estendem por todas as esferas da vida social. Para nós, o suporte discursivo desse novo dispositivo de poder seria o discurso do trabalhador como  empreendedor de si mesmo”. Iniciaremos nossa discussão versando sobre a analítica do poder de Foucault, mais precisamente sobre a noção de sociedade disciplinar que teria tido seu apogeu no início do século XX e desde então teria perdido força e cedido lugar à sociedade de controle, esta noção melhor desenvolvida por Deleuze. Nesse sentido, refletiremos sobre a ocorrência de um novo processo de subjetivação e como novas formas de controle passam a ser exercidas no mundo do trabalho.

  18. Diagnóstico do controle e perfil de sensibilidade de nematódeos de ovinos ao albendazol e ao levamisol no norte de Minas Gerais

    Directory of Open Access Journals (Sweden)

    Eduardo R. Duarte

    2012-02-01

    Full Text Available A resistência anti-helmíntica é um dos principais entraves para o controle da verminose em ruminantes e a presença de nematódeos multiresistentes pode inviabilizar a atividade em uma determinada área. Neste trabalho o objetivo foi avaliar a eficácia anti-helmíntica do levamisol e do albendazol em rebanhos ovinos do norte de Minas Gerais. O teste foi realizado em dez propriedades, onde foram selecionados três grupos de 12 borregos cada. Dois desses grupos foram tratados respectivamente com levamisol (5 mg/kg pc ou albendazol (10 mg/kg pc e o terceiro grupo não foi tratado. Fezes foram coletadas antes do tratamento e no sétimo dia após, para a realização do teste de redução de ovos por grama de fezes. Foi realizado o cultivo de larvas provenientes dos grupos avaliados para a identificação dos principais gêneros de nematódeos gastrintestinais antes e após os tratamentos. Para todos os rebanhos avaliados no norte de Minas Gerais, o levamisol apresentou eficácia anti-helmíntica elevada, variando de 90% a 100%. Apenas para um rebanho o albendazol seria efetivo e para seis propriedades as eficácias dessa droga foram inferiores a 80%, sendo considerada insuficientemente ativa. Após as coproculturas foram identificadas, em maior ocorrência, larvas dos gêneros Haemonchus e Trichostrongylus. O gênero Haemonchus foi o mais prevalente mesmo após o tratamento dos ovinos. Ressalta-se neste estudo a importância do teste de eficácia in vivo para a escolha das bases anti-helmínticas nas propriedades, pois foi observado que o perfil de susceptibilidade variou entre os diferentes rebanhos.

  19. AVALIAÇÃO DOS BENEFÍCIOS SECUNDÁRIOS DE PROJETOS MDL: CONTRIBUIÇÃO AO CONTROLE DE POLUIÇÃO E AO DESENVOLVIMENTO LOCAL E REGIONAL

    Directory of Open Access Journals (Sweden)

    Pedro Camargo Amaral

    2011-05-01

    Full Text Available Considerando o aumento da importância de poluentes locais, regionais e globais nas atividades humanas, notados os acordos internacionais para controlar e reduzir as emissões de gases de efeito estufa destaca-se o Mecanismo de Desenvolvimento Limpo do Protocolo de Kyoto, como ferramenta para promover a redução de emissões de GEE e contribuir para o controle de poluição e desenvolvimento local e regional. Dentro do processo de aprovação de projetos de MDL no Brasil, existe a necessidade de se atender aos critérios relacionados à sustentabilidade local, definidos pelo governo brasileiro no documento denominado Anexo III. O presente estudo busca avaliar o processo que culminou com a definição dos critérios de sustentabilidade para projetos de MDL no Brasil e avaliar o impacto local e regional de projetos aprovados pelo governo brasileiro, no que concerne os poluentes ambientais CO, NOx, SOx, MP e hidrocarbonetos, assim como impactos diretos à fauna, flora e recursos hídricos. Para a avaliação dos projetos foi proposta uma metodologia, baseada em metodologias previamente sugeridas para avaliação de projetos de MDL. Concluí-se que os critérios estabelecidos para o Anexo III contemplam, em essência, os critérios sugeridos nos trabalhos que antecederam sua definição. Por outro lado, é notável a diminuição do peso de benefícios secundários no mecanismo, como critérios obrigatórios ou classificatórios, quando se comparam as idéias originais àquelas que de fato foram implementadas. Ao mesmo tempo, devem ser valorizados os impactos secundários positivos advindos dos projetos de MDL, notados àqueles apresentados neste trabalho. Ressalta-se que os impactos ambientais positivos são extremamente relacionados ao menor consumo de combustíveis fósseis (não desconsiderando também a menor necessidade de produção dos mesmos e aos impactos associados a estes combustíveis.

  20. An ecosystem approach to malaria control in an urban setting Uma abordagem ecossistêmica ao controle da malária em contexto urbano

    Directory of Open Access Journals (Sweden)

    Gabriel Carrasquilla

    2001-01-01

    Full Text Available We conducted a research project aimed at strengthening local government and the community for a sustainable malaria control strategy. The project began with a baseline diagnosis of malaria prevalence, a KAP survey, entomology, and health services delivery, after which an epidemiological study was performed to identify risk factors associated with malaria, thereafter used to plan intervention measures. A program evaluation was conducted five years later. By using an ecosystem approach to reanalyze data, this paper discusses how malaria arises from a complex interaction of cultural, economic, ecological, social, and individual factors. Intervention measures require an intersectorial and transdisciplinary approach that does not exist at the moment. Health sector leadership is limited, and there is no true community participation. Implications for research, including the use of qualitative and quantitative methods, study design, and complexity of data analysis are discussed. Finally, implications for malaria control are discussed, stressing the differences between the ecosystem and integrated disease control approaches.Os autores implementaram um projeto de pesquisa voltado ao fortalecimento do governo local e da comunidade com vistas à estratégia sustentável de controle da malária. O projeto iniciou com diagnóstico prévio, incluindo prevalência da malária, entomologia, KAP (conhecimentos, atitudes e práticas e oferta de serviços de saúde; a seguir, realizou-se inquérito epidemiológico para identificar fatores de risco associados à malária e a escolha de medidas de intervenção adequadas. O programa foi avaliado após cinco anos. Ao adotar a abordagem ecossistêmica para re-analisar os dados, o artigo discute como a malária surge a partir da interação complexa entre fatores culturais, econômicos, ecológicos, sociais e individuais. Medidas de intervenção exigem abordagem intersetorial e transdisciplinar ainda não existente. A

  1. Fatores para não-adesão ao programa de controle da hipertensão arterial em Campo Grande, MS

    Directory of Open Access Journals (Sweden)

    Lia Lusitana Cardozo Castro

    2010-06-01

    Full Text Available A adesão ao tratamento farmacológico em doenças crônicas como a hipertensão arterial, é fundamental para o controle, prevenção de complicações e diminuição da mortalidade. Identificar os fatores que levam a não adesão ao programa de controle de hipertensão arterial, em Unidades Básicas de Saúde de Campo Grande, MS e produzir um modelo de predição desta condição foi o objetivo do presente estudo. Utilizou-se o método de caso-controle, aninhado a coorte de pacientes cadastrados no programa, no período de 2002 a 2005. Foi utilizada regressão logística tendo como variável-resposta ‘adesão ao programa’. As associações significativas identificadas na análise univariada foram: características socioeconômicas, da doença, do tratamento e as relacionadas ao programa. Para prever a adesão, mantiveram-se no modelo as seguintes variáveis: dificuldade em ir ao programa, renda familiar, presença de diabetes, escolaridade e viver com companheiro. Com base no modelo, a probabilidade do paciente ser classificado corretamente como aderente, é de aproximadamente, 80% e como não aderente, 67%. O modelo identifica precocemente, pacientes vulneráveis à não adesão ao programa propiciando que este institua medidas voltadas aos prováveis, não aderentes. Palavras-chave: Hipertensão arterial. Programa de controle da hipertensão. Estudo caso-controle. Modelo de predição. Farmacoepidemiologia. ABSTRACT Factors for nonadherence to the Arterial Hypertension Control Program in Campo Grande, MS, Brazil Introduction: Adherence to the pharmacological treatment of chronic diseases such as arterial hypertension is decisive in their control, in preventing complications, and in decreasing mortality rates. Objective: To identify factors that led patients to drop out of an arterial hypertension control program available at local district clinics of the government-run National Health Service in Campo Grande, MS, Brazil, and to design a

  2. Sistematização da assistencia de enfermagem : visita pre-operatoria a pacientes submetidos a revascularização do miocardio

    OpenAIRE

    Carin de Freitas Nomi Cordeiro

    2001-01-01

    Resumo: O presente trabalho tem como objetivos analisar a assistência pré-operatória de enfermagem, pela ótica dos pacientes em pós-operatório de revascuIarizaçãodo miocárdio, e identificar a contribuição da visita pré-operatória de enfermagem - VPreOE - na assistência aos pacientes. A opção por pacientes submetidos a cirurgia cardíaca deve-se, particularmente, à estigmatização do órgão afetado (coração - órgão vital de extrema importância) e sua associação à vida e à morte, à complexidade e ...

  3. Meloxicam associado ou não ao tramadol no controle da dor após ovário-histerectomia videoassistida em cadelas

    Directory of Open Access Journals (Sweden)

    M.T. Oliveira

    2016-02-01

    Full Text Available O objetivo deste estudo foi avaliar a eficácia do meloxicam associado ou não ao tramadol, no controle da dor após ovário-histerectomia (OVH laparoscópica com dois portais. Foram selecionadas 14 cadelas hígidas. Os animais foram separados de forma aleatória, em dois grupos. O grupo M (GM recebeu meloxicam (0,2mg kg-1, s.i.d., enquanto os animais do grupo MT (GMT receberam a associação de meloxicam (0,2mg kg-1, s.i.d. e tramadol (4mg kg-1, t.i.d., ambos durante dois dias de pós-operatório. Para avaliação da dor pós-cirúrgica, foram utilizadas as escalas de Melbourne e escala visual analógica (EVA, além de mensurações de glicemia e cortisol sérico. Não houve diferença ao se avaliarem os grupos GM e GMT pela escala de Melbourne nem pela EVA. As mensurações de cortisol não atingiram valores superiores aos de referência para a espécie, enquanto os valores de glicemia não apresentaram variação significativa ao longo do tempo de avaliação nem entre grupos. Com os resultados deste estudo, foi possível concluir que a utilização de meloxicam associado ou não ao tramadol, nas doses e posologias propostas, é eficaz para controlar a dor pós-operatória de cadelas submetidas à OVH laparoscópica com dois portais.

  4. Adesão ao tratamento e controle da pressão arterial por meio da monitoração ambulatorial de 24 horas

    Directory of Open Access Journals (Sweden)

    Guilherme Brasil Grezzana

    2013-04-01

    Full Text Available FUNDAMENTO: A hipertensão arterial sistêmica (HAS é um importante fator de risco cardiovascular, no entanto os níveis de controle pressórico persistem inadequados. A avaliação da adesão ao tratamento anti-hipertensivo com a utilização da monitoração ambulatorial da pressão arterial (MAPA de 24 horas pode representar um importante auxílio na busca de metas de controle da HAS. OBJETIVO: Avaliar a adesão ao tratamento anti-hipertensivo e a sua relação com os valores de PA obtidos pela MAPA de 24 horas entre pacientes hipertensos de centros de atenção primária à saúde (APS. MÉTODOS: Estudo transversal com 143 pacientes hipertensos de amostra representativa de serviço de APS do município de Antônio Prado, RS. Foi realizada aplicação do teste de Morisky e Green para avaliar a aderência ao tratamento e a verificação do número de medicamentos utilizados, seguida pela aplicação da MAPA de 24 horas. RESULTADOS: Observou-se que 65,7% da amostra foram considerados aderentes ao tratamento proposto, 20,3% eram moderadamente aderentes, enquanto somente 14% foram classificados como não aderentes. Do total de 143 pacientes avaliados, 79 (55,2% foram identificados como HAS controlada (130/80 mmHg, 103 (72% apresentaram ausência de descenso noturno da PA e 60 (41,9% não estavam controlados durante o período de vigília. CONCLUSÃO: Verificamos, no presente estudo, que não há um controle adequado da HAS, com consequente perda de oportunidade dos profissionais envolvidos na APS de ajuste adequado das metas de PA preconizados. Esse fato ocorre a despeito de apropriada adesão ao tratamento anti-hipertensivo dos pacientes vinculados ao ambulatório de APS.

  5. AO Group Annual Report

    Energy Technology Data Exchange (ETDEWEB)

    Olivier, S

    2005-10-04

    The Adaptive Optics (AO) Group in I Division develops and tests a broad range of advanced wavefront control technologies. Current applications focus on: Remote sensing, High power lasers, Astronomy, and Human vision. In the area of remote sensing, the AO Group leads a collaborative effort with LLNL's Nonproliferation, Arms Control & International Security (NAI) Directorate on Enhanced Surveillance Imaging. The ability to detect and identify individual people or vehicles from long-range is an important requirement for proliferation detection and homeland security. High-resolution imaging along horizontal paths through the atmosphere is limited by turbulence, which blurs and distorts the image. For ranges over {approx}one km, visible image resolution can be reduced by over an order of magnitude. We have developed an approach based on speckle imaging that can correct the turbulence-induced blurring and provide high resolution imagery. The system records a series of short exposure images which freeze the atmospheric effects. We can then estimate the image magnitude and phase using a bispectral estimation algorithm which cancels the atmospheric effects while maintaining object information at the diffraction limit of the imaging system.

  6. Development of software for management of radioactive waste in biological research and clinical assistance; Desenvolvimento do software para gerenciamento de rejeitos radioativos em pesquisa biologica e assistencia clinica

    Energy Technology Data Exchange (ETDEWEB)

    Maciel, Bianca; Mattos, Maria Fernanda S.S.; Medeiros, Regina B. [Universidade Federal de Sao Paulo (UNIFESP/EPM), Sao Paulo, SP (Brazil). Dept. de Diagnostico por Imagem. Nucleo de Protecao Radiologica; Franca Junior, Jose Antonio de, E-mail: fernanda@cfhr.epm.b, E-mail: rbitelli@cfhr.epm.b, E-mail: jafjunior@unifesp.b [Universidade Federal de Sao Paulo (UNIFESP/EPM), Sao Paulo, SP (Brazil). Dept. de Tecnologia da Informacao. Div. de Sistema de Informacao

    2011-10-26

    This paper describes the development of software which facilitates the automation of this process by mean of the Safety Analysis Report generating a data base allowing the statistic analysis and elaboration of radioactive wastes inventory. The software was developed in PHP language and the information is stored in a data base generated in Oracle and organized in different tables which allows to calculate the storage time of waste and to register the specificities of radioisotopes, cadastral data of the professionals which handle that radioisotope and also the characteristics of handling laboratories. That tool collaborates for a effective control on the use of radioisotopes in research laboratories and assistance areas as well

  7. Community participation in mosquito breeding site control : an interdisciplinary mixed methods study in Curaçao

    NARCIS (Netherlands)

    Elsinga, Jelte; van der Veen, Henry T; Gerstenbluth, Izzy; Burgerhof, Johannes G M; Dijkstra, Arie; Grobusch, Martin P; Tami, Adriana; Bailey, Ajay

    2017-01-01

    BACKGROUND: As the arboviral diseases dengue, chikungunya and Zika emerge in the Americas, so does the need for sustainable vector control policies. To successfully achieve mosquito control, joint efforts of both communities and governments are essential. This study investigates this important, but

  8. Automedida da pressão arterial para o controle das cifras tensionais e para a adesão ao tratamento

    Directory of Open Access Journals (Sweden)

    Weimar Kunz Sebba Barroso Souza

    2012-02-01

    Full Text Available FUNDAMENTO: A medida da pressão arterial (PA pelo próprio paciente, sem protocolos rígidos, com treinamento adequado, aparelhos validados e no próprio domicílio, é definida como automedida da pressão arterial (AMPA. OBJETIVO: Avaliar a interferência da AMPA na adesão ao tratamento e no controle pressórico. MÉTODOS: Participaram do estudo 57 pacientes, 38 no grupo de estudo (GE e 19 no grupo de controle (GC. Esses pacientes foram seguidos por 12 meses e avaliados na randomização (V1, bem como no sexto (V2 e no décimo segundo mês (V3. Comparadas as médias da PA pela medida casual, pela AMPA e pela monitorização ambulatorial da pressão arterial (MAPA, exames laboratoriais e as respostas ao questionário sobre o estilo de vida. Os aparelhos utilizados foram: OMRON HEM 714, para a AMPA; OMRON 705 CP, para a medida casual; e Monitor SPACELABS 9002, para a MAPA. RESULTADOS: A idade média em anos foi de 62,05 ± 10,78 e de 55,42 ± 11,87 no GE e no GC (p = 0,03, respectivamente. Os valores da pressão arterial sistólica (PAS pela medida casual no GE e no GC foram: 140,01 ± 16,73 mmHg e 141,79 ± 23,21 mmHg em V1 (p = 0,72; 135,49 ± 12,73 mmHg e 145,69 ± 19,31 mmHg em V2 (p = 0,02; 131,64 ± 19,28 mmHg e 134,88 ± 23,21 mmHg em V3 (p = 0,59. Os valores da pressão arterial diastólica (PAD foram: 84,13 ± 10,71 mmHg e 86,29 ± 10,35 mmHg em V1 (p = 0,47; 81,69 ± 10,88 mmHg e 89,61 ± 11,58 mmHg em V2 (p = 0,02; 80,31 ± 11,83 mmHg e 86 ± 13,38 mmHg em V3 (p = 0,12. CONCLUSÃO: Os pacientes do GE apresentaram adesão ao tratamento não farmacológico semelhante ao GC, mas tiveram maior adesão ao tratamento medicamentoso e utilizaram menor número de drogas anti-hipertensivas. Não houve diferença entre os grupos na comparação do perfil metabólico e da função renal. (Arq Bras Cardiol. 2011; [online].ahead print, PP.0-0

  9. Uso da bandagem elástica associada ao tratamento fonoaudiológico no controle da sialorréia

    Directory of Open Access Journals (Sweden)

    Wanessa Furtado Caneschi

    2014-10-01

    Full Text Available OBJETIVO:verificar a efetividade do uso da bandagem elástica associada ao tratamento fonoaudiológico no controle da sialorréia.MÉTODOS:estudo longitudinal realizado com onze crianças com quadro de sialorréia crônica e alteração neurológica. Foi verificada a percepção do fonoaudiólogo e do responsável acerca da gravidade e o número de toalhas/paninhos de boca utilizados ao dia. Empregou-se também a sialometria. Cada participante recebeu a aplicação da bandagem elástica Kinesio Tape na região da musculatura supra-hióidea por 30 dias. As crianças foram avaliadas sem a bandagem (T0, imediatamente após a retirada da bandagem (T1 e três meses após (T2. O tratamento fonoaudiológico foi realizado pelo o mesmo profissional em duas sessões semanais. Os dados foram analisados estatisticamente.RESULTADOS:no questionário verificou-se redução da queixa de engasgos com saliva em T1 (p=0,024.A média de uso diário de toalhas/paninhos era de quatro (10,2% em T0, duas (5,1% em T1 e quatro (10,2% em T2.De acordo com a sialometria, verificou-se redução da sialorréia de T0 para T1 (p=0,018 e ausência de diferença entre T0 e T2 (p=0,215 e aumento de T1 para T2 (p=0,05.De acordo com a percepção do fonoaudiólogo houve redução da sialorréia 30 dias após o uso da bandagem, entretanto não se observou melhora ao se comparar os resultados 30 dias após o uso e três meses sem a bandagem.CONCLUSÃO:a bandagem elástica se mostrou eficaz no controle da sialorréia durante seu período de uso, não sendo observada permanência dos resultados após interrupção da aplicação.

  10. FRIGMOBILE: APLICATIVO MÓVEL DIRECIONADO AO CONTROLE COMERCIAL E DE ESTOQUES EM REDES FRIGORÍFICAS

    Directory of Open Access Journals (Sweden)

    Rodrigo C. Borges

    2015-03-01

    Full Text Available Advances in telecommunications, networking technologies and portable devices, makes mobile computing is an emerging paradigm on its ability to interact and distribution of information. Mobile computing enhances the ability to migrate physically computational services. The computer becomes an ever present device, expanding the ability of a user to use the services found in typical networks. Given the above, this work aims at applying the mobile computing scenario for the marketing and storage of slaughterhouse. The proposal is a system to assist in internal and external administrative control of the sector, implementing a mobile application directed to the Android operating system.

  11. MANEJO FITOTÉCNICO DA BANANEIRA, CULTIVAR D' ANGOLA (AAB, VISANDO AO CONTROLE DA SIGATOKA-NEGRA

    Directory of Open Access Journals (Sweden)

    MARIA DE JESUS BARBOSA CAVALCANTE

    2014-01-01

    Full Text Available The objective of this work was to evaluate management systems for the control of Black Siga- toka in the cultivation of banana D'Angola cultivar. The experiment was installed and carried out at Embrapa Acre, Rio Branco - AC with the treatments distributed in randomized complete blocks with six replications consisting of different planting densities, corresponding to T1 - (1.111 plants ha-1; T2 - 1.666 plants ha-1; T3 - 2.000 plants ha-1; T4 - 1.333 plants ha-1; T5 - 2.500 plants ha-1 and; T6 - 1.111 plants ha-1 under rubber trees. The evaluations were carried out during two cycles of production. Plants of cv. D'Angola (AAB cultivated in 3.0 x 3.0 m, shaded by the rubber trees, presented higher plant height, higher number of functional leaves at flowering and harvest, higher average bunch weight, greater weight of the bunches, longer cycle production and reduced severity of black sigatoka. Highest yields were obtained when we adopted higher densities. The banana intercropping with rubber trees proved to be a good alternative to permit cultivation of cv. D'Angola (long banana.

  12. Fuzzy logic applied to the control of the energy consumption in intelligent buildings; Logica fuzzy aplicada ao controle do consumo de energia eletrica em edificios inteligentes

    Energy Technology Data Exchange (ETDEWEB)

    Costa, Herbert R. do N.

    1998-02-01

    This work shows a study on the using of fuzzy control algorithms for the energy optimization of a standard building. The simulation of this type of control was performed using a central conditioned air model and the fuzzy control architecture already used in various control projects. This situation allowed a comparative study among the the control algorithms normally used in conditioned air installations, and the control performed through the building automation system, using an algorithm based on fuzzy logic.

  13. Adesão ao tratamento e controle da pressão arterial por meio da monitoração ambulatorial de 24 horas Blood pressure treatment adherence and control through 24-hour ambulatory monitoring

    Directory of Open Access Journals (Sweden)

    Guilherme Brasil Grezzana

    2013-04-01

    Full Text Available FUNDAMENTO: A hipertensão arterial sistêmica (HAS é um importante fator de risco cardiovascular, no entanto os níveis de controle pressórico persistem inadequados. A avaliação da adesão ao tratamento anti-hipertensivo com a utilização da monitoração ambulatorial da pressão arterial (MAPA de 24 horas pode representar um importante auxílio na busca de metas de controle da HAS. OBJETIVO: Avaliar a adesão ao tratamento anti-hipertensivo e a sua relação com os valores de PA obtidos pela MAPA de 24 horas entre pacientes hipertensos de centros de atenção primária à saúde (APS. MÉTODOS: Estudo transversal com 143 pacientes hipertensos de amostra representativa de serviço de APS do município de Antônio Prado, RS. Foi realizada aplicação do teste de Morisky e Green para avaliar a aderência ao tratamento e a verificação do número de medicamentos utilizados, seguida pela aplicação da MAPA de 24 horas. RESULTADOS: Observou-se que 65,7% da amostra foram considerados aderentes ao tratamento proposto, 20,3% eram moderadamente aderentes, enquanto somente 14% foram classificados como não aderentes. Do total de 143 pacientes avaliados, 79 (55,2% foram identificados como HAS controlada (130/80 mmHg, 103 (72% apresentaram ausência de descenso noturno da PA e 60 (41,9% não estavam controlados durante o período de vigília. CONCLUSÃO: Verificamos, no presente estudo, que não há um controle adequado da HAS, com consequente perda de oportunidade dos profissionais envolvidos na APS de ajuste adequado das metas de PA preconizados. Esse fato ocorre a despeito de apropriada adesão ao tratamento anti-hipertensivo dos pacientes vinculados ao ambulatório de APS.BACKGROUND: Although systemic arterial hypertension (SAH is an important cardiovascular risk factor, blood pressure level control often remains inadequate. Assessment of adherence to antihypertensive treatment through 24-hour ambulatory blood pressure monitoring (ABPM may

  14. Incentivos ao investimento estrangeiro

    OpenAIRE

    Mendes, Valter Nuno Dias

    2015-01-01

    Dissertação de Mestrado apresentada ao Instituto de Contabilidade e Administração do Porto para a obtenção do grau de Mestre em Contabilidade e Finanças, sob orientação de Doutor José de Campos Amorim O presente estudo tem por tema os Incentivos ao Investimento Estrangeiro ao nível das pessoas singulares: o Regime Fiscal do Residente Não Habitual (RNH) e a Autorização de Residência para Atividade de Investimento (ARI) – Vistos Dourados (Golden Visa), tendo por objetivo a análise mais po...

  15. Controle de pragas e doenças, maturação e qualidade de maçãs 'imperial gala' submetidas ao ensacamento

    Directory of Open Access Journals (Sweden)

    Rosângela Teixeira

    2011-06-01

    Full Text Available O objetivo deste trabalho foi avaliar a eficiência de diferentes embalagens no ensacamento de maçãs para o controle de pragas e doenças, e sua influência na maturação e qualidade dos frutos, em pomar sob sistema orgânico. O experimento foi conduzido em pomar com plantas de dez anos de idade da cultivar Imperial Gala, sobre porta-enxerto 'Marubakaido', com filtro EM-9, localizado no município de São Joaquim-SC, nas safras 2007/2008 e 2008/2009. Os frutos foram ensacados, após o raleio, com embalagens plásticas transparentes microperfuradas ou de tecido não texturizado (TNT. Frutos não ensacados constituíram o tratamento-controle. Na colheita, os frutos foram avaliados quanto aos danos provocados por mosca-das-frutas (Anastrepha fraterculus, mariposa-oriental (Grapholita molesta, lagarta-enroladeira (Bonagota salubricola e pulgão-lanígero (Eriosoma lanigerum, incidência das doenças sarna-da-macieira (Venturia inaequalis e podridão-amarga (Colletotrichum gloeosporioides, e atributos físico-químicos de maturação e qualidade e teor de cálcio (Ca nos frutos. O ensacamento, independentemente do tipo de material utilizado, reduziu os danos de insetos-praga, porém não foi eficiente no controle de doenças nos frutos. O ensacamento não comprometeu o desenvolvimento de coloração vermelha na casca e o teor de Ca nos frutos. De modo geral, o ensacamento antecipou o processo de maturação, caracterizado pela redução na firmeza de polpa e na textura da casca e da polpa, e pelo aumento no índice de iodoamido.

  16. Development of a computational system for supporting to the wells control in deep water; Desenvolvimento de um sistema computacional para suporte ao controle de pocos em aguas profundas

    Energy Technology Data Exchange (ETDEWEB)

    Sotomayor, Gabriel Paulo Gutierrez

    1997-06-01

    This dissertation presents the development and application of a computational tool that works with an integrated vision of well control process and includes tasks related to the well design concerning safety, kick detection and circulation out of the well. This tool, named PROKICK, offers to the technical personnel involved in well control operations, functionality to operational procedures, pressure behavior prediction and preparation of killsheet for deepwater wells. Also, this tool supports the analysis of well control problems with knowledge systems, built production rules. (author)

  17. Control of glyphosate resistant hairy fleabane (Conyza bonariensis with dicamba and 2,4-D Controle de buva (Conyza bonariensis resistente ao glyphosate com dicamba e 2,4-D

    Directory of Open Access Journals (Sweden)

    D.J. Soares

    2012-06-01

    Full Text Available Auxyn type herbicides such as dicamba and 2,4-D are alternative herbicides that can be used to control glyphosate-resistant hairy fleabane. With the forthcoming possibility of releasing dicamba-resistant and 2,4-D-resistant crops, use of these growth regulator herbicides will likely be an alternative that can be applied to the control of glyphosate resistant hairy fleabane (Conyza bonariensis. The objective of this research was to model the efficacy, through dose-response curves, of glyphosate, 2,4-D, isolated dicamba and glyphosatedicamba combinations to control a brazilian hairy fleabane population resistant to glyphosate. The greenhouse dose-response studies were conducted as a completely randomized experimental design, and the rates used for dose response curve construction were 0, 120, 240, 480, 720 and 960 g a.i. ha-1 for 2,4-D, dicamba and the dicamba combination, with glyphosate at 540 g a.e. ha-1. The rates for glyphosate alone were 0, 180, 360, 540, 720 and 960 g a.e. ha-1. Herbicides were applied when the plants were in a vegetative stage with 10 to 12 leaves and height between 12 and 15 cm. Hairy fleabane had low sensitivity to glyphosate, with poor control even at the 960 g a.e. ha-1 rate. Dicamba and 2,4-D were effective in controlling the studied hairy fleabane. Hairy fleabane responds differently to 2,4-D and dicamba. The combination of glyphosate and dicamba was not antagonistic to hairy fleabane control, and glyphosate may cause an additive effect on the control, despite the population resistance.Os herbicidas mimetizadores de auxinas como dicamba e 2,4-D são alternativas para o controle de buva resistente ao glyphosate. Com a possível futura liberação comercial de culturas resistentes ao dicamba e 2,4-D, a aplicação destes herbicidas reguladores de crescimento será uma provável alternativa de controle de buva resistente ao glyphosate. O objetivo desta pesquisa foi modelar por meio de curvas de dose-resposta a efic

  18. CONTROL TEST TO MICRO ACARID Aculops lycopersici (Massee, 1937 (ACARI: ERIOPHYIDAE ATTACKING TOMATO PLANT, USING A NEW ACARID-KILLER ENSAIO DE CONTROLE AO MICROÁCARO DO TOMATEIRO Aculops lycopersici (Massee, 1937 (Acari: Eriophyidae COM UM NOVO ACARICIDA

    Directory of Open Access Journals (Sweden)

    Roberto Magno de Castro e Silva

    2007-09-01

    Full Text Available

    This experiment was conducted in a tomato culture area in the surroundings of the Agronomy School of UFG with the objective of evaluate the effect of a new acarid-killer named avermectin against Aculops lycopersici (Massee, 1937, the tomato plant micro acarid. The experimental delineation used was random blocks with six treatments and four replicates. Treatments utilized were: Avermectin (Vertimec 18 CE, 50, 75 and 100 ml/100 1 of water; Cyhexatin (Plictran 50 BR 100 g/100 l of water; Sulphur (Kumulus 80% PM, 400g/100 1 of water and control. Pulverizations were made by using a portable costal sprayer, applying 30 ml of solution per plant. Estimations were made at 3, 7, 10, 14 and 21 days after treatments, sampling 10 leaves at random of 10 plants pertaining to 2 central lines of each parcel and counting the number of acarids aiming an area of 0.7 cm2/leaf. The results showed that the product avermectin was superior to other acarid-killers in all estimations realized, presenting a control efficiency close to 95% at smaller dosage, until 21 days. Cybexatin and sulphur reduced its efficiency during the experiment development.

    O experimento foi conduzido numa área de plantação de tomate, nas proximidades da Escola de Agronomia da UFG, com o objetivo de avaliar o efeito de um novo acaricida denominado avermectin, contra Aculops lycopersici (Massee, 1937, o microácaro do tomateiro. O delineamento experimental foi de blocos ao acaso com seis tratamentos e quatro repetições. Os tratamentos utilizados foram: Avermectin (Vertimec 18 CE, 50, 75 e 100 ml/l00 1 de água; Cyhexatin (Plictran 50 BR. 100 g/100 1 de água; Enxofre (Kumulus 80% PM. 400 g/100 1 de água e Testemunha. As aplicações foram efetuadas com um pulverizador costal manual jacto, gastando-se 30 ml de calda por planta. As avaliações foram realizadas

  19. Expression of Cry1Ac in transgenic tobacco plants under the control of a wound-inducible promoter (AoPR1) isolated from Asparagus officinalis to control Heliothis virescens and Manduca sexta.

    Science.gov (United States)

    Gulbitti-Onarici, Selma; Zaidi, Mohsin Abbas; Taga, Ibrahim; Ozcan, Sebahattin; Altosaar, Illimar

    2009-07-01

    Expression of cry1Ac gene from Bacillus thuringiensis (Bt) was evaluated under the control of a wound-inducible AoPR1 promoter from Asparagus officinalis in transgenic tobacco plants. The leaves of transgenic plants were mechanically wounded to evaluate the activity of the AoPR1 promoter in driving the expression of Cry1Ac protein at the wound site. Our results indicate that mechanical wounding of transgenic plants was effective in inducing the expression of Cry1Ac protein. As a result of this induction, the accumulated levels of Cry1Ac protein increased during 6-72 h post-wounding period. The leaves of transgenic tobacco plants were evaluated for resistance against Heliothis virescens and Manduca sexta in insect bioassays in two different ways. The detached tobacco leaves were either fed directly to the insect larvae or they were first mechanically wounded followed by a 72 h post-wounding feeding period. Complete protection of mechanically wounded leaves of transgenic plants was observed within 24 h of the bioassay. The leaves of transgenic plants fed directly (without pre-wounding) to the larvae achieved the same level of protection between 24 and 72 h of the bioassay.

  20. Estratégias de manejo de inverno e verão visando ao controle de Conyza bonariensis e Bidens pilosa Winter and summer management strategies for Conyza bonariensis and Bidens pilosa control

    Directory of Open Access Journals (Sweden)

    A.M. Oliveira Neto

    2010-01-01

    Full Text Available Conyza bonariensis é uma das principais plantas daninhas da região Sul do País; com a seleção de biótipos tolerantes e resistentes ao herbicida glyphosate, demandas são crescentes por alternativas de manejo para essa espécie. Com esse intuito, o objetivo do presente trabalho foi avaliar a eficiência de diferentes estratégias de manejo de inverno e de verão sobre o controle de Conyza bonariensis, utilizando a mistura em tanque de glyphosate+2,4-D associada ou não com herbicidas residuais. As combinações de manejo foram realizadas após a colheita do milho safrinha (manejo de inverno, associadas a manejos antecedendo a semeadura da soja (manejo de verão, totalizando 15 tratamentos. Os manejos de inverno avaliados foram eficientes na dessecação das plantas daninhas e mantiveram excelentes níveis de controle residual até a pré-semeadura da cultura da soja. A semeadura da aveia após o manejo de inverno com posterior manejo de verão com glyphosate+2,4-D+diclosulam mostrou-se eficiente no controle de Bidens pilosa. Em todos os manejos em que o herbicida 2,4-D foi associado ao glyphosate houve controle total de Conyza bonariensis.Conyza bonariensis is one of the most important weeds in southern Brazil. The selection of biotypes tolerant and resistant to the herbicide glyphosate has led to increasing demand for alternatives of management strategy to control this species. This work aimed to evaluate the efficiency of different winter and summer management strategy for the control of Conyza bonariensis, by using glyphosate + 2,4-D tank mixtures combined or not with residual herbicides. The different burndown alternatives were applied after corn harvest (winter burndown, associated to applications before soybean sowing (summer burndown with a total of 15 treatments. Winter burndown options evaluated in this research were efficient in weed desiccation and provided excellent levels of residual weed control up to the next summer soybean

  1. Carta ao Editor

    OpenAIRE

    Correia, Miguel

    2017-01-01

    Exmos. Senhores Editores-Chefe,Li com muito interesse o artigo de Sousa R e colaboradores, intitulado “Que fatores levam ao abandono de crianças do serviço de urgência antes da observação médica?”.

  2. Evaluation of quality control tools for patients submitted to IMRT; Avaliacao das ferramentas de controle da qualidade para pacientes submetidos ao IMRT

    Energy Technology Data Exchange (ETDEWEB)

    Lavor, Milton; Rodrigues, Laura N.; Silva, Marco A., E-mail: miltonlavor@gmail.com [Universidade de Sao Paulo (HCFMRP/USP), Sao Paulo, SP (Brazil). Hospital das Clinicas. Servico de Radioterapia

    2013-04-15

    Intensity modulated radiation therapy (IMRT) is currently being implemented in a rapidly growing number of centers in Brazil. As consequence many institutions are now facing the problem of performing a comprehensive quality control program before and during the implementation of IMRT in the clinical practice. This paper proposes a methodology for quality control and presents the results and evaluations of the data obtained from the proposed methodology. Ionization chamber and two-dimensional array detector were performed in IMRT treatment planning in order to assess the absolute value of the total dose of all fields. The relative total dose distribution of all fields was measured with a radiochromic film and a two-dimensional array in a phantom. A comparison between measured and calculated dose distributions was performed using the gamma-index method, assessing the percentage of points that meet the criteria of ±3% dose difference and ±3mm distance to agreement. As a result and review of 113 tested IMRT beams using ionization chamber and 81 using two-dimensional array, the proposal was to take an action level of about ±5% compared to the treatment planning systems and measurements, for the verification of the dose in a single point at the low gradient dose region. Analysis of the two-dimensional array measurements showed that the gamma value was <1 for 97.7% of the data and for the film the gamma value was <1 for 96.6% of the data. This work can establish action levels required for quality control program proposed and implemented in the Department of Radiotherapy - Hospital das Clinicas in Sao Paulo that allows an accurate delivery of dose in 'sliding-window' IMRT with micro multi leaf collimator. (author)

  3. Determinantes da adesão ao tratamento anti-retroviral em Brasília, DF: um estudo de caso-controle Determinants of antiretroviral treatment adherence in Brasília, Federal District: a case-control study

    Directory of Open Access Journals (Sweden)

    Cláudio Viveiros de Carvalho

    2007-10-01

    Full Text Available Buscou-se avaliar os fatores relacionados à adesão ao tratamento anti-retroviral no Distrito Federal. De 150 pacientes entrevistados em sete centros de referência, 35 não aderentes foram definidos como casos, sendo selecionados 70 controles aderentes, pareados por idade. Avaliaram-se variáveis sócio-demográficas, hábitos, suporte social, qualidade de vida, questões relacionadas a doença, estado clínico, tratamento e serviço. Na análise bivariada, houve associação da adesão com raça/cor, escolaridade, centros de referência em que faz acompanhamento e renda familiar. Após ajuste, cor parda, centros de referência localizado no Plano Piloto, escolaridade alta e receber apoio dos amigos quanto às necessidades permaneceram associados com adesão. Retirando raça/cor do modelo, mantiveram-se centros de referência, escolaridade, profissão, renda, apoio (contar com alguém que demonstre gostar de você e satisfação com o atendimento na farmácia de dispensação. Além dos fatores já consolidados na literatura, questões relacionadas ao apoio no âmbito micro-social e aos serviços de assistência mostraram-se associados à observância terapêutica.We sought to evaluate factors relating to adherence to antiretroviral treatment in the Federal District. Out of 150 patients interviewed at seven reference centers; 35 non-adherent subjects were considered to be cases; we selected 70 age-matched adherent individuals as controls. Variables relating to sociodemographics, habits, social support, quality of life, disease-related issues, clinical conditions, treatment and healthcare services were evaluated. Bivariate analysis showed that adherence was associated with race/color, educational level, the reference center where the patient was followed up and familial income. After adjustments, mixed race (parda, reference center location in central Brasília, high educational level and friends’ support for needs remained associated with

  4. Adesão ao tratamento e controle da pressão arterial em idosos com hipertensão Treatment adherence and blood pressure control in older individuals with hypertension

    Directory of Open Access Journals (Sweden)

    Rachel G. Bastos-Barbosa

    2012-07-01

    Full Text Available FUNDAMENTO: A não adesão ao tratamento tem sido identificada como a causa principal da Pressão Arterial (PA não controlada, e pode representar um risco maior em idosos. OBJETIVO: O objetivo deste estudo foi avaliar e comparar a taxa de adesão ao tratamento da hipertensão arterial por diferentes métodos, para estimar a taxa de controle da PA, e observar se há uma associação entre controle da pressão arterial e adesão. MÉTODOS: A adesão ao tratamento foi avaliada em pacientes idosos com hipertensão, acompanhados pelo serviço público de saúde, por meio de quatro métodos, incluindo o teste de Morisky-Green (referência, o questionário sobre atitudes referentes à ingestão de medicação (AMI, uma avaliação da adesão por parte do enfermeiro em consultório (AEC, e avaliação domiciliar da adesão (ADA. A ingestão de sal foi estimada pela excreção urinária de sódio de 24 horas. O controle da pressão arterial foi avaliado pelo monitorização ambulatorial da pressão arterial na vigília. RESULTADOS: A concordância entre o teste de Morisky-Green e o AMI (Kappa = 0,27 ou a AEC (Kappa = 0,05 foi pobre. Houve uma concordância moderada entre o teste de Morisky-Green e a ADA. Oitenta por cento tinham a PA controlada, incluindo 42% com efeito do jaleco branco. O grupo com menor excreção de sal relatou evitar o consumo de sal mais vezes (p BACKGROUND: Non-adherence to treatment has been identified as the main cause of uncontrolled blood pressure (BP, and may represent a greater risk in older individuals. OBJECTIVE: The aim of this study was to evaluate and compare the rate of adherence to hypertension treatment using different methods, to estimate the BP control rate, and to observe if there is an association between BP control and adherence. METHODS: Treatment adherence was evaluated in older patients with hypertension, followed by the public primary health care, through four methods, including the Morisky-Green test

  5. Tratamento das sementes com inseticidas, visando ao controle de pragas em culturas de arroz-de-sequeiro Seed treatment to control soil insects that attack the germinating rice seedlings

    Directory of Open Access Journals (Sweden)

    Derly Machado de Souza

    1972-01-01

    Full Text Available Com o intuito de testar a eficiência dos inseticidas Birlane 25% PM, nas dosagens de 400 e 600 g/60 kg de sementes, Aldrin 40% PM, na dosagem de 400 g/60 kg de sementes, e a mistura de Aldrin 27°/o PM + Birlane 25% PM, na dosagem de 400 g/ 60 kg de sementes, aplicados em mistura prévia com as sementes, visando ao controle das pragas de solo em cultura de arroz de sequeiro, foram instalados três experimentos em municípios paulistas e dois em municípios mineiros. Os esquemas estatísticos utilizados foram o quadrado latino 5x5 e blocos ao acaso com cinco tratamentos e cinco repetições. Os resultados mostraram eficiência dos produtos, isolados ou em mistura, nas dosagens empregadas, no controle do cupim e Elasmopalpus,durante o período inicial de desenvolvimento das plantinhas de arroz, que não apresentaram sintomas de fitotoxicidade. Embora a produção de arroz em casca não tenha mostrado diferença estatística significativa, entre os diferentes tratamentos e a testemunha, notou-se uma tendência de maior produção em todos canteiros tratados.Five comparative tests were carried out to compare the efficiency of two insecticides applied to rice seeds prior to sowing to control the attacks of termite (Cornitermes, spp. and lesser cornstalk borer Elasmopalpus llgnosellus(Zeller 1918 on the germinating seedlings. The insecticides tested were: (1 Birlane 25% WP at the rates of 400 g and 600 g per 60 kg of seeds; (2 Aldrin 40% WP at the rate of 400 g per 60 kg of seeds; and (3 a mixture Aldrin 27% a. i. and Birlane 25% of equal parts of the two at the rate of 400 g per 60 kg of seeds. These four treatments and the control were compared in five different localities (two rice growing areas in Minas Gerais and three in São Paulo. Four tests were planted in 5 x 5 Latin aquares and the fifth as a randomized block with five replications. The average results from the five tests indicate that all treatments were effective in increasing the stand

  6. Biological control agents (Arthropoda - Insecta associated with cultivation of the sugar apple (Annona squamosa L. = Agentes de controle biológico (Arthropoda - Insecta associados ao cultivo da pinha (Annona squamosa L.

    Directory of Open Access Journals (Sweden)

    Laise Malaspina Rossi

    2017-03-01

    Full Text Available Knowledge of biological control agents occurring naturally in agricultural areas is of great importance in adopting methods of integrated pest management. The aim of this work therefore, was to undertake a population survey of biological control agents (Insecta associated with cultivation of Annona squamosa. The research was carried out during the 2015/2016 harvest in a conventional orchard of A. squamosa, located in the town of Tabatinga in the State of São Paulo, Brazil. The biological control agents were captured using yellow sticky traps. The following faunistic indices were calculated: dominance, abundance, frequency and constancy. Population fluctuations in the natural enemies sampled were analysed by histogram. The coccinellid predators, Scymnus sp. (Coleoptera: Coccinellidae and Cycloneda sanguinea (Coleoptera: Coccinellidae were the principal biological control agents sampled during the study, and considered superdominant, superabundant, superfrequent and constant. As for population fluctuation of predominant natural enemies, high population density was seen in Scymnus sp. between September and January 2015, whereas there were three population peaks for C. sanguinea during the study, in September 2015 and January and July 2016. The coccinellids, Scymnus sp. and C. sanguinea, were the predominant biological control agents in the cultivation of A. squamosa, with a higher population density for the genus Scymnus seen in the spring and summer seasons, and no distribution pattern for C. sanguinea observed. = O conhecimento acerca dos agentes de controle biológico presentes naturalmente em áreas agrícolas apresenta grande importância na adoção de metodologias voltadas ao manejo integrado de pragas. Assim, objetivou-se com este trabalho realizar o levantamento da ocorrência populacional de agentes de controle biológico (Insecta associado ao cultivo de Annona squamosa. A pesquisa foi realizada na safra agrícola 2015/2016 em pomar

  7. Automedida da pressão arterial para o controle das cifras tensionais e para a adesão ao tratamento Self measurement of blood pressure for control of blood pressure levels and adherence to treatment

    Directory of Open Access Journals (Sweden)

    Weimar Kunz Sebba Barroso Souza

    2012-02-01

    Full Text Available FUNDAMENTO: A medida da pressão arterial (PA pelo próprio paciente, sem protocolos rígidos, com treinamento adequado, aparelhos validados e no próprio domicílio, é definida como automedida da pressão arterial (AMPA. OBJETIVO: Avaliar a interferência da AMPA na adesão ao tratamento e no controle pressórico. MÉTODOS: Participaram do estudo 57 pacientes, 38 no grupo de estudo (GE e 19 no grupo de controle (GC. Esses pacientes foram seguidos por 12 meses e avaliados na randomização (V1, bem como no sexto (V2 e no décimo segundo mês (V3. Comparadas as médias da PA pela medida casual, pela AMPA e pela monitorização ambulatorial da pressão arterial (MAPA, exames laboratoriais e as respostas ao questionário sobre o estilo de vida. Os aparelhos utilizados foram: OMRON HEM 714, para a AMPA; OMRON 705 CP, para a medida casual; e Monitor SPACELABS 9002, para a MAPA. RESULTADOS: A idade média em anos foi de 62,05 ± 10,78 e de 55,42 ± 11,87 no GE e no GC (p = 0,03, respectivamente. Os valores da pressão arterial sistólica (PAS pela medida casual no GE e no GC foram: 140,01 ± 16,73 mmHg e 141,79 ± 23,21 mmHg em V1 (p = 0,72; 135,49 ± 12,73 mmHg e 145,69 ± 19,31 mmHg em V2 (p = 0,02; 131,64 ± 19,28 mmHg e 134,88 ± 23,21 mmHg em V3 (p = 0,59. Os valores da pressão arterial diastólica (PAD foram: 84,13 ± 10,71 mmHg e 86,29 ± 10,35 mmHg em V1 (p = 0,47; 81,69 ± 10,88 mmHg e 89,61 ± 11,58 mmHg em V2 (p = 0,02; 80,31 ± 11,83 mmHg e 86 ± 13,38 mmHg em V3 (p = 0,12. CONCLUSÃO: Os pacientes do GE apresentaram adesão ao tratamento não farmacológico semelhante ao GC, mas tiveram maior adesão ao tratamento medicamentoso e utilizaram menor número de drogas anti-hipertensivas. Não houve diferença entre os grupos na comparação do perfil metabólico e da função renal. (Arq Bras Cardiol. 2011; [online].ahead print, PP.0-0BACKGROUND: The measurement of blood pressure (BP by the patient himself without strict protocols, adequate

  8. Plântulas de soja 'Tracajá' expostas ao ozônio sob condições controladas Soybean 'Tracajá' seedlings exposed to ozone under controlled conditions

    Directory of Open Access Journals (Sweden)

    Patricia Bulbovas

    2007-05-01

    Full Text Available O objetivo deste trabalho foi avaliar o crescimento inicial, acúmulo de biomassa, trocas gasosas e defesas antioxidativas de soja 'Tracajá', cultivada na Região Amazônica, exposta ao ozônio sob condições controladas. Sementes germinadas em vasos foram levadas para duas câmaras, uma com ar filtrado (AF e outra com ar filtrado mais 30 ppb de ozônio (AF + O3. Aos 10 e 20 dias após a semeadura, as trocas gasosas, crescimento em altura e acúmulo de biomassa foram medidos; aos 20 dias após a semeadura, as defesas antioxidativas (ácido ascórbico e superóxido dismutase foram analisadas. Aos 10 dias após a semeadura, a fotossíntese líquida, condutância estomática, transpiração, altura, área foliar e biomassa foram 16, 27, 11, 22, 29 e 18% menores, respectivamente, no tratamento AF + O3. Aos 20 dias após a semeadura, além dessas variáveis, comprimento da raiz, diâmetro do caule e razão raiz:parte aérea foram 10, 15 e 12% menores, respectivamente, apesar da concentração de ácido ascórbico e da atividade da superóxido dismutase terem aumentado. Plântulas de soja 'Tracajá' apresentam baixa tolerância à concentração de 30 ppb de ozônio.The objective of this work was to assess initial growth, biomass production, gas exchange and antioxidative defenses of soybean 'Tracajá' seedlings, cultivated in the Amazonian region, exposed to ozone under controlled conditions. Seeds germinated in pots were placed in two chambers, one with filtered air (AF and other with filtered air plus 30 ppb of ozone (AF + O3. At 10 and 20 days after sowing, gas exchange, growth and biomass were measured; at 20 days after sowing, antioxidative defenses (ascorbic acid and superoxide dismutase were analyzed. Net photosynthesis, stomatal conductance, transpiration rate, height, leaf area and biomass were 16, 27, 11, 22, 29 and 18% smaller, respectively, in AF + O3 at 10 days after sowing. At 20 days after sowing, besides this parameters, root length

  9. Uma contribuição ao estudo da dinamica não linear e controle de um particular sistema robotico levando-se em conta as interações entre as juntas

    OpenAIRE

    Leo Santana Pires

    2005-01-01

    Resumo: Uma aproximação unificada para projeto e controle de manipuladores robóticos que retenha todas as não linearidades inerentes na dinâmica é desenvolvido para uma configuração robô-motor considerado como um sistema interagente. Este projeto de sistema interagente, baseado no modelo de teoria de controle de desacoplagem não-linear de Beekmann, desacopla a configuração robô-motor para os subsistemas robô, motor e interação cm série. Esta aproximação está em contraste ao tratamento convenc...

  10. Fatores associados ao controle da asma em pacientes pediátricos em centro de referência Factores asociados al control del asma en pacientes pediátricos en centro de referencia Factors associated with asthma control in a pediatric reference center

    OpenAIRE

    Vanessa Mika Kinchoku; Irai Santana Oliveira; Letícia Abe Watanabe; Ângela Bueno F Fomin; Ana Paula B. M Castro; Cristina Miuki A Jacob; Antonio Carlos Pastorino

    2011-01-01

    OBJETIVO: Descrever os dados epidemiológicos, clínicos e os fatores associados ao controle da asma em pacientes asmáticos seguidos em um ambulatório pediátrico especializado. MÉTODOS: Estudo transversal de pacientes asmáticos ambulatoriais, para os quais eram fornecidas medicações profiláticas. A classificação da asma, as etapa de tratamento e a avaliação do controle seguiram a IV Diretrizes Brasileiras para o Manejo da Asma, de 2006. Os fatores avaliados foram: outras alergias, obesidade, im...

  11. Reação de linhagens de feijoeiro ao fungo Fusarium oxysporum f. sp. phaseoli em condições controladas Reaction of common bean lines to Fusarium oxysporum f. sp. phaseoli in controlled conditions

    Directory of Open Access Journals (Sweden)

    Mônica Juliani Zavaglia Pereira

    2011-10-01

    Full Text Available Entre os patógenos que mais contribuem para a redução da produtividade do feijoeiro no Brasil está o Fusarium oxysporum f. sp. phaseoli. O emprego de cultivares resistentes é o controle mais eficaz para esse patógeno. Conduziu-se este trabalho, com o objetivo de avaliar linhagens de feijoeiro (Phaseolus vulgaris L. do banco de germoplasma da Universidade Federal de Lavras (UFLA, quanto a reação ao Fusarium oxysporum f. sp. phaseoli e, ao mesmo tempo, estimar os parâmetros genéticos e fenotípicos que possam auxiliar em futuros programas de melhoramento para esse caráter. Foram avaliadas 367 linhagens em dez experimentos. As testemunhas 'Carioca' (suscetível e 'Carioca MG' (resistente foram utilizadas em todos os experimentos. O delineamento utilizado foi inteiramente ao acaso, com cinco repetições e parcelas de uma planta por vaso. As inoculações foram realizadas segundo a metodologia de corte e imersão de raízes na suspensão de esporos do fungo e as avaliações realizadas aos 21 dias após a inoculação com base no índice de severidade da doença empregando-se notas de 1 (plantas sem sintomas a 9 (plantas mortas.Das linhagens do banco de germoplasma da Universidade Federal de Lavras (UFLA avaliadas, 36,5% foram resistentes ao Fusarium oxysporum f. sp. phaseoli. Entre as resistentes, a maioria foi linhagens obtidas antes de 1990. Das 18 linhagens dos experimentos de VCU, do período de 2005/06, apenas quatro foram suscetíveis. A estimativa da herdabilidade (h² foi elevada (h² = 87%, indicando que, a princípio, o caráter é de fácil seleção.Among the pathogens that most contribute for reducing the productivity of beans in Brazil is the Fusarium oxysporum f. sp. phaseoli. The use of resistant cultivars is the most effective control for this pathogen. The aim of this study was to evaluate germoplasm bean (Phaseolus vulgaris L. lines of the Federal University of Lavras (UFLA as the reaction to the Fusarium oxysporum f

  12. Uma contribuição ao desenvolvimento e implementação de processos em escala de laboratório para controle

    OpenAIRE

    Simas, Henrique

    1998-01-01

    Dissertação (mestrado) - Universidade Federal de Santa Catarina, Centro Tecnológico. Nos dias de hoje, a universidade possui um sério problema a ser resolvido, o desafio de conciliar as disciplinas clássicas e avançadas, importantes para aperfeiçoar o conhecimento do aluno com o ensino de controle. O Laboratório de Controle de Processos (LCP) da Universidade Federal de Santa Catarina, desenvolve atividades de pesquisa de projeto e implementação de processos de baixo custo em escala de labo...

  13. Controle da antracnose na pós-colheita de bananas-'prata' com produtos alternativos aos agrotóxicos convencionais Postharvest control of antracnose in 'prata' bananas with alternatives products to conventional pesticides

    Directory of Open Access Journals (Sweden)

    Ricardo José Zimmermann de Negreiros

    2013-03-01

    Full Text Available Produtos alternativos aos agrotóxicos convencionais foram avaliados no controle da antracnose causada por Colletotrichum musae em pós-colheita de bananas 'Prata' [Musa spp. (AAB]. Foram utilizados buquês com três frutos, com diâmetro médio de 32 mm a 36 mm, no estádio pré-climatérico, com coloração de casca totalmente verde. Os frutos foram pulverizados com uma suspensão de conídios de C. musae, na concentração de 2,5x10(5 conídios/mL e mantidos em câmara úmida a 25 ºC, por 24 horas. Após esse período, foram pulverizados com as caldas dos produtos alternativos extrato cítrico 'Biogermex', óleo de nim 'Organic Neem' e óleo de alho 'Probinatu', na concentração de 10,0 mL/L, óleo de pimenta-longa e óleo de cravo-da-índia na concentração de 5,0 mL/L e quitosana na concentração de 10,0 mg/mL, além do fungicida Tectoï SC (tiabendazol na concentração de 0,65 mL/L. Água destilada foi utilizada como tratamento-testemunha. Os frutos tratados com quitosana, óleo de nim e óleo de alho tiveram a severidade da doença reduzida. O óleo de alho foi o produto mais eficiente, com redução também da incidência da doença. A qualidade dos frutos não foi depreciada por nenhum dos tratamentos alternativos nas concentrações utilizadas.Alternatives products to conventional pesticides in the control of anthracnose caused by Colletotrichum musae after harvest of 'Prata' banana [Musa spp. (AAB] were evaluated. Fruits with an average diameter of 32-36 mm were selected at the pre-climacteric stage, with a peel color index of 1 (totally green peel. Hands were subdivided into clusters of three fruits. The fruits were sprayed with a conidial suspension of C. musae at a concentration of 2.5 x 10(5 conidia/mL and were kept in a moist chamber at 25°C for 24 hours. After this period, fruits were sprayed with the alternative products 'Biogermex' citric extract, 'Organic Neem' oil and 'Probinatu' garlic oil at a concentration of 10.0 m

  14. AoB PLANTS: origins and features.

    Science.gov (United States)

    Jackson, Michael B

    2009-01-01

    AoB PLANTS is a peer reviewed, Open Access (OA) journal owned and run by plant biologists and published by Oxford University Press. The journal publishes research papers, reviews and opinion papers on all aspects of land based plant biology. They are made available rapidly online and can be accessed without the need for subscriptions or payment. Several difficulties in conventional publishing of peer-reviewed manuscripts encouraged AoB PLANTS to adopt OA. Open Access helps sidestep library budgets which are struggling to purchase the increasing numbers of journals. Open Access makes research freely available both to the academic community and beyond while publishing online only eliminates the need to reject good manuscripts simply to control the size of the printed journal. Finally, the journal chose to go OA to ensure the widest possible international readership for the growing amount of high-quality plant science research being carried out worldwide in response to problems such as climate change and food shortages. Responses to a wide-ranging online questionnaire indicated strong international support for a journal such as AoB PLANTS. AoB PLANTS strives for fair and rapid peer review followed by fast publication of accepted papers. For an initial period, there will be no OA fees, and fees will remain modest once introduced. AoB PLANTS adopts double-blind peer review using published criteria for acceptability as a basis for decision-making. Accepted papers are published shortly after acceptance together with referees' analyses using Stanford University Libraries High Wire Press H2O platform. Authors retain ownership of the copyright in their papers.

  15. Emprego de estações totais robotizadas na automação, controle e aquisição de dados, voltado ao monitoramento de barragens

    Directory of Open Access Journals (Sweden)

    Marco Aurélio Debus Nadal

    2017-02-01

    Full Text Available Atualmente com a evolução do instrumental utilizado em levantamentos geodésicos, especialmente no que diz respeito a robotização de estações totais, é possível a utilização destes em monitoramento geodésico contínuo, principalmente em estruturas de grande porte. No presente trabalho foi abordada a maneira de se estabelecer comunicação e controle destes instrumentos de medição através do desenvolvimento de programas que permitiram o envio e o recebimento de dados, em uma comunicação entre a estação total robotizada e o computador. Foram testadas as interfaces de comunicação que o instrumento utilizado neste trabalho, dentre elas: conexão via cabo serial, Bluetooth®, e link de rádio. Também foi estudado o protocolo de comunicação específico para este instrumento, disponibilizado pelo fabricante. O objetivo foi o desenvolvimento de um programa de computador que permitisse o controle de uma estação total robotizada Leica TCRA1205, voltado a aplicações de monitoramento geodésico.

  16. Resposta da maçã cv. Fuji ao etileno no armazenamento em atmosfera controlada Response of Fuji apples to ethylene in controlled atmosphere storage

    Directory of Open Access Journals (Sweden)

    Auri Brackmann

    2001-12-01

    Full Text Available Conduziu-se um experimento com o objetivo de avaliar o efeito das concentrações de etileno sobre a manutenção da qualidade e ocorrência de distúrbios fisiológicos na maçã cv. Fuji armazenada em atmosfera controlada (AC com 1kPa de O2 e 0,2kPa de CO2 na temperatura de 0,5ºC. O delineamento experimental foi o inteiramente casualizado com três repetições. Os tratamentos avaliados foram: 0,25; 20; e, 800m.L-1 de etileno. As avaliações foram realizadas após nove meses de armazenamento, no momento da abertura das câmaras e após sete dias de exposição a 25ºC. Somente os frutos mantidos em 800m.L-1 de etileno durante o período de conservação em AC foram influenciados pelo etileno, apresentando maior respiração e síntese de etileno, menor firmeza de polpa e cor de fundo da epiderme mais amarela do que aqueles armazenados com 0,25 ou 20m.L-1 de etileno na atmosfera da câmara. A maçã 'Fuji' apresentou baixa sensibilidade a altas concentrações de etileno durante o armazenamento em AC, não se justificando a sua absorção em câmaras comerciais.The experiment was carried out aiming to evaluate the effect of ethylene concentrations on the quality and occurrence of physiological disorders on Fuji apples stored in controlled atmosphere (CA with 1kPa O2 / 0,2kPa CO2 at 0.5ºC. The treatments applied were: 0.25; 20; and 800m.L-1 ethylene. The evaluations were accomplished after nine months of storage, at the opening of the chambers and after seven days in shelf life (25ºC. Only the fruits kept at 800m.L-1 ethylene during storage period were influenced by the ethylene, showing higher respiration and ethylene biosynthesis, lower firmness and more yellow background color of the peel than those stored with 0.25 or 20m.L-1. Fuji apples presented low sensibility to high ethylene concentrations during storage in AC, therefore absorption is not recomended in commercial storage rooms.

  17. Retinosquise juvenil ligada ao X

    Directory of Open Access Journals (Sweden)

    Cesar Gomes da Silveira

    2015-08-01

    Full Text Available RESUMO Relatar o caso de um paciente masculino de 28 anos que foi encaminhado ao Centro de Estudos e Pesquisas Oculistas Associados (RJ para avaliação de retina e apresentou os achados típicos de retinosquise juvenil ligada ao cromossomo X: maculopatia cistóide com formação de cistos na fóvea e retinosquise periférica. Foi realizado o manejo conservador, com atenção para as complicações.

  18. Aquisição do controle esfincteriano em uma coorte de nascimentos: situação aos 2 anos de idade Toilet training: situation at 2 years of age in a birth cohort

    Directory of Open Access Journals (Sweden)

    Denise M. Mota

    2008-10-01

    Full Text Available OBJETIVOS: O aprendizado do controle esfincteriano é influenciado por fatores fisiológicos, psicológicos e socioculturais. O objetivo deste estudo foi avaliar a prevalência de crianças sem fraldas aos 24 meses e seus fatores associados. MÉTODOS: Um total de 3.281 crianças nascidas no ano de 2004 em Pelotas (RS foi incluído em um estudo longitudinal. Aos 24 meses, as mães responderam a um questionário domiciliar com questões sociodemográficas, características dos hábitos miccionais e intestinais das crianças, com atenção ao treinamento esfincteriano. Foi empregada a regressão de Poisson para as análises multivariáveis. RESULTADOS: Do total, 24,3% estavam sem fraldas durante o dia, com predomínio do sexo feminino (27,8 versus 21,1%, p OBJECTIVES: Acquisition of bladder and bowel control is influenced by physiological, psychological and sociocultural factors. The objective of this study was to evaluate the prevalence of children out of diapers by 24 months of age and the factors associated with this finding. METHODS: A total of 3,281 children born in Pelotas, RS, Brazil in 2004 were enrolled on a longitudinal study. At 24 months their mothers were visited at home and replied to a questionnaire containing questions about sociodemographic data and the characteristics of their children's urinary and intestinal evacuation habits, with special attention to toilet training. Multivariate analyses were carried out using Poisson regression. RESULTS: From the total, 24.3% were out of diapers during the day, with the female sex predominating (27.8 vs. 21.1%, p < 0.001 and 8.6% were out of diapers at night, also with the female sex predominating (10.6 vs. 6.8%, p < 0.001. The abilities needed to start toilet training were present in 85.5% of the children. Guidance was received from a pediatrician in 10% of cases, and more frequently among richer mothers than among poorer mothers (22.9 vs. 4.8%. Mothers who spent more years in education (13

  19. SCExAO: First Results and On-Sky Performance

    Science.gov (United States)

    Currie, Thayne; Guyon, Olivier; Martinache, Frantz; Clergeon, Christophe; McElwain, Michael; Thalmann, Christian; Jovanovic, Nemanja; Singh, Garima; Kudo, Tomoyuki

    2013-01-01

    We present new on-sky results for the Subaru Coronagraphic Extreme Adaptive Optics imager (SCExAO) verifying and quantifying the contrast gain enabled by key components: the closed-loop coronagraphic low-order wavefront sensor (CLOWFS) and focal plane wavefront control ("speckle nulling"). SCExAO will soon be coupled with a high-order, Pyramid wavefront sensor which will yield greater than 90% Strehl ratio and enable 10(exp 6) -10(exp 7) contrast at small angular separations allowing us to image gas giant planets at solar system scales. Upcoming instruments like VAMPIRES, FIRST, and CHARIS will expand SCExAO's science capabilities.

  20. MEMS AO for Planet Finding

    Science.gov (United States)

    Rao, Shanti; Wallace, J. Kent; Shao, Mike; Schmidtlin, Edouard; Levine, B. Martin; Samuele, Rocco; Lane, Benjamin; Chakrabarti, Supriya; Cook, Timothy; Hicks, Brian; hide

    2008-01-01

    This slide presentation reviews a method for planet finding using microelectromechanical systems (MEMS) Adaptive Optics (AO). The use of a deformable mirror (DM) is described as a part of the instrument that was designed with a nulling interferometer. The strategy that is used is described in detail.

  1. Relationship among social support, treatment adherence and metabolic control of diabetes mellitus patients Relación entre apoyo social, adhesión al tratamiento y control metabólico de personas con Diabetes Mellitus Relação entre apoio social, adesão aos tratamentos e controle metabólico de pessoas com diabetes mellitus

    Directory of Open Access Journals (Sweden)

    Lilian Cristiane Gomes-Villas Boas

    2012-02-01

    ão aos tratamentos não medicamentoso (dieta e exercício físico e medicamentoso (insulina e/ou antidiabéticos orais e controle clínico-metabólico de 162 pessoas com diabetes mellitus tipo 2. Constituiu-se em um estudo seccional, de abordagem quantitativa. Os dados foram coletados por meio de instrumentos validados. O apoio social teve correlação direta com a adesão aos tratamentos. Observou-se correlação inversa entre adesão ao tratamento não medicamentoso e índice de massa corporal, bem como entre adesão medicamentosa e pressão arterial diastólica. Não houve associações entre apoio social e variáveis de controle clínico-metabólico. Conclui-se que o apoio social poderá ser útil para se obter a adesão aos tratamentos. Estudos com outros delineamentos devem ser desenvolvidos, a fim de se ampliar a análise das relações entre apoio social e outras variáveis.

  2. In vitro antifungal susceptibility of Candida spp. isolates from patients with chronic periodontitis and from control patients Suscetibilidade in vitro aos antifúngicos em cepas de Candida spp. isoladas de pacientes com periodontite crônica e de indivíduos controle

    Directory of Open Access Journals (Sweden)

    Cristiane Yumi Koga Ito

    2004-03-01

    Full Text Available Superinfection by Candida can be refractory to conventional periodontal treatments in specific situations, such as in immunocompromised patients. In these cases, the systemic therapy with antifungal drugs could be indicated. The aim of this study was to analyse antifungal susceptibility of Candida spp. strains isolated from chronic periodontitis patients and from control individuals. A total of 39 C. albicans isolates, 9 C. tropicalis, 2 C. glabrata and 5 Candida spp. from control individuals and 30 C. albicans, 3 C. tropicalis and 2 C. glabrata from periodontitis patients were tested. In the control group, 1 isolate of C. glabrata was resistant to ketoconazole and 1 Candida spp. was resistant to amphotericin B, ketoconazole and miconazole. Among the isolates of periodontitis group, 1 (3.33% C. albicans isolate was resistant to flucytosine and ketoconazole. According to the obtained results, it could be concluded that fluconazole was the most effective drug against the several Candida species studied. There were not expressive differences in the susceptibility of isolates from periodontitis patients or from control individuals.Em certas situações, tal como em pacientes imunocomprometidos, superinfecção por Candida pode ocorrer e ser refratária ao tratamento periodontal convencional. Nesses casos, a terapia sistêmica com antifúngicos pode ser indicada. O objetivo deste trabalho foi estudar a suscetibilidade aos antifúngicos de cepas de leveduras do gênero Candida isoladas de pacientes com periodontite crônica e de indivíduos controle. Um total de 39 isolados de C. albicans, 9 de C. tropicalis, 2 de C. glabrata e 5 de Candida spp. provenientes de indivíduos controle e 30 de C. albicans, 3 de C. tropicalis e 2 de C. glabrata de pacientes com periodontite foram testados. No grupo controle, uma amostra de C. glabrata foi resistente ao cetoconazol e uma de Candida spp. mostrou-se resistente a anfotericina B, cetoconazol e miconazol. Dentre

  3. Adesão ao tratamento da dor crônica e o locus de controle da saúde Adhesión al tratamiento del color crónico y eL locus de control de la salud Compliance with the treatment of chronic pain and health control locus

    Directory of Open Access Journals (Sweden)

    Geana Paula Kurita

    2004-09-01

    Full Text Available Objetivou-se avaliar a adesão dos doentes com dor crônica não oncológica ao tratamento e identificar relações entre a crença de controle da saúde e a adesão. Trinta doentes foram avaliados durante seis meses, em cinco entrevistas. A adesão foi classificada em plena, parcial e não adesão, e foi calculado o Índice de Acerto de Ingestão Medicamentosa (IAIM. A crença de controle da saúde foi avaliada por meio da Escala de Locus de Controle da Saúde. Observaram-se altos índices de adesão parcial e não adesão ao tratamento (40,0% a 56,7%, médias do IAIM entre 57,2% e 69,5%, e que doentes com crenças de maior "internalidade" aderiram menos ao tratamento.El estudio tuvo como objetivo analizar la adhesión de enfermos con dolor crónico no oncológico al tratamiento e identificar relaciones entre la creencia de control de la salud y la adhesión. Fueron evaluados treinta enfermos durante seis meses, en cinco entrevistas. La adhesión fue clasificada en plena, parcial y no adhesión, y fue calculado el Índice de Acierto de Ingestión Medicamentosa (IAIM. La creencia de control de la salud fue evaluada por medio de la Escala de Locus de control de la salud. Se observaron altos índices de adhesión parcial y no adhesión al tratamiento (40.0% a 56.7%, promedios del IAIM entre 57.2% y 69.5%, y que enfermos con creencias de mayor internalidad se adhirieron menos al tratamiento.The objective was to assess compliance of patients with non-oncologic pain and identify relationships between beliefs of health control and compliance. Thirty patients were evaluated over a period of six months, in five interviews. Compliance was classified as total, partial and non-compliance, and the Index of Correct Medication Ingestion (ICMI was calculated. The belief about health control was evaluated by the Multidimensional Health Locus of Control Scale. High rate of partial compliance and non-compliance with the treatment (40.0% to 56.7%, ICMI means

  4. REALIDADE AUMENTADA APLICADA AO DESIGN

    OpenAIRE

    Fernandes, Bruno Chagas Alves; Sánchez, Joaquín Fernández

    2008-01-01

    Este artigo apresenta o atual estado da arte da Realidade Aumentada aplicada ao design. São apresentados exemplos de aplicações da Realidade Aumentada em áreas como design de produtos, arquitetura, indústria automotiva, educação e design colaborativo. Também é apresentada uma rápida visão geral sobre as tecnologias envolvidas na criação de aplicações de Realidade Aumentada.

  5. Realidade aumentada aplicada ao design

    OpenAIRE

    Fernández Sánchez, Joaquín

    2008-01-01

    Este artigo apresenta o estado da arte da Realidade Aumentada aplicada ao design. São apresentados exemplos de aplicações da Realidade Aumentada em áreas como design de produtos, arquitetura, indústria automotiva, educação e design colaborativo. Também é apresentada uma rápida visão geral sobre as tecnologias envolvidas na criação de aplicações de Realidade Aumentada.

  6. Cometas: Das Lendas aos Fatos

    Science.gov (United States)

    Voelzke, M. R.

    O descobrimento de cometas, devido ao seu aparecimento espetacular, tem registro nas mais antigas culturas humanas. A primeira referência situa-se no ano de 1095 antes de Cristo [a.C.; HO; HO, 1962]. A quantidade de registros de descobrimentos cometários, principalmente provenientes do território chinês em particular e do oriente em geral, aumentou gradualmente a partir do quarto século depois de Cristo (d.C.). É de origem chinesa a primeira referência ao cometa P/Halley no ano de 240 a.C. [VOELZKE, 1993]. Com o desenvolvimento da astronomia relativamente às técnicas observacionais os descobrimentos bem como as observações cometárias aumentaram sensivelmente a partir do século XVII, sendo que a partir do século XIX um novo incremento ocorreu devido ao emprego da fotografia e a resultante melhora de sensibilidade na observação.

  7. Ensaio de combate ao ácaro da leprose de citros Brevipalpus phoenicis (Geijskes, 1939 com novo juvenóide e outros acaricidas Citrus leprosis mite control (Brevipalpus phoenicis Geijskes, 1939 with flucycloxuron, propargite and bromopropilate

    Directory of Open Access Journals (Sweden)

    A.I. Clari

    1993-05-01

    Full Text Available Foi montado um ensaio visando conhecer a eficiência do flucicloxurom (juvenóide constituído de benzoil-fenil-uréia substituída, do propargite e do bromopropilato, no combate ao acaro da leprose (Brevipalpus phoenicis Geijskes, 1939. Os produtos foram empregados nas seguintes dosagens: A testemunha; B flucicloxurom, 10g; C flucicloxurom, 15g; D flucicloxurom, 20g; E flucicloxurom, 30g; F propargite, 72g; G bromopropilato, 37,5g (tratamento padrão, sendo os valores supracitados quantidade de ingrediente ativo por 100 litros de calda. Foram aplicados 6 litros de calda por laranjeira, com pulverizador motorizado costal. Foram feitas 5 avaliações do combate: uma prévia (02 dias antes da pulverização e quatro outras (07, 20, 34 e 50 dias pós-aplicação. A partir dos resultados obtidos, conclui-se que os tratamentos mais eficientes foram o propargite e o bromopropilato.A field test was carried out on adult orange trees sprayed with flucycloxuron, propargite and bromopropilate to check their efficiency in controlling leprosis mite. Treatments used were: A check; B flucycloxuron, 10g; C flucycloxuron, 15g; D flucycloxuron, 20g; E flucycloxuron, 30g; F propargite, 72g; G bromopropilate, 37,5g. Quantities indicated are grams of active ingredients per 100 liters of water. Control evaluations were made 2 days before and 7, 20, 34 and 50 days after spraying. Treatments of propargite and bromopropilate turned out to be the most efficient. Treatments B, C, D, E were not efficient at all.

  8. Análise dos indicadores de hemorragia letal em vítimas de trauma penetrante de tronco admitidas em choque: um método objetivo para selecionar os candidatos ao "controle de danos"

    Directory of Open Access Journals (Sweden)

    José Gustavo Parreira

    Full Text Available OBJETIVO: Identificar os indicadores de hemorragia letal em vítimas de trauma penetrante de tronco, admitidas com hipotensão arterial sistêmica e analisar sua aplicabilidade na seleção dos candidatos ao "controle de danos". MÉTODO: Foram analisadas informações sobre 74 vítimas de ferimentos penetrantes exclusivamente de tronco, admitidas com hipotensão arterial sistêmica secundária à hemorragia, que sobreviveram até o tratamento definitivo. Os dados foram coletados prospectivamente durante dois anos. A média etária foi 29,5 + 8 anos, e 62 (83% pacientes eram do sexo masculino. Trinta e nove (52% foram vítimas de ferimentos de instrumentos perfurocortantes e 35 (47%, de ferimentos por projéteis de arma de fogo. Houve 23 óbitos (31%, 19 por hemorragia (82,6%. Os que faleceram por hemorragia foram incluídos no grupo H e os outros no grupo O. Foram comparadas diversas variáveis entre os grupos, utilizando-se o teste t de Student (controlado pelo teste de Levene e a correlação de Spearman, considerando p1.200ml. Através de um modelo de regressão logística foi possível calcular o risco de morte por hemorragia baseado na pressão arterial no início da operação e volume de concentrados de hemácias transfundido. CONCLUSÃO: A análise dos indicadores de hemorragia letal fornece dados objetivos para a indicação do "controle de danos".

  9. Characterizing and mitigating vibrations for SCExAO

    Science.gov (United States)

    Lozi, Julien; Guyon, Olivier; Jovanovic, Nemanja; Singh, Garima; Goebel, Sean; Norris, Barnaby; Okita, Hirofumi

    2016-07-01

    The Subaru Coronagraphic Extreme Adaptive Optics (SCExAO) instrument, under development for the Subaru Telescope, has currently the fastest on-sky wavefront control loop, with a pyramid wavefront sensor running at 3.5 kHz. But even at that speed, we are still limited by low-frequency vibrations. The current main limitation was found to be vibrations attributed mainly to the rotation of the telescope. Using the fast wavefront sensors, cameras and accelerometers, we managed to identify the origin of most of the vibrations degrading our performance. Low-frequency vibrations are coming from the telescope drive in azimuth and elevation, as well as the elevation encoders when the target is at transit. Other vibrations were found at higher frequency coming from the image rotator inside Subaru's adaptive optics facility AO188. Different approaches are being implemented to take care of these issues. The PID control of the image rotator has been tuned to reduce their high-frequency contribution. We are working with the telescope team to tune the motor drives and reduce the impact of the elevation encoder. A Linear Quadratic Gaussian controller (LQG, or Kalman filter) is also being implemented inside SCExAO to control these vibrations. These solutions will not only improve significantly SCExAOs performance, but will also help all the other instruments on the Subaru Telescope, especially the ones behind AO188. Ultimately, this study will also help the development of the TMT, as these two telescopes share very similar drives.

  10. AoS28D, a proline-Xaa carboxypeptidase secreted by Aspergillus oryzae.

    Science.gov (United States)

    Salamin, Karine; Eugster, Philippe J; Jousson, Olivier; Waridel, Patrice; Grouzmann, Eric; Monod, Michel

    2017-05-01

    Prolyl peptidases of the MEROPS S28 family are of particular interest because they are key enzymes in the digestion of proline-rich peptides. A BLAST analysis of the Aspergillus oryzae genome revealed sequences coding for four proteases of the S28 family. Three of these proteases, AoS28A, AoS28B, and AoS28C, were previously characterized as acidic prolyl endopeptidases. The fourth protease, AoS28D, showed high sequence divergence with other S28 proteases and belongs to a phylogenetically distinct cluster together with orthologous proteases from other Aspergillus species. The objective of the present paper was to characterize AoS28D protease in terms of substrate specificity and activity. AoS28D produced by gene overexpression in A. oryzae and in Pichia pastoris was a 70-kDa glycoprotein with a 10-kDa sugar moiety. In contrast with other S28 proteases, AoS28D did not hydrolyze internal Pro-Xaa bonds of several tested peptides. Similarly, to human lysosomal Pro-Xaa carboxypeptidase, AoS28D demonstrated selectivity for cleaving C-terminal Pro-Xaa bonds which are resistant to carboxypeptidases of the S10 family concomitantly secreted by A. oryzae. Therefore, AoS28D could act in synergy with these enzymes during sequential degradation of a peptide from its C-terminus.

  11. Armazenamento de pêssegos cv. "Granada" em atmosfera controlada, visando ao transporte a longas distâncias Storage of cv. "Granada" peach fruit in controlled atmosphere aiming the transport for long distances

    Directory of Open Access Journals (Sweden)

    Auri Brackmann

    2007-06-01

    Full Text Available O objetivo deste trabalho foi determinar as condições mais adequadas de atmosfera controlada (AC e temperatura, para a manutenção da qualidade de pêssegos cv. "Granada" colhidos em dois estádios de maturação, visando ao transporte para mercados distantes, como a Europa. Os regimes de armazenamento avaliados foram: [1] frigoconservação em atmosfera natural (20,8kPa de O2 +This research was aimed at evaluating controlled atmosphere (CA and temperature conditions for storing of cv. Granada peach fruit harvested at two ripening stages aiming the transport of fruit for distant market, such as Europe. Treatments evaluated were six storage conditions and two ripening stages. The storage conditions were: [1] cold storage (20.8kPa de O2 +<0.5kPa de CO2; controlled atmosphere (CA conditions with [2] 6.0kPa de O2 + 15.0kPa de CO2; [3] 1.0kPa de O2 + 3.0kPa de CO2; [4] 1.0kPa de O2 + <0.5kPa de CO2, all at +0.5°C. Moreover, CA with 2.0kPa O2 + 5.0kPa CO2 was evaluated both at [5] +0.5°C and [6] -0.5°C. Fruits were harvested either at the breaking stage or at the half-ripe ripening stage and stored in the conditions cited above. The harvest of cv. Granada peaches in the breaking stage (greeny background color of the skin is the most suitable, because although not affecting the physical and chemical quality, these fruits showed a reduced incidence of flesh browning and rot. For short-term storage (25 days, controlled atmosphere did not significantly improve fruit quality in relation to cold storage.

  12. REALIDADE AUMENTADA APLICADA AO DESIGN

    Directory of Open Access Journals (Sweden)

    Bruno Chagas Alves Fernandes

    2008-07-01

    Full Text Available Este artigo apresenta o atual estado da arte da Realidade Aumentada aplicada ao design. São apresentados exemplos de aplicações da Realidade Aumentada em áreas como design de produtos, arquitetura, indústria automotiva, educação e design colaborativo. Também é apresentada uma rápida visão geral sobre as tecnologias envolvidas na criação de aplicações de Realidade Aumentada.

  13. Review of AO calibrations, or how to best educate your AO system

    Science.gov (United States)

    Kolb, Johann

    2016-07-01

    If the Real-Time Computer is the heart of an AO system, the Wavefront Sensor (WFS) its eyes, the Deformable Mirror (DM) its hands and the control strategy its nervous system, the sum of all those parts is made into a harmonious entity thanks to calibrations. This paper does not have the ambition to provide an overview of all the currently existing calibration strategies, but rather to focus on a few challenging problems and their recent evolution in the era of adaptive telescopes, mostly based on the experience of ESO's Adaptive Optics Instruments in general and the AO Facility in particular. Single most important calibration in post-focal AO system, the recording of the Interaction Matrix (IM) between WFS and DM has since long evolved to use fast modulation techniques, has shown to be feasible on-sky and is now almost free from measurements thanks to its pseudo-synthetic generation, quasi-mandatory solution in an adaptive telescope. Pseudo- because it requires an unprecedented knowledge of the components' characteristics, especially the WFS, DM and the optical registration between the two. Bigger telescopes and the use of Laser Guide Stars (LGS) also mean that the properties of the system will change in time and thus need to be constantly updated thanks to online diagnosis tools for spot size measurement, atmosphere monitoring, Wavefront Sensing and control optimization. New loops come into play like the one to minimize LGS Jitter and the one taking over the telescope active optics by means of offloading the DM low orders, and they all require calibration. More calibration means more time and one has to carefully balance the calibrations that require precious telescope night time, day time or for the best, no telescope time at all. Their importance sometimes underestimated, calibrations have repeatedly shown to be a vital part in the optimum functioning of present and future AO systems.

  14. Estudo caso-controle sobre exposição precoce ao leite de vaca e ocorrência de Diabetes Mellitus tipo 1 em Campina Grande, Paraíba Case-control study on early exposure to cow's milk and the occurrence of Diabetes Mellitus type 1 in Campina Grande in the State of Paraíba

    Directory of Open Access Journals (Sweden)

    Josimar dos Santos Medeiros

    2003-09-01

    Full Text Available OBJETIVOS: estudar a relação entre exposição precoce ao leite de vaca e ocorrência de Diabetes Mellitus tipo 1 entre menores de 18 anos atendidos no Hospital Universitário Alcides Carneiro, em Campina Grande. MÉTODOS: estudo caso-controle. A amostra foi constituída por 128 indivíduos de ambos os sexos. Foram entrevistadas 64 mães de portadores de Diabetes Mellitus e 64 mães de controles. Análises univariadas e multivariadas foram utilizadas. RESULTADOS: 84,4% dos indivíduos diabéticos foram expostos ao leite de vaca antes dos quatro meses de idade, enquanto que no grupo controle este percentual foi de 64,1%. A análise univariada identificou uma associação estatisticamente significante entre exposição precoce ao leite de vaca e Diabetes (p = 0,01. Na análise multivariada, essa associação permaneceu e a razão chances estimada foi de 4,09 (IC95%: 1,19 - 14,04; p = 0,01. CONCLUSÕES: os resultados indicam uma forte associação entre exposição precoce ao leite de vaca e ocorrência de Diabetes Mellitus tipo1 na população estudada. Assim, crianças expostas precocemente ao leite de vaca apresentam uma chance maior de adquirir a doença quando comparadas àquelas que receberam aleitamento materno exclusivo até pelo menos quatro meses após o nascimento.OBJECTIVES: to study the relationship between early exposure to cow's milk and Diabetes Mellitus, type 1 among children under 18 years old seen at the Hospital Universitário Alcides Carneiro, in Campina Grande. METHODS: case-control study. Sample of 128 individuals of both sexes. Sixty-four mothers with Diabetes Mellitus type 1 and 64 mothers of a control group. Univariate and multivariate analysis was accomplished through logistic and conditional regression. RESULTS: 84,4% of diabetic individuals were exposed to cow mild before four months of age while in the control group this percentage was 64,1%. Univariate analysis determined a significant statistic association between

  15. Como responder ao momento presente?

    Directory of Open Access Journals (Sweden)

    Maria Filomena Molder

    2013-12-01

    Full Text Available http://dx.doi.org/10.5007/1984-784X.2013v13n19p13 Foi com esta pergunta — já um efeito de um primeiro encontro entre Irene Pimentel e eu própria — que decidimos desafiar colegas, estudantes e funci­onários da nossa Faculdade, FCSH (Faculdade de Ciências Sociais e Huma­nas, de outras Faculdades da Universidade Nova de Lisboa, de outras Uni­versidades e todos os interessados em con­siderar e discutir em comum aquilo que se passava em Portugal e que no anúncio da Jornada de 6 de De­zembro de 2012 se descrevia como um “processo de desmantela­mento social, económico e cultural sem precedentes — pese embora tantas compara­ções, baseadas na premissa da ‘eterna repetição’ — e cujas consequências não param de exceder as previsões dos responsáveis por esse desmantelamento”. Acedendo com todo o empenho e gratidão ao convite que me foi dirigido por Humberto Brito para fazer uma resenha da Jornada a publicar no primeiro número de Forma de Vida (saúdo a revista e o título, decidi-me, no entanto, a pôr de lado a resenha, que sob a forma de “Editorial” será em breve publi­cada no blogue Responder ao Momento Presente, entre­tanto criado, conjuntamente com os textos escritos pelos nossos convidados, com as parti­cipações de pessoas que corresponderam ao nosso apelo e ainda com contri­bui­ções que se alargaram para lá da Jornada; a que se juntará uma gravação em video, também disponível no Youtube.   Texto publicado originalmente em Forma de Vida, Lisboa, n.1, fev. 2013. Agrade­cemos à autora por permitir a republicação neste número do Boletim. [N.E.

  16. Como responder ao momento presente?

    Directory of Open Access Journals (Sweden)

    Maria Filomena Molder

    2013-06-01

    Full Text Available Foi com esta pergunta — já um efeito de um primeiro encontro entre Irene Pimentel e eu própria — que decidimos desafiar colegas, estudantes e funci­onários da nossa Faculdade, FCSH (Faculdade de Ciências Sociais e Huma­nas, de outras Faculdades da Universidade Nova de Lisboa, de outras Uni­versidades e todos os interessados em con­siderar e discutir em comum aquilo que se passava em Portugal e que no anúncio da Jornada de 6 de De­zembro de 2012 se descrevia como um “processo de desmantela­mento social, económico e cultural sem precedentes — pese embora tantas compara­ções, baseadas na premissa da ‘eterna repetição’ — e cujas consequências não param de exceder as previsões dos responsáveis por esse desmantelamento”. Acedendo com todo o empenho e gratidão ao convite que me foi dirigido por Humberto Brito para fazer uma resenha da Jornada a publicar no primeiro número de Forma de Vida (saúdo a revista e o título, decidi-me, no entanto, a pôr de lado a resenha, que sob a forma de “Editorial” será em breve publi­cada no blogue Responder ao Momento Presente, entre­tanto criado, conjuntamente com os textos escritos pelos nossos convidados, com as parti­cipações de pessoas que corresponderam ao nosso apelo e ainda com contri­bui­ções que se alargaram para lá da Jornada; a que se juntará uma gravação em video, também disponível no Youtube. Texto publicado originalmente em Forma de Vida, Lisboa, n.1, fev. 2013. Agrade­cemos à autora por permitir a republicação neste número do Boletim. [N.E.

  17. Effects of insecticides used in Bemisia tabaci (Gennadius biotype B control and their selectivity to natural enemies in soybean cropEfeitos dos inseticidas utilizados no controle de Bemisia tabaci (Gennadius biótipo B e sua seletividade aos inimigos naturais na cultura da soja

    Directory of Open Access Journals (Sweden)

    Simone Silva Vieira

    2012-10-01

    Full Text Available In recent crop seasons, the whitefly, Bemisia tabaci biotype B has become a serious pest in soybean crops due to high infestations and its control difficulties. Therefore, it is important to search control alternatives in the integrated pest management approach. Thus, it was evaluated in this study the efficacy of the whitefly control using different insecticides in greenhouse conditions and their selectivity to the parasitoids Encarsia formosa, Trichogramma pretiosum and Telenomus remus. Buprofezin 150 g. a.i.ha-1 + mineral oil 0.2% v/v and pyriproxyfen 100 g. a.i.ha-1 were considered the best options for the whitefly management due to combine good pest control efficacy with higher selectivity to the parasitoids except Encarsia formosa for which no treatment was classified as harmless. Betacyflutrin 9.375 + imidacloprid 75 g. i.a. ha-1 was efficient on controlling whiteflies nymphs but was not harmless to the studied natural enemies. In general, the treatments including pyretroids compounds (betacyflutrin 9.375 + imidacloprid 75 + spiromesifen 60, betacyflutrin 9.375 + imidacloprid 75 and lambda-cyhalothrin 26.5 + thiametoxan 35.25 g. a.i. ha-1 were the most harmful to the evaluated parasitoids and therefore it use should be avoid whenever possible. Nas últimas safras a mosca-branca, Bemisia tabaci biótipo B (Hemiptera: Aleyrodidae tornou-se praga de importância econômica para a cultura da soja devido à ocorrência de altas infestações e à dificuldade de controle desta praga. Sendo assim, é importante buscar alternativas de manejo com base em um programa de manejo integrado de pragas. Assim, avaliaram-se neste trabalho a eficiência de diferentes inseticidas no controle da mosca-branca em casa-de-vegetação e a seletividade destes aos parasitoides Encarsia formosa, Trichogramma pretiosum e Telenomus remus. Buprofezina 150 g i.a. ha-1 + óleo mineral 0,2% v/v e piriproxifem 100 g. i.a. ha-1 foram consideradas as melhores opções para

  18. Aerosol Observing System (AOS) Handbook

    Energy Technology Data Exchange (ETDEWEB)

    Jefferson, A

    2011-01-17

    The Aerosol Observing System (AOS) is a suite of in situ surface measurements of aerosol optical and cloud-forming properties. The instruments measure aerosol properties that influence the earth’s radiative balance. The primary optical measurements are those of the aerosol scattering and absorption coefficients as a function of particle size and radiation wavelength and cloud condensation nuclei (CCN) measurements as a function of percent supersaturation. Additional measurements include those of the particle number concentration and scattering hygroscopic growth. Aerosol optical measurements are useful for calculating parameters used in radiative forcing calculations such as the aerosol single-scattering albedo, asymmetry parameter, mass scattering efficiency, and hygroscopic growth. CCN measurements are important in cloud microphysical models to predict droplet formation.

  19. New approaches to disease vector control in the context of sustainable development Novas abordagens ao controle de vetores de doenças no contexto do desenvolvimento sustentável

    Directory of Open Access Journals (Sweden)

    Robert Bos

    1992-09-01

    Full Text Available Faced with problems that are specific to the health sector and ones associated with issues of sustainability, programmes for the control of vector-borne diseases are increasingly resorting to environmental management measures to reduce populations of disease vectors as pan of an integrated control approach. The broader problems on the interface between environment and development that need to be addressed in the context of vector control include accelerated development of natural resources, demographic changes in rural populations and rapid urbanization. Disease vectors need to be recognized as biological risk factors to human health in the environment, and for a sustainable implementation of vector control measures, these should be made an integral pan of the development process. This requires modifications in the policy framework, expansion of our knowledge base, development of operational methods and techniques and a shift in emphasis in training and education.Devido a problemas específicos do setor saúde, bem como a problemas associados a questões de manutenção, os programas para o controle de doenças transmitidas por vetores estão cada vez mais retornando à adoção de práticas de manejo ambiental para reduzirem populações de vetores, como parte de uma abordagem de controle integrada. Os problemas mais gerais advindos da interface entre ambiente e desenvolvimento que necessitam ser abordados no contexto do controle de vetores incluem a acelerada exploração de recursos naturais, mudanças demográficas em populações rurais e a rápida urbanização. Os vetores de doenças devem ser reconhecidos como fatores biológicos de risco no ambiente para a saúde humana. Para uma implementação sustentável das medidas de controle de vetores, estes aspectos devem fazer parte do processo de desenvolvimento. Isto requer modificações na formulação de políticas, aumento da nossa base de conhecimento acerca destes processos

  20. Comportamiento de mujeres y sus parejas referentes a la planificación familiar Comportamento de mulheres e seus casais referentes ao planejamento familiar Women and their couple's behavior regarding birth control

    Directory of Open Access Journals (Sweden)

    Maria de Lourdes da Silva Marques Ferreira

    2010-07-01

    Full Text Available Objetivo. Describir el comportamiento de las mujeres en relación a la planificación familiar y analizar si tal comportamiento tiene influencia cultural. Metodología. Se trata de un estudio cualitativo cuyos sujetos fueron mujeres que aguardaban la consulta en el programa de salud de la familia en tres unidades de salud del municipio de Ilha Comprida de São Paulo, Brasil. Los datos fueron recolectados durante los meses de octubre y noviembre de 2007, empleándose como medio de información la entrevista, y posteriormente fueron sometidos a la técnica del análisis de contenido. Resultados. Las mujeres tienen la responsabilidad de la planificación, consideraron que hay dificultades con la planificación familiar debidas especialmente a la información ineficaz sobre métodos anticonceptivos y a la influencia que la familia ejerce sobre este comportamiento adoptado. Conclusión. La planificación familiar está influenciada por los modelos culturales, valores morales, sociales y religiosos, que tienen que ver con el ejercicio de la sexualidad.Objetivo. Descrever o comportamento das mulheres em relação ao planejamento familiar e analisar se tal comportamento tem influência cultural. Metodologia. Tratase de um estudo qualitativo cujos sujeitos foram mulheres que aguardavam a consulta no programa de saúde da família em três unidades de saúde do município de Ilha Comprida de São Paulo, Brasil. Os dados foram coletados durante os meses de outubro e novembro de 2007, empregandose como meio de informação a entrevista, e posteriormente foram submetidos à técnica da análise de conteúdo. Resultados. As mulheres têm a responsabilidade do planejamento, consideraram que há dificuldades com o planejamento familiar devidas especialmente à informação ineficaz sobre métodos anticonceptivos e à influência que a família exerce sobre este comportamento Conclusão. O planejamento familiar está influenciada pelos modelos culturais, valores

  1. Produção animal em pastagem nativa submetida ao controle de plantas indesejáveis e a intensidades de pastejo Animal production on native pasture submitted to the control of undesirable plants and grazing intensity

    Directory of Open Access Journals (Sweden)

    José Acélio Silveira da Fontoura Júnior

    2007-02-01

    Full Text Available O objetivo deste trabalho, realizado no município de Cachoeira do Sul, região Fisiográfica da Serra do Sudeste do Rio Grande do Sul, foi estudar diferentes métodos de controle de espécies indesejáveis em pastagem nativa, associados a dois níveis de oferta de forragem, medindo suas eficiências em termos de resposta animal. Os tratamentos foram: testemunha (T, roçada de primavera (P, roçada de primavera + outono (P+O e roçada de primavera + controle químico (P+Q, todos submetidos a dois níveis de oferta de forragem (8 e 14kg de matéria seca 100kg-1 de peso vivo por dia. O delineamento experimental utilizado foi o de fatorial em blocos completos casualizados (4 x 2, com duas repetições. Não houve efeito significativo de blocos nem interação dos fatores métodos de controle e níveis de oferta de forragem. O maior nível de oferta proporcionou maior ganho de peso vivo por área (P0,05. Os resultados mostram que é possível manter o peso vivo de bovinos em pastagens nativas da Serra do Sudeste/RS, durante o período de inverno, utilizando práticas de manejo que assegurem nível mínimo de oferta de forragem e, ainda, que o manejo da pastagem nativa com roçada de primavera, com ou sem o uso de herbicida, proporciona melhor desempenho individual e menores perdas de peso no período hibernal.The aim of this experiment was to study different methods of controlling undesirable plants in native pastures, associated with two levels of herbage allowance, and their effects on animal production. The treatments were no control (T, spring slashing (P, spring+autumn slashing (P+O and spring slashing +chemical control (P+Q, under two levels of herbage allowance (8 and 14kg of dry matter 100kg-1 of liveweight per day. The experimental design was a randomized complete block with two replicates. Not have block effects neither interaction between methods of control and herbage allowances (P>0.05. The higher herbage allowance resulted in more

  2. Low-intensity laser coupled with photosensitizer to reduce bacteria in root canals compared to chemical control; Laser em baixa intensidade associado a fotosensibilizador para reducao bacteriana intracanal comparado ao controle quimico

    Energy Technology Data Exchange (ETDEWEB)

    Garcez Segundo, Aguinaldo Silva

    2002-07-01

    The photodynamic therapy is a process in which a dye is associate with an appropriate wavelength of light and this dye goes to an excited state. The excited reacts with oxygen to form the highly reactive compound singlet oxygen, and this compound can kill bacteria and tumor cells. The purpose of this study was to evaluate the bactericidal reduction in root canal contaminated with E. Faecalis. Thirty teeth with their root canals prepared were contaminated with E. faecalis. The teeth have received the chemical substance sodium hypochlorite for 30 minutes; ten teeth have received the azulene dye paste for 5 minutes and have been irradiated with a diode laser, output power 10 mW and {lambda}= 685 nm for 3 minutes. Ten teeth have not received treatment (control group). The bacterial reduction was significantly higher for laser group when compared to chemical and control groups. These results indicate photodynamic therapy as an effective method to kill bacteria. (author)

  3. Apple fruit copper amine oxidase isoforms: peroxisomal MdAO1 prefers diamines as substrates, whereas extracellular MdAO2 exclusively utilizes monoamines.

    Science.gov (United States)

    Zarei, Adel; Trobacher, Christopher P; Cooke, Alison R; Meyers, Ashley J; Hall, J Christopher; Shelp, Barry J

    2015-01-01

    4-Aminobutyrate (GABA) accumulates in apple fruit during controlled atmosphere storage. A potential source of GABA is the polyamine putrescine, which can be oxidized via copper-containing amine oxidase (CuAO), resulting in the production 4-aminobutanal/Δ(1)-pyrroline, with the consumption of O2 and release of H2O2 and ammonia. Five putative CuAO genes (MdAO genes) were cloned from apple (Malus domestica Borkh. cv. Empire) fruit, and the deduced amino acid sequences found to contain the active sites typically conserved in CuAOs. Genes encoding two of these enzymes, MdAO1 and MdAO2, were highly expressed in apple fruit and selected for further analysis. Amino acid sequence analysis predicted the presence of a C-terminal peroxisomal targeting signal 1 tripeptide in MdAO1 and an N-terminal signal peptide and N-glycosylation site in MdAO2. Transient expression of green fluorescent fusion proteins in Arabidopsis protoplasts or onion epidermal cells revealed a peroxisomal localization for MdAO1 and an extracellular localization for MdAO2. The enzymatic activities of purified recombinant MdAO1 and MdAO2 were measured continuously as H2O2 production using a coupled reaction. MdAO1 did not use monoamines or polyamines and displayed high catalytic efficiency for 1,3-diaminopropane, putrescine and cadaverine, whereas MdAO2 exclusively utilized aliphatic and aromatic monoamines, including 2-phenylethylamine and tyramine. Together, these results indicate that MdAO1 may contribute to GABA production via putrescine oxidation in the peroxisome of apple fruit under controlled atmosphere conditions. MdAO2 seems to be involved in deamination of 2-phenylethylamine, which is a step in the biosynthesis of 2-phenylethanol, a contributor to fruit flavor and flower fragrance. © The Author 2014. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

  4. Diagnosis of AOS: definition and criteria.

    Science.gov (United States)

    Croot, Karen

    2002-11-01

    Presented in this article is a discussion of current progress in behavioral, cognitive, and neuroanatomic definitions of apraxia of speech (AOS). A behavioral definition summarizes the speech symptoms that should be considered diagnostic of AOS with or without co-occurring aphasia and dysarthria. AOS is defined in cognitive terms as an impairment in the translation of phonological representations into specifications for articulation. Progress toward a neuroanatomic definition of AOS will rely on mapping the processes described by increasingly sophisticated cognitive models of normal speech production to the brain. The article describes criteria that have been proposed for differentiating apraxic from phonological and dysarthric disorders and suggests that syndrome-based approaches to the diagnosis of AOS may obscure important differences between individual presentations of apraxic disruption as well as similarities between AOS and other speech-language disorders.

  5. Soil amendment with chopped or ground dry leaves of six species of plants for the control of Meloidogyne javanica in tomato under greenhouse conditions Incorporação ao solo de folhas secas picadas ou moídas de seis espécies de plantas para o controle de Meloidogyne javanica em tomateiro em casa de vegetação

    Directory of Open Access Journals (Sweden)

    Everaldo Antônio Lopes

    2011-06-01

    Full Text Available Greenhouse experiments were conducted to evaluate the effect of soil amendment with chopped (1cm² or ground (1mm sieve dry leaves of assa-peixe (Vernonia polyanthes, lemon-grass (Cymbopogon citratus, eucalyptus (Eucalyptus citriodora, castor (Ricinus communis, mango (Mangifera indica or neem (Azadirachta indica for the control Meloidogyne javanica. Into the soil (Yellow red oxisol of each pot were added leaves (5g kg-1 of soil and 5,000 eggs of the nematode. After seven days, one tomato seedling "Santa Cruz Kada" was transplanted to each pot. The tomato root weight, galls and eggs/root system were determined 60 days after transplant. None of the soil amendments reduced gall or eggs, when applied as leaf pieces. However, all tested plant species reduced the gall number, when they were incorporated into the soil as powder, and maximum nematode suppression occurred in soil amended with neem leaves (61%. The amendment with ground leaves of castor, neem, eucalyptus and lemon-grass reduced the number of eggs, with maximum reduction occurring in soil amended with ground castor leaves (69%, evidencing that these organic amendments can be an alternative for M. javanica control in tomato. Further studies are required under field conditions to confirm the potential of these organic amendments on the control of M. javanica.Experimentos em casa de vegetação foram conduzidos com o objetivo de avaliar o efeito da adição ao solo de folhas secas picadas (1cm² ou trituradas (peneira de 1mm de assa-peixe (Vernonia polyanthes, capim-limão (Cymbopogon citratus, eucalipto (Eucalyptus citriodora, mamona (Ricinus communis, manga (Mangifera indica ou nim (Azadirachta indica para o controle de Meloidogyne javanica. Ao solo de cada vaso (latossolo vermelho-amarelo, foram adicionadas folhas (5g kg-1 de solo e 5.000 ovos do nematoide. Após sete dias, uma muda de tomateiro "Santa Cruz Kada" foi transplantada em cada vaso. O peso das raízes e os números de galhas e

  6. Aphid parasitoids (Hymenoptera, Braconidae, Aphidiinae and their associations related to biological control in Brazil Parasitóides (Hymenoptera, Braconidae, Aphidiinae de pulgões e suas interações relacionadas ao controle biológico no Brasil

    Directory of Open Access Journals (Sweden)

    Petr Starý

    2007-03-01

    Full Text Available This study evaluated the parasitoid-aphid-plant associations in Brazil with the objective of developing a useful research database for further studies of aphid parasitoid ecology and aphid management. The original material was obtained from collections made in Paraná, Rio Grande do Sul, Minas Gerais, and São Paulo states. The published information on the Aphidiinae in Brazil is revised. The general features of the target parasitoid fauna of Central and South America is summarized and promising biological control programs of some aphid species in Brazil is discussed.Este trabalho avaliou as interações parasitóides-pulgão-planta no Brasil, com o objetivo de desenvolver um banco útil de dados para estudos subseqüentes em ecologia de parasitóides de afídeos e manejo de pulgões. O material original foi obtido de coletas nos estados do Paraná, Rio Grande do Sul, Minas Gerais e São Paulo, sendo revisadas as informações sobre Aphidiinae publicadas no Brasil. Foram também sumarizadas as caracteristicas gerais da fauna de parasitóides das Américas Central e do Sul e discutidos os programas potenciais de controle biológico de algumas espécies de pulgões no Brasil.

  7. WIYN active optics: a platform for AO

    Science.gov (United States)

    Code, Arthur D.; Claver, Charles F.; Goble, Larry W.; Jacoby, George H.; Sawyer, David G.

    1998-09-01

    The WIYN 3.5 meter telescope is situated on the southwest ridge of Kitt Peak yielding excellent atmosphere seeing conditions. As such, the telescope and enclosure design was directed towards exploiting this feature. The primary mirror was spun cast and figured by the Steward Observatory Mirror Laboratory and the secondary mirror by Contraves. In both cases the performance exceeded the design specifications. The borosilicate primary is actively temperature controlled to within 0.2 C of the desired temperature, typically 0.5 degrees C below the ambient air. The telescope structure is also temperature controlled and the enclosure is opened to the outside ion all sides, which all heat sources are vented to ducts carrying air downwind of the facility. The primary mirror is actively controlled for low order aberrations by 66 axial actuators which are adjusted open loop via force matrix look-up tables and closed loop via real-time wavefront curvature sensing measurements. The active optics also included real-time collimation and focus control. The telescope drive and guider are capable of providing tracking to a few hundredths of a second of arc. By employing active telescope control at this level, it is possible to maintain telescope and local wavefront distortion to a level where atmospheric effects dominate the image quality. Since a significant fraction of the power in the atmospheric disturbances is contained in image motion the first step in adaptive optics control will be simple tip tilt. Studies of higher order AO system are being carried out, as well as additional test characterizing the telescope and site. It is intended to continue such studies in an attempt to establish long term variances.

  8. Entomopathogenic fungi isolates to control the borer of yerba mate (Hedypathes betulinus Kluger (Coleoptera; CerambycidaeIsolados de fungos entomopatogênicos visando ao controle da broca da erva-mate (Hedypathes betulinus Kluger (Coleoptera; Cerambycidae

    Directory of Open Access Journals (Sweden)

    André Luis Pereira Fanti

    2013-09-01

    Full Text Available Yerba mate is an important crop of southern Brazil, Argentina and Paraguay, with socio-economic and environmental importance. Due the lack of native herbals, yerba mate has become a monoculture, and as a consequence, insects have become pests, and the borer, Hedypathes betulinus, one of the most important. In order to improve biological control in the crop, this work aims to select in laboratory the most virulent, of 32 isolates of the entomopathogenic fungi Beauveria bassiana (Bals. Vuill. and 18 isolates of Metarhizium anisopliae (Metsch. Sorok. Initially, isolates virolence was evaluated by immersing the adults borers in a fungal suspension, containing 1×108 conidia mL-1, and after, those caused highest confirmed mortality were selected for the second step, wherein it was evaluated the virulence, vegetative growth and conidia production in culture medium, rice and borer bodies. Three isolates of B. bassiana (UNIOESTE 4, UNIOESTE 52 and UNIOESTE 64 and one of M. anisopliae (IBCB 352 reached confirmed mortality equal or superior to 90%, these isolates were selected for the second step, together with the standard isolated GC 716 (B. bassiana. The isolated IBCB 352 of M. anisopliae, despite being the only of this species to be selected for the second step, promoted the high confirmed mortality and conidiogenesis in adults borer, indicating a high inoculums production i, being nominated for field evaluations. A erva-mate é uma cultura importante da região sul do Brasil, Argentina e Paraguai, tendo grande importância sócio-econômica e ambiental. Com a escassez de ervais nativos, a cultura da erva-mate passou a ser cultivada em sistema de monocultivo e como consequência, alguns insetos tornaram-se pragas, sendo a broca, Hedypathes betulinus, muito importante. A fim de incrementar o controle biológico na cultura, o objetivo deste trabalho foi selecionar em laboratório os isolados mais virulentos de 32 isolados do fungo entomopatog

  9. Eficácia de controle de plantas daninhas e toxicidade ao milho da mistura de foramsulfuron e Iodosulfuron isoladamente ou em associação com atrazine e/ou clorpirifós Weed control efficacy and corn toxicity of the foramsulfuron and iodosulfuron mixture, alone or combined with atrazine and/or chlorpyriphos

    Directory of Open Access Journals (Sweden)

    M.M. Trezzi

    2005-12-01

    Full Text Available Este trabalho constou de dois ensaios que avaliaram a toxicidade ao milho e a eficácia de controle de plantas daninhas dos herbicidas atrazine, da mistura foramsulfuron + iodosulfuron e do inseticida clorpirifós, isoladamente ou em mistura, aplicados em pósemergência. Utilizou-se o delineamento de blocos ao acaso com quatro repetições. No primeiro ensaio, todos os tratamentos foram capinados e constaram de: atrazine (3.000 g ha¹ de i.a.; atrazine + clorpirifós (3.000 + 225 g ha-1 de i.a.; atrazine + foramsulfuron + iodosulfuron + clorpirifós (2.250 + 15 + 1 + 225; 1.500 + 22,5 + 1,5 + 225; e 750 + 30 + 2 + 225 g ha-1 de i.a.; foramsulfuron + iodosulfuron (45 + 3 g ha-1 de i.a.; foramsulfuron + iodosulfuron + clorpirifós (45 + 3 + 225 g ha-1 de i.a.; e testemunha sem aplicação de herbicidas. Já no segundo ensaio foram utilizados todos os tratamentos anteriores, com exceção da mistura de todos os produtos nas doses de 750 + 30 + 2 + 225 g ha-1 de i.a., além dos respectivos tratamentos sem capina. Utilizou-se o cultivar de milho AG 3010 (híbrido duplo, superprecoce, tolerante a inibidores da ALS. Em 2002/2003, avaliou-se a toxicidade a milho e o rendimento, enquanto em 2003/2004 também foi avaliada a eficácia de controle de plantas daninhas. O uso de atrazine isoladamente ou em mistura com clorpirifós não gerou toxicidade às plantas de milho. A adição de clorpirifós à mistura foramsulfuron + iodosulfuron acentuou a injúria ao milho. A inclusão de atrazine simultaneamente à redução dos níveis de foramsulfuron + iodosulfuron permitiu reduzir em parte a injúria a plantas de milho, mantendo o controle de BRAPL e ampliando os níveis de controle de EPHHL.Two trials evaluated corn toxicity and weed control efficacy of the herbicides atrazine, foramsulfuron, and iodosulfuron and the insecticide chlorpyriphos applied at postemergence alone or in mixture. A randomized complete block design was used with four replications. In

  10. Adesão de pessoas com diabetes mellitus tipo 2 ao tratamento medicamentoso

    OpenAIRE

    BOAS, Lilian Cristiane Gomes-Villas; Foss-Freitas, Maria Cristina; Pace, Ana Emilia

    2014-01-01

    Estudo seccional de abordagem quantitativa que objetivou avaliar a adesão ao tratamento medicamentoso entre pessoas com diabetes mellitus, e sua relação com variáveis clínicas, de tratamento e controle metabólico. A amostra constituiu-se de 162 pessoas com diabetes mellitus tipo 2 em seguimento ambulatorial. Para a coleta dos dados, foram utilizadas a Medida de Adesão aos Tratamentos e a consulta aos prontuários dos participantes. Obteve-se elevada adesão ao tratamento medicamentoso. Para um ...

  11. ESSAY ON Elasmopalpus lignosellus (ZELLER, 1848 AND TO Syntermes sp., Procornitermes spp., AND Cornitermes spp. CONTROL IN MAIZE BY SEED TREATMENT ENSAIO DE CONTROLE À LAGARTA DO COLO Elasmopaplus lignosellus (Zeller, 1984 E AOS CUPINS Syntermes sp., Procornitermes spp. E Cornitermes spp., NA CULTURA DO MILHO, VIA TRATAMENTO DE SEMENTES

    Directory of Open Access Journals (Sweden)

    Luiz Carlos Corrêa de Oliveira Júnior

    2007-09-01

    Full Text Available

    This study presents the results of the field experiments carried out in Goiânia, Goiás State, Brazil, in 1985/86, to estimate the efficiency of insecticides in controlling the Lesser Cornstalk (Elasmopaplus lignosellus and the termites Syntermes sp., Procornitermes spp. and Cornitermes spp. which attack corn plants, by seed treatment. The results show that benfuracarbe, carbofuran and thiodicarbe, respectively, were highly efficient in controlling both pests, lesser cornstalk borer and termites up to 21 days after seed germination.

    Foi realizado um experimento com milho no município de Goiânia, Goiás, safra 1985/86, visando ao controle da lagarta do colo Elasmopaplus lignosellus e cupins  Syntermes sp., Procornitermes spp. e Cornitermes spp., via tratamento de sementes. Pelos resultados obtidos concluiu-se que Thiodicarbe na dose de 700 g. i.a. (gramas de ingrediente ativo; Carbofuran na dose de 700 g. i.a. e Benfuracarbe nas doses de 800 e 1000 g. i.a. / 100 kg de sementes deram 84,3 , 97,1 e 96,5% de controle a E. lignosellus, respectivamente, e controlaram 82,7 , 100,0 e 96,0% de cupins, na mesma ordem, até 21 dias após germinação das sementes.

  12. Susceptibility of Aedes aegypti larvae to temephos and Bacillus thuringiensis var israelensis in integrated control Susceptibilidade de larvas de Aedes aegypti ao tratamento integrado com temephos e Bacillus thuringiensis var israelensis

    Directory of Open Access Journals (Sweden)

    Carlos Fernando S. de Andrande

    1991-06-01

    Full Text Available The susceptibility of field collected Aedes aegypti larvae was evaluated in terms of median lethal time (LT50 and final mortality, when treated with temephos, Bacillus thuringiensis var israelensis as well as mixtures of these two agents. Third instar larvae were shown to be more susceptible than early and late fourth instar ones to the entomopathogen. Survival of some individuals when exposed to temephos suggest possible resistance. Temporal synergism in early fourth instar larvae was detected when they were exposed to mixtures of Bti-temephos. The possibility of this integrated treatment is commented on.A susceptibilidade de larvas de Aedes aegypti coletadas no campo foi avaliada em termos do tempo letal mediano (TL50 e da mortalidade final, quando tratadas com temephos, Bacillus thuringiensis var israelensis ou misturas desses dois agentes. As larvas de terceiro estádio mostraram-se mais suceptíveis ao patógeno do que aquelas no início ou no fim do quarto estádio. A sobrevivência de alguns indivíduos aos tratamentos com temephos permite sugerir a possibilidade de resistência. Foi detectada a existência de sinergismo temporal, quando larvas no início do quarto estádio foram tratadas com as misturas do Bti com o temephos. A possibilidade do tratamento integrado é comentada.

  13. Direito e Risco: do Consumo ao Ambiente

    OpenAIRE

    Marques, Carlos Alexandre Michaello

    2014-01-01

    A presente Dissertação tem como tema de investigação “Direito e Risco: do Consumo ao Ambiente”. Para tanto, essa temática foi delimitada através da investigação sobre a capacidade do Direito a partir de uma leitura Sociológica e Antropológica de compreender e promover aprendizagem nas questões que envolvem o Risco como elemento decorrente do Consumo e que externa suas consequências ao Ambiente. Neste sentido, se direcionou a responder ao problema de saber: em que medida é possível e necessári...

  14. Controle genético e tolerância ao estresse de calor em populações híbridas e em cultivares de trigo Genetic control and tolerance to the heat stress in wheat hybrid population and cultivars

    Directory of Open Access Journals (Sweden)

    Moacil Alves de Souza

    2001-10-01

    Full Text Available O objetivo deste trabalho foi obter informações sobre o controle genético da produtividade de grãos de trigo sob condições de estresse de calor, o grau de tolerância ao estresse de calor de algumas cultivares e linhagens e a identificação de populações segregantes promissoras para a obtenção de linhagens adaptadas às condições da região central do Brasil. Foram avaliados 13 parentais e 40 populações provenientes de um dialelo parcial, nas gerações F1 e F2 em condições de campo, em Lavras e Patos de Minas, MG, com as semeaduras feitas no verão (fevereiro e no inverno (maio. Houve diferença de tolerância ao calor entre os parentais e entre as populações híbridas quanto ao caráter produção de grãos, e ambos os efeitos aditivos e não-aditivos foram importantes no controle genético deste caráter na presença ou ausência de calor. Apesar da ocorrência de interações populações x épocas de semeadura, a alta repetibilidade dos efeitos da capacidade geral de combinação permite inferir a possibilidade de acelerar os programas de melhoramento na região, efetuando-se a seleção tanto na época de verão quanto no inverno.The objective of this work was to get information about the genetic control of the grain yield under heat stress conditions, the tolerance of cultivar and the identification of promising segregation populations for selections of lines adapted to the conditions of the central region of Brazil. Thirteen parents and 40 populations in F1 and F2 generations derived by partial diallel crosses were evaluated. The experiments were conducted under field conditions in Lavras and Patos de Minas, MG, Brazil, sowing the seeds in the summertime (February and in the winter (May. There was difference of heat tolerance among parents and hybrid populations for grain yield character, and both additive and non-additive effects were important in the genetic control of grain yield character in the presence or absence

  15. Customer satisfaction and response to AOS

    Science.gov (United States)

    1999-01-01

    Passenger surveys were conducted in each of three successive springs in order to track passenger perception of changes in service quality during AOS implementation. In general, no improvement in passenger perceptions was observed relative to a high b...

  16. Fatores associados ao controle da asma em pacientes pediátricos em centro de referência Factores asociados al control del asma en pacientes pediátricos en centro de referencia Factors associated with asthma control in a pediatric reference center

    Directory of Open Access Journals (Sweden)

    Vanessa Mika Kinchoku

    2011-12-01

    Full Text Available OBJETIVO: Descrever os dados epidemiológicos, clínicos e os fatores associados ao controle da asma em pacientes asmáticos seguidos em um ambulatório pediátrico especializado. MÉTODOS: Estudo transversal de pacientes asmáticos ambulatoriais, para os quais eram fornecidas medicações profiláticas. A classificação da asma, as etapa de tratamento e a avaliação do controle seguiram a IV Diretrizes Brasileiras para o Manejo da Asma, de 2006. Os fatores avaliados foram: outras alergias, obesidade, imunodeficiências, refluxo gastresofágico e sensibilização alérgica, sendo comparados pacientes com asma controlada ou não com relação à etapa do tratamento, à obesidade e à sensibilização alérgica. RESULTADOS: Foram analisados 300 pacientes com asma (1,38M:1F, com mediana de idade de 10,8 anos, e de início dos sintomas de 1,0 ano. A atopia estava presente em 78% dos pais e/ou irmãos. Antecedentes pessoais de doenças alérgicas ocorreram em 292 pacientes (96% rinite, 27% dermatite atópica, 18% conjuntivite alérgica, 6% alergia alimentar. Foram diagnosticados sete casos de deficiência de IgA (DIgA e quatro de IgG2; obesidade em 37/253 (15%, sendo que sobrepeso e obesidade estiveram associados à falta de controle (p=0,023. Em 118 pacientes com multissensibilização, predominaram casos não controlados (22 (19% casos; p=0,049; OR 1,9; IC95% 1,03-3,50. Entre os 180 casos (60% em tratamento nas etapas 3 e 4, 122 (45% estavam controlados e 112 (41% parcialmente controlados. CONCLUSÕES: A rinite foi a alergia mais associada à asma e a prevalência de DIgA foi 20 vezes maior do que na população geral. O controle parcial ou total dos sintomas da asma foi obtido em 85% dos casos. Obesidade/sobrepeso e multissensibilização foram associadas à falta de controle da asma.OBJETIVO: Describir los datos epidemiológicos, clínicos y los factores asociados al control del asma en pacientes asmáticos seguidos en ambulatorio pedi

  17. Standard Triaxial Ellipsoid Asteroids from AO Observations

    Science.gov (United States)

    Drummond, Jack D.; Merline, W. J.; Conrad, A.; Dumas, C.; Carry, B.

    2008-09-01

    As part of our study of resolved asteroids using adaptive optics (AO) on large telescopes (>8; m), we have identified several that can serve as Standard Triaxial Ellipsoid Asteroids (STEAs), suitable for radar and thermo-physical calibration. These objects are modeled well as triaxial ellipsoids, having: 1) small uncertainties on their three dimensions as determined with AO; 2) rotational poles well determined from both lightcurves and AO; and 3) good sidereal periods from lightcurves. Although AO allows the opportunity to find an asteroid's dimensions and rotational pole in one night, we have developed a method to combine AO observations from different oppositions to pool into a global solution. The apparent orientation and sizes of STEAs can be predicted to within a few degrees and a few km over decades. Currently, we consider 511 Davida, 52 Europa, 2 Pallas, and 15 Eunomia as STEAs. Asteroids that are not well modeled as ellipsoids, clearly showing departures from ellipsoid figures in AO images, include 129 Antigone and 41 Daphne. We will show movies of images and models of these asteroids.

  18. INSETICIDAS APLICADOS VIA TRATAMENTO DE SEMENTES VISANDO AO CONTROLE DAS MOSCAS BRANCAS (Bemisia tabaci, GENN. E MINADORA (Liriomyza sp. NA CULTURA DO FEIJOEIRO CHEMICAL CONTROL OF THE WHITE FLY Bemisia tabaci GENN. AND LEAFMINER Liriomyza sp. IN BEAN CROPS BY SEED TREATMENTS

    Directory of Open Access Journals (Sweden)

    Antônio Lopes da Silva

    2007-09-01

    Full Text Available

    Realizou-se o presente experimento no campo experimental da Escola de Agronomia da Universidade Federal de Goiás, de março a maio de 1993, para avaliar o controle das moscas brancas (Bemisia tabaci, GENN. e minadora (Liriomyza sp. na fase inicial da cultura do feijoeiro, com produtos aplicados via tratamento de sementes. Os tratamentos constaram de: imidacloprid 700 PM nas dosagens de 140, 210, 280 e 350 gramas de ingrediente ativo (i.a/l00 kg de sementes; carbosulfan + zinco 250 TS nas dosagens de 375 e 500g i.a./100kg de sementes, comparados com o carbofuran 350 TS na dosagem de 525 g i.a./100kg de sementes (padrão. Pelos resultados, concluiu-se que todos os tratamentos foram eficientes no controle da mosca minadora, com porcentagens de eficiência que variaram de 93 a 99%. Imidacloprid, a partir de 280g i.a./100kg de sementes, foi igual aos outros produtos em eficiência no controle da mosca branca, com porcentagens de controle variando entre 83 a 89%.

    A trial to control the white fly Bemisia tabaci, GENN. and leafminer Liriomyza sp. was carried out in Goiânia, state of Goiás. The treatments and dosages of the insecticides per 100kg of seed were: imidacloprid (140, 210, 280 and 350g a.i., carbofuran (525 g a.i., carbosulfan (375 and 500g a.i, plus an untreated check. The application of the treatments were made on the seeds. The results of the experiment showed that all insecticides were efficient in controlling the leafminer at all dosages tested and imidacloprid at the dosages of 280 and 350g a.i. per 100kg seed was similar in controlling the white fly in bean crops.

  19. Efeito "in vitro" de antibióticos e rizobactérias no controle de bactérias fitopatogênicas ao Eucalyptus spp. "In vitro" effect of antibiotics and rhizobacteria on the control of phytopathogenic bacteria in Eucalyptus spp.

    Directory of Open Access Journals (Sweden)

    Jeane de Fátima Cunha

    2006-12-01

    Full Text Available Doenças causadas por bactérias constituem um novo desafio à cultura do Eucalyptus spp., podendo, inclusive, limitar o uso de clones suscetíveis. O presente trabalho objetivou avaliar a eficiência de antibióticos e rizobactérias na inibição do crescimento "in vitro" de isolados de bactérias fitopatogênicas ao Eucalyptus spp. na fase de viveiro e de campo. O antibiótico sulfato de amicacina e a rizobactéria S1 (Bacillus subtillis destacaram-se quanto à inibição do crescimento do isolado fitopatogênico IP1-05 (Pseudomonas chichorii, enquanto a cefoxitina causou maior inibição dos isolados BSV16 e RVV11 (Rhizobium sp.. Os antibióticos de uso comercial na área agronômica, Mycoshield (oxitetraciclina e Agrimicina (estreptomicina e tetraciclina foram pouco efetivos. Este trabalho proporciona embasamento a alternativas para controle biológico de doenças bacterianas em mudas de Eucalyptus spp. na fase de viveiro.Diseases caused by bacteria represent a new challenge for Eucalyptus spp. and may also limit the use of susceptible clones. Our study aimed at an evaluation of the efficiency of antibiotics and rhizobacteria in inhibiting "in vitro" growth of phytopathogenic bacteria isolates in Eucalyptus spp. during the nursery stage and in the field. The antibiotic amicacine sulfate and rhizobacterium S1 (Bacillus subtilis stood out inhibiting the growth of the phytopathogenic isolate IP1-05 (Pseudomonas chichorii, whereas cefoxitin caused a greater inhibition of the isolates BSV16 and RVV11 (Rhizobium sp.. The commercial antibiotics for agricultural use Mycoshield (oxitetracycline and Agrimycin (estreptomycin and tetracycline were little effective. This study offers a base for alternatives of biological control of bacterial diseases in Eucalyptus spp. nursery seedlings.

  20. Investigation on the use digital controls instead of PID analog controls in the level control of steam generators of nuclear power PWR; Investigacao sobre o uso de controladores digitais em substituicao aos controladores analogicos PID para o controle de nivel de geradores de vapor de centrais nucleares PWR

    Energy Technology Data Exchange (ETDEWEB)

    Alvarenga, Marco Antonio Bayout

    2012-07-01

    The aim of this study is to identify current alternatives for the implementation of digital controllers in the level control of steam generators of nuclear power PWR (Pressurized Water Reaetor). It is intended to identify the types of digital controls that are available from the theoretical and conceptual viewpoints for this purpose. We investigate the advantages and disadvantages of each controller model. From this assessment are pointed the most suitable models in hierarchical scale. This evaluation also serves to suggest possible types of control installation as a whole, where the level control of the steam generators becomes just one of many controls that are part of the plant. In this case, the use of digital controls allows the non-linear and multivariable treatment which is characteristic of complex systems, such as the nuclear power generation. The treatment of nonlinearities and multivariable aspects allows a more detailed study of the stability of these plants when they are subject to transients or several accidents, such as the case of losing external power of transients. In the specific case of steam generators, the instabilities result from the emergence of the shrink and swell phenomenas, depending on the load variations of thermonuclear plant. The application of several types and digital controllers, considering these inherent characteristics of the level control of steam generators, allows to infer which types of controllers are more appropriate to treat instabilities of this type and to make conjectures in its use for the cases of more complex instabilities, considering the integration of all nucleus-plant controls.

  1. Comunicação visual como recurso de apoio a prevenção e ao controle das infecções hospitalares - valor da lavagem das mãos realçado por figuras e mensagens ilustrativas

    Directory of Open Access Journals (Sweden)

    José Luís da Silveira Baldy

    1984-11-01

    Full Text Available Proposition of visual communication, by illustrative figures and messages appealing to jokes and expressionism, as a mean to reduce the incidence of the hospital infections. The content of the messages is related to the value of the handwashing with soap and water to reach the onlookers, emphasizing the need for the physicians, nurses, students and the remaining technicians and therapists to take to the hand-washing, berfore and after the contacts with the patients, as a basic measure and a routine procedure.Proposta de recurso de comunicação visual - através de figuras e mensagens ilustrativas - para ser aplicada com o objetivo de contribuir pedagogicamente, apelando ao chiste e ao expressionismo, para a divulgação e o estimulo da prática de lavar as mãos, rotineiramente, antes e depois do contato com os doentes, como conduta de grande importância, adotada pelo pessoal médico e paramédico, entre as medidas de prevenção e controle das infecções adquiridas por pacientes hospitalizados.

  2. Gorgonids from Curaçao Island

    NARCIS (Netherlands)

    Gordon, Isabella

    1925-01-01

    This report contains an account of a collection of Gorgonids made by Dr. C. J. VAN DER HORST at the island of Curaçao and also of a few specimens collected in the same locality by Ir. G. J. H. MOLENGRAAFF. The Majority of the specimens are taken from Caracas bay at a depth of not more than five

  3. Estados Unidos: do Iraque ao Brasil

    Directory of Open Access Journals (Sweden)

    Virgílio Caixeta Arraes

    2010-12-01

    Full Text Available O presente artigo busca analisar os recentes temas recorrentes na política externa norte-americana, caracterizada pela “guerra contra o terror”, e seus impactos para a agenda a ser discutida na vindoura visita do presidente dos Estados Unidos, Geoge W. Bush, ao Brasil.

  4. Nematoides entomopatogênicos e sua interação com inseticida químico visando ao controle da broca-da-bananeira Cosmopolites sordidus Germar (Coleoptera: Curculionidae)

    OpenAIRE

    BORTOLUZZI, L.; L. F. A. ALVES; Alves,V.S.; Holz, N.

    2013-01-01

    The banana weevil borer (Cosmopolites sordidus) is the main pest of banana crops, causing significant losses in productivity, being recommended control by chemical insecticides which cause several environmental impacts. On the other hand, entomopathogenic nematodes can be an alternative to the pest control, mainly because of their habits. Thus, this study aimed at evaluating isolated entomopathogenic nematodes under laboratory conditions and also their interaction with a chemical insecticide ...

  5. Investigação de variável adequada ao controle automático de vazão sem uso de sensores em campos irrigados por meio de análise multivariada Investigation of variable appropriately to the automatic flow control without the use of sensors in fields irrigated by means of multivariate analysis

    Directory of Open Access Journals (Sweden)

    Francisco José Firmino Canafístula

    2010-11-01

    Full Text Available Utilizar inversores no controle de vazão de sistemas de bombeamento por meio da variação de sua velocidade pode ter uma maior viabilidade, caso o custo de sensores seja minimizado. Este trabalho investiga, por intermédio de análise multivariada, uma variável adequada ao pseudocontrole da vazão de um sistema de irrigação que economize o uso de sensores e simplifique o sistema de controle. Uma bancada de ensaio para coleta dados foi montada no laboratório e os dados foram processados no Statistical Package for the Social Sciences (SPSS. A análise de agrupamento hierárquico utilizando o método de Ward com base na distância euclidiana quadrática mostrou um grupo composto de quatro variáveis, estando presente nesse grupo a vazão, voltas no registro, altura do nível de água da calha parshall e a corrente elétrica, indicativo de que a corrente elétrica pode ser usada para o pseudocontrole, pois o inversor mede essa variável. A análise fatorial também indicou uma forte correlação da corrente elétrica com a vazão do sistema. A pressão foi o parâmetro da primeira componente da análise fatorial que apresentou a maior correlação com a vazão, no entanto o uso dessa variável para o controle automático demanda o uso de sensores.Using inverters to control flow of pumping systems by means of changes in speed may be more viable if the cost of sensors is minimized. This work investigates through multivariate analysis an adequate variable for the pseudo control of the flow of an irrigation system that saves the use of sensors and simplifies the control system. A bench test to collect data was mounted in the laboratory and the data were processed using Statistical Package for the Social Sciences (SPSS. The hierarchical cluster analysis using the Ward method based on the squared Euclidean distance showed a group composed of four variables, being present in that group flow, turns on the register, water level of the Parshall weir and

  6. Robust 2DOF controller applied to station keeping of offshore platform in deep-water environment; Controlador 2DOF robusto aplicado ao posicionamento de plataformas offshore em aguas profundas

    Energy Technology Data Exchange (ETDEWEB)

    Borges Filho, Alvaro M. [PETROBRAS, Macae, RJ (Brazil); Costa, Ramon R.; Gomes, Afonso C.D.N. [Universidade Federal, Rio de Janeiro, RJ (Brazil). Coordenacao dos Programas de Pos-graduacao de Engenharia

    1996-12-31

    In this paper an Automatic Station Keeping System is developed for a thruster assisted moored drilling semi-submersible platform operating in deep water environment. A single-input-single-output two degree of freedom controller (2DOF) is designed using a polynomial approach and its performance is compared with the classic PID solution. The controller parameters are tuned through frequency techniques in order to obtain a robust performance. Computational simulations are presented to illustrate the results. (author) 10 refs., 9 figs., 2 tabs.; e-mail: alvaro at vishnu.coep.ufrj.br

  7. Building a reliable, scalable and affordable RTC for AO instruments on ELTs

    Science.gov (United States)

    Gratadour, Damien; Sevin, Arnaud; Perret, Denis; Brule, Julien

    2013-12-01

    Addressing the unprecedented amount of computing power needed by the ELTs AO instruments real-time controllers (RTC) is one of the key technological developments required for the design of the next generation AO systems. Throughput oriented architectures such as GPUs, providing orders of magnitude greater computational performance than high-end CPUs, have recently appeared as attractive and economically viable candidates since the fast emergence of devices capable of general purpose computing. However, using for real-time applications a I/0 device which cannot be scheduled nor controlled internally by the operating system but is sent commands through a closed source driver comes with a number of challenges. Building on the experience of almost real-time end-to-end simulations using GPUs, and relying on the development of the COMPASS platform, a unified and optimized framework for AO simulations and real-time control, our team has engaged into the development of a scalable, heterogeneous GPU-based prototype for an AO RTC. In this paper, we review the main challenges arising when utilizing GPUs in real-time systems for AO and rank them in terms of impact significance and available solutions. We present our strategy, to mitigate these issues including the general architecture of our prototype, the real-time core and additional dedicated components for data acquisition and distribution. Finally, we discuss the expected performance in terms of latency and jitter on the basis of realistic benchmarks and focusing on the dimensioning of the MICADO AO module RTC.

  8. Modificação de uma barra de pulverização para a aplicação de fungicida em trigo visando ao controle de giberela Fungicidal spray boom modification for controling head blight in wheat crop

    Directory of Open Access Journals (Sweden)

    Edivan Panisson

    2004-04-01

    Full Text Available Devido ao aumento da intensidade e da freqüência de ocorrência da giberela, doença causada pelo fungo Gibberella zeae (anamorfo Fusarium graminearum, essa vem sendo apontada como uma das moléstias de maior importância na cultura do trigo no Sul do Brasil. A giberela é uma doença de infecção floral e mesmo os fungicidas sistêmicos recomendados apresentam apenas efeito protetor das anteras. Os objetivos do presente trabalho foram avaliar a eficiência de controle e os efeitos nos grãos colhidos, de diferentes pontas de pulverização (jato plano, jato plano duplo e jato cônico vazio, diferentes arranjos dos bicos na barra de aplicação e dois volumes de calda. Em dois experimentos realizados no ano de 1999, a aplicação dos tratamentos reduziu significativamente a incidência, o número de espiguetas gibereladas e a severidade da doença, aumentando o rendimento de grãos. As pontas de pulverização, seus arranjos na barra e os volumes de calda utilizados comportaram-se de maneira semelhante em todas as variáveis avaliadas. O incremento do rendimento de grãos obtido nas parcelas tratadas em relação à testemunha sugere que se deve recomendar a aplicação de fungicidas para o controle da giberela, utilizando pontas que gerem gotas finas a médias com volume de calda de 200 L ha-¹.The increased frequency and yield losses in wheat, associated with head blight in Winter cereal crops in Southern Brazil, caused by the fungus Gibberella zeae, have turned this disease into a major problem. Gibberella zeae enters the host plants through the anthers. To avoid infection, the fungicides need to protect the anthers from the fungus, which requires improved spray techniques. The role of different spray nozzles (flat fan, twin flat fan, and hollow cone, different nozzles arrangements, and two spray volumes on head blight control and grain yield were evaluated. In two experiments conducted in the field, at the year 1999, the fungicidal

  9. Sensibilidade da rosa 'Osiana' ao etileno

    OpenAIRE

    Delaine Cristina Cordeiro; Fernando Luiz Finger; Joice Simone dos Santos; Juliane Karsten; José Geraldo Barbosa

    2011-01-01

    Os objetivos deste trabalho foram determinar a sensibilidade e as respostas da rosa cultivar Osiana (Rosa × hybrida) à presença de etileno ao longo da vida pós-colheita. Para determinar a sensibilidade da flor ao etileno, hastes foram cortadas e colocadas em câmaras herméticas e em seguida tratadas por 24 horas com diferentes concentrações de etileno variando de 0,0; 0,1; 1,0; 10; 100 e 1000 µL L-1do ar no interior da câmara. A rosa teve a vida pós-colheita reduzida pelo etileno, quando expos...

  10. Sensibilidade da rosa 'Osiana' ao etileno

    Directory of Open Access Journals (Sweden)

    Delaine Cristina Cordeiro

    2011-01-01

    Full Text Available Os objetivos deste trabalho foram determinar a sensibilidade e as respostas da rosa cultivar Osiana (Rosa × hybrida à presença de etileno ao longo da vida pós-colheita. Para determinar a sensibilidade da flor ao etileno, hastes foram cortadas e colocadas em câmaras herméticas e em seguida tratadas por 24 horas com diferentes concentrações de etileno variando de 0,0; 0,1; 1,0; 10; 100 e 1000 µL L-1do ar no interior da câmara. A rosa teve a vida pós-colheita reduzida pelo etileno, quando exposta a concentração igual ou superior a 10 µL L-1 de etileno. As flores tratadas com no mínimo de 10 µL L-1de etileno desenvolveram necrose, murcha e abscisão prematura das pétalas ainda túrgidas. As concentrações de 0,1 e 1,0 µL L-1de etileno estimularam a abertura do botão floral durante o período de 24 horas de exposição ao etileno, sem no entanto, reduzir a vida pós-colheita. A rosa 'Osiana' pode ser classificada como uma cultivar sensível ao etileno e a concentração influência os processos estimulados.

  11. ECOPERSONALISMO E DIREITO AO MEIO AMBIENTE

    Directory of Open Access Journals (Sweden)

    Jesús Ballesteros

    2008-04-01

    Full Text Available O objetivo do presente artigo consiste em refletir brevemente sobre as conseqüências, no âmbito do direito ao meio ambiente, das diferentes concepções sobre a relação entre o ser humano e a natureza, isto é, o modelo tecnocrático, o biologista e o ecológico-personalista

  12. Controle de pragas e doenças, maturação e qualidade de maçãs 'imperial gala' submetidas ao ensacamento Control of insect pests and diseases, maturity and quality of 'imperial gala' apples submitted to bagging

    Directory of Open Access Journals (Sweden)

    Rosângela Teixeira

    2011-06-01

    Full Text Available O objetivo deste trabalho foi avaliar a eficiência de diferentes embalagens no ensacamento de maçãs para o controle de pragas e doenças, e sua influência na maturação e qualidade dos frutos, em pomar sob sistema orgânico. O experimento foi conduzido em pomar com plantas de dez anos de idade da cultivar Imperial Gala, sobre porta-enxerto 'Marubakaido', com filtro EM-9, localizado no município de São Joaquim-SC, nas safras 2007/2008 e 2008/2009. Os frutos foram ensacados, após o raleio, com embalagens plásticas transparentes microperfuradas ou de tecido não texturizado (TNT. Frutos não ensacados constituíram o tratamento-controle. Na colheita, os frutos foram avaliados quanto aos danos provocados por mosca-das-frutas (Anastrepha fraterculus, mariposa-oriental (Grapholita molesta, lagarta-enroladeira (Bonagota salubricola e pulgão-lanígero (Eriosoma lanigerum, incidência das doenças sarna-da-macieira (Venturia inaequalis e podridão-amarga (Colletotrichum gloeosporioides, e atributos físico-químicos de maturação e qualidade e teor de cálcio (Ca nos frutos. O ensacamento, independentemente do tipo de material utilizado, reduziu os danos de insetos-praga, porém não foi eficiente no controle de doenças nos frutos. O ensacamento não comprometeu o desenvolvimento de coloração vermelha na casca e o teor de Ca nos frutos. De modo geral, o ensacamento antecipou o processo de maturação, caracterizado pela redução na firmeza de polpa e na textura da casca e da polpa, e pelo aumento no índice de iodoamido.This work was carried out to evaluate the efficiency of different fruit bagging materials to insect pests and diseases control, and its influence on maturity and quality of the fruits in an organic apple orchard. The experiment was conducted in an orchard with ten years old 'Imperial Gala' apple trees grafted on 'Marubakaido' rootstock (with a filter of EM-9, in São Joaquim, State of Santa Catarina, in 2007/08 and 2008

  13. Contribuição ao controle de qualidade farmacognóstico das folhas e caules de Melão-de-São Caetano (Momordica charantia L. - Cucurbitaceae)

    OpenAIRE

    Martins Daleffi Zocoler, Analice; Mourao, Káthia Socorro Mathias; Mello, João Carlos Palazzo de; Marques, Luís Carlos

    2006-01-01

    Momordica charantia L. (Cucurbitaceae) é uma espécie usada popularmente como anti-helmíntico e anti-hiperglicêmico. Realizou-se controle de qualidade farmacognóstico das partes aéreas (caule e folhas). A macroscopia evidenciou folhas alternas, com cinco a sete lobos ovado-oblongos, denteadas, com presença de gavinhas; suas flores amarelas são axilares, unissexuais; fruto cápsula loculicida, com sementes vermelhas. A microscopia evidenciou folhas dorsiventrais com tricomas glandulares alongado...

  14. Seletividade de agrotóxicos utilizados na cultura do arroz irrigado ao fungo Metarhizium anisopliae, agente de controle microbiano de Tibraca limbativentris Selectivity of chemical pesticides used in rice irrigated crop at fungus Metarhizium anisopliae, microbial control agent of Tibraca limbativentris

    Directory of Open Access Journals (Sweden)

    Fátima Teresinha Rampelotti-Ferreira

    2010-04-01

    Full Text Available Para subsidiar a utilização de táticas de manejo integrado para o inseto-praga Tibraca limbativentris, avaliou-se a compatibilidade in vitro entre o isolado CG 891 de Metarhizium anisopliae e os agrotóxicos utilizados na cultura do arroz irrigado. Os parâmetros avaliados foram crescimento vegetativo, esporulação e germinação em pré e pós-contato do fungo, com duas doses de fipronil, tiametoxam, fenitrotiona, carbofurano, pirazossulfurom-etílico, bentazona, clomazona, glifosato e quincloraque; e uma dose de triciclazol e azoxistrobina. Reduções significativas no crescimento vegetativo e esporulação de M. anisopliae foram observadas para fenitrotiona, carbofurano e azoxistrobina. Observou-se redução na germinação em pré-contato para o agrotóxico azoxistrobina. O valor percentual da germinação alterou a classificação dos agrotóxicos com relação a sua seletividade sobre o entomopatógeno. No entanto, os resultados mostram que in vitro os agrotóxicos fenitrotiona, carbofurano, glifosato e azoxistrobina são prejudiciais ao isolado CG 891 de M. anisopliae.Searching for integrated control strategies for the insect-pest Tibraca limbativentris, the in vitro compatibility between isolated CG 891 of Metarhizium anisopliae and several pesticides used in the culture of irrigated rice was evaluated. The followings parameters were studied: vegetative growth, sporulation and the germination viability in pre- and post-contact of the fungus for two concentrations of fipronil, thiametoxan, fenitrothion, carbofuran, pyrazosulfuron-ethyl, bentazon, clomazone, glyfosate and quinclorac and one concentration of tricyclazole and azoxystrobin. Significant reductions in the vegetative growth and sporulation of M. anisopliae were observed for fenitrothion, carbofuran and azoxystrobin. The germination in pre-contact was affected by azoxystrobin. The percentage of germination changed the classification of pesticides in relation to its

  15. Quality assurance in RapidArc with Alderson anthropomorphic phantom using radiochromic film in comparison to MATLAB; Controle de qualidade em RapidArc com simulador de corpo humano antropomorfico Alderson utilizando filme radiocromico em comparacao ao MATLAB

    Energy Technology Data Exchange (ETDEWEB)

    Garcia, Paulo L.; Silva, Leonardo P.; Santos, Maira R.; Trindade, Cassia; Martins, Lais P.; Batista, Delano V.S., E-mail: Paulo8_lgarcia@hotmail.com [Instituto Nacional de Cancer (INCA), Rio de Janeiro, RJ (Brazil); Alves, Victor G. [Instituto Nacional de Cancer (SQRIS/INCA), Rio de Janeiro, RJ (Brazil). Servico de Qualidade em Radiacoes Ionizantes

    2012-12-15

    This paper presented the quality control for RapidArc using an Alderson human body phantom and radiochromic film as an alternative system to approve the treatment plan for brain tumor. Thus, it was comprised the dose distributions provided by the treatment planning system with those measured by the film radiochromic. The gamma index (Γ) analysis, to verify the acceptability of the dose distribution, was 95% of approved points, with the mostly non-compliance points in regions near the PTV’s edges. These non-compliance points may be associated to transmission blades aspects, because the regions near the edges present significant losses compared to the central areas. Also, MATLAB has proved an effective tool for that measurements and it can be used in quality assurance programs. (author)

  16. Teoria dos jogos aplicada ao controle de potÃncia e à equalizaÃÃo adaptativa em sistemas de comunicaÃÃo mÃvel

    OpenAIRE

    Fabiano de Sousa Chaves

    2005-01-01

    A teoria dos jogos à um ramo da matemÃtica dedicado à anÃlise das interaÃÃes entre elementos concorrentes, que se encontram em situaÃÃo de conflito, e à formulaÃÃo de estratÃgias de decisÃo. O potencial de aplicaÃÃo desta teoria em sistema de comunicaÃÃo mÃvel à considerado, jà que em alguns dos problemas podem ser identificados elementos em situaÃÃo de conflito. Dois problemas sÃo aqui abordados, a saber, o controle de potencia de transmissÃo e a equalizaÃÃo adaptativa de canal. Ambos estÃo ...

  17. Identification of system misregistrations during AO-corrected observations

    Science.gov (United States)

    Béchet, C.; Thiébaut, É.; .; Tallon, M.; Kolb, J.; Madec, P.-Y.

    2011-09-01

    The E-ELT will be equipped with a deformable mirror inside the telescope. The performance of reconstruction and control depends on the calibration of the interaction matrix- or a model of the interaction matrix- , which characterizes the system and the relationship between the commands sent to the deformable mirrors (DM) and the wavefront sensors (WFS) slopes. Such a calibration will be more complex than for the current systems at the VLT since it will have to be at least partly measured on sky and for a much larger number of degrees of freedom (more than 5000). In addition, gravity or temperature variations for instance are likely to introduce slow evolution of the matching between the M4 Deformable mirror and the WFS geometry. This can occur during observations and therefore degrade the adaptive optics (AO) correction. To relax the need of frequent painful calibrations and to prevent a loss of performance due to misregistrations, we investigate how to track the evolution of the interaction matrix errors in closed-loop without introducing any degradation in the observations. This is done thanks to identification methods and optimization theory. First, we formally describe the problem and the difficulties of such an identification in closed-loop configuration. Then, we present 2 solutions, based on the optimization of the error of estimates of the WFS slopes, at the output of the closed-loop AO. The performance of the methods and their limitations are discussed formally and thanks to numerical simulations of a high order AO system. We finally explore to which extent these methods currently studied for the Adaptive Optics Facility (AOF) at the VLT can be applied to the E-ELT.

  18. ROBO-AO M DWARF MULTIPLICITY SURVEY

    Science.gov (United States)

    Lamman, Claire; Berta-Thompson, Zachory; Baranec, Christoph; Law, Nicholas; Schonhut, Jessica

    2018-01-01

    We analyzed over 7,000 observations from Robo-AO’s field M dwarf survey taken on the 2.1m Kitt Peak telescope. Results will help determine the multiplicity fraction of M dwarfs as a function of primary mass, which is a crucial step towards understanding their evolution and formation mechanics. Through its robotic, laser-guided, and automated system, the Robo-AO instrument has yielded the largest adaptive-optics M dwarf survey to date. I developed a graphical user interface to quickly analyze this data. Initial data analysis included assessing data quality, checking the result from Robo-AO’s automatic reduction pipeline, and determining existence as well as the relative position of companions through a visual inspection. This program can be applied to other datasets and was successfully tested by re-analyzing observations from a separate Robo-AO survey. Following the preliminary results from this data analysis tool, further observations were done with the Keck II telescope by using its NIRC2 imager to follow up on ten select targets for the existence and physical association of companions. After a conservative initial cut for quality, 356 companions were found within 4” of a primary star out of 2,746 high quality Robo-AO M dwarf observations, including four triple systems. We will present a preliminary estimate for the multiplicity rate of wide M dwarf companions after accounting for observation limitations and the completeness of our search. Future research will yield insights into low-mass stellar formation and provide a database of nearby M dwarf multiples that will potentially assist ongoing and future surveys for planets around these stars, such as the NASA TESS mission.

  19. Deformable mirror designs for extreme AO (XAO)

    Science.gov (United States)

    Cavaco, Jeffrey; Wirth, Allan

    2014-08-01

    One of the science missions for the next generation of extremely large ground based telescopes (30-42m apertures) is the imaging and spectroscopy of exoplanets. To achieve that goal an Adaptive Optics (AO) subsystem with a very large number of corrected modes is required. To provide contrast ratios in the range of 10-9 or better for a 42m telescope an AO system with 25,000 to 60,000 channels will be needed. This is approximately an order of magnitude beyond the current state of the art. Adaptive Optics Associates Xinetics has developed the Photonex Module Deformable Mirror (DM) technology specifically to address the needs of extreme AO for high contrast applications. A Photonex Module is a monolithic block of electrostrictive ceramic in which a high density of individually addressable actuators are formed by screen printing of electrodes and partial wire saw cutting of the ceramic. The printed electrode structures also allow all electrical connections to be made at the back surface of the module via flex circuits. Actuator spacings of 1mm or less have been achieved using this approach. The individual modules can be edge butted and bonded to achieve high actuator count. The largest DMs fabricated to date have 4096 actuators in a 64X64mm array. In this paper the engineering challenges in extending this technology by a factor of ten or more in actuator count will be discussed. A conceptual design for a DM suitable for XAO will be presented. Approaches for a support structure that will maintain the low spatial frequency surface figure of this large (~0.6m) DM and for the electrical interface to the tens of thousands of actuators will be discussed. Finally, performance estimates will be presented.

  20. Epidemiologia da tricomoniose e sensibilidade ao metronidazol

    OpenAIRE

    Alves, Maria José Gonçalves

    2006-01-01

    A Trichomonas vaginalis é o agente etiológico da tricomoniose, a doença sexualmente transmissível (DST) não viral mais comum no mundo. Actualmente é sabido que promove a transmissão do vírus do HIV, é causa de baixo peso em bebés, bem como de nascimentos prematuros, predispõe mulheres a doença inflamatória pélvica atípica, neoplasia cervical e infertilidade. Acresce ao problema o facto de serem usadas metodologias de diagnóstico com baixa sensibilidade e ainda o aumento de c...

  1. Esta é minha carta ao mundo

    Directory of Open Access Journals (Sweden)

    Fernanda Mourão

    2009-01-01

    Full Text Available A partir da primeira carta de Emily Dickinson (1830-1886 a Thomas Higginson, que então seria seu “preceptor” e interlocutor para sempre, este texto propõe uma leitura da obra da escritora norte-americana a partir do biografema da carta e da ideia de sua obra como “carta ao mundo” – conforme um de seus mais famosos poemas –, com todas as implicações trazidas pelo termo, e à luz das teorias de Roland Barthes, Maurice Blanchot e Silvina Rodrigues Lopes, entre outros.

  2. Hepatotoxicidade associada ao uso de esteroides anabolizantes

    OpenAIRE

    Mónica Brinquinho; Ana Andresa Sousa; Janine Resende; João Valente

    2017-01-01

    O consumo de esteroides androgénicos anabolizantes tem vindo a aumentar no meio desportivo amador, sendo de fácil acesso apesar de se tratarem de substâncias proibidas. Estão descritos múltiplos efeitos laterais, sendo a hepatotoxicidade uma das mais reportadas. Apresentam-se dois casos clínicos representativos da lesão hepática associada ao consumo de esteroides anabolizantes. Ambos evidenciaram morbilidade significativa, embora nenhum deles tenha evoluído para falência hepática. Os autores ...

  3. O TEMA DA JUSTIFICAÇÃO NAS CARTAS AOS ROMANOS E AOS GÂLATAS

    Directory of Open Access Journals (Sweden)

    James N. F. Alisson

    1990-01-01

    Full Text Available Uma das dificuldades para entender a doutrina de Paulo sobre a justificação é o fato de esse tema constar em escritos que retomam a exposição anteriormente apresentada em forma oral à comunidade cristã da Galácia e de Roma. Ele escreve aos destinatários com a finalidade de esclarecer assunto anteriormente explicado. É o que se vê nas referências ao quérigma que recordam o primeiro anúncio da salvação em Cristo, já comunicado aos destinatários em outra ocasião. O uso freqüente da fórmula "acaso não sabeis?" é indício do conhecimento que os destinatários têm sobre o assunto.

  4. History of the AO and its global effect on operative fracture treatment.

    Science.gov (United States)

    Matter, P

    1998-02-01

    In 1958 a group of Swiss general and orthopaedic surgeons established the AO (Arbeitsgemeinschaft für Osteosynthesefragen) or the Association of the Study of Internal Fixation (ASIF) to strive to transform the contemporary treatment of fractures in Switzerland. This association was revolutionary in development of instruments and implants for operative fracture treatment. The first instructional course for teaching the use of these instruments and implants occurred in Davos, Switzerland, in the newly founded Laboratory of Experimental Surgery in 1960. Through a process of internal quality control (AO documentation) the clinical success of these new techniques and implants became evident. Operative fracture treatment gained acceptance throughout Europe and finally worldwide. AO/International (AOI) was founded in 1972 to expand education and the teaching programs for surgeons and operating personnel on an international basis. In 1984, the AO/ASIF Foundation was created with an AO Board of Trustees comprising 90 leading trauma surgeons from throughout the world. Continuous research, implant and instrument development, clinical documentation, and multifaceted educational opportunities are coordinated by the AO/ASIF Foundation to maintain its position as the international authority in the treatment of trauma. The medical community recognizes today the enormous positive global effect that this respected and ever changing organization has had by continually improving operative fracture treatment.

  5. Ensaios de combate ao cupim de monte Cornitermes cumulans (Kollar, 1832 (Isoptera, Termitidae Field tests for control of the mound-building termite Cornitermes cumulans (Kollar, 1832 (Isoptera, Termitidae

    Directory of Open Access Journals (Sweden)

    F.A.M. Mariconi

    1994-12-01

    Full Text Available Com a finalidade de combater o cupim de monte Cornitermes cumulans, importante espécie invasora, foram instalados dois campos experimentais. Experimento I: 60 ninhos foram escolhidos e medidos externamente. O ensaio constou de 6 tratamentos com 10 repetições: A abamectina (50 cm³ CE 1,8%; B silafluofem (200 cm³ CE 80%; C silafluofem (400 cm³ CE 80%; D fipronil (15g G 2%; E fipronil (20g G 2%; F clorpirifós (30g G 0,125%. Nos tratamentos A, B, C, as quantidades entre parênteses são da formulação comercial em 100 litros de água. Em D, E, F, são do granulado para cada ninho. Dos líquidos, usou-se um litro de calda por monte. A demolição dos montes deu-se após 103 dias da aplicação. Os melhores resultados foram obtidos com a abamectina e fipronil. Experimento II: Também neste ensaio os cupinzeiros foram 60, abrangendo 6 tratamentos com 10 repetições: A fipronil (l0g G 2%; B fipronil (15g G 2%; C bendiocarbe (20g G 0,1%; D bendiocarbe (20g G 0,5%; E imidaclopride (0,15g G 70%; F imidaclopride (0,30g G 70%. Em A, B, C, D, as quantidades de granulados são por ninho. Em E, F são de granulado dispersível em um litro de água, por ninho. A destruição dos cupinzeiros foi feita 148 e 149 dias após a aplicação. Os melhores resultados foram o fipronil e imidaclopride.Two field tests were carried out to evaluate the performance of several pesticides for the control of the mound termite pest in pastures. Experiment I: 60 mounds were selected and measured outside. There were 6 treatments with 10 replicátions: A abamectin (50 cm³ 1.8% EC; B silafluofen (200 cm³ 80% EC; C silafluofen (400 cm³ 80% EC; D fipronil (15g 2% G; E fipronil (20g 2% G; F chlorpirifos (30g 0.125% G. In A,B,C, the quantities between parenthesis are of the commercial formulation in 100 liters of water. In D,E,F, are of granular insecticides per mound. One liter of the liquids was used per nest. Demolition of the mounds were made 103 days after the application

  6. Fatores associados ao elevado ganho ponderal e ao excesso de peso de lactentes

    OpenAIRE

    Morais, Caroline Neves de

    2015-01-01

    O excesso de peso e o ganho ponderal estão associados a um conjunto complexo de fatores que atuam desde a vida fetal. O presente estudo teve como objetivo verificar os fatores associados ao elevado ganho ponderal e ao excesso de peso de lactentes. Trata-se de um estudo realizado com dados secundários de uma pesquisa de corte transversal que envolveu 967 mães e lactentes do estado de Pernambuco. Na caracterização do estado nutricional utilizou-se o índice de massa corporal para ...

  7. AO Observations of Three Powerful Radio Galaxies

    Energy Technology Data Exchange (ETDEWEB)

    de Vries, W; van Bruegel, W; Quirrenbach, A

    2002-08-01

    The host galaxies of powerful radio sources are ideal laboratories to study active galactic nuclei (AGN). The galaxies themselves are among the most massive systems in the universe, and are believed to harbor supermassive black holes (SMBH). If large galaxies are formed in a hierarchical way by multiple merger events, radio galaxies at low redshift represent the end-products of this process. However, it is not clear why some of these massive ellipticals have associated radio emission, while others do not. Both are thought to contain SMBHs, with masses proportional to the total luminous mass in the bulge. It either implies every SMBH has recurrent radio-loud phases, and the radio-quiet galaxies happen to be in the ''low'' state, or that the radio galaxy nuclei are physically different from radio-quiet ones, i.e. by having a more massive SMBH for a given bulge mass. Here we present the first results from our adaptive optics imaging and spectroscopy pilot program on three nearby powerful radio galaxies. Initiating a larger, more systematic AO survey of radio galaxies (preferentially with Laser Guide Star equipped AO systems) has the potential of furthering our understanding of the physical properties of radio sources, their triggering, and their subsequent evolution.

  8. Nefrocalcinose associada ao uso de esteroide anabolizante

    Directory of Open Access Journals (Sweden)

    Weverton Machado Luchi

    2015-03-01

    Full Text Available Os esteroides anabolizantes têm sido usados como arma terapêutica em diversas condições clínicas. Entretanto, o uso abusivo e indiscriminado, associado a outros suplementos nutricionais, tem gerado efeitos adversos graves. Relato do caso: Sexo masculino, 21 anos, admitido com náuseas, astenia, hiporexia, cefaleia e hipertensão arterial. Exames no sangue evidenciaram Cr: 3,9 mg/dl U:100 mg/dl e Cálcio total 14 mg/dl. Ultrassonografia e biópsia renal compatíveis com nefrocalcinose. Houve melhora gradativa da função renal e da calcemia após hidratação vigorosa e furosemida. Entretanto, após 1 ano, persistiram depósitos renais de cálcio e relação córticomedular reduzida ao ultrassom e creatinina estável em 1,4 mg/dl. Casos anteriores evidenciaram necrose tubular aguda e nefrite intersticial com poucos depósitos de cálcio no interstício renal. Nesse caso, encontramos nefrocalcinose acentuada associada à nefroesclerose. O objetivo deste estudo é relatar a ocorrência de injúria renal aguda com nefrocalcinose associada ao uso de esteroide anabolizante e oferecer uma revisão do assunto.

  9. Escala de valores relativos ao trabalho : EVT

    Directory of Open Access Journals (Sweden)

    Porto Juliana Barreiros

    2003-01-01

    Full Text Available Na literatura internacional são encontradas várias escalas para medir valores relativos ao trabalho, porém a maioria apresenta problemas com relação à definição do conceito ou a falta de integração com os modelos teóricos sobre valores pessoais. No Brasil foram encontrados dois instrumentos, um não foi validado para a população brasileira e o outro foi validado para uma população de baixa escolaridade. Foi objetivo do presente estudo desenvolver e validar uma Escala de Valores relativos ao Trabalho. Para o desenvolvimento da EVT foi realizado um levantamento de instrumentos anteriores e foram entrevistados trabalhadores. Após a análise de juízes e validação semântica, o instrumento foi respondido por 394 pessoas. A análise fatorial apontou para quatro fatores: Realização no trabalho, Relações sociais, Prestígio e Estabilidade. O instrumento após validação é composto por 45 itens. Os resultados corroboraram o modelo teórico previsto e conclui-se que a escala foi devidamente estabelecida e pode ser utilizada para pesquisa e diagnóstico.

  10. Escala de valores relativos ao trabalho: EVT

    Directory of Open Access Journals (Sweden)

    Juliana Barreiros Porto

    Full Text Available Na literatura internacional são encontradas várias escalas para medir valores relativos ao trabalho, porém a maioria apresenta problemas com relação à definição do conceito ou a falta de integração com os modelos teóricos sobre valores pessoais. No Brasil foram encontrados dois instrumentos, um não foi validado para a população brasileira e o outro foi validado para uma população de baixa escolaridade. Foi objetivo do presente estudo desenvolver e validar uma Escala de Valores relativos ao Trabalho. Para o desenvolvimento da EVT foi realizado um levantamento de instrumentos anteriores e foram entrevistados trabalhadores. Após a análise de juízes e validação semântica, o instrumento foi respondido por 394 pessoas. A análise fatorial apontou para quatro fatores: Realização no trabalho, Relações sociais, Prestígio e Estabilidade. O instrumento após validação é composto por 45 itens. Os resultados corroboraram o modelo teórico previsto e conclui-se que a escala foi devidamente estabelecida e pode ser utilizada para pesquisa e diagnóstico.

  11. Medicina moderna: rumo à prevenção, à cura, ao bem-estar e à longevidade

    OpenAIRE

    Ajai Singh

    2010-01-01

    A medicina moderna tem realizado muitas coisas nos campos de doenças infecciosas e de emergências para assistir a cura. Na maior parte dos outros campos, ela visa, sobretudo, ao controle, que é outro nome para o tratamento paliativo. A farmacologia, na qual se inclui a psicofarmacologia, é igualmente dirigida ao controle e ao alívio. Está na hora de profissionais da área e pesquisadores voltarem-se decisivamente para a prevenção e para a cura. Ademais, o outro grande desafio da medicina moder...

  12. Diferentes Metodologias Aplicadas ao Ensino de Astronomia

    Science.gov (United States)

    Albrecht, E.; Voelzke, M. R.

    2007-08-01

    Espera-se que o educando ao final da educação básica, adquira uma compreensão atualizada das hipóteses, modelos e formas de investigação sobre a origem e evolução do Universo em que vive. O presente trabalho tem como principal objetivo compreender dentre três práticas pedagógicas adotadas no Ensino de Astronomia, na terceira série do Ensino Médio, da Escola Estadual Colônia dos Pescadores, qual melhor cumpre o papel de formação e aprendizagem para vida. A pesquisa preliminar foi através de um questionário onde o intuito foi diagnosticar o conhecimento já existente acerca do tema em questão. O questionário é composto de vinte questões dissertativas e objetivas, onde os educandos das três turmas envolvidas o responderam. Este trabalho utiliza as seguintes metodologias: a tradicional, onde o professor é um repassador de informações, fazendo uso exclusivo de lousa e giz; a segunda também de forma tradicional, porém com auxílio de multimídia para desenvolvimento das aulas e aterceira sob forma de seminários, elaborados e apresentados pelos educandos, no qual o educador faz apenas as intervenções necessárias. Ao final do trabalho os alunos responderão novamente o questionário inicial para diagnosticar dentre as três metodologias utilizadas qual apresentou melhor resultado. Os resultados preliminares obtidos, já podem ser observados e, dos 119 alunos entrevistados, as respostas obtidas são as mais diversas e evidenciam que a grande maioria nunca teve em sua vida escolar o tema Astronomia. Ao serem questionados se já haviam estudado Astronomia as respostas foram: turma A: sim 43%; turma B: sim: 21%; turma C: sim: 24%. Porém quando questionados a respeito do significado de Astronomia observou-se que: turma A: 100% de acertos; turma B: 64% acertos; turma C: 84% de acertos, demonstrando claramente a aprendizagem em diferentes esferas, não dependendo unicamente da escola. Até o presente momento, verificou-se que há interesse em

  13. Spacecraft thermal control coatings (AO 138-6)

    Science.gov (United States)

    Paillous, Alain; Guillaumon, Jean Claude

    1991-01-01

    The experiment A0 138-6 was located on the trailing edge of LDEF as part of the Experiment FRECOPA. Material specimens 2 x 2 cm, independently mounted in sample-holders with their surface in the same reference plane, were exposed to space. Materials include paints (conductive or not), SSMs, polymeric films, surface coatings, composite materials, and metals. The results show that for some materials the degradation was higher for samples in the canister than for those directly mounted on the tray; contamination problems were ruled out, the higher temperature experienced by the samples inside the canister probably explains this phenomenon.

  14. Hepatotoxicidade associada ao uso de esteroides anabolizantes

    Directory of Open Access Journals (Sweden)

    Mónica Brinquinho

    2017-06-01

    Full Text Available O consumo de esteroides androgénicos anabolizantes tem vindo a aumentar no meio desportivo amador, sendo de fácil acesso apesar de se tratarem de substâncias proibidas. Estão descritos múltiplos efeitos laterais, sendo a hepatotoxicidade uma das mais reportadas. Apresentam-se dois casos clínicos representativos da lesão hepática associada ao consumo de esteroides anabolizantes. Ambos evidenciaram morbilidade significativa, embora nenhum deles tenha evoluído para falência hepática. Os autores pretendem chamar a atenção para o consumo destes fármacos, particularmente frequente em indivíduos jovens, praticantes de desporto amador.

  15. Acesso ao aborto e liberdades laicas

    Directory of Open Access Journals (Sweden)

    Roberto Arriada Lorea

    2006-12-01

    Full Text Available Enfrentar o tema do aborto no Brasil requer uma perspectiva laica, na medida em que a liberdade de consciência assegurada na Constituição Federal impõe ao Estado contemplar não apenas as diferentes visões oriundas de distintas religiões, mas, principalmente, assegurar o direito à diversidade existente no seio de uma mesma religião, garantindo o direito de divergir da hierarquia de sua própria igreja. Assim, não havendo obstáculo jurídico à descriminalização do aborto no país, resta aos legisladores reformar a lei vigente, para descriminalizar o aborto, atendendo os compromissos assumidos pelo Brasil perante organismos internacionais de proteção dos direitos humanos e assegurando a eficácia das liberdades laicas.In Brazil, face an issue like abortion requires a lay perspective considering that the freedom of conscience assured by the Federal Constitution lays upon the State the need to look not only at different views from different religions but specially assure the right to the existing diversity within the same religion, as well as, the right to diverge from the hierarchy of his/her own religion. Therefore there is no legal barrier for the decriminalization of abortion in the country. It is up to the legislators to reform the present law to decriminalize abortion, assuming the commitments made by Brazil upon international organizations for the protection of the human rights assuring the efficacy of lay liberties.

  16. Controlling factors of benthic macroinvertebrates distribution in a small tropical pond, lateral to the Paranapanema River (São Paulo, Brazil Macroinvertebrados bentônicos e fatores controladores de sua distribuição em uma pequena lagoa tropical adjacente ao rio Paranapanema (São Paulo, Brasil

    Directory of Open Access Journals (Sweden)

    Erika Mayumi Shimabukuro

    2011-06-01

    Full Text Available AIM: The aim of the present study was to examine the benthic fauna in a marginal pond lateral to the Paranapanema River and to identify the main controlling factors of its distribution. Considering the small size of the lacustrine ecosystem, we expected that seasonal variations of the benthic community attributes are more important than spatial variations; METHODS: Two samplings, one in March and another in August, were carried out at nine sites in the pond. Sediment samples were obtained through a Van Veen grab for invertebrate sorting, granulometric analysis, and for quantification of organic matter in sediment. Other abiotic factors were measured, such as water transparency, dissolved oxygen, pH, electric conductivity, temperature, and depth of sediment sampling sites. Regarding the comparative analysis at spatial scale, no significant variations in density of the benthic invertebrate community were found. RESULTS: In relation to the studied abiotic factors, only depth presented significant differences among sampling sites; All the measured environmental parameters presented significant differences among sampling months, except depth and the physical and chemical characteristics of the sediment. The abundance of Chaoboridae and Chironomidae was the unique attribute with a significant difference in comparing the two months. A higher abundance of taxa occurred in August, especially for Oligochaeta, Nematoda, Chaoboridae, and Chironomidae; CONCLUSIONS: Because of the low structural complexity of the studied pond, we concluded that the changes in benthic macroinvertebrate community attributes were mainly due to seasonal effects.OBJETIVO: O presente estudo tem por objetivo examinar a fauna bentônica em lagoa marginal ao rio Paranapanema e os principais fatores reguladores da sua distribuição. Devido ao pequeno tamanho do ambiente lacustre, procurou-se mostrar que as variações sazonais dos atributos da comunidade bentônica são mais

  17. Isquemia e reperfusão hepática total associada ao estado de choque hemorrágico controlado: efeitos no seqüestro de neutrófilos no pulmão do rato Total hepatic warm ischemia and reperfusion associated with controlled hemorrhagic shock: effects of neutrophil sequestration in lung of rats

    Directory of Open Access Journals (Sweden)

    Mario Mantovani

    2002-02-01

    Full Text Available OBJETIVO: Estudar os efeitos da isquemia e reperfusão hepática total sobre acúmulo de neutrófilos no interstício pulmonar de ratos, em condições de normalidade e submetidos ao estado de choque hemorrágico controlado. MÉTODOS: 32 ratos Wistar, machos, foram divididos em quatro grupos de oito animais cada: grupo Sham, submetido aos procedimentos padrões com um período de 60 minutos de observação; grupo Choque, submetido a choque hemorrágico controlado (PAM = 40 mmHg, 20 min. seguido de reposição volêmica (Ringer lactato + sangue, 3:1 e reperfusão (60 min.; grupo Pringle, submetido a isquemia hepática total (15 min. e reperfusão (60 min.; grupo Total submetido a choque hemorrágico controlado (15 min. seguido de reposição volêmica (Ringer lactato + sangue, 3:1 e reperfusão (60 min.. Após o sacrifício dos animais, procedeu-se à contagem de neutrófilos no interstício pulmonar. RESULTADOS: Os valores encontrados para contagem de neutrófilos no interstício pulmonar indicaram que, os animais dos grupos Pringle, Total e, também, do grupo Choque, não diferiram dos animais do grupo Sham com valores de (Sham 21,08± 14,12; Choque 35,15± 18,74; Pringle 19,78± 15,38; Total 23,90± 16,37 (p=0.253 CONCLUSÃO: Em ratos submetidos a estado de choque hemorrágico controlado associado a isquemia hepática de 15 minutos, seguida de 60 minutos de reperfusão, não ocorreu acúmulo significativo de neutrófilos no interstício pulmonar.OBJECTIVE: The purpose of this experimental work was to study the effects of total hepatic ischemia and reperfusion on the accumulation of neutrophils in the lung of rats, under normal conditions and submitted to controlled hemorrhagic shock state. METHODS: thirty two adult male Wistar rats, were divided into four groups: the Sham group, was submitted to the standard procedures for a period of 60 min. of observation; Shock group, was submitted to controlled hemorrhagic shock (PAM=40 mmHg, 20 min

  18. Avaliação da sensibilidade de diversas espécies de plantas daninhas aquáticas ao carfentrazone-ethyl, em ambiente controlado Assessment of sensitivity of several aquatic weeds to carfentrazone-ethyl under controlled environment

    Directory of Open Access Journals (Sweden)

    L.L. Foloni

    2005-06-01

    Full Text Available Plantas aquáticas, especialmente macrófitas, tornam-se sério problema em hidrelétricas, afetando a múltipla utilização dos corpos d'água, incluindo produção de peixes e atividades de pesca, perdas d'água por evapotranspiração, esportes aquáticos, canoagem, irrigação e produção de energia nas usinas hidrelétricas. Com o objetivo de analisar o potencial de uso do carfentrazone-ethyl no controle das principais plantas daninhas aquáticas no Brasil, foi instalado um experimento em vasos com água. Utilizaram-se os seguintes tratamentos herbicidas (g i.a. ha-1: carfentrazone-ethyl a 15, 30 e 60; glyphosate a 4.536; 2,4-D a 4.690; imazapyr a 1.250; e uma testemunha sem herbicida. Esses tratamentos foram testados nas seguintes espécies: Eichhornia crassipes, Salvinia auriculata, Pistia stratiotes, Myriophyllum aquaticum, Brachiaria arrecta, Hydrocotyle umbellata, Typha sp. e Echinochloa polystachya. As avaliações foram efetuadas aos 7, 14, 21 e 28 dias após os tratamentos. Os resultados mostraram que o carfentrazone-ethyl foi eficiente no controle de E. crassipes (maior dose e P. stratiotes (duas maiores doses, com efeito supressivo sobre S. auriculata. Foi observado que nas outras plantas daninhas estudadas não houve eficiência de controle.Aquatic weeds, especially macrophytes, are a serious problem in hydroelectric plant systems, affecting the multiple use of water, such as fish production and fishing activities, water losses by evapotranspiration, aquatic sports, boating, irrigation and hydroelectric power production. An experiment using boxes filled with water was carried out to analyze the potential use of carfentrazone-ethyl in the control of the main aquatic weeds in Brazil. The following herbicide treatments (g i.a. ha-1 were used: carfentrazone-ethyl at 15, 30 and 60; glyphosate at 4,536; 2,4D at 4,690; imazapyr at 1,250, and no herbicide. These treatments were tested on the species: Eichhornia crassipes, Salvinia

  19. Adesão ao tratamento da Hanseníase: dificuldades inerentes aos portadores

    Directory of Open Access Journals (Sweden)

    Izaildo Tavares Luna

    2010-12-01

    Full Text Available Esta pesquisa, realizada em Guaiúba, CE, Brasil, objetivou identificar as dificuldades de adesão ao tratamento pelos portadores de hanseníase, relacionando os fatores associados. Estudo qualitativo, cujos dados foram coletados a partir de uma visita domiciliária com roteiro de entrevista contendo sete questões norteadoras. Participaram pacientes com diagnóstico de hanseníase e histórico de não adesão ao tratamento. Utilizou-se o Modelo de Atividade de Vida de Roper, Logan e Tierney. As falas dos sujeitos foram categorizadas de acordo com as doze atividades de vida. A utilização do modelo possibilitou uma abordagem holística sobre as barreiras vivenciadas pelo hanseniano na adesão ao tratamento medicamentoso, de modo a conhecer as atividades de vida destes pacientes para possível adequação de ações voltadas a essa clientela.

  20. Directly Imaging Planets with SCExAO: First Results

    Science.gov (United States)

    Currie, Thayne M.; Guyon, Olivier; Jovanovic, Nemanja; Lozi, Julien; Tamura, Motohide; Kudo, Tomoyuki; Uyama, Taichi; Garcia, Eugenio

    2017-01-01

    We present the first science results from the newly commissioned Subaru Coronagraphic Extreme Adaptive Optics project, an experimental system dedicated to image faint jovian planets around nearby stars. SCExAO is now achieving true extreme AO capability. We describe the typical performance of SCExAO, the first images of benchmark exoplanets and planet-forming disks, and SCExAO’s first science results. Finally, we briefly chart the path forward for SCExAO to achieve its full scientific capability, including imaging mature planets in reflected light.

  1. Photon counting arrays for AO wavefront sensors

    CERN Document Server

    Vallerga, J; McPhate, J; Mikulec, Bettina; Clark, Allan G; Siegmund, O; CERN. Geneva

    2005-01-01

    Future wavefront sensors for AO on large telescopes will require a large number of pixels and must operate at high frame rates. Unfortunately for CCDs, there is a readout noise penalty for operating faster, and this noise can add up rather quickly when considering the number of pixels required for the extended shape of a sodium laser guide star observed with a large telescope. Imaging photon counting detectors have zero readout noise and many pixels, but have suffered in the past with low QE at the longer wavelengths (>500 nm). Recent developments in GaAs photocathode technology, CMOS ASIC readouts and FPGA processing electronics have resulted in noiseless WFS detector designs that are competitive with silicon array detectors, though at ~40% the QE of CCDs. We review noiseless array detectors and compare their centroiding performance with CCDs using the best available characteristics of each. We show that for sub-aperture binning of 6x6 and greater that noiseless detectors have a smaller centroid error at flu...

  2. A VIA DEMOCRÁTICA AO AUTORITARISMO

    Directory of Open Access Journals (Sweden)

    Paulo César Nascimento

    2013-09-01

    Full Text Available Este artigo analisa as teorias de Aristóteles, Tocqueville e Hannah Arendt a respeito de como alguns aspectos da democracia como a busca do igualitarismo e o voto majoritário podem conduzir ao despotismo. Examinando os casos da democratização da Rússia pós-comunista e o sistema político da Venezuela durante a presidencia de Hugo Chavez, o texto procura demonstrar a importância das idéias daqueles pensadores para a compreensão de regimes autoritários legitimados pelo voto popular. --- The democratic route of autoritarism This article reviews the theories of Aristotle, Tocqueville and Hannah Arendt with respect to some elements of democracy such as the pursue of egalitarianism and the reliance on the will of the majority that can lead to despotism. On the basis of post-communist Russia’s transition to democracy and Venezuela’s political system under the presidency of Hugo Chavez, the article shows the importance of those thinker’s insights to understand current authoritarian regimes which rely on popular vote. keywords: democracy, autoritarian regimes, voting.

  3. Adesao ao guia alimentar para populacao brasileira

    Directory of Open Access Journals (Sweden)

    Eliseu Verly Junior

    2013-12-01

    Full Text Available OBJETIVO : Analisar a adesão ao Guia Alimentar para População Brasileira. MÉTODOS : Amostra composta por participantes do Inquérito de Saúde de São Paulo (n = 1.661 que preencheram dois recordatórios de 24 horas. Foi utilizado modelo bivariado de efeito misto para a razão entre o consumo de energia do grupo de alimentos e o consumo calórico total. A razão estimada foi utilizada para calcular o percentual de indivíduos com consumo abaixo ou acima da recomendação. RESULTADOS : Pelo menos 80,0% da população consome abaixo do recomendado para: leite e derivados; frutas e sucos de frutas; e cereais, tubérculos e raízes; aproximadamente 60,0% para legumes e verduras; 30,0% para feijões; e 8,0% para carnes e ovos. Adolescentes apresentaram a maior inadequação para legumes e verduras (90,0%, e o estrato de maior renda foi associado à menor inadequação para óleos, gorduras e sementes oleaginosas (57,0%. CONCLUSÕES : Foi observado consumo inadequado dos grupos de alimentos relacionados com aumento do risco de doenças crônicas.

  4. Toxicologia do tolueno: aspectos relacionados ao abuso

    Directory of Open Access Journals (Sweden)

    Letícia M.K. Forster

    1994-04-01

    Full Text Available O tolueno está presente em muitos produtos de uso doméstico e industrial e é o principal solvente envolvido no abuso de substâncias e na exposição ocupacional. O problema mais grave no estudo de patologias relacionadas ao tolueno é que este está geralmente associado, em suas preparações comerciais, a outras substâncias. O potencial tóxico do tolueno foi abordado nos seguintes aspectos: parâmetros farmacológicos; características físico-químicas; exposição; estudos clínicos; diagnóstico; pesquisa experimental; tolerância e dependência; efeitos agudos e crônicos; neurotoxicidade; teratogenicidade; doenças psiquiátricas; carcinogenicidade e tratamento. Conclui-se ser de grande importância e urgência que se realizem estudos clínicos com amostras maiores para definição mais precisa das conseqüências do uso crônico

  5. Toxicologia do tolueno: aspectos relacionados ao abuso

    Directory of Open Access Journals (Sweden)

    Forster Letícia M.K.

    1994-01-01

    Full Text Available O tolueno está presente em muitos produtos de uso doméstico e industrial e é o principal solvente envolvido no abuso de substâncias e na exposição ocupacional. O problema mais grave no estudo de patologias relacionadas ao tolueno é que este está geralmente associado, em suas preparações comerciais, a outras substâncias. O potencial tóxico do tolueno foi abordado nos seguintes aspectos: parâmetros farmacológicos; características físico-químicas; exposição; estudos clínicos; diagnóstico; pesquisa experimental; tolerância e dependência; efeitos agudos e crônicos; neurotoxicidade; teratogenicidade; doenças psiquiátricas; carcinogenicidade e tratamento. Conclui-se ser de grande importância e urgência que se realizem estudos clínicos com amostras maiores para definição mais precisa das conseqüências do uso crônico

  6. Sensibilidade de estirpes de Bradyrhizobium ao glyphosate

    Directory of Open Access Journals (Sweden)

    Rodrigo Josemar Seminoti Jacques

    2010-02-01

    Full Text Available A aplicação do glyphosate sobre a soja resistente a este herbicida pode causar prejuízos à simbiose com o rizóbio. O objetivo deste trabalho foi avaliar a sensibilidade ao herbicida glyphosate de três estirpes de Bradyrhizobium recomendadas para a produção de inoculantes de sementes de soja no Brasil. Avaliou-se o efeito das concentrações de 0,0; 5,4; 10,8; 21,6 e 43,2 µg L-1 do ingrediente ativo do glyphosate [N-(fosfonometil glicina] no meio YM líquido sobre o crescimento de B. japonicum (estirpe SEMIA 5079 e de B. elkanii (estirpe SEMIA 5019 e estirpe SEMIA 587, por meio de leituras das densidades óticas e geração de curvas de crescimento. As reduções de crescimento na presença da menor concentração do glyphosate foram de 18% para SEMIA 5079, 29% para SEMIA 5019 e de 35% para SEMIA 587, sendo, de modo geral, quanto maior a concentração do herbicida no meio de cultura maior a inibição do crescimen­to. As estirpes apresentaram sensibilidade diferencial somente às concentrações mais baixas do glyphosate; nesse caso, foi possível determinar a seguinte ordem de sensibilidade: SEMIA 587 > SEMIA 5019 > SEMIA 5079. Essa sensibilidade diferencial é dependente da concentração do herbicida, pois na presença de 43,2 µg L-1 todas as estirpes tiveram seu crescimento severamente reduzido, não havendo diferença entre elas.

  7. Qualidade da maçã "Gala" armazenada em atmosfera controlada associada à absorção e ao controle da síntese e da ação do etileno Quality of 'Gala' apples stored in controlled atmosphere associated with ethylene absorption and control of its syntheses and action

    Directory of Open Access Journals (Sweden)

    Auri Brackmann

    2008-11-01

    Full Text Available Este trabalho teve por objetivo avaliar o efeito da inibição da biossíntese de etileno no período pré-colheita e o efeito da inibição da ação ou da absorção do etileno durante o armazenamento em atmosfera controlada (AC; 1,2kPa de O2 + 2,5kPa de CO2 a 0°C sobre a qualidade de maçãs cv. "Gala". Além disso, avaliou-se também o efeito combinado desses tratamentos. Os tratamentos avaliados foram: (1 armazenamento em AC (controle; (2 aplicação pré-colheita de AVG; (3 AVG + aplicação pós-colheita de 1-MCP; (4 aplicação de 1-MCP; (5 AVG + absorção do etileno durante todo o período de armazenamento; e (6 absorção de etileno. Após oito meses de armazenamento mais sete dias a 20°C, os frutos tratados com AVG apresentaram menor atividade da ACC oxidase. A combinação de AVG + 1-MCP ou AVG + absorção de etileno mantiveram menor produção de etileno até cinco dias de vida de prateleira a 20°C. Além disso, a firmeza da polpa dos frutos submetidos a esses tratamentos combinados manteve-se mais elevada. A cor de fundo da epiderme manteve-se mais verde nos frutos tratados com AVG, independente do tratamento em pós-colheita, demonstrando que a modificação da coloração da epiderme é mais afetada pelo etileno produzido ainda na pré-colheita. Portanto, conclui-se que a aplicação em pré-colheita de AVG associada com a absorção do etileno durante o armazenamento é mais eficiente no controle da maturação de maçãs "Gala", no entanto, a aplicação pré-colheita de AVG combinada com a aplicação pós-colheita de 1-MCP também é eficiente.This research aimed to evaluate the effect of inhibition the ethylene biosynthesis at the pre-harvest stage, the ethylene action and the absorption from the controlled atmosphere storage room on the quality of 'Gala' apples. The experimental design was entirely randomized, with four replicates and the experimental unit composed by 25 fruits. The treatments were: (1 CA storage only

  8. Evaluation of entomopathogenic nematodes under laboratory and greenhouses conditions for the control of Spodoptera frugiperda Avaliação de nematoides entomopatogênicos em condições de laboratório e casa-de-vegetação visando ao controle de Spodoptera frugiperda

    Directory of Open Access Journals (Sweden)

    Vanessa Andaló

    2010-09-01

    Full Text Available The increased corn planting grown in the late season crop and the use of a notillage planting system benefits the development of Spodoptera frugiperda, the main pest of corn crop. Thus, this study aimed to select entomopathogenic nematodes based on the mortality of S. frugiperda, and to adjust the nematode concentrations in the laboratory and evaluate the action of these organisms in greenhouse conditions. Seventeen nematode populations were tested at concentrations of 100, 250, and 500 infective juveniles (IJ/larvae. The obtained data were submitted to the polynomial regression test. In the greenhouse, corn sowing was performed in plastic buckets with soil, corn straw, and water. After 7 days, Steinernema arenarium or Heterorhabditis sp. RSC02, and the larvae were added (40 larvae, one larvae/repetition. The data were submitted to the variance analysis and the Scott-Knott test (PO aumento no plantio do milho "safrinha" e o uso do sistema de plantio direto favorecem o desenvolvimento de Spodoptera frugiperda, principal praga da cultura. Dessa forma, os objetivos deste trabalho foram selecionar nematoides entomopatogênicos, de acordo com a mortalidade causada sobre S. frugiperda, adequar as concentrações em laboratório e avaliar a ação desses organismos em condições de casa-de-vegetação. Foram testadas 17 populações de nematoides nas concentrações de 100, 250 e 500 juvenis infectantes (JI lagarta-1. Os dados obtidos foram submetidos ao teste de regressão polinomial. Em casa-de-vegetação, a semeadura do milho foi realizada em vasos de plástico contendo solo, palhada de milho e água. Após sete dias, foram adicionados Steinernema arenarium ou Heterorhabditis sp. RSC02 e as lagartas (40 lagartas, uma lagarta/repetição. Os dados obtidos foram submetidos à análise de variância e ao teste de médias Scott-Knott (P<0,05. Nos testes de laboratório, S. arenarium e Heterorhabditis sp. RSC02 causaram mortalidade de 85 e 90

  9. Saude do homem: internacoes hospitalares por intoxicacao registradas em um centro de assistencia toxicolo

    Directory of Open Access Journals (Sweden)

    Lucia Margarete dos Reis

    2013-09-01

    Full Text Available METODOS: Pesquisa descritiva, com abordagem quantitativa de registros da Listagem Mensal de Pacientes Internados do período de 2006 a 2010. RESULTADOS: Foram analisadas 2.448 internações masculinas, representado 60,9%. Os homens tinham idade média de 36,5 anos, 1.610 (65,8% eram adultos, e a maioria (77,8% foi internada com diagnóstico de intoxicação por drogas de abuso. Das 505 (20,5% internações decorrentes de acidente individual, 252 (49,9% envolviam crianças. A tentativa de suicídio foi responsável por 440 (18,0% internações, sendo 110 (25,0% em adolescentes. O tempo médio de internação foi de cinco dias, mas 81 (3,3% homens ocuparam leitos em terapia intensiva e 106 (4,3% morreram. CONCLUSÃO: Pela razão de internações por intoxicação entre os sexos, pode-se inferir maior gravidade nas intoxicações em homens em todas as faixas etárias.

  10. Xamanismo Kalapalo e assistencia medica no alto xingu : estudo etnografico das praticas curativas

    OpenAIRE

    João Veridiano Franco Neto

    2010-01-01

    Resumo: Esta dissertação é resultado de doze meses intercalados de pesquisa de campo realizada entre os índios Kalapalo do Alto Xingu, Terra Indígena do Xingu, Mato Grosso. Busca empreender uma descrição e análise do modo pelo qual ocorre uma interação entre o xamanismo dos Kalapalo e o saber biomédico tal como esta se dá no âmbito das práticas da política nacional de atenção à saúde dos povos alto-xinguanos. O xamanismo kalapalo não difere do xamanismo praticado no Alto Xingu como um todo: c...

  11. Tectono-stratigraphic control of the generation, migration and trapping process in the Irati-Rio Bonito Petroleum System, Santa Catarina coal field region; Controle tectonoestratigrafico dos processos de geracao, migracao e trapeamento do Sistema Petrolifero Irati-Rio Bonito, na regiao carbonifera de Santa Catarina

    Energy Technology Data Exchange (ETDEWEB)

    Loutfi, Ivan Soares; Pereira, Egberto; Rodrigues, Rene; Cardozo, Cassia Lima [Universidade do Estado do Rio de Janeiro (UERJ). Faculdade de Geologia. Dept. de Estratigrafia e Paleontologia (Brazil)], e-mail: rene@uerj.br

    2010-05-15

    The work aims at the geological characterization of the structural and stratigraphic system responsible for the petroleum oils that occurs in Rio Bonito Formation, in the coal fields of Santa Catarina, eastern edge of Parana Basin, in the municipalities of Lauro Muller, Sideropolis and Criciuma, state of Santa Catarina. Currently, it has been speculated that the geochemical signature of this oil is related to the Irati Formation associated with an unconventional model generation, by the thermal maturation of diabase intrusion, due to source rock insufficient burial. As the Irati is stratigraphically positioned above the Rio Bonito Formation, the system is associated to a strong structural control for the migration model. The preparation of a geological map for the area that includes the geological field data, aero magnetometry map data and drill hole information has enabled to a deep understanding of tectonic-stratigraphic region. Geological cross-sections showed the presence of faults that caused a system of grabens and horsts related to NE-SW faults and secondarily E-W, mapped in the study area, that may have positioned the Irati Formation alongside or below the Rio Bonito Formation. Chronostratigraphic sections made it possible to recognize seals, structural and stratigraphic traps associated with the petroleum system Irati-Rio Bonito. The geochemical analysis of the oil (biomarkers) and isotopes collected at the Rio Bonito Formation, indicated that they are associated with the Assistencia Member shales (Irati Formation). The structural framework and studied oils in the region suggest that the migration occurred from south-west to northeast along the NE-SW fault system that was generated previously the basalt floods associated with the Serra Geral Formation. (author)

  12. Resistência de Eleusine indica aos inibidores de ACCase Eleusine indica resistance to ACCase inhibitors

    Directory of Open Access Journals (Sweden)

    R.A. Vidal

    2006-01-01

    Full Text Available Dentre as causas da ineficácia no controle de plantas daninhas destaca-se a resistência delas aos herbicidas. Os objetivos deste trabalho foram avaliar a suspeita de resistência de Eleusine indica a inibidores de acetil-CoA carboxilase (ACCase e investigar a ocorrência de resistência cruzada entre os inibidores de ACCase. Biótipo de Eleusine indica originado do Mato Grosso com suspeita de resistência aos herbicidas inibidores de ACCase foi avaliado em casa de vegetação na sua suscetibilidade para diversos produtos do grupo dos ariloxifenoxipropionatos e cicloexanodionas. Estudos de resposta à dose confirmaram que o biótipo era 18 vezes mais insensível ao sethoxydim do que biótipo suscetível nunca aspergido com herbicidas. Também se constatou resistência cruzada ao fenoxaprop, cyhalofop, propaquizafop e butroxydim. Não se observou resistência cruzada aos produtos fluazifop, haloxyfop, quizalofop e clethodim.Among the causes for weed control inefficacy, the worst one is resistance to herbicides. The objectives of this work were to evaluate an Eleusine indica biotype suspected of resistance to ACCase inhibitors and to investigate the occurrence of cross- resistance to several ACCase inhibitors. One biotype of Eleusine indica originated from Mato Grosso with suspected resistance to ACCase inhibitors was evaluated in a greenhouse in relation to its susceptibility to several products of the ariloxyphenoxypropionate and cyclohexanedione groups. Studies on dose response confirmed that the suspected biotype was 18 times more insensitive to sethoxydim than the susceptible biotype that had never been treated with herbicides. Cross-resistance was confirmed for fenoxaprop, cyhalofop, propaquizafop and butroxydim. No cross-resistance was observed with fluazifop, haloxyfop, quizalofop, and clethodim.

  13. Acesso ao tratamento da diabetes na Bahia: por que se recorre ao judiciário?

    OpenAIRE

    Lisboa, Erick Soares

    2015-01-01

    A judicialização da saúde é um fenômeno importante, que tem motivado a realização de inúmeros estudos no país. A Constituição do país estabelece o direito de todos e o dever do Estado em prover acesso universal as ações e serviços de saúde. Ao longo dos 25 anos do SUS houve uma ampliação do acesso a medicamentos, e a cada ano, novos fármacos vem sendo lançados no Brasil pelas indústrias farmacêuticas. A judicialização do acesso a medicamentos tem causado impactos na estruturação, no financiam...

  14. LGS-AO Imaging of Every Kepler Planet Candidate: the Robo-AO KOI Survey

    Science.gov (United States)

    Law, Nicholas Michael; Baranec, Christoph; Morton, Timothy; Ziegler, Carl; Atkinson, Dani; Riddle, Reed

    2015-08-01

    The Robo-AO Kepler Planetary Candidate Survey is observing every Kepler planet candidate host star with laser adaptive optics imaging, to search for blended nearby stars which may be physically associated companions and/or responsible for transit false positives. We will present the results from searching for companions around over 3,000 Kepler planet hosts in 2012-2015. We will describe our first data release covering 715 planet candidate hosts, and give a preview of ongoing results including improved statistics on the likelihood of false positive planet detections in the Kepler dataset, many new planets in multiple star systems, and new exotic multiple star systems containing Kepler planets.We will also describe the automated Robo-AO survey data reduction methods, including a method of using the large ensemble of target observations as mutual point-spread-function references, along with a new automated companion-detection algorithm designed for extremely large adaptive optics surveys.Our first data release covered 715 objects, searching for companions from 0.15” to 2.5” separation with contrast up to 6 magnitudes. We measured the overall nearby-star-probability for Kepler planet candidates to be 7.4+/-1.0%, and we will detail the variations in this number with stellar host parameters. We will also discuss several KOIs of particular interest, including KOI-191 and KOI-1151, which are both multi-planet systems with detected stellar companions whose unusual planetary system architecture might be best explained if they are ``coincident multiple'' systems, with several transiting planets shared between the two stars. Finally, we will discuss and update the 98%-confidence evidence from our survey that third bodies in star/planet systems produce an excess of close-in giant planets.

  15. Passagem ao ato e acting-out: duas respostas subjetivas

    Directory of Open Access Journals (Sweden)

    Roberto Calazans

    2010-08-01

    Full Text Available O presente artigo delimita o conceito de passagem ao ato em relação ao acting-out e distingue as respostas subjetivas que envolvem. A partir das distinções propostas por Lacan entre eles com base no conceito de objeto a, busca-se situar o sujeito em ambas as modalidades de ato, com os objetivos de submeter à discussão clínica as passagens ao ato discretas e de interrogar o papel de suplência que supostamente desempenham. Para tal, são retomados dois fragmentos de casos de anorexia discutidos na literatura psicanalítica; no primeiro, o objeto ao qual o sujeito se identifica é circunscrito, enquanto no segundo, trata-se do objeto posto em cena pelo sujeito.

  16. Tuberculose em Recife, PE: o efeito da estratégia DOTS (Directly Observed Treatment Short-course) e fatores associados ao óbito e ao abandono de tratamento, 1996 a 2005

    OpenAIRE

    Mirian Pereira Domingos

    2007-01-01

    O abandono de tratamento de tuberculose é considerado o principal obstáculo no controle da doença. Persistência da fonte de infecção, aumento da mortalidade e da taxa de recidiva, além do desenvolvimento de cepas resistentes aos fármacos, estão associados ao abandono. Os componentes essenciais das políticas de controle da tuberculose foram sintetizados num pacote que constitui a estratégia DOTS (Directly Observed Treatment Short-course), recomendada pela Organização Mundial de Saúde. Este tra...

  17. The AO Pediatric Comprehensive Classification of Long Bone Fractures (PCCF)

    OpenAIRE

    Audigé, L.; Slongo, T; Lutz, N.; Blumenthal, A.; Joeris, A

    2016-01-01

    Background and purpose - To achieve a common understanding when dealing with long bone fractures in children, the AO Pediatric Comprehensive Classification of Long Bone Fractures (AO PCCF) was introduced in 2007. As part of its final validation, we present the most relevant fracture patterns in the upper extremities of a representative population of children classified according to the PCCF. Patients and methods - We included children and adolescents (0-17 years old) diagnosed with 1 or more ...

  18. Doença periodontal materna como fator associado ao baixo peso ao nascer Maternal periodontal disease as a factor associated with low birth weight

    Directory of Open Access Journals (Sweden)

    Simone Seixas da Cruz

    2005-10-01

    Full Text Available OBJETIVO: Estudos recentes têm apresentado evidências de que a doença periodontal em gestantes pode ser um dos determinantes do baixo peso ao nascer. Realizou-se estudo para verificar a existência de associação entre doença periodontal materna e baixo peso ao nascer. MÉTODOS: Estudo do tipo caso-controle com 302 mulheres, sendo 102 mães de nascidos vivos de baixo peso (grupo caso e 200 mães de nascidos vivos com peso normal (grupo controle. A existência de associação entre doença periodontal e baixo peso ao nascer foi avaliada mediante modelo multivariado de regressão logística, considerando outros fatores de risco para o baixo peso. RESULTADOS: Ambos os grupos de mães eram comparáveis no que se refere a idade, altura, peso pré-gestacional, tabagismo, alcoolismo, doenças prévias, estado civil, situação socioeconômica, número de escovações e uso de fio dental, número de refeições diárias, e visitas ao dentista. A doença periodontal foi diagnosticada em 57,8% das mães do grupo caso e 39,0% do grupo controle. A análise de regressão logística indicou associação positiva entre doença periodontal e baixo peso ao nascer (ORbruto=2,15; IC 95%: 1,32-3,48, especialmente entre as mães com escolaridade menor ou igual a quatro anos (ORajustada=3,98; IC 95%: 1,58-10,10. CONCLUSÕES: A doença periodontal é um possível fator de risco para o baixo peso ao nascer.OBJECTIVE: Recent studies have presented evidence that periodontal disease in pregnant women may be a determining factor for low birth weight. The present investigation was carried out to verify whether or not there is an association between maternal periodontal disease and low birth weight. METHODS: This was a case-control study on 302 women, of whom 102 were the mothers of live newborns of low weight (case group and 200 were the mothers of live newborns of normal birth weight (control group. The existence of an association between periodontal disease and low

  19. Diabetes Mellitus: desafios relacionados ao autocuidado abordados em Grupo de Apoio Psicológico

    Directory of Open Access Journals (Sweden)

    Nunila Ferreira de Oliveira

    2011-04-01

    Full Text Available O objetivo foi identificar os sentimentos dos usuários associados ao diagnóstico do Diabetes Mellitus (DM, as dificuldades inerentes ao controle glicêmico e estratégias de enfrentamento adotadas diante das demandas impostas pela doença. Estudo qualitativo realizado com grupo de pessoas acompanhadas por equipe multiprofissional de um centro de pesquisa e extensão universitária de Ribeirão Preto, SP, Brasil. Quatro sessões grupais que constituíram o corpus da pesquisa, foram audiogravadas e transcritas. A análise temática originou as categorias: sentimentos despertados a partir do diagnóstico do DM; dificuldades no controle da doença e estratégias de enfrentamento. Os resultados evidenciaram diferentes modos de lidar com os desafios suscitados pela doença no cotidiano, que influenciam diretamente na adesão ao tratamento e constituem elementos relevantes para o planejamento de intervenções mais efetivas.

  20. A exposição ao risco das familias

    OpenAIRE

    dos Santos Amaro, Ana Raquel

    2014-01-01

    A presente Dissertação de Mestrado aborda a exposição ao risco financeiro das famílias. Ao longo do trabalho serão abordados temas como a heurística, as finanças comportamentais, a percepção do risco e a exposição ao risco. Estes são os conceitos que foram considerados como sendo fundamentais e os principais responsáveis pela tomada de decisões a nível financeiro das famílias. Este estudo é de natureza quantitativa e pretenderá tirar conclusões da população em geral tendo em consideraçã...

  1. Atitudes, normas subjetivas e controle comportamental percebido de uma população universitária em relação ao consumo de água: análise à luz da Teoria do Comportamento Planejado (TPB)

    OpenAIRE

    Gomide, Camila Sant’Anna

    2014-01-01

    Diante do crescimento populacional e da dinâmica do consumo, esta pesquisa pretendeu estudar o comportamento do consumidor em relação à água, recurso esse que, devido ao mau uso e às condições climáticas, tornou-se insuficiente para atender à demanda da população. Analisando os contextos nos quais o comportamento de consumo de água poderia ser estudado, este trabalho teve como foco a população da Universidade Federal de Viçosa (UFV), incluindo professores, alunos e técnicos. O comportamento d...

  2. Adesão ao tratamento da ambliopia

    OpenAIRE

    Arakaki Mara Regina; Schellini Silvana Artioli; Heimbeck Felipe Jorge; Furuya Margareth Tiemi; Padovani Carlos Roberto

    2004-01-01

    OBJETIVO: Avaliar a influência da adesão no resultado do tratamento da ambliopia. MÉTODOS: Foi feito estudo retrospectivo avaliando a resposta ao tratamento da ambliopia em 151 crianças portadoras de ambliopia, tratadas com esquema de oclusão diária, com o número de dias variando de acordo com a idade da criança. Os pacientes foram separados em dois grupos que diferiam entre si pela adesão ou não ao tratamento. RESULTADOS: Observou-se que o tratamento teve melhores resultados nas crianças de ...

  3. Violência relacionada ao trabalho: uma proposta conceitual

    OpenAIRE

    Oliveira,Roberval Passos de; Nunes,Mônica de Oliveira

    2008-01-01

    p. 22-34 O aumento de situações de violência no âmbito do trabalho vem se constituindo um importante problema de Saúde Pública, que tem impacto na dignidade e na qualidade de vida dos trabalhadores. Nessa perspectiva, este artigo tem como objetivo propor, a partir da discussão do fenômeno da violência e de sua faceta concernente ao trabalho, o conceito de violência relacionada ao trabalho, como referência para futuros estudos no campo da Saúde do Trabalhador. Trata-se de um artigo conceitu...

  4. High-Performance CCSDS AOS Protocol Implementation in FPGA

    Science.gov (United States)

    Clare, Loren P.; Torgerson, Jordan L.; Pang, Jackson

    2010-01-01

    The Consultative Committee for Space Data Systems (CCSDS) Advanced Orbiting Systems (AOS) space data link protocol provides a framing layer between channel coding such as LDPC (low-density parity-check) and higher-layer link multiplexing protocols such as CCSDS Encapsulation Service, which is described in the following article. Recent advancement in RF modem technology has allowed multi-megabit transmission over space links. With this increase in data rate, the CCSDS AOS protocol implementation needs to be optimized to both reduce energy consumption and operate at a high rate.

  5. Do teatro grego ao teatro romano de Lisboa

    OpenAIRE

    Maciel, Manuel Justino

    2006-01-01

    A tipologia do teatro nasceu na Grécia e foi apropriada por Roma, com alterações significativas que constituem instrumento importante da investigação em História da Arte. Assim acontece com o teatro romano de Lisboa que, foi construído “ao modo grego”. Parece evidente que o Teatro foi adaptado para “espectáculos aquáticos”, embora o aprofundamento da reflexão exija a continuação de trabalhos arqueológicos, sob a Rua de São Mamede ao Caldas.

  6. Abuso sexual: um trajeto da fantasia ao real

    OpenAIRE

    Malgarim, Bibiana Godoi

    2015-01-01

    O presente trabalho visou apresentar a Dissertação de Mestrado realizada junto ao Programa de Pós-Graduação de Psicologia da Universidade do Vale do Rio dos Sinos, cujo título é Abuso Sexual: Um trajeto da fantasia ao real. O objetivo desta pesquisa foi compreender e interpretar a dinâmica das representações das relações objetais de duas pré-adolescentes encaminhadas por suspeita de abuso sexual, através de métodos projetivos, como o Rorschach e o HTP.

  7. Fatores associados aos tratamentos inadequados em grupo de portadores de tuberculose multirresistente

    Directory of Open Access Journals (Sweden)

    Barroso Elizabeth Clara

    2003-01-01

    Full Text Available INTRODUÇÃO: A tuberculose multirresistente é uma ameaça ao controle da tuberculose em todo o mundo. Tratamento inadequado é freqüentemente apontado como fator de risco para tuberculose multirresistente. OBJETIVO: Identificar fatores associados ao tratamento inadequado em portadores de tuberculose multirresistente. MÉTODO: Foram levantados e identificados os testes de sensibilidade para tuberculose, realizados no Laboratório Central do Estado do Ceará de 1990 a 1999. Foi realizado um estudo retrospectivo e prospectivo, em grupo de portadores de tuberculose multirresistente, comparando as características dos pacientes com tratamento adequado com as dos com tratamentos inadequados. Foi considerado multirresistente o bacilo resistente a pelo menos rifampicina + isoniazida e utilizado o método das proporções. RESULTADOS: Dos 1.500 testes de sensibilidade realizados, 266 eram multirresistentes. Destes, identificaram-se apenas 153 pacientes, dos quais 19 foram excluídos, restando, no estudo, 134 pacientes. Pela análise univariada os fatores associados significativamente ao tratamento inadequado foram: não-adesão ao tratamento, pobreza extrema, intolerância medicamentosa, falha no atendimento, falta de medicação, dois ou mais tratamentos anteriores, lesões radiológicas bilaterais e grandes cavidades pulmonares. Foi encontrada ainda associação (p < 0,001 de alcoolismo e/ou tabagismo com a não-adesão. Na análise multivariada, permaneceram associados ao tratamento inadequado: dois ou mais tratamentos anteriores (p < 0,0001, OR = 5,9; IC 95%: 2,5-13,7, grandes cavidades pulmonares (p < 0,0217, OR = 2,7; IC 95%: 1,2-6,1 e lesões radiológicas bilaterais (p < 0,0226, OR = 3,2; IC 95%: 1,4-7,4. CONCLUSÃO: Neste estudo, observou-se que os fatores associados aos tratamentos inadequados são de grande abrangência. Deve existir uma tentativa para controlar melhor a doença, principalmente nos pacientes em retratamento e nos portadores

  8. Desempenho escolar da criança vitimizada encaminhada ao fórum judicial

    Directory of Open Access Journals (Sweden)

    Paulo Celso Pereira

    Full Text Available O objetivo do estudo foi caracterizar o desempenho escolar da criança vítima de violência doméstica atendida no Fórum Judicial. Participaram do estudo 20 crianças vitimizadas comparadas com seus pares da mesma sala de aula, mesmo sexo e mesma faixa etária, mas sem histórico de violência doméstica, suas respectivas mães e professoras. As crianças responderam ao Teste de Desempenho Escolar, Inventário de Estilos Parentais e ao Teste de Raven (Escala Especial e apresentaram o caderno escolar. As mães responderam a uma entrevista e a Escala de Táticas de Conflitos Revisada (CTS-2. As professoras apresentaram sua opinião sobre o desempenho acadêmico dos participantes. Os dados obtidos mostraram que a criança vitimizada tem desempenho escolar inferior ao grupo controle. Os resultados da CTS-2 indicaram que a maioria das crianças vitimizadas estava exposta à violência conjugal. O estudo mostrou que, além da violência doméstica direta e indireta, tais crianças estavam expostas a outros fatores de risco, tais como, pobreza, baixa escolaridade materna e uso de álcool e/ou droga por familiares.

  9. Isolamento de Salmonella sp e Staphylococcus aureus no processo do abate suíno como subsídio ao sistema de Análise de Perigos e Pontos Críticos de Controle - APPCC Isolation of Salmonella sp and Staphylococcus aureus at swine slaughtering as subsidy for HACCP, the Hazard Analysis and Critical Control Point system

    Directory of Open Access Journals (Sweden)

    Emilia do Socorro C. de Lima

    2004-12-01

    Full Text Available O presente estudo foi realizado para avaliar a presença de Salmonella sp e o número de Staphylococcus aureus na superfície de carcaças suínas e caracterizar os perigos microbiológicos em diferentes etapas do abate e pontos críticos de controle (PCCs, através da quantificação de riscos (odds ratio. Um total de 120 esfregaços superficiais de carcaça suína foi coletado em um matadouro-frigorífico, após o escaldamento/depilação (ponto A, antes da evisceração (B, após evisceração e serragem da carcaça (C e após 24 horas de refrigeração (D. Salmonella sp foi encontrada com uma freqüência média de 11,7% (14 nas carcaças, enquanto o número de S. aureus variou entre 1,2 e 1,5 log UFC/cm² em 11,7% das carcaças amostradas, sem evidenciar diferença estatística entre os pontos A, B, C e D. Pode-se concluir que os riscos de contaminação por Salmonella sp e S. aureus foram os mesmos nas etapas do abate de suínos consideradas neste estudo.This study was done to evaluate the superficial contamination of swine carcasses by Salmonella sp and Staphylococcus aureus, the identification of microbiological hazards in different segments of the processing line, and critical control points (CCPs, through the quantification of risks. A total of 120 surface swabbing carcasses were collected in a slaughterhouse: after the scalding/dehairing (point A, before evisceration (B, after evisceration and splitting (C, and after 24 hours of refrigeration (D. Salmonella sp and S. aureus were isolated from 14 (11.7% carcasses. No statistical difference between the points studied was observed. The number of S. aureus isolated was between 1.2 and 1.5 log UFC/cm². It was concluded that the risks observed were the same for both microorganisms.

  10. Resposta ao estresse: II. Resiliência e vulnerabilidade

    Directory of Open Access Journals (Sweden)

    Nicole Leite Galvão-Coelho

    2015-06-01

    Full Text Available ResumoA crescente exposição a estressores na vida cotidiana aumentou significativamente a investigação da resposta ao estresse nas duas últimas décadas. Embora associada a consequências negativas, pois muitas patologias físicas e mentais são desencadeadas por exposição crônica a estressores, esta resposta é indispensável para sobrevivencia do indivíduo e é extremamente adaptativa quando ativada de forma aguda. Na parte I desta revisão foram abordados os conceitos de homestase e alostase e os sistemas fisiológicos ativados durante a resposta ao estresse. Na parte II serão discutidos fatores que modulam a resposta ao estresse tais como sexo, temperamento, períodos críticos do desenvolvimento e a presença ou ausência de suporte social. A interação entre os fatores genéticos e ambientais gera os perfis da resposta psicofisiológica que caracterizam os fenótipos de susceptibilidade e resiliência frente aos estressores e sua relação com uma patologia mental cada vez mais presente na sociedade moderna, o transtorno de estresse pós-traumático.

  11. Reptiles and Amphibians of Curaçao

    NARCIS (Netherlands)

    Rooij, de Nelly

    1922-01-01

    The Zoological Museum of Amsterdam received some collections of reptiles from Curaçao made by Dr. J. BOEKE in 1905, by Dr. C. J. VAN DER HORST in 1920 and by Mr. G. J. H. MOLENGRAAFF „Engineer” in 1921. I had the opportunity of studying them and will here give an enumeration of all the reptiles

  12. Variability in olecranon AO fracture fixation: A radiological study ...

    African Journals Online (AJOL)

    Background: Tension Band Wire(TBW) fixation of olecranon fracture is a commonly used technique by orthopaedic surgeons. However surgeons do not strictly adhere to the AO standard. Objectives: To determine the use and variability of this technique by surgeons at the hospital. Design: A hospital based retrospective ...

  13. Adesão ao tratamento da ambliopia

    Directory of Open Access Journals (Sweden)

    Arakaki Mara Regina

    2004-01-01

    Full Text Available OBJETIVO: Avaliar a influência da adesão no resultado do tratamento da ambliopia. MÉTODOS: Foi feito estudo retrospectivo avaliando a resposta ao tratamento da ambliopia em 151 crianças portadoras de ambliopia, tratadas com esquema de oclusão diária, com o número de dias variando de acordo com a idade da criança. Os pacientes foram separados em dois grupos que diferiam entre si pela adesão ou não ao tratamento. RESULTADOS: Observou-se que o tratamento teve melhores resultados nas crianças de 4 a 7 anos e que aderiram ao tratamento; as crianças que aderiram ao tratamento necessitaram de tempo menor de permanência em tratamento. Mesmo crianças com idade superior a 7 anos tiveram resultados positivos com a oclusão. CONCLUSÃO:O tratamento oclusivo é um meio terapêutico eficiente desde que haja a cooperação do paciente.

  14. The Foraminifera of Piscadera Bay, Curaçao

    NARCIS (Netherlands)

    Hofker, J.

    1971-01-01

    Piscadera Bay is situated 4 km West of Willemstad, Curaçao, between two limestone hills which have a height of about 100 m. It is a drowned river system, the entrance of which is almost completely blocked by a bar of coral debris reaching to about 2 meters above sea level. The following parts may be

  15. On some Polychaetous Annelids from Curaçao

    NARCIS (Netherlands)

    Horst, R.

    1922-01-01

    Though we know already a rather large number of Polychaetous Annelids from the Caribbean Sea, hitherto, as far as I know, no Annelids have been described from the coast of the island Curaçao and I therefore was very glad, that my colleague Dr. VAN DER HORST kindly placed in my hands for

  16. Application of FMEA-DEA (Failure Modes and Effect Analysis - Data Envelopment Analysis) to the air conditioning system of the control room a nuclear power plant; Aplicacao de FMEA-DEA ao sistema de ar condicionado da sala de controle de uma usina nuclear

    Energy Technology Data Exchange (ETDEWEB)

    Barbosa Junior, Gilberto Varanda

    2007-03-15

    This dissertation presents the FMEA-DEA analysis application to the air conditioning system of the control room of a nuclear power plant. After obtaining the failure modes, the index associated to the occurrence probability, the severity of the effects and the potential of detention, a priority order is established for the failure modes or deviations. This number is obtained by multiplying the three mentioned index that vary in a natural scale from 1 to 10, where the higher the index, the more critical the situation will be. In this work, it is intended to use a model based on the data envelopment analysis, DEA jointly with the FMEA, to identify the current efficiency of the system and which failure modes or deviations are considered more critical, and by means of the weights attributed for the mathematical modeling to identify which index are contributing more for these deviations. From this identification, improvements can be set, which may consider administrative changes, operator training and so on, thus adding value to the final product. (author)

  17. Prevalence of chronic autoimmune thyroiditis in the urban area neighboring a petrochemical complex and a control area in Sao Paulo, Brazil Prevalência de tireoidite de Hashimoto na população vicinal ao Pólo Petroquímico de Capuava (área Polo e área controle (São Bernardo Campo na região metropolitana da grande São Paulo, Brasil

    Directory of Open Access Journals (Sweden)

    Rosalinda Y. A. Camargo

    2006-08-01

    was present from 1998 through 2005 may be related to a higher prevalence of chronic autoimmune thyroiditis in both areas that were studied. There was no apparent or documented relationship of chronic autoimmune thyroiditis prevalence to the proximity to the petrochemical complex.OBJETIVO: Analisar a prevalência populacional de tireoidite crônica autoimune (tireoidite de Hashimoto na área vicinal ao Polo Petroquímico de Capuava comparativamente a área controle em São Bernardo Campo. CASUÍSTICA E MÉTODOS: Em ambas as áreas urbanas foram incluídos, aleatoriamente, indivíduos adultos que, de forma voluntária, concordaram em participar do estudo, estratificado por idade (20 a > 70 anos e sexo (mulheres 80%, homens 20%. Na área Polo foram incluídos 409 indivíduos e na área controle (São Bernardo Campo 420 pessoas (sem diferenças significativas quanto a idade e sexo. Na área Polo 15,6% apresentava sinais ecográficos e de positividade para anticorpos anti TPO, confirmando tireoidite crônica autoimune (TCA comparativamente a 19,5% na área controle (p > 0,05, NS. A presença de hipotiroidismo foi confirmada em 4,9% da população na área Polo e 8,3% na área controle (São Bernardo Campo (p = 0,046, significativo. No conjunto 6,63% dos pacientes com TCA apresentavam hipofunção tireóidea. A excreção urinária de iodo ultrapassou 300 mcg Iodo/L de urina em 58,5% de ambas populações. O sal coletado nas casas dos examinados apresentava concentração normal de iodo (35,5 + 6,6 mg I/Kg de sal. CONCLUSÕES: A maior prevalência de tireoidite crônica autoimune em ambas as áreas é, provavelmente, decorrente da elevada ingestão nutricional de iodo durante o quinqüênio que precedeu esta pesquisa (1998-2004. A suposta conexão epidemiológica de maior prevalência epidemiológica de TCA com vicinidade com o Polo Petroquímico de Capuava é improvável.

  18. Atomic Oxygen (AO) and Nitrogen (AN) In-situ Flux Sensor

    Science.gov (United States)

    2016-03-10

    AFRL-AFOSR-VA-TR-2016-0126 DURIP 09) AN ATOMIC OXYGEN FLUX MONITOR FOR USE IN THE SEARCH FOR NEW AND BETT Malcolm Beasley LELAND STANFORD JUNIOR UNIV...Grant # FA9550-01-1-0433 M. R. Beasley, PI Stanford University Project Title: Atomic Oxygen (AO) and Nitrogen (AN) In-situ Flux Sensor...with its ability to achieve controlled layer-by-layer growth on the atomic level. In the case of oxides and nitrides, one problem has been the lack

  19. Mortalidade atribuível ao tabagismo no Brasil em 2003

    OpenAIRE

    Paulo Cesar Rodrigues Pinto Correa

    2007-01-01

    Existem vários métodos para fazer a estimativa da mortalidade atribuível ao tabagismo (MAT). Estimativas confiáveis da MAT são muito importantes para planejar, implementar e avaliar o impacto de programas de controle do tabagismo. A presente dissertação descreve o resultado de uma revisão dos artigos sobre MAT publicados nas bases Medline, Lilacs e Bireme até 20/10/2005. Foram identificados e analisados sete métodos para cálculo da mesma. O método de Levin, o primeiro a ser descrito - em 1953...

  20. Tratamento fungicida e peliculização de sementes de soja submetidas ao armazenamento

    OpenAIRE

    Pereira,Carlos Eduardo; Oliveira,João Almir; Guimarães,Renato Mendes; Vieira,Antônio Rodrigues; Evangelista,José Renato Emilioreli; Oliveira,Gustavo Evangelista

    2011-01-01

    O tratamento de sementes de soja com fungicidas vem sendo utilizado como importante ferramenta no controle de patógenos. Nesse trabalho, objetivou-se estudar o desempenho de sementes de soja tratadas com fungicidas e peliculizadas, antes e após o armazenamento. Foram utilizados cinco lotes de sementes, cultivar Monsoy 6101, submetidos aos tratamentos: thiabendazole+thiram sem polímero, carbendazin+thiram sem polímero, sem fungicida (testemunha) sem polímero, além desses tratamentos realizados...

  1. Indicadores relacionados ao retardo no diagnóstico e na instituição das precauções para aerossóis entre pacientes com tuberculose pulmonar bacilífera em um hospital terciário Indicators related to delays in diagnosis and in implementation of measures to control airborne infection among patients with pulmonary tuberculosis in a tertiary-care hospital

    Directory of Open Access Journals (Sweden)

    Mariângela Ribeiro Resende

    2005-06-01

    Full Text Available INTRODUÇÃO: Há risco de transmissão de tuberculose em instituições de cuidados à saúde. OBJETIVO: Avaliar indicadores relacionados ao risco de transmissão entre pacientes com tuberculose pulmonar bacilífera atendidos em um hospital universitário. MÉTODO: Estudo retrospectivo, descritivo, de 01/1997 a 09/1999. Foram estudados os pacientes internados com tuberculose pulmonar bacilífera no Hospital de Clínicas da Universidade Estadual de Campinas. Foram avaliados três intervalos: entre admissão e coleta da pesquisa de BAAR no escarro; entre admissão e instituição das precauções para aerossóis; entre coleta do escarro e início do tratamento. RESULTADOS: Foram incluídos 63 casos. Associação ao vírus da imunodeficiência humana ocorreu em 31,7%. Quarenta pacientes foram admitidos pelo pronto-socorro (63,5%. Suspeita de tuberculose esteve presente na admissão em 42 pacientes (66,7%. O intervalo entre admissão e coleta de escarro excedeu 12 horas em 27,5% dos casos admitidos pelo pronto-socorro e em 30,4% dos internados nas enfermarias (p = 0,803. Retardo no isolamento respiratório ocorreu em 31 casos (49,2%. Os fatores associados ao retardo de isolamento foram ausência de tuberculose no diagnóstico de admissão (p BACKGROUND: The risk for nosocomial transmission of tuberculosis exists in health care institutions. OBJECTIVE: To evaluate indicators of transmission risk among patients with pulmonary tuberculosis treated at a university hospital. METHOD: A retrospective study covering the January 1997 to September of 1999 period and evaluating patients admitted to the Hospital de Clínicas of the Universidade Estadual de Campinas with pulmonary tuberculosis. Three intervals were determined: from admission to collection of sputum for acid-fast bacilli microscopy; from admission to implementation of airborne infection control measures; from sputum collection to the initiation of treatment. RESULTS: The final sample included 63

  2. Fatores associados aos óbitos entre homens envenenados por carbamato (“chumbinho”

    Directory of Open Access Journals (Sweden)

    Júlio César Santos da Silva

    Full Text Available RESUMO Objetivo Determinar os fatores associados aos óbitos em vítimas de envenenamento por carbamato (“chumbinho”. Método Estudo retrospectivo, epidemiológico tipo caso-controle, baseado nas fichas de notificação de intoxicação do centro de controle de intoxicações localizado na região metropolitana do Rio de Janeiro. Foram utilizadas 24 fichas de notificação de intoxicações de homens dos 20 aos 59 anos com história de envenenamento por carbamato entre 2005 e 2009. As fichas foram sorteadas aleatoriamente, respeitando-se a razão de 1:3 (um caso para três controles. A faixa etária variou de 23 a 58 anos; a média 43,83 anos. Resultados Os sintomas mais recorrentes foram: miose (OR = 1.0; IC 95%: 0,27 – 3,69. p= 1.0, sialorreia (OR = 0,83; IC 95%: 0,22 – 3,12. p= 0,78, dispneia (OR = 0,66; IC 95%: 0.14 – 3,03. p= 0,59. Conclusão Os óbitos apresentaram associação com sialorreia, miose e dispneia e uma forte associação com estertores pulmonares, broncoespasmos e os roncos pulmonares.

  3. Expressao genica associada ao estresse oxidativo no coracao de camundongo apos isquemia intestinal

    Directory of Open Access Journals (Sweden)

    Frederico Somaio Neto

    2014-03-01

    Full Text Available FUNDAMENTO: O fenômeno da isquemia e reperfusão intestinal é um evento frequente na clínica e está associado a repercussões deletérias em órgãos a distância, em especial ao coração. OBJETIVO: Investigar a expressão gênica do estresse oxidativo e defesa antioxidante no coração de camundongos isogênicos, submetidos a isquemia e reperfusão intestinal (IR. MÉTODOS: Doze camundongos (C57BL/6 foram distribuídos em dois grupos: Grupo IR (GIR com 60 min de oclusão da artéria mesentérica superior, seguidos de 60 min de reperfusão. Grupo Controle (GC submetidos a anestesia e a laparotomia sem o procedimento de IR observados por 120 min. As amostras de intestino e coração foram processadas pelo método (RT-qPCR / Reverse transcriptase - quantitative Polymerase Chain Reaction para determinar a expressão gênica de 84 genes relacionados ao estresse oxidativo ("t" de Student, p < 0,05. RESULTADOS: Observou-se no tecido intestinal (GIR uma expressão significantemente aumentada em 65 (74,71% genes em relação ao tecido normal (GC, e 37 (44,04% genes estiveram hiperexpressos (maior que três vezes o limiar permitido pelo algoritmo. No tocante aos efeitos da I/R intestinal a distância no tecido cardíaco verificou-se a expressão significantemente aumentada de 28 genes (33,33%, mas somente oito genes (9,52% se hiperexpressaram três vezes acima do limiar. Quatro (7,14% desses oito genes se expressaram simultaneamente nos tecidos intestinal e cardíaco. No GIR notaram-se cardiomiócitos com núcleos de menor tamanho, picnóticos, ricos em heterocromatina e raros nucléolos, indicando sofrimento cardíaco. CONCLUSÃO: A I/R intestinal promoveu a hiperexpressão estatisticamente significante de oito genes associados ao estresse oxidativo a distância no tecido miocárdico.

  4. Prevenção ao crime e teoria social

    OpenAIRE

    Sento-Sé, João Trajano

    2011-01-01

    O artigo estabelece um diálogo entre a criminologia positivista e algumas correntes contemporâneas da prevenção ao crime inspiradas em teorias sociológicas. Através desse exercício, busca-se evidenciar que algumas das formulações focadas no campo da prevenção já aparecem, em estado embrionário, na agenda teórica positivista. Do mesmo modo, torna-se possível explicitar que alguns postulados empíricos e práticos do positivismo são menos estranhos às teorias contemporâneas de prevenção ao crime ...

  5. Cuidado ao idoso deprimido e institucionalizado à luz da Complexidade

    Directory of Open Access Journals (Sweden)

    Cenir Gonçalves Tier

    2008-06-01

    Full Text Available Instituições de Longa Permanência para Idosos (ILPI são estabelecimentos para atendimento integral, institucionalizando pessoas de 60 anos e mais, dependentes/ou não, que não dispõem de condições para permanecer com a família ou/em seu domicílio. A institucionalização pode desencadear doenças, dentre elas a depressão. Foi objetivo deste artigo de atualização fazer uma reflexão sobre a relação do cuidado ao idoso deprimido e residente em ILPI com três princípios da Complexidade segundo Edgar Morin. Primeiro, se reflete sobre a complexidade; depois, se relaciona o cuidado ao idoso deprimido e residente em ILPI, com os princípios dialógico, recursivo e hologramático. Percebeu-se que a Complexidade pode sustentar teoricamente, não só a compreensão do fenômeno depressão no idoso residente em uma ILPI, como também inspirar o modo de cuidar que direcione aos trabalhadores da saúde, que atuam junto à pessoa idosa, a abordarem o idoso de forma mais global. Para tanto deve ser utilizada a Avaliação Multidimensional do Idoso, que analisa as várias dimensões da pessoa idosa, contribuindo no desenvolvimento de um plano de cuidado/tratamento e acompanhamento multidisciplinar e interdisciplinar adequados. A Complexidade vem sendo utilizada, por enfermeiros, para entender melhor a enfermagem e prestar cuidado mais adequado ao ser humano.

  6. Da esclerodermia ao síndrome de poems

    Directory of Open Access Journals (Sweden)

    Ana Sofia Montez

    2015-12-01

    Full Text Available Homem, 84 anos, com antecedentes de hipotiroidismo e alterações cutâneas recentes compatíveis com esclerodermia, confirmadas em biópsia cutânea, mas com estudo auto-imune negativo. Foi internado por queixas constitucionais. Ao exame objetivo, apresentava-se emagrecido, com lesões de vitiligo nas mãos além das de esclerodermia (figura 1 e distensão abdominal com ascite

  7. High-Resolution Imaging of Asteroids/Satellites with AO

    Science.gov (United States)

    Merline, William

    2012-02-01

    We propose to make high-resolution observations of asteroids using AO, to measure size, shape, and pole position (spin vectors), and/or to search for satellites. We have demonstrated that AO imaging allows determination of the pole/dimensions in 1 or 2 nights on a single target, rather than the years of observations with lightcurve inversion techniques that only yield poles and axial ratios, not true dimensions. Our new technique (KOALA) combines AO imaging with lightcurve and occultation data for optimum size/shape determinations. We request that LGS be available for faint targets, but using NGS AO, we will measure several large and intermediate asteroids that are favorably placed in spring/summer of 2012 for size/shape/pole. Accurately determining the volume from the often-irregular shape allows us to derive densities to much greater precision in cases where the mass is known, e.g., from the presence of a satellite. We will search several d! ozen asteroids for the presence of satellites, particularly in under-studied populations, particularly NEOs (we have recently achieved the first-ever optical image of an NEO binary [Merline et al. 2008b, IAUC 8977]). Satellites provide a real-life lab for testing collisional models. We will search for satellites around special objects at the request of lightcurve observers, and we will make a search for debris in the vicinity of Pluto, in support of the New Horizons mission. Our shape/size work requires observations over most of a full rotation period (typically several hours).

  8. Atitudes dos profissionais de enfermagem relacionadas ao Processo de Enfermagem

    Directory of Open Access Journals (Sweden)

    Erika de Souza Guedes

    2012-10-01

    Full Text Available Os objetivos do estudo foram descrever a disposição sobre o Processo de Enfermagem (PE e a percepção de poder clínico dos profissionais de enfermagem; analisar associações entre atitudes relacionadas ao PE e variáveis selecionadas. Participaram 1.605 auxiliares de enfermagem e enfermeiros (86,9% mulheres, idade média 44,12 anos; DP=9,55. O escore médio no instrumento Posições sobre o Processo de Enfermagem (PPE foi 112,37 (DP=22,28 e no Power as Knowing Participation in Change Tool - versão brasileira (PKPCT foi 281,12 (DP= 38,72. Os escores nos instrumentos foram mais altos para enfermeiros quando comparados aos auxiliares. Houve correlação positiva moderada entre escores do PPE e PKPCT. Para os auxiliares houve associação entre os escores no PPE, sexo e pós-graduação; e entre percepção de poder e sexo. Para os enfermeiros houve associação entre PKPCT e cargo de chefia. Mais estudos devem ser desenvolvidos com vistas a identificar variáveis potencialmente associadas ao uso do Processo de Enfermagem na prática clínica.

  9. Resposta ao estresse: I. Homeostase e teoria da alostase

    Directory of Open Access Journals (Sweden)

    Maria Bernardete Cordeiro de Sousa

    2015-03-01

    Full Text Available ResumoOs seres vivos desenvolvem ao longo de sua história evolutiva mecanismos de enfrentamento às condições adversas originadas tanto no ambiente geofísico como no ambiente social. Esta resposta adaptativa é coordenada e envolve diferentes sistemas funcionais, particularmente, os sistemas nervoso, endócrino e imune, e é denominada de resposta ao estresse e deve atender a duas demandas principais da vida: sobrevivência e reprodução. Esta revisão tem o objetivo de discutir o emprego do conceito clássico de homeostase e um conceito alternativo, alostase, que inclui os mecanismos preditivos e reativos de regulação, assim como os diferentes níveis de impacto dos estressores crônicos, resultando em sobrecarga alostática que pode ou não se seguir de falha alostática. Os mecanismos neurais, hormonais, imunes, sistêmicos e moleculares, que compreendem os sistemas alóstaticos subjacentes à resposta ao estresse são também apresentados.

  10. Fatores associados a baixa adesao ao tratamento medicamentoso em idosos

    Directory of Open Access Journals (Sweden)

    Noemia Urruth Leao Tavares

    2013-12-01

    Full Text Available OBJETIVO : Analisar fatores associados à baixa adesão ao tratamento medicamentoso em idosos. MÉTODOS : Estudo transversal de base populacional, com amostra representativa de 1.593 indivíduos com 60 anos ou mais, residentes na região urbana de Bagé, RS, em 2008. A amostragem foi realizada em múltiplos estágios. Os dados foram coletados em entrevistas individuais nos domicílios. Analisou-se a associação entre a baixa adesão referida ao tratamento medicamentoso mensurado pelo Brief Medication Questionnaire (BMQ e fatores demográficos, socioeconômicos, comportamentais e de saúde, assistência e prescrição. Foi utilizado modelo de regressão de Poisson para estimar as razões de prevalência bruta e ajustada, os respectivos intervalos de confiança de 95% e p-valor (teste de Wald. RESULTADOS : Cerca de 78,0% dos indivíduos referiram ter usado algum medicamento nos sete dias precedentes à entrevista. Desses, cerca de 1 / 3 foram considerados com baixa adesão ao tratamento. Os fatores significativamente associados à baixa adesão foram: idade (65 a 74 anos, não ter plano de saúde, ter que comprar (totalmente ou em parte os seus medicamentos, ter três ou mais morbidades, possuir incapacidade instrumental para a vida diária e usar três ou mais medicamentos. CONCLUSÕES : A utilização elevada de medicamentos, decorrente da alta prevalência de doenças crônico-degenerativas em idosos, e o acesso ao tratamento devem ser considerados pelos profissionais de saúde para adoção de estratégias que visem diminuir a baixa adesão ao tratamento, aumentando a resolutividade terapêutica e a qualidade de vida desses pacientes.

  11. Suppression of Plant Immune Responses by the Pseudomonas savastanoi pv. savastanoi NCPPB 3335 Type III Effector Tyrosine Phosphatases HopAO1 and HopAO2

    Science.gov (United States)

    Castañeda-Ojeda, María Pilar; Moreno-Pérez, Alba; Ramos, Cayo; López-Solanilla, Emilia

    2017-01-01

    The effector repertoire of the olive pathogen P. savastanoi pv. savastanoi NCPPB 3335 includes two members of the HopAO effector family, one of the most diverse T3E families of the P. syringae complex. The study described here explores the phylogeny of these dissimilar members, HopAO1 and HopAO2, among the complex and reveals their activities as immune defense suppressors. Although HopAO1 is predominantly encoded by phylogroup 3 strains isolated from woody organs of woody hosts, both HopAO1 and HopAO2 are phylogenetically clustered according to the woody/herbaceous nature of their host of isolation, suggesting host specialization of the HopAO family across the P. syringae complex. HopAO1 and HopAO2 translocate into plant cells and show hrpL-dependent expression, which allows their classification as actively deployed type III effectors. Our data also show that HopAO1 and HopAO2 possess phosphatase activity, a hallmark of the members of this family. Both of them exert an inhibitory effect on early plant defense responses, such as ROS production and callose deposition, and are able to suppress ETI responses induced by the effectorless polymutant of P. syringae pv. tomato DC3000 (DC3000D28E) in Nicotiana. Moreover, we demonstrate that a ΔhopAO1 mutant of P. savastanoi NCPBB 3335 exhibits a reduced fitness and virulence in olive plants, which supports the relevance of this effector during the interaction of this strain with its host plants. This work contributes to the field with the first report regarding functional analysis of HopAO homologs encoded by P. syringae or P. savastanoi strains isolated from woody hosts. PMID:28529516

  12. Suporte relacionado ao cuidado em saúde ao doente com aids: o modelo de comboio e a enfermagem

    Directory of Open Access Journals (Sweden)

    Edilene Aparecida Araújo da Silveira

    2011-06-01

    Full Text Available O presente estudo teve como objetivo conhecer a relação e a troca de suporte entre o doente com AIDS e pessoas à sua volta. O estudo está baseado no modelo de comboio das relações sociais que tem como uma de suas características a representação da rede em três círculos concêntricos. Os participantes eram pessoas que estavam internadas e que falaram sobre o suporte relacionado ao cuidado em saúde proporcionado por pessoas próximas, ou seja, que pertenciam ao círculo interno do comboio. A maioria dos participantes descreveu o círculo como sendo composto por no máximo cinco integrantes, sendo que pessoas da família foram as mais citadas. Os profissionais de saúde precisam conhecer o paciente e seu comboio, reconhecendo-os no contexto psicossocial e cultural de forma a favorecer a aceitação da soropositividade, mudanças no estilo de vida, ajuda nos cuidados de saúde e adesão ao tratamento.

  13. Relative importance of the AO, NAO and Aleutian Low in predicting regional climate change

    Science.gov (United States)

    Paeth, H.; Rauthe, M.; Hense, A.

    2003-04-01

    In recent years, several observational and climate model studies have drawn a picture of Northern Hemisphere circulation modes which are largely sensitive to the greenhouse forcing with implications for regional climate change. The dominant candidates are the Arctic Oscillation (AO), the North Atlantic Oscillation (NAO) and the Aleutian Low (AL). Here, we consider all these modes equally and try to get insight into their relative importance with respect to temperature and rainfall variability over the Northern Hemisphere. The relative importance of AO, NAO and AL time series is determined by stepwise multiple regression with cross validation at every grid point of the globe. This tool is appropriate to sort the predictors - AO, NAO and AL - by their relative contribution to temperature and rainfall predictability and to evaluate the predictability with respect to an independent control data set. This allows to cut off the number of predictors as soon as the mean square error between the multiple regression model and the control data set is increasing. For better reliability of our results, the procedure is applied many times with 100 permutations. This part is based on the NCEP reanalysis data set. For estimating future temperature and rainfall anomalies, a broad model intercomparison study has been carried out, including most state-of-the-art models of the international modeler community. For each circulation mode superensemble-mean time series under greenhouse-gas (GHG) only and GHG plus sulphate aerosol conditions are determined respectively. Concerning annual-mean temperature, the total explained variance by an optimal number of predictors amounts to 60% over northern Europe, Siberia and North America. At most grid points of the Northern Hemisphere, the AO is the most prominent mode, also in the European-Atlantic sector where the NAO is supposed to be the main player. In the North Pacific sector and in some regions of the low latitudes the AL is dominating. The

  14. Data of evolutionary structure change: 1AO5B-3BSQC [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AO5B-3BSQC 1AO5 3BSQ B C VVGGFNCEKNSQPWQVAVYYQKEHICGGVLLDRNWVLTA...AHCYVDQYEVWLGKNKLFQEEPSAQHRLVSKSFPHPGFNMSLLMLQTIPPGADFSDDLMLLRLSKPADITDVVKPIALPTKEPKPGSKCLASGWGSITPT-WQKPDDLQC...bChain>C 3BSQC TTTSPDVTFPS 3BSQ C 3BSQC DT

  15. Data of evolutionary structure change: 1AO5B-2AGEX [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AO5B-2AGEX 1AO5 2AGE B X VVGGFNCEKNSQPWQVAVYYQKEHICGGVLLDRNWVLTAAHCYVDQYEVWLGKNKL...KCLASGWGSITPT-WQKPDDLQCVFITLLPNENCAKVYLQKVTDVMLCAGEMGGGKDTCRDDSGGPLICDGILQGTTSYGPVPCGKPGVPAIYTNLIKFNSWIKDTMMKNA... 2AGE X 2AGEX 1 2AGE X 2AGEX 2 2AGE X 2AGEX

  16. Data of evolutionary structure change: 1AO5A-2AGEX [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AO5A-2AGEX 1AO5 2AGE A X VVGGFNCEKNSQPWQVAVYYQKEHICGGVLLDRNWVLTAAHCYVDQYEVWLGKNKL...KCLASGWGSITPT-WQKPDDLQCVFITLLPNENCAKVYLQKVTDVMLCAGEMGGGKDTCRDDSGGPLICDGILQGTTSYGPVPCGKPGVPAIYTNLIKFNSWIKDTMMKNA... 2AGE X 2AGEX 1 2AGE X 2AGEX 2 2AGE X 2AGEX

  17. Ensaio clínico, aberto, controlado sobre a adição de brometo de ipratrópio ao fenoterol no tratamento da crise de asma em adultos Open, controlled clinical assay of the addition of ipratropium bromide to fenoterol in the treatment of acute asthma crisis in adults

    Directory of Open Access Journals (Sweden)

    Solange Diccini

    1999-12-01

    Full Text Available No tratamento da crise de asma, empregam-se doses repetidas de drogas b2-agonistas por via inalatória. O efeito da adição do brometo de ipratrópio (BI ao b2-agonistas é controverso em adultos. OBJETIVO: Avaliar se adição de BI ao fenoterol, em tratamentos inalatórios repetidos, induz a maior broncodilatação, com reversibilidade da crise e alta da emergência em pacientes em crise grave de asma. LOCAL DO ESTUDO: Serviço de Pronto-Atendimento de Pneumologia, Disciplina de Pneumologia da Unifesp-Hospital São Paulo, no período de julho de 1995 a fevereiro de 1997. TIPO DE ESTUDO: Aberto, randomizado, paralelo. Alta da emergência determinada pelo VEF1 e PFE > 60% do previsto. CASUÍSTICA E MÉTODOS: Cento e vinte pacientes em crise de asma foram divididos em dois grupos (N = 60: fenoterol (F e brometo de ipratrópio + fenoterol (BIF com VEF1 e PFE Repeated dosis of inhaled b2-agonists have been used in the treatment of acute asthma. The effect of added ipratropium bromide (IB to b2-agonist is controversial in adults. OBJECTIVE: To evaluate if addition of IB to fenoterol, in repeated doses, induces a greater bronchodilation, a greater reversion of the attack, and discharge from emergency unit in adults with acute severe asthma. SETTING: Pneumology Emergency Department, Unifesp-Hospital São Paulo, in the period from July 1995 to February 1997. TYPE OF STUDY: Open, randomized and parallel study. Discharge from the hospital: FEV1 and PEF > 60% of the predicted value. METHODS: 120 patients with FEV1 and PEF < 50% of the predicted value were divided into two groups (N = 60: fenoterol (F and ipratropium bromide + fenoterol (IBF. Each group received inhalation treatment through a metered-dose inhaler (MDI attached to a holding chamber, administered at 30-minute interval, for a total of three treatments. In the group F four puffs of fenoterol (400 mg were administered, and in the IBF group, 160 mg of BI and 400 mg of fenoterol (four puffs

  18. Desempenho de bezerros aleitados com soro de queijo em associação ao colostro

    Directory of Open Access Journals (Sweden)

    Renata Nayhara de Lima

    2012-08-01

    Full Text Available O objetivo deste trabalho foi avaliar o desempenho de bezerros mestiços, aleitados com soro de queijo em associação ao colostro. Foram utilizados 24 bezerros Holandês x Zebu, distribuídos em delineamento inteiramente casualizado, com três tratamentos e oito repetições. Os tratamentos consistiram de: leite integral, 50% de leite integral + 50% de soro de queijo, e 30% de colostro + 70% de soro de queijo. O desenvolvimento dos bezerros foi avaliado até os 60 dias de idade, por meio de pesagens semanais e mensurações corporais. Para a estimativa de consumo, foram feitas medições diárias de consumo da dieta sólida, pelo método oferta/sobra. O desempenho econômico foi avaliado pelo cálculo de indicadores de custos e receitas, e de medidas de resultados econômicos. Não houve influência da dieta líquida sobre o consumo de matéria seca e sobre as médias de medidas corporais dos bezerros. Foram observadas diferenças significativas no ganho de peso dos animais na segunda e na quarta semanas de vida. A dieta com colostro apresentou o maior lucro adicional em comparação ao tratamento controle. A associação do soro de queijo ao colostro é a opção mais vantajosa economicamente, já que a substituição de 100% do leite por esses subprodutos não prejudicou o desempenho dos animais.

  19. Probing circumplanetary disks with MagAO and ALMA

    Science.gov (United States)

    Wu, Ya-Lin

    2018-01-01

    The dedication of the Magellan Adaptive Optics (MagAO) on the 6.5 m Clay Telescope has opened a new era in high-contrast imaging. Its unique diffraction-limited wavelengths of 0.6 to 1 micron helps to probe circumplanetary disks by measuring the amount of dust reddening as well as by searching for the strongest gas accretion indicator H-alpha (0.65 micron). Using MagAO, I found that two wide-orbit planetary-mass companions CT Cha B and 1RXS 1609 B have a significant dust extinction of Av ~ 3 to 5 mag likely from their disks. For GQ Lup B, I found that it is actively accreting material from its disk and emitting strong H-alpha emission. My research with MagAO demonstrates that circumplanetary disks could be ubiquitous among young giant planets. I later carried out a survey using ALMA to image accretion disks around several wide planet-mass companions at 1.3 mm continuum and CO (2-1). This is the first systematic study aiming to measure the size, mass, and structure of planetary disks. However, except for FW Tau C (which was shown to actually be a low-mass star from the dynamical mass measurement) no disks around the companions were found in my ALMA survey. This surprising null result implies that circumplanetary disks are much more compact and denser than expected, so they are faint and optically thick in the radio wavelengths. Therefore, mid- to far-infrared may be more favorable to characterize disk properties. The MIRI camera on the JWST can test this compact optically-thick disk hypothesis by probing disk thermal emission between 10 and 25 micron.

  20. Anemia e peso ao nascer Anemia and birthweight

    Directory of Open Access Journals (Sweden)

    Taqueco T Uchimura

    2003-08-01

    Full Text Available OBJETIVO: Verificar a influência do baixo peso ao nascer (BPN na anemia e desnutrição da criança, ao longo do primeiro ano de vida. MÉTODOS: A população amostral foi constituída por todas as crianças menores de um ano de idade atendidas nas unidades de saúde do Município de Maringá, PR, em 1998, num total de 587. Considerou-se baixo peso ao nascer, todas as crianças com peso OBJECTIVE: To verify the influence of Low Birthweight (LBW on child anemia and malnutrition during the first year of life. METHODS: Sample population included all children under one year seen at Health Units of the municipality of Maringá, southern Brazil, in 1998. Total sample size was 587 children. LBW was defined as birthweight below 2 500 g. The analysis of growth for the weigh-for-age and height-for-age indicators was based on NationalCenter for HealthSstatiscs standards. For anemia diagnosis, a biochemical hemoglobin concentration dosage, using HemoCue direct colorimetric method was employed. Children with [Hb] <11,0 g/dL were considered as anemic. RESULTS: Fifty-eight percent of the studied population were anemic, and 37 children (6.3% presented LBW. Anemia was more prevalent during the second semester of life (p=0.0093. Undernutrition, as indicated by the height-for-age indicator, was high especially for children aged 0-3 months with LBW. CONCLUSIONS: Although LBW rates among the studied population were similar to those of developed countries, we suggest the implementation of specific antenatal care for high-risk women, aiming at reducing LBW, an event that affects the child, hampering its growth and increasing the risk of anemia and its countless deleterious consequences.

  1. Child abuse: a common problem in Curaçao?

    Science.gov (United States)

    Klein, K; Boersma, A A; Meyboom-de Jong, B; de Bruijn, J

    2013-02-01

    To assess the prevalence of child abuse among high school students in Curacao. A questionnaire survey among high school students up to 17 years of age was conducted. The questionnaire was based on existing literature and validated questionnaires. The questionnaire used was analysed and adapted to the situation in Curaçao by a panel of experts on child abuse. The primary objective was to gain insight into the incidence, prevalence and various forms of child abuse among students in Curaçao. Five forms of child abuse are distinguished in the literature: physical abuse, emotional abuse, sexual abuse, neglect and exploitation. Furthermore, the degree of confidence of the students in general practitioners (GPs) as care providers in the field of child abuse was explored. Questionnaires from 545 of the 628 respondents were included. In total, 43% of the respondents had ever-experienced an event which could be defined as (a form of) child abuse. More than one-third of the respondents reporting child abuse ever had an experience that could be interpreted as physical abuse. More than 15% of the respondents reporting child abuse had experienced sexual abuse. Girls experienced significantly more sexual abuse than boys. Emotional abuse in the last year was experienced by 3% of the respondents. One per cent of the respondents ever-experienced neglect. According to most respondents, GPs were not seen as care providers in cases of child abuse; they believed that GPs were mainly to be consulted for illnesses or physical symptoms and not for forms of child abuse. The prevalence of ever-having-experienced a form of child abuse is estimated at 431 per 1000 students. Child abuse, particularly physical abuse, is common in Curaçao, and is probably comparable to other surrounding countries. General practitioners were not seen as care providers in identifying and reporting cases of child abuse according to most respondents.

  2. Assistência de enfermagem humanizada ao paciente em UTI

    OpenAIRE

    Vieira, Claudir Aparecido; Maia, Luiz Faustino dos Santos

    2013-01-01

    Hoje em dia a humanização é ponto de pauta nos encontros nacionais e internacionais da área da saúde. Assim, cada vez mais enfermeiros nas unidades de terapia intensiva tem se preocupado com a sua prática. O presente estudo foi desenvolvido com o objetivo de compreender, reconhecer e entender como o comportamento humanizado reflete ao paciente e identificar a percepção da equipe de enfermagem sobre o processo de humanização. Trata-se de uma pesquisa de revisão bibliográfica descritiva com aná...

  3. Resistencia ao brometo de etidio em aspergillus nidulans

    OpenAIRE

    Maria Elizabeth Scarazzatti Frau

    1985-01-01

    Resumo: O presente trabalho teve por objetivo isolar e ana-lisar geneticamente mutantes de Aspergillus nidulans resistentes ao Brometo de Etídio (BE), bem como estudar os efeitos da riboflavina em relação a toxicidade do BE. Foram isolados mutantes espontâneos e induzidos. Dos mutantes isolados espontaneamente apenas 3 continuaram a apresentar resistência, sendo 1 da linhagem A e 2 da linhagem biAl methGl. Os outros mutantes (16) foram obtidos por indução com luz ultravioleta. Destes apenas 9...

  4. Stream-Field Interactions in the Magnetic Accretor AO Piscium

    Science.gov (United States)

    Hellier, Coel; van Zyl, Liza

    2005-06-01

    UV spectra of the magnetic accretor AO Psc show absorption features for half the binary orbit. The absorption is unlike the wind-formed features often seen in similar stars. Instead, we attribute it to a fraction of the stream that overflows the impact with the accretion disk. Rapid velocity variations can be explained by changes in the trajectory of the stream depending on the orientation of the white dwarf's magnetic field. Hence, we are directly observing the interaction of an accretion stream with a rotating field. We compare this behavior to that seen in other intermediate polars and in SW Sex stars.

  5. Atenção ao Suicídio

    Directory of Open Access Journals (Sweden)

    Berenice Rheinreimer

    2015-11-01

    Full Text Available De acordo com a OMS a cada ano ocorrem 1 milhão de mortes causadas por suicídio, número maior que a soma das mortes causadas por guerras e homicídios (1. Até 2030, as mortes por suicídio podem chegar a 1 milhão e quinhentos mil, caso sejam mantidos os índices de crescimento atuais (2, 3. Para cada morte, ocorrem de 10 a 40 tentativas de suicídio, ou seja, 10 a 40 milhões de tentativas de suicídio ao ano (4.

  6. Aspect-Oriented Business Process Modeling with AO4BPMN

    Science.gov (United States)

    Charfi, Anis; Müller, Heiko; Mezini, Mira

    Many crosscutting concerns in business processes need to be addressed already at the business process modeling level such as compliance, auditing, billing, and separation of duties. However, existing business process modeling languages including OMG's Business Process Modeling Notation (BPMN) lack appropriate means for expressing such concerns in a modular way. In this paper, we motivate the need for aspect-oriented concepts in business process modeling languages and propose an aspect-oriented extension to BPMN called AO4BPMN. We also present a graphical editor supporting that extension.

  7. O papel do leite ao longo do ciclo de vida

    OpenAIRE

    Lima, Joana Catarina Dinis

    2012-01-01

    Resumo da tese: A presença do leite nos guias alimentares denota a sua importância na alimentação humana. Contudo, não é consensual que este alimento deva fazer parte da nossa alimentação ao longo de todo o ciclo de vida. Sabe-se que cada espécie produz um tipo de leite diferente, com diversas moléculas bioativas e nutrientes que modulam o seu crescimento e desenvolvimento corporal. Recentemente, uma parte da fração proteica do leite tem sido apontada como tendo um possível efeito estimulante...

  8. Controle da dor pós-operatória da artroplastia total do joelho: é necessário associar o bloqueio do nervo isquiático ao bloqueio do nervo femoral? Control del dolor postoperatorio de la artroplastia total de la rodilla: ¿es necesario asociar el bloqueo del nervio isquiático al bloqueo del nervio femoral? Control of postoperative pain following total knee arthroplasty: is it necessary to associate sciatic nerve block to femoral nerve block?

    Directory of Open Access Journals (Sweden)

    Affonso H. Zugliani

    2007-10-01

    Full Text Available JUSTIFICATIVA E OBJETIVOS: A artroplastia total do joelho (ATJ promove grande trauma tecidual, produzindo intensa dor no pós-operatório. A analgesia pós-operatória de boa qualidade é fundamental, devendo-se considerar que a mobilização articular precoce é um importante aspecto para obtenção de bons resultados. Há controvérsias na literatura sobre a eficácia do bloqueio isolado do nervo femoral. O objetivo deste estudo foi avaliar a analgesia pós-operatória com a associação do bloqueio dos nervos isquiático e femoral. MÉTODO: Foram estudados 17 pacientes submetidos à ATJ sob raquianestesia, divididos em dois grupos: A e B. No Grupo A (n = 9 foi realizado bloqueio do nervo femoral e no Grupo B (n = 8, bloqueio dos nervos femoral e isquiático. Os bloqueios foram realizados no pós-operatório imediato utilizando-se 20 mL de ropivacaína a 0,5% em cada um. A dor foi aferida nas primeiras 24 horas pela Escala Analógica Visual e escala verbal. Foi observado o tempo decorrido entre os bloqueios e a primeira queixa de dor (M1. RESULTADOS: A mediana do tempo de analgesia (M1 no Grupo A foi de 110 min. e no Grupo B de 1.285 min. (p = 0,0001. Não foram observadas complicações atribuíveis às técnicas utilizadas. CONCLUSÃO: O bloqueio do nervo isquiático, quando associado ao bloqueio do nervo femoral, nas condições deste estudo, melhorou de maneira significativa a qualidade da analgesia pós-operatória da ATJ.JUSTIFICATIVA Y OBJETIVOS: La artroplastia total de la rodilla (ATR promueve gran trauma del tejido produciendo un intenso dolor en el postoperatorio. La analgesia de postoperatorio de buena calidad es fundamental, debiendo considerar que la movilización articular precoz es un importante aspecto para la obtención de buenos resultados. Existen controversias en la literatura sobre la eficacia del bloqueo aislado del nervio femoral. El objetivo de este estudio fue evaluar la analgesia en postoperatorio con la asociaci

  9. Checklist of the birds of Aruba, Curaçao and Bonaire, South Caribbean

    NARCIS (Netherlands)

    Prins, T.G.; Reuter, J.H.; Debrot, A.O.; Wattel, J.; Nijman, V.

    2009-01-01

    We present an updated checklist of the birds of the islands of Aruba, Curaçao and Bonaire, and the islets of Klein Curaçao and Klein Bonaire, southern Caribbean, and compare this with earlier checklists (K.H. Voous, Stud. Fauna Curaçao Carib. Isl. 7: 1-260, 1957; Ardea 53: 205-234, 1965; Birds of

  10. Suscetibilidade do capim-colonião e de cultivares de milho ao flúor

    Directory of Open Access Journals (Sweden)

    Rimena Ramos Domingues

    2011-01-01

    Full Text Available A emissão de fluoretos à atmosfera oriunda da produção de superfosfatos e de cerâmica tem causado preocupação pelo efeito tóxico às plantas, contudo são poucos os estudos desenvolvidos acerca do problema com espécie de interesse econômico agrícola. Desenvolveu-se o estudo para avaliar o efeito do flúor (F atmosférico em plantas de capim-colonião e de cultivares de milho, utilizando como referência espécies bioindicadoras do tipo sensível e tolerante. As plantas foram expostas à contaminação pelo F atmosférico por curtos períodos durante 32 dias em sistema de nebulização com 0,16 mol L-1 de ácido fluorídrico no ambiente interno de uma câmara (~0,20 mmol m-3 de F, havendo um controle não exposto, com quatro repetições. A exposição das plantas ao F causou aumento da concentração do elemento nas folhas até 60 mg kg-1 para o capim-colonião, e entre 100 mg kg-1 nas folhas novas e 170 mg kg-1 nas folhas velhas para quatro cultivares de milho, o que demonstrou o efeito cumulativo do elemento no ambiente. Sintomas visuais da toxicidade foram observados nas plantas e se caracterizaram pela ocorrência de cloroses e necroses na lâmina foliar. O capim-colonião é uma espécie bastante sensível ao poluente no ar. As cultivares de milho DKB 390 e Ômega 8315 também são mais sensíveis ao F quando comparadas às AG7088 e 2B707. Os teores de clorofila a nas plantas foram mais afetados pelo F em relação aos teores de clorofila b.

  11. Titanium alloys (AoN) and their involvement in osseointegration.

    Science.gov (United States)

    Danza, Matteo; Zollino, Ilaria; Candotto, Valentina; Cura, Francesca; Carinci, Francesco

    2012-12-01

    Osseointegration is essential for a long-term successful and inflammation-free dental implant. Such a result depends on osteoblastic cells growth and differentiation at the tissue-implant interface. The aim of this study was to compare two different AoN titanium layers (GR4 and GR5) to investigate which one had a greater osteoconductive power using human osteoblasts (HOb) culture at two different time-points. The expression levels of some bone-related (ALPL, COL1A1, COL3A1, SPP1, RUNX2, and SPARC) were analyzed using real time reverse transcription-polymerase chain reaction (real time RT-PCR). Real-time RT-PCR data showed that after 3 days of treatment with TiA4GR, the genes up-regulated were COL3A1, ALPL, SPP1, and RUNX2. Moreover, no difference in gene expression was noticed 4 days later. On the other hand, the genes that overexpressed after 3 days of treatment with AoN5GR were ALPL, SPP1, and RUNX2. In both cases, the expression of COL1A1 and SPARC was negatively regulated. Our data showed that both titanium surfaces led to osteoblasts recruitment, maturation, and differentiation, thus promoting osseointegration at the tissue-implant interface.

  12. Atribuições de significados ao transplante renal

    Directory of Open Access Journals (Sweden)

    Quintana, Alberto M.

    2011-01-01

    Full Text Available Este trabalho teve foco na investigação das atribuições de significados ao transplante renal de pacientes com Insuficiência Renal Crônica (IRC de um Hospital Universitário da Região Sul. Foi utilizado um método qualitativo e participaram doze pessoas na pesquisa. Os instrumentos utilizados foram a entrevista semidirigida e a autofotografia. Para a análise dos dados foi empregada a técnica de análise de conteúdo, o que permitiu que fossem construídas quatro categorias temáticas: a ansiedade da espera, os conflitos ante o doador, as expectativas em relação ao devir e a vida antes e depois do transplante. Constatou-se que a possibilidade deste traz consigo uma série de repercussões psíquicas devido o fato de ser visto como algo que restitui a vida, proporciona bem-estar e sentimento de liberdade, mesmo levando em consideração que ainda persistem os cuidados com o corpo, com a alimentação e com os remédios

  13. New Results from the AO327 Drift Pulsar Survey

    Science.gov (United States)

    Deneva, Julia S.; Stovall, K.; McLaughlin, M.; Bates, S.; Freire, P.; Martinez, J.; Jenet, F.; Bagchi, M.

    2014-01-01

    The Arecibo 327 MHz drift pulsar survey (AO327) has operated since 2010 and aims to cover the entire Arecibo sky (declinations of -1 to 38 degrees). We present details on the progress of the survey and a new set of discoveries over the past year. Phase 1 of AO327 targets declinations of -1 to 28 degrees and is 55% complete; Phase 2 will target declinations of 28 to 38 degrees. The survey is expected to be completed in 2017. Out of a total of 28 new pulsars, 12 were found in 2013, including three millisecond pulsars. PSR J2234+06 has a rotation period of 3.58 ms and is in a 32-day orbit in a binary system with a white dwarf companion. This pulsar is bright and a very stable rotator, making it suitable for inclusion in Pulsar Timing Arrays. The orbit of J2234+06 has an eccentricity of 0.13, which cannot be accounted for by stellar evolution but may be explained by an origin in a subsequently disrupted hierarchical triple, or by an exchange interaction. PSR J0509+08 has a period of 4.06 ms and is in a 4.9-day binary system with a white dwarf companion. This pulsar is also a candidate for inclusion in PTAs.

  14. UMA PROPOSTA DE ABORDAGEM AO PROBLEMA DE FLÁVIO JOSEFO APLICADA AO ENSINO MÉDIO

    OpenAIRE

    Márcia Erondina Dias de Souza

    2013-01-01

    Neste trabalho, apresentamos uma sequência didática de atividades elaboradas para um grupo de alunos do ensino médio, na faixa etária de 15 a 18 anos, tendo como principal objetivo estudar o problema proposto pelo matemático Flávio Josefo, nos meados do ano 64. Conta a lenda que um grupo de rebeldes, dentre eles Flávio Josefo, foi encurralado numa caverna pelo exército inimigo. Preferindo o suicídio à captura, os rebeldes decidiram formar um círculo e, contando ao longo dest...

  15. OBSOLESCÊNCIA PROGRAMADA E TEORIA DO DECRESCIMENTO VERSUS DIREITO AO DESENVOLVIMENTO E AO CONSUMO (SUSTENTÁVEIS)

    OpenAIRE

    Oliveira da Silva, Maria Beatriz Beatriz; UNiversidade Federal de Santa Maria (UFSM)

    2012-01-01

    Inspirado em um documentário intitulado “Prêt à Jeter”, este texto tem como objetivo central colocar em apreciação algumas reflexões acerca da obsolescência programada como uma das estratégias do modelo de desenvolvimento capitalista e ensaiar uma reposta às seguintes questões: para combater a obsolescência programada se faz necessária a defesa de uma “teoria do decrescimento”? Sendo a obsolescência programada uma das estratégias da sociedade de consumo, é possível combatê-la e, ao mesmo temp...

  16. Resposta fisiológica de sementes de palmeiras ao envelhecimento acelerado

    Directory of Open Access Journals (Sweden)

    Negreiros Gisele de Freitas

    2004-01-01

    Full Text Available O objetivo deste trabalho foi avaliar a qualidade fisiológica de sementes de quatro espécies da família Palmae submetidas ao envelhecimento acelerado. Sementes recém-colhidas de cada uma das espécies foram expostas às condições de envelhecimento acelerado em câmara a 45ºC e 100% de UR, durante os períodos de 0 (controle, 12, 24, 36 e 48 horas. Sementes de Euterpe edulis e Dypsis lutescens foram sensíveis ao tratamento, sendo a germinação totalmente suprimida após 12 horas de permanência na câmara. As espécies Roystonea oleracea e Phoenix reclinata apresentaram sementes mais resistentes que as outras espécies, mas redução gradativa do vigor, de acordo com o aumento do período de exposição às condições de envelhecimento; o período de 48 horas foi crítico para determinados parâmetros de vigor avaliados.

  17. Tolerância da mamoneira ao herbicida trifluralin em solos com diferentes texturas

    Directory of Open Access Journals (Sweden)

    Katty A. A. de L. Medeiros

    2013-12-01

    Full Text Available A escassez de herbicidas registrados para a cultura da mamoneira ainda é fator limitante para sua expansão. Objetivou-se então, com este trabalho, avaliar a tolerância da mamoneira ao herbicida trifluralin em solos com diferentes texturas. O experimento foi conduzido em casa de vegetação, em delineamento inteiramente casualizado com cinco repetições, em esquema fatorial com 8 doses do herbicida trifluralin aplicado em pré-emergência (0; 187,5; 375; 750; 1.500; 3.000; 6.000 e 12.000 g ha-1 i.a. e quatro tipos de substrato (areia lavada; franco-arenoso; franco argiloso-arenoso e franco-argiloso. Aos 28 dias após a semeadura foram determinadas as variáveis: altura de plantas, área foliar, massa seca da parte aérea, volume e massa seca do sistema radicular. Concluiu-se que a dose do herbicida trifluralin tolerada pela mamoneira é influenciada pelas características químicas e físicas do solo. Em solos de textura arenosa e franco-arenosa doses do herbicida trifluralin abaixo daquelas comumente utilizadas para controle de plantas daninhas, são suficientes para ocasionar redução no crescimento das plantas de mamoneira.

  18. Seleção de linhagens de melancia resistentes ao Watermelon mosaic virus e ao Papaya ringspot virus Selection of resistant watermelon lines to Watermelon mosaic virus and Papaya ringspot virus

    Directory of Open Access Journals (Sweden)

    José Evando Aguiar Beserra Júnior

    2007-10-01

    Full Text Available Foram avaliadas 20 linhagens de melancia, provenientes do cruzamento da cultivar comercial suscetível Crimson Sweet e da introdução PI 595201 resistente ao Watermelon mosaic virus (WMV e Papaya ringspot virus (PRSV-W. As linhagens, e os parentais foram inoculados com o WMV ou com o PRSV-W em casa-de-vegetação distintas. Aos 35 e 49 dias após a primeira inoculação (DAI, as plantas foram avaliadas por meio de uma escala de notas, em que 1 (ausência de sintomas a 5 (intenso mosaico e deformações foliares. Pelos resultados infere-se que, aos 35 DAI, as linhagens 1, 2 e 20 apresentaram resistência tanto para o WMV como para o PRSV-W, com médias de 1,95, 1,80 e 2,25 para o WMV, e de 2,50, 2,30 e 2,50 para o PRSV-W, respectivamente. As linhagens 5, 7 e 13 foram resistentes somente ao WMV e as plantas das linhagens 3, 10 e 18 para o PRSV-W. A reação das linhagens permaneceu em geral pouco alterada aos 49 DAI. A existência de linhagens resistentes somente ao WMV e somente ao PRSV-W, ao lado de linhagens resistentes a ambos os vírus, é indicativo de que as resistências ao WMV e ao PRSV-W não são controladas pelos mesmos genes.Twenty advanced watermelon breeding lines, derived from the cross between cv. Crimson Sweet (susceptible and PI 595201 (resistant to WMV and PRSV-W, were screened for resistance to both potyviruses. The twenty lines, among with Crimson Sweet and PI 595201, were inoculated with either WMV or PRSV-W, in two different greenhouse trials. Plants were evaluated for symptoms 35 and 49 days after the first inoculation (DAI, using a scale from 1 (no symptoms to 5 (severe mosaic and foliar distortion. Evaluations at 35 DAI indicated that lines 1, 2 and 20 had good levels of resistance to both WMV and PRSV-W, with ratings of 1,95, 1,80 and 2,25 for WMV, and of 2,50, 2,30 and 2,50 for PRSV-W, respectively. Lines 5, 7 and 13 were resistant to WMV only, whereas lines 3, 10 and 18 were resistant to PRSV-W only. The reaction of

  19. Fatores associados à adesão ao tratamento antihipertensivo por idosos na atenção primária

    Directory of Open Access Journals (Sweden)

    Lorena Flor da Rosa Santos Silva

    2014-04-01

    Full Text Available A adesão ao tratamento anti-hipertensivo é fundamental para o manejo dos pacientes portadores de hipertensão arterial, o que contribui para a redução da morbimortalidade por esta enfermidade. Desta forma, este estudo teve como objetivo determinar a adesão ao tratamento anti-hipertensivo e fatores associados em idosos hipertensos cadastrados em uma Unidade de Saúde da Família, Londrina-PR. Desenvolveu-se um estudo transversal com idosos (60 anos ou mais, selecionados a partir do Sistema de Informação da Atenção Básica. As variáveis de interesse (socioeconômicas e demográficas, hábitos de vida, acesso aos serviços de saúde e adesão ao tratamento medicamentoso foram obtidas pela aplicação de um formulário semiestruturado através de um inquérito domiciliar. A adesão foi avaliada por meio do Teste de Morisky-Green e o controle pressórico. Dos 117 idosos investigados, 54,7% foram identificados como aderentes ao tratamento anti-hipertensivo e 61,4% apresentaram pressão arterial controlada. A média de medicamentos anti-hipertensivos utilizados foi de 1,97, destacando-se hidroclorotiazida (30,8%, enalapril (24,8% e captopril (14,5%. A adesão ao tratamento farmacológico apresentou-se associada ao sexo feminino (61,8%; p<0,05 e a idade entre 60 e 79 anos (67,9%; p<0,01. O controle pressórico mostrou-se associado à menor escolaridade (75,6%; p<0,05 e não possuir trabalho remunerado (69,4%; p<0,02. Os resultados observados indicam moderada adesão ao tratamento anti-hipertensivo e ao controle pressórico. Além disso, detectou-se que as variáveis socioeconômicas e demográficas mostraram-se mais fortemente associadas à adesão e controle pressórico.

  20. Performance of the Sewage Treatment Plant of S˜ao Jo˜ao de Iracema (Brazil

    Directory of Open Access Journals (Sweden)

    Tsunao Matsumoto

    2016-05-01

    Full Text Available Context: Some of the most important parameters measured in the sewage treatment plant –STP- are: organic matter, solids and faecal organisms. The objective of this work was to diagnose the performance of S˜ao Jo˜ao de Iracema STP for those parameters removal. Method: A batimetric survey of the anaerobic and facultative lagoons; the STP influent and effluent monitoring in three different climate seasons of 3-month long each were conducted by dissolved oxygen, pH, temperature, BOD, filtered BOD, COD, solids and coliforms measuring. Results: Sludge accumulations of 1.3 and 6.5% in the anaerobic and facultative lagoons were registered; average BOD removal was of 73.6%, smaller than the 80% recommended by Brazilian legislation; the average faecal coliform number on final effluent was of 9.55*106/100mL, above the per-missible limit of 1000/100mL. Conclusions: The STP needs to set-up a post treatment system that guarantees additional organic matter removal and fecal coliforms in order to adjust the effluent quality to the environmental legislation standards.

  1. Prednisona e meloxicam no tratamento de ratos submetidos ao trauma agudo da medula espinhal

    Directory of Open Access Journals (Sweden)

    Graciane Aiello

    2015-01-01

    Full Text Available O objetivo deste estudo foi investigar o efeito da prednisona e do meloxicam na terapia de ratos submetidos ao modelo experimental de trauma agudo da medula espinhal, induzida pelo cateter de Fogarty 2Fr, mediante a avaliação dos parâmetros de estresse oxidativo, dos testes neurológicos e do exame histopatológico da medula espinhal. Foram utilizados 90 ratos Wistar, distribuídos em seis grupos, denominados controle salina ou GCS (n=15, controle prednisona ou GCP (n=15, controle meloxicam ou GCM (n=15, trauma mais salina ou GTS (n=15, trauma mais prednisona ou GTP (n=15 e trauma mais meloxicam GTM (n=15. Cada grupo foi redistribuído em três subgrupos de igual número, de acordo com o tempo de tratamento no pós-operatório de 24h, 72h e sete dias. Todos os grupos foram submetidos à laminectomia e, nos grupos GTS, GTM e GTP, após a exposição da medula espinhal, foi realizado o trauma medular compressivo, utilizando o cateter de Fogarty 2Fr. Os grupos GCS e GTS foram tratados com solução salina, os GSM e GTM receberam meloxicam e os GSP e GTP prednisona, sendo administrados pela via intraperitoneal. Em todos os ratos, foram avaliados os parâmetros de estresse oxidativo, testes neurológicos e exame histopatológico da medula espinhal. Os animais dos grupos GTS, GTM e GTP, nos diferentes tempos (24h, 72h e sete dias, tiveram pontuação zero na escala de Basso, Beattie e Bresnahan (BBB; no plano inclinado, permaneceram com pontuação três e perderam a percepção da dor profunda. Os grupos GTM e GTP apresentaram menor atividade da catalase e de níveis de TBARS, quando comparado ao grupo GTS. Foi constatada degeneração Walleriana e necrose da substância cinzenta de intensidades variáveis, não apresentando diferença entre os grupos submetidos ao trauma. O meloxicam e a prednisona apresentam possível efeito antioxidante, mas não impedem a necrose e a degeneração Walleriana da medula espinhal de ratos.

  2. Fatores associados ao câncer do colo uterino em Propriá, Sergipe, Brasil

    Directory of Open Access Journals (Sweden)

    Carlos Anselmo Lima

    Full Text Available O câncer do colo uterino apresenta uma alta incidência nas regiões pobres dos países em desenvolvimento. Relaciona-se a fatores ligados ao estilo de vida que levam à infecção pelo Papilomavirus humano (HPV. O objetivo do estudo foi avaliar quais os fatores que favoreciam a infecção pelo HPV e ao desenvolvimento do carcinoma do colo uterino no Município de Própria, Sergipe, Brasil. Para o desenvolvimento da pesquisa, realizou-se um estudo de caso-controle, pareando-se quatro controles para cada caso quanto à idade, procedência e condição sócio-econômica. Foram identificadas vinte mulheres portadoras de carcinoma do colo uterino e oitenta controles. As mulheres do grupo casos apresentaram maior número de gestações e freqüência menor de realização de exame preventivo de rotina. Verificou-se também que as mulheres nos dois grupos tinham conhecimento pobre sobre o câncer e as suas formas de prevenção, alto índice de analfabetismo e os seus companheiros tinham múltiplas parceiras sexuais. O estudo concluiu que no Município de Própria, o maior número de gestações e a não realização de exames preventivos de rotina associaram-se à ocorrência de carcinoma do colo uterino.

  3. Forma musical como um processo: do isomorfismo ao heteromorfismo

    Directory of Open Access Journals (Sweden)

    Danilo Rossetti

    2016-05-01

    Full Text Available Este artigo se propõe a analisar a questão da forma musical a partir do momento em que temos, no início do século XX, uma ruptura com sua predeterminação, passando a se configurar como o resultado de diferentes operações ou processos de composição. Neste contexto, abordamos a noção de forma estatística, ligada ao isomorfismo e à continuidade entre as diferentes escalas temporais presentes numa obra musical (MEYER-EPPLER, 2009 [1954]; STOCKHAUSEN 1959; EIMERT, 1959 e ao princípio do grau de mudança (STOCKHAUSEN, 1989b [1958]; KOENIG, 1963, 1965, bem como a noção da forma como uma emergência, ligada ao heteromorfismo e à descontinuidade entre as diversas escalas temporais (VAGGIONE, 1994, 2010. Para tanto, trazemos como fundamentação teórica o método alagmático e o princípio da individuação das formas de Gilbert Simondon (2005, assim como as características morfológicas perceptivas de saliência (saillance e pregnância (prégnance de René Thom (1988, 1990a, além de sua teoria das catástrofes (THOM, 1985. No contexto proposto, a fusão de timbres é pensada como um processo alagmático gerador de novas formas, sendo analisada a partir de diferentes possibilidades tais como por jitter (DUBNOV; TISHBY; COHEN, 1997, síntese granular, permeabilidade (LIGETI, 2010a [1958], micropolifonia (LIGETI, 2010c [1980] e convolução (ERBE, 1997; JAFFE, 1987; ROADS, 1993; VAGGIONE, 1996. Concluímos a respeito dos processos de fusão analisados não apenas considerando-os isoladamente, mas como operações que propiciam o nascimento da forma musical, afirmando o pensamento da forma como um processo e não como algo definido a priori.

  4. Do dispositivo da sexualidade ao dispositivo da biotecnologia

    Directory of Open Access Journals (Sweden)

    Laura Belluzzo de Campos Silva

    2015-12-01

    Full Text Available Resumo No livro “A vontade de saber”, onde definiu o que chamou de dispositivo da sexualidade, Foucault deixou entrever que talvez outro dispositivo já estivesse em vias de se compor. Os avanços recentes no campo da biotecnologia molecular reabrem a discussão sobre as bases biológicas do comportamento, acenando com a possibilidade de novas formas de intervenção e com a de seu uso para fins comerciais. Partindo dessas idéias, este trabalho visa discutir que contribuições o conceito de biopoder pode trazer em relação aos recentes avanços da biotecnologia e cartografar algumas linhas que compõem esse novo dispositivo, que poderíamos chamar de biotecnológico.

  5. Lévi-Strauss nos 90 voltas ao passado

    Directory of Open Access Journals (Sweden)

    Lévi-Strauss Claude

    1998-01-01

    Full Text Available Este artigo responde às críticas formuladas por Christian Delacampagne e Bernard Traimond em "A Polêmica Sartre/Lévi-Strauss Revisitada. Nas Raízes das Ciências Sociais de Hoje", publicado em Les Temps Modernes 596 (novembro-dezembro de 1997. Para fazê-lo, recorda inicialmente o caráter relativo da oposição entre "sociedades frias" e "sociedades quentes". Em seguida, refuta a tese de que Maurice Merleau-Ponty, sob a capa de um elogio, teria dirigido críticas veladas ao autor. Finalmente, reconhecendo o afastamento da antropologia de hoje em face das posições do autor, admite, sem se pronunciar sobre o valor desse movimento, que temas de ar sartriano ressurgem nos antropólogos contemporâneos.

  6. Cuidado ao idoso deprimido e institucionalizado à luz da Complexidade

    OpenAIRE

    Cenir Gonçalves Tier; Valéria Lerch Lunardi; Silvana Sidney Costa Santos

    2008-01-01

    Instituições de Longa Permanência para Idosos (ILPI) são estabelecimentos para atendimento integral, institucionalizando pessoas de 60 anos e mais, dependentes/ou não, que não dispõem de condições para permanecer com a família ou/em seu domicílio. A institucionalização pode desencadear doenças, dentre elas a depressão. Foi objetivo deste artigo de atualização fazer uma reflexão sobre a relação do cuidado ao idoso deprimido e residente em ILPI com três princípios da Complexidade segundo Edgar ...

  7. Cuidado ao idoso deprimido e institucionalizado à luz da Complexidade

    OpenAIRE

    Tier, Cenir Gonçalves; Lunardi, Valéria Lerch; Santos, Silvana Sidney Costa

    2008-01-01

    Instituições de Longa Permanência para Idosos (ILPI) são estabelecimentos para atendimento integral, institucionalizando pessoas de 60 anos e mais, dependentes/ou não, que não dispõem de condições para permanecer com a família ou/em seu domicílio. A institucionalização pode desencadear doenças, dentre elas a depressão. Foi objetivo deste artigo de atualização fazer uma reflexão sobre a relação do cuidado ao idoso deprimido e residente em ILPI com três princípios da Complexidade segundo Edg...

  8. Empreendedorismo: do ensino básico ao ensino superior

    OpenAIRE

    Gonçalves, Vitor

    2009-01-01

    A Sociedade da Informação exige cada vez mais indivíduos com capacidade e espírito empreendedor. Embora seja visto como uma resposta ao problema do desemprego através da promoção do auto-emprego, o empreendedorismo deve assumir uma semântica mais abrangente. Não basta correr o risco e criar empresas, é necessário procurar fazê-lo com responsabilidade, competência e excelência. Mas, essa atitude empreendedora não é apenas apanágio dos gestores ou empresários, terá de ser também uma necessi...

  9. MODERNIDADE E LIBERTAÇÃO: DOIS DESAFIOS AO CRISTIANISMO

    Directory of Open Access Journals (Sweden)

    . Editorial

    1987-01-01

    Full Text Available A recente Assembléia Geral da Sociedade de Teologia e Ciências da Religião (SOTER, reunida em Belo Horizonte de 6 a 9 de julho passado, dedicou boa parte de seus trabalhos ao "debate em torno da Modernidade em relação com as preocupações da Teologia da Libertação no Brasil". Está mais uma vez relançada a sempre conflitiva questão da relação entre Cristianismo e Modernidade, só que agora percebida num Continente que não simplesmente goza de algumas luzes da Modernidade, como também sofre efeitos perversos deste processo histórico.

  10. Os ditongos do latim ao português

    Directory of Open Access Journals (Sweden)

    Quednau, Laura Rosane

    2005-01-01

    Full Text Available O presente trabalho trata da evolução dos ditongos já existentes e do surgimento de novos ditongos do latim ao português, analisando a motivação de sua redução quando esta ocorre. Para tanto, apresentamos cada ditongo separadamente, trazendo informações sobre a sua forma em latim clássico, latim vulgar e português. Além disso, tratamos de outros processos de formação de ditongos em português, uma vez que o português possui um número maior de ditongos do que o latim. Por fim, apresentamos um quadro-resumo, sintetizando as informações mais importantes do trbalho: quais ditongos permaneceram, quais foram reduzidos, quais surgiram por outros processos e quais são as causas da formação de ditongos em português

  11. Sophia, Mésseder e um Timor contado aos jovens

    OpenAIRE

    Albuquerque, Pedro; Azevedo, Fernando; Vergopolan, Roseli

    2015-01-01

    Devido a sucessivos e quase ininterruptos períodos bélicos e de ocupação, a fragilidades socioeconómicas e à ausência de um ensino sistematizado numa língua oficial, a produção literária timorense escrita revela-se bastante modesta. Apesar de a literatura timorense ter assistido ao despertar do género romanesco - sendo Luís Cardoso o mais proeminente escritor de Timor -, a invenção literária dedicada a um público mais jovem é praticamente inexistente. Ainda assim, os jovens timorenses, que tê...

  12. Induced abortion is not associated with a higher likelihood of depression in Curaçao women.

    Science.gov (United States)

    Boersma, Adriana A; van den Berg, Desirée; van Lunsen, Rik H W; Laan, Ellen T M

    2014-10-01

    To investigate the risk of developing a depression after induced abortion. A prospective cohort study conducted in Curaçao which involved 92 women having an induced abortion and 37 women delivering after an unplanned or unwanted pregnancy, who served as controls. All participants completed the Center of Epidemiological Studies Depression (CES-D) scale before and two to three weeks after the abortion or delivery. Following the abortion, significantly fewer women were at risk of depression (30%) as compared to when still pregnant (60%). Mean depression scores were significantly lower after- than before the procedure. The likelihood of depression post-abortum (30%) was similar to that after delivery of an unplanned/unwanted child (22%). Even though women in the abortion group more often reported having suffered from depression in the past than controls, they were not at greater risk of depression after their pregnancy had ended. Curaçao women's risk of developing a depression following an (early) induced abortion is not greater than that after carrying to term an unplanned/unwanted pregnancy. We recommend that the results of this study be taken into account in case the Curaçao government should consider legalisation of induced abortion in the near future.

  13. HST and Keck AO Images of Vortices on Jupiter

    Science.gov (United States)

    de Pater, Imke; Wong, M.; Luszcz-Cook, S.; Adamkovics, M.; Marcus, P.; Asay-Davis, X.; Conrad, A.; Go, C.

    2009-09-01

    Observations of Jupiter were conducted in April 2006 and May 2008 with both HST (250-890 nm) and the 10-m Keck telescope. On Keck we used the near-infrared camera NIRC2, coupled to the AO system, at 1.2 to 5 micrometers. At 5 um we are sensitive to Jupiter's thermal emission in cloud-free regions of the atmosphere, while at 1.2 um we see reflected sunlight from hazes and clouds in the troposphere-stratosphere. All small ovals (i.e., all except for Oval BA and the GRS) appear to be surrounded by bright rings at 5 mu, with typical brightness temperatures of 225-250 K, and hence probing depths to 2.5-4 bar. We argue that the small vortices are columnar structures, extending down into the water cloud. Air is rising along the center of these vortices, and descending around the outer periphery; the storm systems are likely fueled by the latent heat released from the water cloud. The descending part of the vertical circulation in the larger ovals is within the ovals, likely at the location of the red ring in Oval BA, which may indicate the maximum radial distance where such return flows can take place. On 19 July 2009, amateur observer Anthony Wesley (Australia) reported a dark spot/streak on Jupiter, near a southern latitude of 56 deg, which he attributed to an impact (analogous to the SL9 impact on Jupiter). We are scheduled to observe Jupiter with the Keck AO system on 24 July 2009 UT; if observations are successful, we will report preliminary results.

  14. Comportamento do gramado submetido aos herbicidas clethodim e sethoxydim.

    Directory of Open Access Journals (Sweden)

    Cleber D. de G. Maciel

    2007-06-01

    Full Text Available O principal fator do custo de manutenção de um gramado é o corte na altura adequada. O crescimento vegetativo e reprodutivo do gramado formado com grama-batatais (Paspalum notatum Flügge, submetido às doses de clethodim e sethoxydim foi avaliado em dois experimentos conduzidos no campus urbano da Escola Superior de Agronomia de Paraguaçu Paulista-ESAPP (SP, em gramado já estabelecido. Foi utilizado o delineamento experimental de blocos casualizados com seis tratamentos e quatro repetições, representados por clethodim nas subdoses de 0,0000; 0,0037; 0,0075; 0,0150; 0,0300 e 0,0600 kg i.a. ha-1, assim como pelo sethoxydim a 0,0000; 0,0156; 0,0312; 0,0625; 0,1250 e 0,2500 kg i.a. ha-1. O clethodim e sethoxydim, aos 7 DAA, intoxicaram as plantas a partir das doses de 0,0300 e 0,1250 kg ha-1, respectivamente. Os sintomas de intoxicação, aos 49 DAA, praticamente desapareceram para todos os tratamentos. O teor de clorofila nas folhas não apresentou diferenças significativas entre as subdoses de clethodim e sethoxydim em relação à testemunha, em nenhuma das épocas estudadas. Houve redução progressiva da altura média e no número de inflorescências do gramado em função do incremento das doses de clethodim e sethoxydim. Estes herbicidas apresentam viabilidade na redução vegetativa e reprodutiva da espécie P. notatum, sendo o sethoxydim mais seletivo em relação à preservação das características visuais do gramado

  15. Estilos de Aprendizagem versus Treinamento Vivencial ao Ar Livre

    Directory of Open Access Journals (Sweden)

    Luciano Munck

    2010-04-01

    Full Text Available O objetivo deste estudo foi analisar a relação entre estilos individuais de aprendizagem e o treinamento vivencial ao ar livre. Os treinamentos vivenciais tiveram como técnicas o arvorismo, dinâmicas de grupo e paintball. Para alimentar a análise, foram aplicados dois instrumentos de pesquisa a cento e cinco participantes dos treinamentos: o Learning Style Inventory (LSI e um questionário para identificação da satisfação. A coleta de dados foi realizada nos próprios locais de treinamento, sendo a identificação dos estilos de aprendizagem realizada antes, e a da satisfação, depois dos treinamentos. Os dados evidenciaram que o estilo de aprendizagem predominante entre os participantes da pesquisa foi o estilo acomodador(24,8%. A satisfação foi predominantemente alta, com 100% das respostas variando entre mais ou menos satisfeito e muito satisfeito (arvorismo P=0,006. Os dados da pesquisa demonstraram fraca influência dos estilos individuais de aprendizagem na maior ou menor satisfação para com os treinamentos recebidos. Em suma, concluiu-se que os treinamentos vivenciais ao ar livre possuem características que proporcionam alta satisfação para diferentes habilidades e estilos de aprendizagem. Informação essa que deveria ser levada em consideração por gestores e líderes no momento de planejar e estruturar programas de treinamento e desenvolvimento para seus colaboradores.

  16. The AO Pediatric Comprehensive Classification of Long Bone Fractures (PCCF).

    Science.gov (United States)

    Joeris, Alexander; Lutz, Nicolas; Blumenthal, Andrea; Slongo, Theddy; Audigé, Laurent

    2017-04-01

    Background and purpose - To achieve a common understanding when dealing with long bone fractures in children, the AO Pediatric Comprehensive Classification of Long Bone Fractures (AO PCCF) was introduced in 2007. As part of its final validation, we present the most relevant fracture patterns in the upper extremities of a representative population of children classified according to the PCCF. Patients and methods - We included children and adolescents (0-17 years old) diagnosed with 1 or more long bone fractures between January 2009 and December 2011 at the university hospitals in Bern and Lausanne (Switzerland). Patient charts were retrospectively reviewed and fractures were classified from standard radiographs. Results - Of 2,292 upper extremity fractures in 2,203 children and adolescents, 26% involved the humerus and 74% involved the forearm. In the humerus, 61%, and in the forearm, 80% of single distal fractures involved the metaphysis. In adolescents, single humerus fractures were more often epiphyseal and diaphyseal fractures, and among adolescents radius fractures were more often epiphyseal fractures than in other age groups. 47% of combined forearm fractures were distal metaphyseal fractures. Only 0.7% of fractures could not be classified within 1 of the child-specific fracture patterns. Of the single epiphyseal fractures, 49% were Salter-Harris type-II (SH II) fractures; of these, 94% occurred in schoolchildren and adolescents. Of the metaphyseal fractures, 58% showed an incomplete fracture pattern. 89% of incomplete fractures affected the distal radius. Of the diaphyseal fractures, 32% were greenstick fractures. 24 Monteggia fractures occurred in pre-school children and schoolchildren, and 2 occurred in adolescents. Interpretation - The pattern of pediatric fractures in the upper extremity can be comprehensively described according to the PCCF. Prospective clinical studies are needed to determine its clinical relevance for treatment decisions and

  17. The AO Pediatric Comprehensive Classification of Long Bone Fractures (PCCF).

    Science.gov (United States)

    Joeris, Alexander; Lutz, Nicolas; Blumenthal, Andrea; Slongo, Theddy; Audigé, Laurent

    2017-04-01

    Background and purpose - To achieve a common understanding when dealing with long bone fractures in children, the AO Pediatric Comprehensive Classification of Long Bone Fractures (AO PCCF) was introduced in 2007. As part of its final validation, we present the most relevant fracture patterns in the lower extremities of a representative population of children classified according to the PCCF. Patients and methods - We included patients up to the age of 17 who were diagnosed with 1 or more long bone fractures between January 2009 and December 2011 at either of 2 tertiary care university hospitals in Switzerland. Patient charts were retrospectively reviewed. Results - More lower extremity fractures occurred in boys (62%, n = 341). Of 548 fractured long bones in the lower extremity, 25% involved the femur and 75% the lower leg. The older the patients, the more combined fractures of the tibia and fibula were sustained (adolescents: 50%, 61 of 123). Salter-Harris (SH) fracture patterns represented 66% of single epiphyseal fractures (83 of 126). Overall, 74 of the 83 SH patterns occurred in the distal epiphysis. Of all the metaphyseal fractures, 74 of 79 were classified as incomplete or complete. Complete oblique spiral fractures accounted for 57% of diaphyseal fractures (120 of 211). Of all fractures, 7% (40 of 548) were classified in the category "other", including 29 fractures that were identified as toddler's fractures. 5 combined lower leg fractures were reported in the proximal metaphysis, 40 in the diaphysis, 26 in the distal metaphysis, and 8 in the distal epiphysis. Interpretation - The PCCF allows classification of lower extremity fracture patterns in the clinical setting. Re-introduction of a specific code for toddler's fractures in the PCCF should be considered.

  18. Sub-rubble communities of Curaçao and Bonaire coral reefs

    Science.gov (United States)

    Meesters, E.; Knijn, R.; Willemsen, P.; Pennartz, R.; Roebers, G.; van Soest, R. W. M.

    1991-12-01

    The distribution and abundance of sessile organisms under coral rubble has been studied at Bonaire and Curaçao, Netherlands Antilles. Species richness under rubble is extremely high with at least 367 species of which sponges, tunicates and bryozoans are the most important. Shallow sub-rubble communities can be considered refuges as the majority of these species are crypt-obligate. Sub-rubble communities may also have a preserve function for sponges, but do not harbour enough corals to ensure a quick coral recolonization of the reef surface after a major disaster. Cryptic community composition is affected by depth and pollution, and differs substantially between the two neighbouring islands, possibly as a result of different bottom characteristics. Biomass of the sub-rubble communities may contribute considerably to total reef biomass. Diversity varies inversely with increased depth and increased rubble size, possibly indicating abiotic control (e.g. physical disturbance by wave action and reef slope substrate collapse).

  19. Medicina moderna: rumo à prevenção, à cura, ao bem-estar e à longevidade

    Directory of Open Access Journals (Sweden)

    Ajai Singh

    2010-06-01

    Full Text Available A medicina moderna tem realizado muitas coisas nos campos de doenças infecciosas e de emergências para assistir a cura. Na maior parte dos outros campos, ela visa, sobretudo, ao controle, que é outro nome para o tratamento paliativo. A farmacologia, na qual se inclui a psicofarmacologia, é igualmente dirigida ao controle e ao alívio. Está na hora de profissionais da área e pesquisadores voltarem-se decisivamente para a prevenção e para a cura. Ademais, o outro grande desafio da medicina moderna é a longevidade aliada ao bem-estar. Avanços em vacinas contra hipertensão, diabetes, câncer etc. merecem atenção, bem como o papel da meditação, yoga, espiritualidade etc. na prevenção de doenças em vários níveis. Pesquisas sobre longevidade, mudanças no estilo de vida e centenários saudáveis merecem um exame especialmente minucioso na busca dos fatores que contribuem para a longevidade com bem-estar. Um olhar de perto para a medicina complementar e alternativa é necessário para encontrar modelos apropriados que esta possa vir a ter, à parte seus grandes discursos ou sua hostilidade para com o cuidado médico tradicional. A medicina é uma manifestação do Eros humano, e não deve tornar-se instrumento de seu Tanatos. Ela deve realizar seu verdadeiro potencial, de forma que Eros prevaleça, e Tanatos prevaleça apenas finalmente, não prematuramente.

  20. Atmosfera controlada associada ao 1-metilciclopropeno na preservação da qualidade de kiwi ‘tewi’

    Directory of Open Access Journals (Sweden)

    Camila Pegoraro

    2016-01-01

    Full Text Available Resumo O objetivo deste trabalho foi determinar os efeitos de diferentes tecnologias de armazenamento na qualidade físico-química de kiwis da cultivar Tewi. Após a colheita, parte dos frutos foi submetida ao tratamento com 1-metilciclopropeno (1-MCP e, posteriormente, frutos tratados e não tratados foram submetidos a diferentes condições de armazenamento, conforme segue: armazenamento em temperatura ambiente (20 °C ± 0,5 °C durante 12 dias; armazenamento refrigerado (0°C ± 0,5°C com ou sem controle da atmosfera (3 KPa O2 e 5 KPa CO2, e com ou sem absorção de etileno durante dois e quatro meses. Foram avaliadas a firmeza de polpa, o teor de sólidos solúveis e a acidez titulável. Verificou-se que, independentemente da tecnologia de conservação, houve uma diminuição na firmeza de polpa já aos dois meses de armazenamento, sendo a condição atmosfera controlada associada ao uso do 1-MCP a mais eficaz na retenção desse atributo. Frutos mantidos em temperatura ambiente apresentaram relação direta entre a redução da firmeza de polpa e o aumento do índice de sólidos solúveis; no entanto, após o armazenamento, essa relação nem sempre ocorreu. A maior acidez titulável foi verificada em frutos que receberam 1-MCP. Kiwis ‘Tewi’ apresentam bom potencial de conservação, podendo permanecer armazenados por até quatro meses em atmosfera controlada associada ao controle do etileno pelo uso de 1-MCP ou por absorção do etileno.

  1. Perfil da assistencia domiciliar generica e fisioterapeutica e cuidados paliativos a um grupo de pacientes com esclerose lateral amiotrofica

    OpenAIRE

    Nubia Maria Freire Vieira Lima

    2009-01-01

    Resumo: A Esclerose Lateral Amiotrófica (ELA) é doença degenerativa dos neurônios motores superiores e inferiores, progressiva e fatal e caracteriza-se por paralisia progressiva de membros, orofaringe e musculatura respiratória e conseqüente disfagia, disartria e insuficiência respiratória. A doença é considerada um paradigma para o cuidado paliativo não oncológico e, apesar da ausência de tratamento curativo para ELA, suas complicações podem ser abordadas sintomaticamente e por vários profis...

  2. Do gorila amestrado de taylor ao macaco de nicolelis From taylor's tamed gorilla to nicolelis' monkey

    Directory of Open Access Journals (Sweden)

    Laymert Garcia dos Santos

    2010-11-01

    Full Text Available Partindo de uma análise de Gramsci das transformações pelas quais passava o trabalhador humano no capitalismo do início do século XX, busca-se neste texto indicar aspectos de como tais processos de transformação vêm se dando no capitalismo do início do século XXI. Para isso, abordamos a transição da problemática muscular e energética da substituição do trabalhador humano pela máquina para a problemática cognitiva e informacional do controle nos acoplamentos homem-máquina. Do gorila amestrado de Taylor ao macaco de Nicolelis, mudaram as formas de subsunção do trabalhador ao capital, mas não a própria subsunção.With Gramsci's analysis of the transformations the human worker underwent in capitalism in the early 20th century as a starting point, this article seeks to point to aspects of how such transformation processes are taking place in capitalism in the early 21st century. To achieve this, we approach the transition from muscular and energetic problem of substituting human for machine labor to the cognitive and informational issue of control in the man-machine couplings. From Taylor's tamed gorilla to Nicolelis' monkey, the forms of subsumption of the worker to capital changed, but not the actual subsumption.

  3. Avaliação da testagem anti-HIV no pré-natal e na assistência ao parto no Rio de Janeiro, Brasil

    Directory of Open Access Journals (Sweden)

    Daniela Marcondes Gomes

    2015-12-01

    Full Text Available Resumo Objetivos: avaliar a testagem anti-HIV durante a assistência pré-natal e ao parto no Sistema Único de Saúde. Métodos: estudo transversal conduzido em 2009 em 15 maternidades no Rio de Janeiro, sendo entrevistada amostra representativa de 835 parturientes e observados prontuários. Para avaliação da adequação da testagem anti-HIV foi elaborado um modelo lógico. Resultados: segundo informação das parturientes, 86,7% dispunham de sorologia não reagente do pré-natal e 55,7% foram submetidas ao teste rápido anti-HIV no hospital; em 49,9% dos casos o procedimento relativo ao teste rápido anti-HIV no hospital foi considerado adequado: mães com status ignorado de HIV do pré-natal submetidas ao teste rápido e mães com status conhecido não submetidas ao mesmo. Segundo dados do prontuário, 68,0% dispunham de sorologia não reagente e 79,6% foram submetidas ao teste rápido anti-HIV; em 50,9% dos casos o procedimento relativo ao teste rápido anti- HIV no hospital foi adequado. Conclusões: o protocolo de exames anti-HIV no pré-natal e na maternidade, vigentes em 2009, não foram cumpridos a contento, tanto por gerar procedimentos desnecessários quanto falhas na testagem da população alvo, ameaçando a instituição oportuna de medidas profiláticas de controle da transmissão vertical.

  4. Duas grandes transformações ao mesmo tempo: atitudes em relação à alimentação e ao corpo em gestantes adolescentes

    OpenAIRE

    Carolina Marques Oliboni

    2014-01-01

    Introdução - Adolescência e gestação são caracterizadas por intensas transformações relacionadas ao corpo, e ocorrendo concomitantemente podem potencializar riscos para o surgimento de problemas com a imagem corporal, atitudes alimentares disfuncionais e comportamentos de risco para transtornos alimentares. Objetivo - Avaliar as atitudes em relação à alimentação, ao peso e ao corpo de um grupo de adolescentes grávidas. Métodos - Uma amostra de adolescentes grávidas (n=67) foi avaliada por mei...

  5. Decisões judiciais sobre acesso aos medicamentos em Pernambuco

    Directory of Open Access Journals (Sweden)

    Artur Stamford

    2012-10-01

    Full Text Available OBJETIVO: Analisar as decisões do sistema jurídico sobre acesso da população a medicamentos no Sistema Único de Saúde por via judicial quanto a critérios de decisão e eventuais pressões políticas e econômicas. MÉTODOS: Estudo documental descritivo e retrospectivo de abordagem qualitativa e quantitativa. A coleta de dados foi realizada na Superintendência Estadual de Assistência Farmacêutica de Pernambuco, utilizando-se como fontes de dados 105 ações judiciais e relatórios administrativos de janeiro a junho de 2009. Verificaram-se os medicamentos com pedido ou carta patente no banco de dados do Instituto Nacional de Propriedade Industrial para identificar a frequência das patentes nas ações judiciais. Os dados obtidos foram classificados conforme o Sistema Anatômico Terapêutico Químico. Para análise das decisões judiciais, foi utilizada a teoria dos sistemas sociais autopoiéticos. RESULTADOS: As ações judiciais somaram 134 medicamentos com valor estimado de R$ 4,5 milhões para atender aos tratamentos solicitados; 70,9% dos medicamentos estavam com carta patente ou pedido e se concentraram em três classes terapêuticas: antineoplásicos e moduladores imunológicos, aparelho digestório e metabolismo, órgãos dos sentidos. Foram identificadas seis ideias centrais com os critérios de decisão dos magistrados (Constituição Federal e prescrição médica e as pressões entre os sistemas do direito, da economia e da política quanto ao acesso a medicamentos. CONCLUSÕES: A análise das decisões judiciais fundamentadas na teoria dos sistemas sociais autopoiéticos permitiu identificar as estimulações mútuas (dependências entre o sistema do direito e demais sistemas sociais em relação à questão do acesso dos cidadãos aos medicamentos. Essas dependências foram representadas pela Constituição Federal e pela propriedade intelectual. A Constituição Federal e a prescrição médica foram identificadas como

  6. De fora para dentro : a agenda de enfrentamento ao tráfico de pessoas e o dilema de cidadania do trabalhador migrante no Brasil

    OpenAIRE

    de Melo (PPGDH/UnB), Vitor Coelho Camargo

    2016-01-01

    O fenômeno do tráfico de pessoas ganhou crescente atenção na cena mundial, conseguindo espaço nas agendas governamentais, na sociedade civil organizada e no debate público. Discutimos neste trabalho, primeiro, pontos de tensão referentes ao texto e ao processo de negociação do Protocolo de Palermo, destacando perspectivas que apontam para uma ideologia securitária por trás do documento, de controle da migração indocumentada e da prostituição. Discorremos, em seguida, sobre a atual estrutura d...

  7. Potencial de cruzamento natural entre o arroz transgênico resistente ao herbicida glufosinato de amônio e o arroz daninho

    OpenAIRE

    J.A. Noldin; S. Yokoyama; Antunes, P.; Luzzardi, R.

    2002-01-01

    A utilização de cultivares de arroz irrigado resistentes a herbicidas não-seletivos, como o glufosinato de amônio, pode se constituir numa alternativa de controle de arroz daninho em lavouras de arroz irrigado. O objetivo deste trabalho foi avaliar a taxa e o sentido do cruzamento natural entre plantas de uma linhagem modificada geneticamente para resistência ao herbicida glufosinato de amônio (arroz GM) e ao arroz daninho. A taxa de cruzamento natural entre o arroz GM como receptor feminino ...

  8. Linhagens de alface-crespa para o verão resistentes ao Meloidogyne javanica e ao vírus mosaico-da-alface Lineages of crisp-leaf lettuce for summer cropping resistant to Meloidogyne javanica and to Lettuce mosaic virus

    Directory of Open Access Journals (Sweden)

    Renata Rodrigues Silva

    2008-10-01

    Full Text Available O objetivo deste trabalho foi selecionar famílias F4 de alface, oriundas do cruzamento entre as cultivares Verônica e Salinas 88, para o cultivo no verão, com relação ao tipo de folha, e à resistência ao Lettuce mosaic virus (LMV e ao nematóide-das-galhas Meloidogyne javanica. Primeiramente, avaliaram-se a coloração da folha, tipos de borda e limbo foliares, além da tolerância ao calor no campo, em blocos ao acaso compostos pelas 15 famílias F4 previamente selecionadas, pelas cultivares parentais e pela cultivar testemunha Regina 71 (folhas lisas e tolerante ao calor, com cinco repetições e oito plantas por parcela. Na segunda etapa, as famílias foram avaliadas quanto à resistência ao LMV e ao nematóide-das-galhas, em bandejas de 128 células acondicionadas em estufa. As médias das notas atribuídas a cada família foram comparadas às médias de cada cultivar parental pelo teste de Dunnet (5%. A família AFX007B-140-21, homozigota resistente aos nematóides e ao LMV e, também, tolerante ao calor, foi a mais promissora. O cruzamento entre uma cultivar de folhas crespas e soltas com uma de folhas crespas e repolhuda, pode originar linhagens promissoras tanto de folhas crespas quanto de folhas lisas.The aim of this work was to select F4 lettuce families, derived from the cross 'Veronica' x 'Salinas 88 ', for summer cropping, type of leaves, and for resistance to Meloidogyne javanica and to Lettuce mosaic virus (LMV. First, evaluations were made for leaf colour, leaf limb, border type, and heat tolerance in the field, in a complete blocks desing, in 15 F4 families previously selected, parent cultivars and, as control, the cultivar Regina 71 (butterleaf and tolerant to heat. Five replicates and eight plants per plot were used. As second step, the families were evaluated in greenhouse, in 128-cell expanded polystyrene trays, for resistance to LMV and root-knot nematodes. Score means of each family were compared to the means of

  9. Efeito do sulfato de cobre e de zinco no controle da populaçao de fungos e bactérias do solo que causam intemperismo em arenitos de prédios históricos na Lapa (PR)

    OpenAIRE

    Lopes, Claudemira Vieira Gusmao; Carvalho, Francisco José Pereira de Campos, 1955-; Krieger, Nadia, 1952-

    2012-01-01

    Resumo: Estuda o efeito dos sulfatos de cobre e de zinco no controle da população de fungos e bactérias que causam intemperismo em arenitos de prédios históricos em Lapa (PR). Os objetivos específicos propostos foram identificar nos monumentos zonas de intemperismo; caracterizar a rocha por métodos físicos; identificar por métodos microbiológicos e por fotomicrografias os fungos e as bactérias heterotúpicos na rocha que potencialmente podem contribuir com o intemperismo; levantar as caracterí...

  10. Controlling

    OpenAIRE

    Tůmová, Jana

    2009-01-01

    The diploma thesis focuses on the problems of operational controllership and the instruments used for their solution. In connection with these issues the thesis also defines the role of the controller, in particular his authorities and responsibilities. The theoretical part of the work looks at the academic conception of controlleship. The practical part describes the main functions, duties, activities and the system of cooperation in between controllership and other departments in particular...

  11. Estudo do comportamento da aderência e do conforto ao rolamento em pistas de pouso e decolagem

    Directory of Open Access Journals (Sweden)

    Francisco de Oliveira

    2016-09-01

    Full Text Available Este artigo analisa as relações existentes entre a aderência e o conforto ao rolamento em pistas de pouso e decolagem. Por intermédio dos dados de macrotextura, de coeficiente de atrito e do índice de irregularidade internacional, obtidos entre 2013 e 2014 no Aeroporto Internacional de Fortaleza, foi possível comparar esses parâmetros e suas alterações ao longo da pista. As análises foram efetuadas com base na literatura técnico-científica e nas exigências normativas da Organização da Aviação Civil Internacional e da Agência Nacional de Aviação Civil. Verifica-se que em alguns trechos da pista em estudo, sobretudo no segmento central, o comportamento entre os parâmetros analisados apresenta tendência divergente. Com esta análise, espera-se contribuir para o incremento da segurança das operações de pousos e decolagens, especialmente na resistência à derrapagem, no controle direcional e no conforto ao rolamento das aeronaves.

  12. Adesão ao tratamento anti-hipertensivo: análise pelo Teste de Morisky-Green*

    Directory of Open Access Journals (Sweden)

    Letícia Palota Eid

    2013-06-01

    Full Text Available Considerando que a adesão ao tratamento é um desafio para o controle da hipertensão arterial sistêmica (HAS, este estudo teve como objetivo caracterizar os sujeitos da pesquisa segundo as variáveis sóciodemograficas e econômicas e avaliar o nível de adesão pelo Teste de Morisky-Green. Trata-se de estudo descritivo transversal de abordagem quantitativa, realizado com 90 hipertensos em um Centro de Saúde. O instrumento utilizado para coleta de dados foi o Teste de Morisky-Green (TMG. Os resultados mostraram que 63,0% da amostra eram mulheres e a média de idade foi de 66 anos, sendo que 72,2% não apresentaram adesão ao tratamento medicamentoso, corroborando pesquisas realizadas sobre adesão. Conclui-se que este estudo pode proporcionar subsídios para intervenções sobre a assistência aos pacientes com HAS, com a finalidade de aumentar as taxas de adesão e a qualidade de vida.

  13. Controlled short-circuiting MIG-MAG welding process and procedures applied to the root pass in pipeline construction; Processo de soldagem MIG/MAG em curto-circuito controlado e procedimentos aplicados ao passe de raiz na construcao de linhas dutoviarias

    Energy Technology Data Exchange (ETDEWEB)

    Silva, Regis H.G. e; Gohr Junior, Raul; Weck, Leonardo W.A. [Santa Catarina Univ., Florianopolis, SC (Brazil). Dept. de Engenharia Mecanica. Lab. de Soldagem e Mecatronica (LABSOLDA)

    2005-07-01

    The work deals with the study and development of the Controlled Short-Circuiting MIG/MAG Welding Process (CCC) and procedures for the root pass on pipes, in pipelines construction. The developed process (CCC) consists in an semi-automatic slag free operation, yielding higher productivity than the Coated Electrode and TIG processes, with satisfactory properties on the root weld. The significant influence of the welding over the time schedule and construction cost makes the development of this technology attractive, in order to become available at low cost, enhancing the companies' competitiveness in the globalized oil sector. The developed system, a MIG/MAG variant, features the advantages of short-circuiting metal transfer and avoids its inconveniences (mainly with high CO{sub 2} content gases), enabling its use on pipes root welding. This is possible through current waveform control, providing process and weld pool stability. Procedures for the root pass were determined for each of the welding positions reached in thick walled pipes welding, with the CCC. Also, the low welder training time was notable. (author)

  14. RETORNO AO ESPORTE APÓS ARTROPLASTIA TOTAL DO JOELHO: REVISÃO SISTEMÁTICA

    Directory of Open Access Journals (Sweden)

    Pedro Baches Jorge

    Full Text Available RESUMO Esta revisão sistemática da literatura teve como objetivo analisar as variáveis envolvidas no retorno às atividades esportivas em pacientes submetidos à artroplastia total do joelho (ATJ, verificar o tipo de esporte recomendado, o tempo de retorno ao esporte, a satisfação do paciente e o nível de atividade física após a cirurgia. Os estudos relacionados com a prática de atividade física e desportiva depois da ATJ foram selecionados por dois revisores independentes. Foram incluídos 11 estudos (10 transversais retrospectivos e um caso-controle. A maioria dos pacientes que participou de alguma atividade física regular antes da ATJ retornou à prática esportiva após a cirurgia, sendo mais comuns os esportes de baixo impacto como caminhada, esportes aquáticos, golfe, bicicleta estacionária, entre outros. Foi possível observar que o nível de atividade física não depende da dor e dos sintomas pós-operatórios, mas da satisfação com a cirurgia, motivação e capacidade funcional dos indivíduos. O tempo de retorno ao esporte variou de seis a 18 meses depois da ATJ. Apesar de alguns estudos mostrarem que os cirurgiões não recomendam a prática de esportes de alto impacto após a cirurgia, alguns estudos mostraram bons resultados, desde que o nível de atividade prévio à cirurgia, a população adequada e a expectativa do paciente no pós-operatório sejam considerados. Assim, conclui-se que o retorno ao esporte após ATJ não só é possível, como é recomendado em níveis recreativos, e um paciente colaborativo, instruído e com preparo adequado de condicionamento físico pode melhorar tanto no nível funcional e cardiovascular quanto no psicológico, com aumento da autoestima e da qualidade de vida. Há ainda a necessidade de estudos futuros, de boa qualidade metodológica como os ensaios clínicos randomizados, sobre os efeitos (benefícios e prejuízos dos esportes de alto impacto para os pacientes submetidos

  15. Robo-AO KP: A new era in robotic adaptive optics

    Science.gov (United States)

    Riddle, Reed L.; Baranec, Christoph; Law, Nicholas M.; Kulkarni, Shrinivas R.; Duev, Dmitry; Ziegler, Carl; Jensen-Clem, Rebecca M.; Atkinson, Dani Eleanor; Tanner, Angelle M.; Zhang, Celia; Ray, Amy

    2016-01-01

    Robo-AO is the first and only fully automated adaptive optics laser guide star AO instrument. It was developed as an instrument for 1-3m robotic telescopes, in order to take advantage of their availability to pursue large survey programs and target of opportunity observations that aren't possible with other AO systems. Robo-AO is currently the most efficient AO system in existence, and it can achieve an observation rate of 20+ science targets per hour. In more than three years of operations at Palomar Observatory, it has been quite successful, producing technology that is being adapted by other AO systems and robotic telescope projects, as well as several high impact scientific publications. Now, Robo-AO has been selected to take over operation of the Kitt Peak National Observatory 2.1m telescope. This will give Robo-AO KP the opportunity to pursue multiple science programs consisting of several thousand targets each during the three years it will be on the telescope. One-sixth of the observing time will be allocated to the US community through the NOAO TAC process. This presentation will discuss the process adapting Robo-AO to the KPNO 2.1m telescope, the plans for integration and initial operations, and the science operations and programs to be pursued.

  16. COMO ENTENDER E ATENDER AOS DIREITOS DAS MINORIAS?

    Directory of Open Access Journals (Sweden)

    Maria Cristina Alves Delgado de Ávila

    2014-05-01

    Full Text Available No âmbito do Estado Democrático de Direito, um Governo representa a maioria. Conforme os ditames da Constituição Federal de 1988 – CRFB/88 -, a maioria pode organizar-se e decidir sobre os assuntos públicos de um determinado Estado. Dentro da idéia de maioria, tem-se o grupo que, em certo momento, encontra-se no poder com o direito de liderar os demais indivíduos ocupantes de um território. A minoria é o oposto. Para garantir a harmonia social, a maioria não tem o direito de oprimir a minoria e não deve retirar os direitos e as liberdades fundamentais de um grupo minoritário ou mesmo de um indivíduo. Ao contrário, a maioria deve garantir o pluralismo cultural de um povo dentro de um território. Partindo da hermenêutica dos direitos das minorias, pretende-se responder a pergunta como entender e atender a estes direitos.

  17. Subsunção do trabalho imaterial ao capital

    Directory of Open Access Journals (Sweden)

    Eleutério F. S. Prado

    Full Text Available O presente artigo examina a transformação do modo de produção capitalista que acompanha a expansão do trabalho imaterial como fonte de geração de riqueza efetiva. Essa avaliação é feita no interior da teoria do valor-trabalho e da crítica da economia política. Para tanto, interroga, primeiro, o verdadeiro impacto da informatização na natureza capitalista dos processos produtivos atualmente em andamento, principalmente nos países centrais. Compara, depois, as principais características da indústria taylorista com as características marcantes da indústria pós-taylorista. Ao final, conclui que uma transformação importante do sistema capitalista está em curso: a grande indústria, tal como foi caracterizada por Marx em O Capital, não predomina mais nos países do centro do sistema, pois o que aí prevalece agora é a pós-grande indústria.

  18. Touraine, Burawoy, Gramsci: do social ao político

    Directory of Open Access Journals (Sweden)

    Leonardo Mello e Silva

    Full Text Available O ensaio empreende uma discussão da proposta da sociologia pública de Michael Burawoy, nos anos 2000, a partir da confrontação com a intervenção sociológica de Alain Touraine, formulada nos anos 1970. Pontos de contato são detectados no que diz respeito à relação entre pesquisador e pesquisado, como atores sociais. Problemas e limitações, tanto da intervenção sociológica quanto da sociologia pública, são elencados, trazendo-se como apoio exemplos extraídos de trabalho de campo próprio. O texto vale-se também da inspiração de Antonio Gramsci e sua concepção da relação entre senso comum e intelectuais. Ao invés de um juízo conclusivo, propõe-se um diálogo entre os autores, todos preocupados, à sua maneira, com o destino público ou cívico do conhecimento obtido sobre o mundo social.

  19. Imigrantes ou refugiados? As tecnologias de governamentalidade e o êxodo palestino rumo ao Brasil no século XX

    Directory of Open Access Journals (Sweden)

    Denise F. Jardim

    Full Text Available Resumo Este artigo pretende analisar os dispositivos de governamentalidade da proteção internacional do refúgio e das imigrações. Indago sobre o modo como categorizamos e diferenciamos os imigrantes de refugiados no marco de políticas internacionais de proteção que incidiram sobre os palestinos que tiveram que organizar sua evasão das cidades palestinas a partir de 1948. Explicito os modos como tecnologias de controle migratório têm sido pensadas por cientistas sociais a partir do exame de seus usos e transformações diante de situações de fronteira e atentos à transformação do estatuto jurídico das pessoas em deslocamento. O foco dessa reflexão reside em demonstrar o modo como dispositivos diversos interatuam: leis, documentos e procedimentos administrativos através de agentes da burocracia que corporificam o Estado. Para tanto, examino o modo como tecnologias de governamentalidade da imigração interferiram nas escolhas de palestinos no momento em que vivenciaram o êxodo. Tais aspectos estão entrelaçados ao surgimento de um sistema de proteção internacional e ao surgimento de agências humanitárias com mandatos regionais, como a United Nations Relif and Works Agency for Palestine Refugees in the Near East (UNRWA, anterior ao surgimento do Alto Comissariado das Nações Unidas (ACNUR após a convenção de 1951 relativa ao reconhecimento e proteção de refugiados.

  20. ROTEIRO DE VIAGEM AO PAÍS DE LACAN

    Directory of Open Access Journals (Sweden)

    Laéria Fontenele

    2015-12-01

    Full Text Available Grande leitor e crítico da cultura de seu tempo e um dos nomes de maior destaque da psicanálise contemporânea, Slavoj Žižek desfaz a fábula segundo a qual ler Lacan é um trabalho árduo e difícil que seria apenas privilégio dos especialistas em psicanálise e, com isso, brinda o seu leitor com um envolvente passeio pelo país de Lacan. De origem eslovena, e quase eleito presidente de seu país, Slavoj Žižek é autor de diversos livros - dentre os quais os instigantes ensaios “Hegel, o mais sublime dos histéricos” e “Eles não sabem o que dizem” -, a maioria publicada em por volta de trinta idiomas. É ele reconhecido como sendo um profundo conhecedor de Hegel e Karl Marx; apaixonado leitor de Sigmund Freud e de Jacques Lacan; crítico contundente das ideologias totalitárias, espírito cultivado por sua filia às múltiplas artes – sendo, inclusive, especialista na cinematografia de Alfred Hitchcock. Os traços de sua erudição e sensibilidade para com as artes, se refletem e particularizam, também, o seu estilo de escrever, o qual se encontra muito bem representado no modo como urdiu esse seu novo livro. “Como ler Lacan” nos ensina a adotar um método especial para orientar em uma tal empreitada. Žižek advoga que, para lermos Lacan, devemos aplicar o mesmo método empregado pela psicanálise para ler e interpretar o texto que resulta do trabalho inconsciente. Mas há uma condição para esse emprego: abandonar o vício de querer entender, pois, assim como o inconsciente, Lacan não deve ser compreendido e sim lido, pois, conforme ele mesmo já nos advertira, o pior destino a que podemos ser conduzidos é o destino que nos leva à compreensão. Só assim será fácil ler Lacan, mais do que, amiúde, se imagina. Muitas introduções ao seu ensino foram publicadas, algumas delas marcadas por rigor conceitual, outras resultaram em versões grosseiras de sua letra. Sem desmerecer as boas introduções a Lacan

  1. Potencial do óleo de Aloysia citriodora Palau no controle de fitopatógenos e na indução de resistência ao tombamento de plântulas de feijão, pepino e beterraba

    OpenAIRE

    Freddo, Álvaro Rodrigo

    2015-01-01

    Os cultivos agrícolas são acometidos por pragas e doenças que diminuem sua produtividade. Dentre as doenças está o tombamento de plântulas que pode ocorrer em pré e pós-emergência. Nas culturas de feijão, pepino e beterraba o tombamento é ocasionado por diversos patógenos, mas principalmente por fungos fitopatogênicos. Várias medidas são utilizadas para o controle deste tipo de doenças e dentre estas, está o tratamento de sementes com fungicidas químicos. No entanto, a sociedade tem cada vez ...

  2. INTRODUÇAO AOS MODELOS ODE PARTICIPAÇÃO DE MERCADO EM SERVIÇOS DE TRANSPORTES

    Directory of Open Access Journals (Sweden)

    Antonio Galvão Novaes

    2010-04-01

    Full Text Available

    Análises de participação de mercado ("market share" são comuns em estudos na área de "marketing", envolvendo produtos e respectivas marcas, de um lado, o perfil da demanda de outro, e o posicionamento das empresas produtoras que competem nesse mercado, num terceiro bloco. No setor de transportes a literatura registra aplicações em ligações aéreas e em serviços intermunicipais de ônibus. Os modelos de participação de mercado se aplicam normalmente a situações em que os operadores oferecem serviços de transportes similares num determinado mercado, com a competição sendo feita não com base em atributos modais intrínsecos, mas sim apoiada em características diferenciadoras intra-modais mais tênues, tais como conforto, atendimento, promoções tarifárias, "marketing" e propaganda, etc. Neste artigo é feita uma introdução aos modelos de "market share" em transportes, com a apresentação de um exemplo de aplicação ao transporte intermunicipal de passageiros em ônibus, sendo discutidos também aspectos ligados a calibração e tais modelos.

    ABSTRACT

    Market share analysis is common in marketing studies involving products and respective brands, on one hand, the demand profile on the other hand, and the competiting industries on a third set. In the transport sector the literature registers a number of applications to air transport problems and to intercity bus services. Market share models are normally applied to situations in which operators offer, in a specific market, transport services that are similar in nature, with competition based not on intrinsic modal attributes, but rather on more tenous intra-mode differentiating characteristics, such as comfort, attendance, tariff promotions, marketing and advertising efforts, etc (sub-modal configurations. It is presented in this paper an introduction to market share modelling in transport, with an example concerning an intercity bus service in

  3. Sobrepeso e obesidade e fatores associados ao climatério

    Directory of Open Access Journals (Sweden)

    Jaqueline Teixeira Teles Gonçalves

    2016-04-01

    Full Text Available Resumo O objetivo deste estudo é verificar a associação entre sobrepeso e obesidade e fatores sociodemográficos, comportamentais e clínicos em mulheres climatéricas. Estudo transversal, com amostra de 253 mulheres climatéricas, que responderam questões sobre fatores socioeconômicos e demográficos, saúde geral, hábitos alimentares e comportamentais. Para a avaliação do estado nutricional, foi utilizado índice de massa corpórea (IMC. Para avaliação da qualidade de vida foi utilizado a Menopause Rating Scale (MRS. Empregou-se o Quociente Sexual (QS-F-Versão Feminina para a avaliação do desempenho sexual. Utilizou-se análise bivariada e regressão múltipla hierarquizada para identificar fatores associados ao sobrepeso e à obesidade no climatério. Pela análise do IMC, 30,8% apresentaram sobrepeso e 35,2%, obesidade, totalizando 66% de excesso de peso. Na análise múltipla, não possuir casa própria, gravidade de sintomas pela avaliação do MRS, uso de medicamento de forma contínua e ter feito algum tipo de dieta apresentaram associação com sobrepeso e obesidade. Intervenção nutricional, visando ao controle de peso e mudanças de hábitos de vida, poderá resultar em benefícios consideráveis relativos à saúde e qualidade de vida das mulheres climatéricas.

  4. PERIGOS ASSOCIADOS AO CONSUMO DA ALFACE, (Lactuca sativa, IN NATURA

    Directory of Open Access Journals (Sweden)

    A. D. I. MOGHARBEL

    2008-09-01

    Full Text Available

    A prevenção de riscos de contaminação por agentes patogênicos em folhas de alface passa pelas boas práticas agrícolas que vai desde a semeadura até a colheita além de outros importantes aspectos, ainda no processo do cultivar, como qualidade da água usada para irrigação, emprego de práticas sanitárias adequadas pelos produtores na manipulação das plantas e higiene do agricultor no campo. Manter a segurança de contaminação bacteriana de frutas e de vegetais frescos requer um conhecimento de sistemas que abranja todos os aspectos da produção, do processamento, da distribuição e do uso. A orientação aos consumidores quanto aos cuidados no armazenamento e na manipulação apropriados do produto fresco, deve ser incentivada pelas autoridades sanitárias, como forma de se evitar doenças veiculadas pelos alimentos. Desta forma, a proteção de contaminantes patológicos em vegetais frescos, visando a proteção tanto do produtor como do consumidor, vão de encontro a algumas práticas similares do sistema APPCC, onde se projetam atributos de limitação, controle, e monitoramento das fontes de contato na produção dos vegetais.

  5. Das portarias aos bloquinhos: arte e apoio institucional ao Projeto Mais Médicos para o Brasil

    Directory of Open Access Journals (Sweden)

    Heloísa Germany

    Full Text Available Este ensaio apresenta experiências vivenciadas por uma artista visual integrante da equipe de Apoio Institucional do Ministério da Educação para o Projeto Mais Médicos para o Brasil (PMMB, uma proposta interministerial que aproxima de forma significativa processos de trabalho e formação relacionados à saúde e à educação. Por meio do que Roland Barthes chama de obtuso e por meio de uma metodologia hifográfica, investe-se na leveza e reinvenção de ações no campo da Saúde Coletiva na interface das artes como processos educativos sensíveis experimentados ao longo de dois anos junto com o PMMB. Por meio de pequenos blocos de anotações produzidos individualmente e por um coletivo de apoiadores, delineia-se um processo singular e sensível, contribuindo na discussão sobre o fortalecimento das coletividades, das redes de Atenção Básica, da formação para o Sistema Único de Saúde e da composição de olhares poético-políticos acerca do PMMB.

  6. Um conceito reinterpretado ao longo do século: do intelectual individualista de Durkheim ao intelectual coletivo de Bourdieu

    Directory of Open Access Journals (Sweden)

    Ione Ribeiro Valle

    2017-10-01

    Full Text Available Para contribuir com o debate sobre os intelectuais recorremos a dois sociólogos, distanciados um do outro cerca de um século: Émile Durkheim (1858-1917 e Pierre Bourdieu (1930-2002. O primeiro preconiza a relação entre uma “moral individualista” e o papel do intelectual. Esta reflexão integra o conjunto de suas apostas na coesão social e na moral laica, indispensáveis à promoção do progresso e da ordem nas sociedades em processo crescente de diferenciação. A perspectiva de Bourdieu volta-se à necessidade de “reinventar uma espécie de intelectual coletivo segundo o modelo do que foram os enciclopedistas”. Segundo ele, um novo desafio se impõe ao intelectual coletivo: mobilizar a ciência, e a sociologia em particular, na luta contra os usos abusivos da própria ciência e da autoridade científica. As ideias destes pensadores oferecem chaves de leitura que inspiram o desenvolvimento de uma sociologia histórica voltada à educação no pensamento social brasileiro.

  7. Avaliação longitudinal da atividade proliferativa em mucosa bucal humana clinicamente saudável exposta ao fumo e ao álcool por meio da técnica de AgNOR

    OpenAIRE

    Luhana Gedoz

    2005-01-01

    OBJETIVO: Avaliar a velocidade de proliferação celular em mucosa bucal clinicamente normal exposta aos carcinógenos do fumo e do álcool, por meio da citopatologia associada a técnica de AgNOR, em um período de 24 meses. METODOLOGIA: Foram avaliados no exame inicial 60 indivíduos, 17 controles (grupo 1), 25 fumantes (grupo 2) e 18 fumantes e etlistas (grupo 3). Na avaliação longitudinal, realizada 24 meses depois, foram reavaliados 52 individuos, 15 no grupo 1, 23 no grupo 2 e 14 no grupo 3. O...

  8. Biomassa microbiana em amostras de solos secadas ao ar e reumedecidas Microbial biomass in air dried and rewetted soil samples

    Directory of Open Access Journals (Sweden)

    Antônio Samarão Gonçalves

    2002-05-01

    Full Text Available O objetivo do trabalho foi avaliar a viabilidade do condicionamento de amostras como terra fina secada ao ar (TFSA por curto período, para a determinação do carbono da biomassa microbiana (BMS-C, pelo método da fumigaçãoextração, e verificar a respiração microbiana basal (RB do solo. O condicionamento como TFSA, procedendo-se à fumigação para a análise da BMS-C imediatamente ou 24 horas após o reumedecimento, proporcionou valores de BMS-C para os solos Podzólicos, Latossolo Vermelho-Amarelo álico e Orgânico, semelhantes aos valores dos seus controles. Os solos Glei Pouco Húmico e Vertissolo apresentaram valores de BMS-C similares aos do controle a partir de 24 horas de incubação; o solo Planossolo arenoso apresentou valores similares aos do controle com 72 horas, e a Rendizina, com 168 horas de incubação. Na maioria dos solos, a RB determinada na TFSA apresentou valores maiores do que os do tratamento-controle, quando avaliada imediatamente ou 24 horas após o reumedecimento a 60% da capacidade máxima de retenção de água, seguida de queda e manutenção em níveis semelhantes ao do controle nos períodos subseqüentes. O précondicionamento, de curta duração, como TFSA, é promissor para a determinação da BMS-C, quando níveis e períodos adequados de reumedecimento são adotados.The objective of this work was to evaluate the utilization of short term air dried soil samples in a determination of soil microbial biomass (SMB-C, by a fumigationextraction method, and soil microbial basal respiration (BR. Zero time or 24 hours rewetting incubation period before fumigation procedure gave values of SMB-C similar to those of the control for the Podzolic soils, Allic RedYellow Latosol and Organic soil. Low Humic Gley and Vertisol soils gave values of SMB-C similar to those of the control for periods of incubation equal or higher than 24 hours. Planosol (sandy soil and Rendzina soils gave values of SMB-C similar to the

  9. Da Ruptura ao Acontecimento: Bachelard, Canguilhem e Foucault

    Directory of Open Access Journals (Sweden)

    Gabriela Menezes Jaquet

    2017-02-01

    Full Text Available Este artigo tem por objetivo propor uma problematização da concepção de acontecimento tal como é pensada, em seus contornos gerais, na filosofia francesa contemporânea e, mais especificamente, pela história da ciência. Nosso enfoque será a compreensão das abordagens de Gaston Bachelard, Georges Canguilhem e Michel Foucault principalmente no que tange às noções de ruptura epistemológica e de ideologia científica em sua articulação com as características do acontecimento pensado por Foucault, partimos, portanto, de concepções de história que, apesar das concordâncias, também acabam por se diferenciar: uma, a história descontinuísta das rupturas epistemológicas, outra, a história arqueológica dos acontecimentos. Para explicarmos a diferença deste nível acontecimental, será necessário compreendermos a visada singular de Foucault em relação à ciência, que é questionada (e criticada de forma a atentar para outro nível: o do saber que aqui exploraremos a partir do conceito de limiar. Igualmente quanto ao estatuto de científico, abordaremos o posicionamento crítico de Canguilhem em relação à Bachelard sobre os desdobramentos de uma razão pensada historicamente, através de sua história dos conceitos. Tendo em vista estas considerações poderemos compreender não só a especificidade do trabalho de cada um destes autores, mas visualizar o que a categoria de acontecimento pôde, via Foucault, trazer de novo para a história da ciência.

  10. As hérnias medem-se aos palmos?

    Directory of Open Access Journals (Sweden)

    Cátia Pereira

    2016-06-01

    Full Text Available Apresenta-se o caso de uma doente do sexo feminino com 74 anos, autónoma, com antecedentes patológicos de obesidade, diabetes mellitus tipo 2, hipertensão arterial e doença osteoarticular degenerativa, que recorreu à urgência por infeção respiratória inferior. Negava sintomas gastrointestinais ou antecedentes cirúrgicos. Ao exame objetivo, destacava-se a presença de uma hérnia umbilical volumosa não dolorosa à palpação, mas que condicionava a sua mobilidade, sendo impossível a redução do conteúdo herniário. Após insistência na anamnese, a doente referiu o seu aparecimento na infância, na altura com recusa em efetuar a sua correção cirúrgica, tendo sido perdido o seu seguimento posteriormente. A radiografia e a tomografia computorizada abdominais mostraram um colo herniário de seis centímetros de diâmetro e herniação de praticamente todo o intestino delgado e parte do cólon, sem evidência de encarceramento (Figuras 1 e 2. Apesar de décadas de evolução condicionarem um progressivo e forte impacto nas atividades da vida diária, a doente não procurou os cuidados de saúde por esse motivo, mantendo a sua decisão e sendo encaminhada para a consulta externa. As complicações herniárias abdominais incluem a obstrução intestinal e a temida emergência cirúrgica da hérnia encarcerada, não se desprezando a morbilidade inerente, bem evidente neste caso.1-2

  11. O sindicalismo mineiro frente aos desafios dos anos 90

    Directory of Open Access Journals (Sweden)

    Antônio Carvalho Neto

    2000-12-01

    Full Text Available O que se analisa neste artigo é como os sindicatos dos bancários, metalúrgicos e trabalhadores em telecomunicações têm negociado o (desemprego, a demanda por qualificação e a remuneração variável. Foram tabuladas/analisadas 3.569 cláusulas de acordos coletivos, e realizadas 26 entrevistas com dirigentes sindicais e empresariais em três Estados (RJ, SP e MG. Os resultados indicam que as mudanças organizacionais foram incomparavelmente mais negociadas no setor metalúrgico do ABC. A flexibilização da jornada foi trocada pela redução (da jornada sem redução de salário nos setores metalúrgicos paulistas, mas não em Minas Gerais. No setor bancário, houve poucos resultados nas negociações sobre jornada. As negociações em torno da remuneração variável vinculada às metas das empresas aconteceram nos setores metalúrgicos, e não nos setores de serviços. As entrevistas apontam para um sindicalismo mais propositivo, no sentido de uma intervenção negociada, predisposição que não é correspondida pelos empresários, grosso modo. O Estado, que poderia utilizar seu poder regulador para induzir os empresários a negociarem nessa direção não tem produzido resultados satisfatórios. Conclui-se que não há maturidade empresarial no Brasil que permita ao Estado ausentar-se das relações de trabalho.

  12. Suscetibilidade de Oligonychus yothersi (Acari: Tetranychidae ao fungo Beauveria bassiana

    Directory of Open Access Journals (Sweden)

    Oliveira Renato Cassol de

    2002-01-01

    Full Text Available A cultura da erva-mate (Ilex paraguariensis é uma importante atividade econômica no Sul do Brasil. Com o aumento de consumo nos anos oitenta, cresceram também as áreas de monocultura, gerando condições favoráveis para o aumento populacional de insetos e ácaros fitófagos, entre eles o ácaro vermelho Oligonychus yothersi. Este estudo avaliou a suscetibilidade do ácaro vermelho O. yothersi a vários isolados do fungo Beauveria bassiana. O experimento foi conduzido em Cascavel, PR. Discos foliares de erva-mate (2,2 cm² foram previamente infestados com 20 fêmeas adultas. Alíquotas de 1 mL de cada suspensão de conídios dos diferentes isolados de B. bassiana, ajustadas na concentração de 1,0x10(8 conídios mL-1 foram pulverizadas, separadamente, sobre um conjunto de 5 discos. Os discos foliares foram mantidos flutuando em água destilada, em caixas plásticas (3 cm de diâmetro, sob condições controladas. Diariamente, os ácaros mortos foram transferidos para câmara úmida, para confirmação de mortalidade causada pelo fungo. A mortalidade total variou entre 77 e 98% (6 dias após a aplicação, não permitindo diferenciar os isolados quanto à virulência (P>0,05. Já a mortalidade confirmada variou entre 19 e 75%, permitindo diferenciá-los (P<0,05. O ácaro vermelho O. yothersi foi suscetível, em diferentes níveis, aos isolados de B. bassiana testados.

  13. Human Reliability Analysis for Digitized Nuclear Power Plants: Case Study on the LingAo II Nuclear Power Plant

    Directory of Open Access Journals (Sweden)

    Yanhua Zou

    2017-03-01

    Full Text Available The main control room (MCR in advanced nuclear power plants (NPPs has changed from analog to digital control system (DCS. Operation and control have become more automated, centralized, and accurate due to the digitalization of NPPs, which has improved the efficiency and security of the system. New issues associated with human reliability inevitably arise due to the adoption of new accident procedures and digitalization of main control rooms in NPPs. The LingAo II NPP is the first digital NPP in China to apply the state-oriented procedure. In order to address issues related to human reliability analysis for DCS and DCS + state-oriented procedure, the Hunan Institute of Technology conducted a research project based on a cooperative agreement with the LingDong Nuclear Power Co. Ltd. This paper is a brief introduction to the project.

  14. Contribuição ao conhecimento do "bicho bôlo", praga da batatinha

    Directory of Open Access Journals (Sweden)

    O. J. Boock

    1952-03-01

    Full Text Available Os tubérculos de batatinha provenientes de culturas feitas em terras marginais ao rio Paraíba, ricas em matéria orgânica, vêm sendo corroídos pelas larvas de um coleóptero denominadas "bicho bôlo", inutilizando grande parte da produção. Foi identificado como pertencente à família Seara-bseidae - Dyscinetus planatus (Burm., 1847 -. Constatações feitas pela Secção de Raízes e Tubérculos do Instituto Agronômico, em experiências de variedades, revelaram, em alguns casos, até 44% de ataque, como, por exemplo, o ocorrido em julho de 1951, na variedade "Krasava". Larvas coligidas em São José dos Campos, foram trazidas para o laboratório, juntamente com o solo da região, continuando a se nutrir e sofrendo metamorfose, Estas, de hábitos lucífugos, medem, quando adultas, cêrca de 35 mm de comprimento, e a largura ao meio do corpo, oscila ao redor de 9 mm, apresentando-se quase sempre recurvadas em forma de U. A pupa mede 21 mm de comprimento e, sob as condições de laboratório, o período pupal foi de 20 e 24 dias, Como inimigo natural, foi observado um fungo imperfeito, cuja identificação não foi ainda possível obter, chegando a destruir, em laboratório, mais de 90% dos lotes de larvas, atacando, também, as pupas e os adultos. Constatou-se ainda, em adultos mortos, a presença de grande número de ácaros, de espécie ainda não determinada. Resultados preliminares, de combate ao ''bicho bôlo" com "Gesarol .P", em doses baixas - 1.400, 2.150 e 2.800 gramas por hectare - não influíram sôbre a redução do ataque.Tubers of Irish potato Solanum tuberosum L. - harvested in soil rich in organic matter along the Paraiba river in the State of São Paulo, are severely damaged by a Coleopterus larva - Scarabxidas - Dyscinetus planatus (Burm., 1847, known by the local name of "bicho bôlo". Potato tubers from eight commercial varieties harvested in trials carried out in the Taubaté region were examined in order to verify

  15. Patterns of Impairments in AOS and Mechanisms of Interaction between Phonological and Phonetic Encoding

    Science.gov (United States)

    Laganaro, Marina

    2012-01-01

    Purpose: One reason why the diagnosis of apraxia of speech (AOS) and its underlying impairment are often debated may lie in the fact that most patients do not display pure patterns of AOS. Mixed patterns are clearly acknowledged at other levels of impairment (e.g., lexical-semantic and lexical-phonological), and they have contributed to debate…

  16. SCExAO as a precursor to an ELT exoplanet direct imaging instrument

    Science.gov (United States)

    Jovanovic, Nemanja; Guyon, Olivier; Martinache, Frantz; Clergeon, Christophe; Singh, Garima; Vievard, Sebastien; Kudo, Tomoyuki; Garrel, Vincent; Norris, Barnaby; Tuthill, Peter; Stewart, Paul; Huby, Elsa; Perrin, Guy; Lacour, Sylvestre

    2013-12-01

    The Subaru Coronagraphic Extreme AO (SCExAO) instrument consists of a high performance Phase Induced Amplitude Apodisation (PIAA) coronagraph combined with an extreme Adaptive Optics (AO) system operating in the near-infrared (H band). The extreme AO system driven by the 2000 element deformable mirror will allow for Strehl ratios>90% to be achieved in the H-band when it goes closed loop. This makes the SCExAO instrument a powerful platform for high contrast imaging down to angular separations of the order of 1 lambda/D and an ideal testbed for exploring coronagraphic techniques for ELTs. In this paper we report on the recent progress in regards to the development of the instrument, which includes the addition of a visible bench that makes use of the light at shorter wavelengths not currently utilized by SCExAO and closing the loop on the tip/tilt wavefront sensor. We will also discuss several exciting guest instruments which will expand the capabilities of SCExAO over the next few years; namely CHARIS which is a integral field spectrograph as well as VAMPIRES, a visible aperture masking experiment based on polarimetric analysis of circumstellar disks. In addition we will elucidate the unique role extreme AO systems will play in enabling high precision radial velocity spectroscopy for the detection of small companions.

  17. The nature of ethnic identity among the people of Curaçao

    NARCIS (Netherlands)

    Dijs, N.M. van der

    2011-01-01

    This qualitative research explores the nature of ethnic identity among the people of Curaçao. The questions that are of fundamental interest to this study are: how do the people of Curaçao perceive themselves ethnically, how do they experience their sense of belonging to an ethnic group and what

  18. About the malacological subdivision of Curaçao; a review

    NARCIS (Netherlands)

    Wagenaar Hummelinck, P.

    1990-01-01

    Burrington Baker (1924) states that Curaçao can be divided into three distinct faunal areas. Stock (1977) mentions the occurrence of three subspecies of hadziid amphipods almost exclusively confined to different parts of Curaçao. The results of a study of the distribution on this island of various

  19. Use of AO PSF models for the Study of Resolved Stellar Populations

    NARCIS (Netherlands)

    Deep, A.; Fiorentino, G.; Jolissaint, L.; Tolstoy, E.; Clénet, Y.; Conan, J.-M.; Fusco, Th.; Rousset, G.

    2010-01-01

    The full scientific exploitation of AO images to study resolved stellar populations is still in a nascent stage. This requires pushing to the faint limits and carrying out deep and accurate crowded field photometry and astrometry. The main complexity of AO images is that the correction is never

  20. Data of evolutionary structure change: 1AO5B-1ELCA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AO5B-1ELCA 1AO5 1ELC B A VVGGFNCEKNSQPWQVAVYYQ----KEHICGGVLLDRNW...TPTWQKPDDLQCVFITLLPNENCAKV--YLQKVTDVMLCAGEMGGGKDTCRDDSGGPLICD----GILQGTTSYGPV-PCGKPGVPAIYTNLIKFNSWIKDTMMKNA TRP CA 491 1ELC A 1ELCA...hain> 1ELC A 1ELCA PLHCLVNGQYAVHG... PRO CA 225 1ELC A 1ELCA

  1. Fatores associados ao sobrepeso em escolares Factors associated with overweight in schoolchildren

    Directory of Open Access Journals (Sweden)

    Lenir Vaz Guimarães

    2006-02-01

    Full Text Available OBJETIVO: Identificar variáveis associadas ao sobrepeso em escolares de Cuiabá, MT, Brasil. MÉTODOS: Foi feito um estudo de caso-controle a partir de um inquérito antropométrico, aplicado em uma amostra aleatória de alunos da primeira série do ensino fundamental, com idades entre 6 e 11 anos. Foram incluídos, como casos, os 158 escolares que apresentaram sobrepeso (índice de massa muscular >P85 e, como controles, 316 crianças sorteadas entre as que apresentaram índice de massa muscular3 salários mínimos (OR= 3,75, que tinham mães de idade entre 25 e 29 anos (OR=1,74 e com nível mais alto de escolaridade (OR=1,91 e com história de apenas uma união conjugal (OR=2,53; também foi maior nos escolares, de sexo feminino (OR=2,15, que possuíam no máximo um irmão (OR=1,94, brincavam 30 (OR= 7,27 e 2,65, respectivamente e nasceram com peso >3500g (OR= 2,27. CONCLUSÃO: Os resultados apontam que variáveis de diferentes níveis hierárquicos se associam na configuração de contextos favoráveis ao aumento do sobrepeso em escolares e fornecem subsídios para o desenvolvimento de intervenções que considerem os grupos mais vulneráveis à presença de sobrepeso.OBJECTIVE: To identify the variables associated with overweight among schoolchildren in Cuiaba, MT, Brasil. METHODS: A case-control study was conducted in a sample of schoolchildren aging from 6 to 11 years. The study consisted of 158 overweight schoolchildren (body mass index >85th percentile and 316 children with body mass index 30 (OR=7.27 and 2.65, respectively, birth weight >3,500g (OR=2.27 and female gender (OR=2.15. CONCLUSION: The results pointed out variables, at different hierarchical levels, correlated with overweight among schoolchildren. Interventions should consider the complex pattern of obesity determination and the groups at higher vulnerability.

  2. Avaliação neurocomportamental de ratos expostos agudamente ao fipronil: influência de diazepam e flumazenil

    OpenAIRE

    Terçariol, Paula Raquel Galbiati [UNESP

    2007-01-01

    Fipronil, um derivado fenil pirazólico, é conhecido por causar neurotoxicidade tendo o ácido gama-amino butírico (GABA) como principal alvo para o mecanismo de sua ação tóxica. O presente estudo investigou os efeitos do diazepam e do flumazenil sobre o comportamento de ratos expostos agudamente ao fipronil (Frontline® Top Spot). Ratos Wistar jovens, machos, receberam um dos seguintes tratamentos: a- 0,3 ml de óleo de milho aplicada topicamente sobre o dorso dos animais (controle). b- fipronil...

  3. Estudo comparativo da espermiogenese normal e diapausica em insetos pertencentes ao complexo percevejo da soja (Hemiptera : Pentatomidae)

    OpenAIRE

    Adrienne de Paiva Fernandes

    2002-01-01

    Resumo: Percevejos fitófagos (Hemiptera, Pentatomidae) são as principais pragas de colheitas economicamente importantes ao redor do mundo, como por exemplo soja, arroz, coco, café, entre outras. Apesar da grande quantidade de informação sobre as espécies-praga, seu dano potencial nas plantas de importância econômica e as formas de controle usadas, fazem com que o impacto dessas pragas na produção de colheitas permaneça em níveis indesejáveis. A caracterização ultra-estrutural da espermiogênes...

  4. The secretory immunoglobulin A response to Mycobacterium tuberculosis in a childhood population Resposta da imunoglobulina A secretória ao Mycobacterium tuberculosis em população infantil

    Directory of Open Access Journals (Sweden)

    Carlos Fernández de Larrea

    2006-10-01

    Full Text Available We report on the measurement of saliva anti-Purified Protein Derivative sIgA and 38kDa antibodies from 127 children, of whom 31 were strong tuberculosis suspects and 96 were healthy contact children. The results concerning the percentage of children with antibody reactivity to PPD and 38kDa antigens showed that, of these 2 antigens, 38kDa induced higher reactivity in patients positive and negative for the Tuberculin Skin Test (28% and 16.6%, respectively in comparison to controls positive and negative for the TST (11.7% and 7.1%, respectively. There was a statistically significant difference between patients positive and controls negative for the TST. In relation to the Purified Protein Derivative antigen, while 14.2% of patients positive for the TST showed antibody reactivity to the PPD antigen, no patients negative for the TST had reactivity to this antigen. The findings suggest that these two antigens seem be associated with a different development of the mucosal defence mechanisms mediated by sIgA against Mycobacterium tuberculosis.Foram dosados anticorpos sIgA anti-Purified Protein Derivative e 38kDa da saliva de 127 crianças, das quais 31 eram de pacientes altamente suspeitos de tuberculose e 96 eram provenientes de crianças saudáveis, que tiveram contato com pacientes. Os resultados referentes à porcentagem de crianças, reativas ao PPD e ao antígeno 38kDa, mostraram que destes dois antígenos, o 38kDa induziu maior reatividade em pacientes positivos e negativos ao Tuberculin Skin Test (28% e 16,6%, respectivamente, em comparação aos controles positivos e negativos ao TST (11,7% e 7,1%, respectivamente. Houve diferença estatisticamente significativa entre pacientes positivos e controles negativos ao Tuberculin Skin Test. Em relação ao antígeno PPD, enquanto 14,2% de pacientes positivos ao TST mostraram anticorpos reativos ao antígeno Purified Protein Derivative, nenhum paciente negativo ao TST foi reativo ao antígeno. Os

  5. Diagnóstico da tuberculose em pessoas idosas: barreiras de acesso relacionadas aos serviços de saúde

    Directory of Open Access Journals (Sweden)

    Annelissa Andrade Virgínio de Oliveira

    Full Text Available Este estudo tem como objetivo analisar as barreiras ao diagnóstico da tuberculose em idosos relacionadas aos serviços de saúde no município de João Pessoa-PB. Trata-se de pesquisa qualitativa que envolveu sete pessoas idosas doentes de tuberculose. Entrevistas foram utilizadas para coletar informações. O material empírico foi organizado com o software Atlas.tiversão 6.0 e analisado conforme a técnica de análise de discurso. As barreiras relacionadas ao acesso para confirmação diagnóstica foram: horário de funcionamento das unidades de saúde da família; transferência de responsabilidades; visitas domiciliares sem controle de comunicantes; demora do serviço de saúde em suspeitar da doença e repetidas idas do doente ao serviço de saúde para a obtenção do diagnóstico. Apesar de terem sido identificadas barreiras comuns às encontradas por doentes de tuberculose de um modo geral, em virtude da vulnerabilidade dos idosos, sugerem-se que ações de controle sejam empreendidas pelos serviços de saúde de modo a evitar que a doença torne-se um agravo comum para essa população.

  6. Clinical therapeutic effects of AO/ASIF clavicle hook plate on distal clavicle fractures and acromioclavicular joint dislocations.

    Science.gov (United States)

    Dou, Qingjun; Ren, Xiaofeng

    2014-07-01

    The aim of this study was to evaluate the security and effectiveness of AO/ASIF clavicle hook plate in the treatment of distal clavicle fractures and acromioclavicular joint dislocations. One hundred patients with distal clavicle fractures and acromioclavicular joint dislocations who were admitted in our hospital from January 2012 to January 2013 were selected as the study subjects. They were then randomly divided into a control group and an observation group (n=50). The observation group was treated with AO/ASIF clavicle hook plates, and the control group was treated with Kirschner-wire tension bands. The outcomes were recorded and compared. The JOA scores of the two groups were similar before surgery (P>0.05). The two groups both had obviously increased JOA scores in the postoperative 6th and 12th weeks, and the score in the postoperative 12th week was higher. There were statistically significant intra-group differences (Pdislocation in the observation group were significantly lower than those of the control group (Pdislocations. The former protocol enjoyed small incisions, firm fixation and early shoulder mobility. Therefore, it is a safe and effective surgical method that is worthy of being widely applied in clinical practice.

  7. Propostas de mudanças ao basquete no sertão cearense: dando voz aos praticantes

    Directory of Open Access Journals (Sweden)

    Bérgson Nogueira de Oliveira

    2017-06-01

    Full Text Available Objetivo: o presente artigo tem como objetivo compreender as percepções de mudanças sociais atribuídas pelos praticantes de basquete em um município do sertão cearense, destacando neste contexto, as suas representações sociais acerca do papel social desta prática esportiva. Método: foram entrevistados cinco sujeitos do sexo masculino que praticam a modalidade há mais de dez anos no contexto do sertão cearense e que estudaram em escolas públicas. Para a construção das informações, utilizamos a entrevista semi-estruturada, seguida por um roteiro composto por temas, que foi adaptado de um estudo realizado por Santos (2004. As análises dos dados se deu a partir da Análise de Conteúdo do tipo Análise Temática, em que foram elaboradas categorias, a partir do material das entrevistas. Resultados: as representações de mudança dos sujeitos indicam o incentivo do basquete nas escolas; criação de projetos sociais; investimento na infraestrutura esportiva; bem como o fomento à criação de competições. Conclusão: conclui-se que a falta de apoio, de forma geral, dificulta a inserção de novos praticantes para essa modalidade. Nesse sentido, entende-se que são necessários mais incentivos ao esporte, pois se trata de um pilar na formação humana e possibilita o seu trabalho, não apenas no alto rendimento, mas também em dimensões de lazer, participação, educação, inclusão social entre outros aspectos.

  8. Sobre a domiciliaçao dos triatomineos

    Directory of Open Access Journals (Sweden)

    Mário B. Aragão

    1981-06-01

    Full Text Available Foram reunidos resultados de testes de precipitina feitos com o conteúdo do tubo digestivo de triatomineos. €ssas informações foram discutidas com base nas proporções de sangue de mamíferos e de ave, encontradas e em diversas observações relativas às espécies de vertebrados a que os triatomíneos estão associados na natureza. O estudo englobou as seguintes espécies: Belminus peruvianus, Panstrongylus geniculatus, Panstrongilus herreri, Panstrongylus megistus, Psammolestes tertius, Rhodnius neglectus, Rhodnius prolixus,Triatoma arthurneivai, Triatoma dimidiata,Triatoma infestans, Triatoma protracta, Triatoma rubrovaria e Triatoma sórdida. As seguintes conclusões puderam ser obtidas: 1 - As espécies que, nos biótopos artificiais, se alimentam principalmente de sangue humano, na natureza, são as mais ecléticas. Sugam mamífero, ave e animais de sangue-frio, mas apresentam marcada preferência por sangue de mamífero. 2 - As espécies que, nos biótopos artificiais, são encontradas com maior freqüência associadas a aves, na natureza ou preferem sangue de ave ou não tem predileção nítida por ave ou mamífero. 3 - As espécies associadas a animais de sangue frio ou restritas a um único grupo de mamíferos, podem colonizar nos domicílios desde que eles sejam previamente colonizados pelo hospedeiro. 4 - Não foram encontrados indícios de que alguma espécie esteja se adaptando aos domicílios. Todos os triatomineos ditos domiciliários já possuíam, na natureza, atributos que permitiam a vida em novos biótopos, habitados ou pelo homem ou por animais domésticos.

  9. Um sopro de Luz e Letra em meio ao caos

    Directory of Open Access Journals (Sweden)

    Marcelo Tomazi

    2009-06-01

    Full Text Available Enquanto compreende avanços científicos, o homem busca compreender a si mesmo. Partindo da citação de Carl Sagan, vemos que a Arte é um dos caminhos para a humanização, e os vínculos entre ciência (tecnologia e arte são cada vez mais estreitos. Um dos artistas que melhor trabalham dentro do nicho conhecido como “arte tecnológica” é Eduardo Kac. Sua trajetória inicial é apresentada aqui, dos “holopoemas” à “arte da telepresença”. Vemos o artista-teórico completo, profundo conhecedor da história da arte eletrônica. O livro Luz & letra: ensaios de arte, literatura e comunicação, sua obra de referência, é apresentado em essência, situando-se sua importância. É uma das poucas obras no Brasil a discutir, pela ótica de quem fez parte, eventos ligados ao advento da arte tecnológica nos anos 1980.In our quest to understand scientific advances, we seek to understand ourselves. Employing Carl Sagan's insight as a departure point, we see that art is one of the paths for humanization and that the links between science (technology and art are increasingly narrow. One of the artists who best works within the realm known as “art and technology” is Eduardo Kac. This essay explores Kac's early artworks, starting with “holopoems” and arriving at “telepresence art”, and especially his texts. We see a complete artist-theorist, with an unrivaled knowledge of electronic art and literature, in part because his theorizing emerges from having actively participated in the creation of the events he refers to. Of special interest is Kac's book Light & letter: essays in art, literature, and communication, which collects his writings of the 1980s. This is a fundamental work and mandatory reference for the study of the experimental art and literature of the period.

  10. Aldehyde oxidase (AO) in the root nodules of Lupinus albus and Medicago truncatula: identification of AO in meristematic and infection zones.

    Science.gov (United States)

    Fedorova, Elena; Redondo, Francisco J; Koshiba, Tomokazu; Pueyo, José J; de Felipe, M Rosario; Lucas, M Mercedes

    2005-05-01

    Phytohormones are involved in the organogenesis of legume root nodules. The source of the auxin indole-3-acetic acid (IAA) in nodules has not been clearly determined. We studied the enzyme aldehyde oxidase (AO; EC 1.2.3.1), that catalyzes the last step of IAA biosynthesis in plants, in the nodules of Lupinus albus and Medicago truncatula. Primordia and young lupin nodules and mature M. truncatula nodules showed AO activity bands after native polyacrylamide gel electrophoresis. Gel activity analyses using indole-3-aldehyde as substrate indicated that the nodules of white lupin and M. truncatula have the capability to synthesize IAA via the indole-3-pyruvic acid pathway. Immunolocalization and in situ hybridization experiments revealed that AO is preferentially expressed in the meristematic and the invasion zones in Medicago nodules and in the lateral meristematic zone of Lupinus nodules. High IAA immunolabeling was also detected in the meristematic and invasion zones. Low expression levels and no AO activity were detected in lupin Fix- nodules that displayed restricted growth and early senescence. We propose that local synthesis of IAA in the root nodule meristem and modulation of AO expression and activity are involved in regulation of nodule development.

  11. O direito fundamental ao conteúdo do próprio trabalho: uma reconstrução normativa do direito ao trabalho

    Directory of Open Access Journals (Sweden)

    Leonardo Vieira Wandelli

    2016-12-01

    Full Text Available Resumo: Pretende-se enfrentar a inefetividade do direito humano e fundamental ao trabalho a partir de um esforço de reconstrução normativa da sua fundamentação, apoiada em um duplo pilar teórico, nas teorias das necessidades e nas teorias do reconhecimento. Com isso, não somente se recupera a importância do vínculo entre trabalho e dignidade humana, como se explicitam aspectos essenciais da centralidade do trabalho para os sujeitos. A partir disso, o direito ao trabalho se desvela não apenas como necessidade radical, tendente à transformação da institucionalidade vigente, mas também como direito positivado em um amplo leque de normas internacionais e nacionais, que contempla diversas dimensões normativas atualmente exigíveis. Propõe-se que, no centro desse direito, está um direito fundamental ao conteúdo do próprio trabalho, que determina juridicamente as condições da atividade e da organização do trabalho. Recente estudo adotado pelo Alto Comissariado em Direitos Humanos da Organização das Nações Unidas (ONU sobre o direito ao trabalho reforça essa compreensão. Palavras-chave: Direitos humanos. Direitos fundamentais. Direito ao trabalho. Psicodinâmica do trabalho. Direito do trabalho.

  12. Tolerância ao alumínio tóxico em germoplasma brasileiro elite de aveia

    Directory of Open Access Journals (Sweden)

    Cássio Barcellos Hervé

    2013-08-01

    Full Text Available A presença de alumínio (Al reduz o rendimento em solos ácidos ou em áreas onde o subsolo possui pH abaixo de 5, pois limita o crescimento radicular e, consequentemente, a absorção de água e nutrientes. Genótipos elite de aveia (Avena sativa L. não selecionados para a tolerância ao Al foram avaliados quanto a essa característica em solução nutritiva. Foi utilizada, como parâmetro de comparação da tolerância ao Al, a média de recrescimento radicular após a exposição ao Al. O recrescimento da raiz principal dos genótipos elite foi comparado com os controles UFRGS17, considerado tolerante e UFRGS930598-6, sensível. Foram avaliadas as linhagens UFRGS057005-1 e UFRGS057022-2, e as cultivares comerciais 'URSGuria', 'URSTorena', 'URSPenca', 'URSGuará', 'URS Charrua', 'URSTarimba', 'URSTaura', 'URSGuapa' e 'URS21'. A amplitude de recrescimento da raiz dentro de cada genótipo foi elevada, sendo a menor de 15mm e a maior de 44mm. As cultivares 'URSCharrua' e 'URSGuapa' demonstraram tolerância superior a 'UFRGS17'. URSTarimba, apesar da média similar a UFRGS17, mostrou distribuição de frequência mais positiva. URSTorena, UFRGS0570005-1 e URSPenca classificaram-se como intermediários, sendo inferiores a UFRGS17. Nenhum dos genótipos elite apresentou médias de recrescimento igual ou inferior às obtidas pelo controle sensível, UFRGS930598-6.

  13. Peso ao nascer e influência do consumo de cafeína

    Directory of Open Access Journals (Sweden)

    Gladys Gripp Bicalho

    2002-04-01

    Full Text Available OBJETIVO: Estudar a associação entre consumo de cafeína na gestação e ocorrência de baixo peso ao nascer, prematuridade e restrição do crescimento intra-uterino. MÉTODOS: A investigação se desenvolveu por estudo caso-controle. Foram selecionados 354 recém-nascidos vivos de partos únicos com peso menor que 2.500 g (casos e 354 com 3.000 g ou mais (controles. A ingesta de cafeína foi calculada considerando-se o consumo diário de café, refrigerante e chá. Os resultados foram ajustados por análise de regressão logística múltipla para as variáveis de confundimento: idade materna, escolaridade, renda, situação conjugal, cor, paridade, fumo, filhos anteriores de baixo peso, peso prévio à gestação, trabalho, intervalo gestacional, consultas durante o pré-natal e hipertensão arterial. RESULTADOS: Os resultados mostraram os seguintes "odds ratio", ajustados entre o consumo diário de cafeína 300mg/dia, e o baixo peso ao nascer, respectivamente: 0,72 (IC95%, 0,45-1,25 e 0,47 (IC95%, 0,24-0,92; prematuridade: 0,59 (IC95%, 0,32-1,09 e 0,32 (IC95%, 0,15-0,72; e retardo do crescimento intra-uterino: 1,16 (IC95%, 0,45-3,01 e 0,64 (IC95%, 0,20-1,98. CONCLUSÃO: Na amostra estudada, a ingesta de cafeína não foi identificada como fator de risco para prejuízo do crescimento intra-uterino ou para a duração da gestação.

  14. Peso ao nascer e influência do consumo de cafeína

    Directory of Open Access Journals (Sweden)

    Bicalho Gladys Gripp

    2002-01-01

    Full Text Available OBJETIVO: Estudar a associação entre consumo de cafeína na gestação e ocorrência de baixo peso ao nascer, prematuridade e restrição do crescimento intra-uterino. MÉTODOS: A investigação se desenvolveu por estudo caso-controle. Foram selecionados 354 recém-nascidos vivos de partos únicos com peso menor que 2.500 g (casos e 354 com 3.000 g ou mais (controles. A ingesta de cafeína foi calculada considerando-se o consumo diário de café, refrigerante e chá. Os resultados foram ajustados por análise de regressão logística múltipla para as variáveis de confundimento: idade materna, escolaridade, renda, situação conjugal, cor, paridade, fumo, filhos anteriores de baixo peso, peso prévio à gestação, trabalho, intervalo gestacional, consultas durante o pré-natal e hipertensão arterial. RESULTADOS: Os resultados mostraram os seguintes "odds ratio", ajustados entre o consumo diário de cafeína 300mg/dia, e o baixo peso ao nascer, respectivamente: 0,72 (IC95%, 0,45-1,25 e 0,47 (IC95%, 0,24-0,92; prematuridade: 0,59 (IC95%, 0,32-1,09 e 0,32 (IC95%, 0,15-0,72; e retardo do crescimento intra-uterino: 1,16 (IC95%, 0,45-3,01 e 0,64 (IC95%, 0,20-1,98. CONCLUSÃO: Na amostra estudada, a ingesta de cafeína não foi identificada como fator de risco para prejuízo do crescimento intra-uterino ou para a duração da gestação.

  15. Prevalência e fatores associados ao sedentarismo em adolescentes de área urbana

    Directory of Open Access Journals (Sweden)

    Maria Helena Klee Oehlschlaeger

    2004-04-01

    Full Text Available OBJETIVO: Determinar a prevalência e fatores associados ao sedentarismo em adolescentes residentes em uma área urbana. MÉTODOS: Realizou-se estudo transversal em uma amostra representativa de 960 adolescentes com idades entre 15 e 18 anos, em 2002, em Pelotas, Estado do Rio Grande do Sul. Os dados foram coletados por meio de um questionário anônimo e auto-aplicado. Foi definindo como sedentário o adolescente que participava de atividades físicas por um tempo menor do que 20 minutos diários e uma freqüência menor do que três vezes por semana. Variáveis sociodemográficas e comportamentais foram avaliadas. Para as comparações entre proporções, utilizou-se o teste do qui-quadrado, e para a análise multivariada, a regressão de Poisson com ajuste robusto para as variâncias. Foi feito controle para efeito de delineamento. RESULTADOS: Foram entrevistados 960 adolescentes, dos quais 39% foram considerados sedentários. As meninas foram mais sedentárias do que os meninos, 2,45 (IC 95% 2,06-2,92. Os adolescentes das classes sociais mais baixas foram mais sedentários, 1,35 (IC 95% 1,06-1,72. Escolaridade inferior a quatro anos de estudo do adolescente 1,30 (IC 95% 1,01-1,68 e da mãe 1,75 (IC 95% 1,31-2,23 apresentaram maior risco para o sedentarismo. Após controle para possíveis fatores de confusão, mostrou-se também positiva a associação entre o sedentarismo e a presença de transtornos psiquiátricos menores e relação inversa, fator de proteção para os sexualmente ativos 0,84 (IC 95% 0,71-0,99. CONCLUSÕES: Ser do sexo feminino, pertencer à classe social baixa, ter uma baixa escolaridade e ser filho de mãe com baixa escolaridade são fatores associados ao sedentarismo.

  16. Efeito do plasma de oxigênio na dentina previamente exposta ao NaOCl

    Directory of Open Access Journals (Sweden)

    Maíra do PRADO

    Full Text Available Resumo Introdução O tratamento de plasma é uma tecnologia eficaz que pode manter as propriedades internas dos materiais inalteradas após o tratamento, modificando apenas a superfície. Objetivo Avaliar o efeito do plasma de oxigênio na dentina previamente exposta ao NaOCl 6%. Material e método Foram utilizados 60 incisivos bovinos. A coroa foi removida, a raiz foi dividida e as faces planificadas, totalizando 120 segmentos referentes ao terço cervical. As amostras foram divididas em dois grupos: controle (imersa em NaOCl 6%, lavada com água destilada, seca, imersa em EDTA 17%, lavada e seca e plasma de oxigênio (após tratamento descrito no grupo controle, plasma de oxigênio foi aplicado por 30 s. As amostras foram avaliadas qualitativamente em relação à topografia por microscopia eletrônica de varredura, utilizando-se microfotografias com ampliação de 1.000×. O goniômetro Ramé-hart foi utilizado para a mensuração do ângulo de contato entre as superfícies e as seguintes soluções foram utilizadas: água, etilenoglicol e di-iodometano. Em seguida, a energia de superfície, representada pelas componentes polar e dispersiva, foi calculada. Avaliou-se também o escoamento dos cimentos Pulp Canal Sealer EWT (PCS e Real Sal SE (RS na superfície dentinária. Os dados foram analisados estatisticamente utilizando os testes Kruskal-Wallis e Mann-Whitney U (p<0,05. Resultado O tratamento com plasma levou à formação de uma camada semelhante à smear layer na superfície dentinária. Este tratamento levou a um aumento da energia de superfície e da componente polar, favorecendo a hidrofilicidade da superfície. Entretanto, desfavoreceu o escoamento do cimento PCS e não influenciou no escoamento do cimento RS. Conclusão O plasma de oxigênio ocasionou mudanças topográficas na superfície dentinária, favorecendo a hidrofilicidade desta. Contudo, não favoreceu o escoamento dos cimentos endodônticos na dentina.

  17. Avaliação da qualidade de vida e vulnerabilidade ao estresse no contexto hospitalar

    Directory of Open Access Journals (Sweden)

    Fernanda Ottati

    2013-05-01

    Full Text Available O conceito de Qualidade de Vida é usado para medir as condições de vida de um ser humano, já a palavra vulnerabilidade refere-se à chance das pessoas estarem expostas ao adoecer. Objetivou-se analisar possíveis relações entre percepção de qualidade de vida e a vulnerabilidade ao estresse no trabalho em enfermeiros, técnicos e auxiliares de enfermagem que atuam na UTI e no setor de emergência de um hospital público. Utilizou-se o instrumento de qualidade de vida da Organização Mundial da Saúde, WHOQOL-Bref e a Escala de Vulnerabilidade ao Estresse no Trabalho. Encontrou-se, em relação ao setor de trabalho, diferença significativa apenas para Qualidade de vida total. Portanto pode-se afirmar que os profissionais que atuam na UTI possuem maior percepção de qualidade de vida quando comparados aos do SUS. Na correlação entre os dois instrumentos, o domínio meio ambiente do WHOQOL-Bref correlacionou-se negativa e significativamente com todos os fatores da EVENT, indicando que a percepção da pessoa em relação aos diversos aspectos do meio em que vive tem relação com a vulnerabilidade ao estresse.

  18. Potencialidades e espaços ao empreendedorismo

    Directory of Open Access Journals (Sweden)

    Adriano Lago

    2008-01-01

    Full Text Available A criação de negócios é apontada como uma das causas da prosperidade de um local, região, estado ou de um país. É neste sentido que o empreendedorismo tem recebido destaque nos últimos anos, como promotor de novos negócios. Captar, descrever e analisar o fenômeno do empreendedorismo é, portanto, necessário para o desenho de ações de promoção do desenvolvimento. Assim, o presente estudo aborda o empreendedorismo na piscicultura, tomando como base três casos analisados: uma propriedade com rizipiscicultura, uma com piscicultura de ciclo completo inclusive com frigorífico, e outra onde a piscicultura desenvolve-se através de um pesque-pague, com vistas a proporcionar o turismo rural. Para fins de pesquisa, entrevistaram-se os proprietários de cada estabelecimento na busca dos dados necessários para a construção de uma abordagem consistente da temática proposta, ou seja, identificar a presença do empreendedorismo e suas características particulares em cada propriedade analisada. Verificou-se que determinadas características empreendedoras são comuns aos três casos analisados: habilidade para identificar oportunidades; busca de conhecimento de sua área de atuação; senso de organização; disposição para tomar decisões; capacidade de liderança; talento para empreender; otimismo e tino empresarial; ser estrategista, além do dinamismo. Portanto, foi possível observar que o perfil empreendedor dos proprietários de cada negócio tornou possível a transformação de idéias e problemas em oportunidades reais de negócio.Abstract The business opening is indicated as one of the prosperity causes of a country, state, region or local. It’s in this context that the entrepreneurship has received attention along the last years as new business promoter. This way, to study and promote development actions it’s necessary, firstly, to get, to describe and to analyze the entrepreneurship phenomenon by itself. So, this study

  19. Contribuição ao estudo da Tripanosomiase Americana

    Directory of Open Access Journals (Sweden)

    Bichat de Almeida Rodrigues

    1942-01-01

    ano (época do estío. 6 Em plena mata, n’uma toca de tamanduá (T. tetradactylus foram encontradas larvas, ninfas e adultos de P. geniculatus. A casa situada mais próximo desse foco, foi a que apresentou maior infestação (22 exemplares e exclusiva para essa espécie. Em uma toca de macaco da noite (P. flavus, foi encontrada uma larva de Triatomídeo. Este foco também ficava próximo à casa acima referida. Em toca de P. flavus foi também achado um exemplar adulto de Panstrongylus refotuberculatus. 7 Amostras de S. cruzi isoladas de animais silvestres, mostraram fraco poder infectante. A amostra isolada do cão, embora infectando facilmente os animais de laboratório, pelos estudos biométricos feito por DIAS e FREITAS, afasta-se das amostras humanas típicas. 8 São discutidos os resultados acima referidos e, pelos hábitos dos transmissores, pela predominância de depositários silvestres do parasito, conclue-se pela natureza silvestre da Tripanosomiase Americana no local estudado. Se bem que não tenham sido verificadas infecções humanas, dado o encontro de um cão parasitado – infecção esta que se pode ter verificado pelo meio normal da transmissão da moléstia – admite-se a possibilidade do aparecimento de casos humanos nessa região. Ressalta-se a confirmação que tais resultados parecem trazer á hipótese de CARLOS CHAGAS, que pensava ser esta doença primitivamente silvestre, com posterior adaptação aos animais domésticos e ao homem.1 The epidemiology of Chagas’ disease was studied for the first time in a systematized work, in a district of the region of the Amazon estuary, whose ecological conditions differ from those encountered in other zones where similar researches have been made. 2 At the place chosen for the studies – Aurá – a locality about 10 kms from Belem (State of Pará, no human infection by S. cruzi has been found, either by blood examination or xenodiagnosis, both having been tried on all the inhabitants (117 people

  20. CLASSICAL AREAS OF PHENOMENOLOGY: Correcting dynamic residual aberrations of conformal optical systems using AO technology

    Science.gov (United States)

    Li, Yan; Li, Lin; Huang, Yi-Fan; Du, Bao-Lin

    2009-07-01

    This paper analyses the dynamic residual aberrations of a conformal optical system and introduces adaptive optics (AO) correction technology to this system. The image sharpening AO system is chosen as the correction scheme. Communication between MATLAB and Code V is established via ActiveX technique in computer simulation. The SPGD algorithm is operated at seven zoom positions to calculate the optimized surface shape of the deformable mirror. After comparison of performance of the corrected system with the baseline system, AO technology is proved to be a good way of correcting the dynamic residual aberration in conformal optical design.

  1. Lesão de mancha branca associada ao tratamento ortodôntico

    OpenAIRE

    Tambelli, Bianca

    2013-01-01

    Projeto de Pós-Graduação/Dissertação apresentado à Universidade Fernando Pessoa como parte dos requisitos para obtenção do grau de Mestre em Medicina Dentária O desenvolvimento de lesões de mancha branca em indivíduos submetidos ao tratamento ortodôntico com aparatologia fixa constitui um problema clínico importante. A inadequada higiene oral cria condições adicionais propícias ao aumento significativo da placa bacteriana ao redor dos suportes dos aparelhos fixos, fator este responsável pe...

  2. A resistência aos inseticidas e sua medida em mosquitos

    Directory of Open Access Journals (Sweden)

    Mario B. Aragão

    1972-04-01

    Full Text Available Depois de um ligeiro histórico scbre a evolução dos inseticidas, o autor chama a atenção para a mudança radical sofrida pela tática de combate a insetos, cem o aparecimento dos inseticidas orgânicos persistentes. Antes o que se visava era o inseto ou o seu alimento, depois passou-se a envenenar todo o espaço frequentado por esses animais. Lembra que existem, em alguns lugares, ambientes naturalmente envenenados onde prosperam seres vivos, perfeitamente adaptados a essas condições. Isso permitia prever o aparecimento de resistência aos inseticidas na escala hoje observada. Cita alguns çens e enzimas responsáveis pela resistência a alguns grupos de inseticidas e salienta a importância desses estudos para a descoberta de substâncias sinergentes. Descreve a técnica adotada pela Organização Mundial da Saúde para medir a susceptibilidade de mosquitos adultos. Menciona os processos de controle biológico por machos esterilizados, parasitas e predadores, e lembra que as duas campanhas contra insetos de importância sanitária que tiveram maior êxito no Brasil, a do Aedes aegypti e a do Anopheles gambiae, utilizaram táticas ecléticas, como é hoje preconizado pelos cntomologistas de vanguarda, no que se convencionou chamar de luta integrada.

  3. Regulacao antidoping e saude publica: limites a exposicao humana ao risco sanitario e a gloria desportiva

    Directory of Open Access Journals (Sweden)

    Fernando Mussa Abujamra Aith

    2013-10-01

    Full Text Available Objetivou-se apresentar reflexões sobre a relação entre o doping e a saúde pública, em face do atual cenário regulatório que cerca o doping no mundo e os recorrentes escândalos que vinculam esportistas de ponta ao doping em várias modalidades desportivas. O estudo teve, como referência, os riscos à saúde que o doping representa e, como horizonte, as opções regulatórias adotadas pela comunidade internacional e pelas federações desportivas para o controle e fiscalização desse tipo de prática antidesportiva e arriscada. Buscou-se ponderar sobre o necessário equilíbrio entre esporte e saúde, bem como sobre o papel do Estado na preservação desse equilíbrio.

  4. Combate experimental ao ácaro da leprose Brevipalpus phoenicis (Geijskes, 1939 em citros

    Directory of Open Access Journals (Sweden)

    H.M. Campos Neto

    1993-09-01

    Full Text Available Com o objetivo de combater o ácaro Brevipalpus phoenicis (Geijskes, transmissor do vírus da leprose, foi estudada a eficiência de diferentes defensivos químicos. Os tratamentos foram seis, cada um com quatro repetições. A propargite (0,05 CE 72% + enxofre (1,0 SC 75%; B peropal (0,1 kg PM 25%; C quinometionato (0,05 kg PM 70% (padrão; D dicofol + tetradifom (0,2 CE 16% + 6%; E propargite (0,075 CE 72%; F testemunha. Cada laranjeira recebeu dez litros de calda numa única aplicação; usou-se o espalhante-adesivo "Extravon", à razão de 20 cm³/l00 litros de calda. Foram feitas cinco avaliações de infestações de ácaro: uma 4 dias antes da aplicação e outras após 16, 31, 45 e 60 dias da pulverização. Com exceção dos tratamentos propargite + enxofre (aos 16 dias e quinometionato (aos 60 dias, todos os produtos apresentaram porcentagem de redução real da praga acima de 80% nas diferentes épocas de avaliação.A field test was carried out to evaluate the performance of several pesticides for the control of the citrus leprosis mite Brevipalpus phoenicis. The treatments were as follows: A propargite (0.05 72% EC + sulphur (1,0 75% CS; B peropal (0.1 kg 25% MP; C quinomethionate (0.05 kg 70% MP (standard treatment; D dicofol + tetradifon (0.2 (16% + 6% EC; E propargite (0.075 72% EC; F check. The quantities of the products employed in the experiment were based on the commercial formulations for 100 liters of water. Each orange-tree received a single application of ten liters of spray. Five mite evaluations were made: 4 days before spray and 16, 31, 45 and 60 days after the application. All treatments resulted in real pest reduction, higher than 80%, except for A (16 days after the spray and for treatment C (60 days after the application.

  5. Combate ao Panstrongylus megistus com o Malathion concentrado

    Directory of Open Access Journals (Sweden)

    Ítalo A. Sherlock

    1975-12-01

    Full Text Available O Malathion concentrado (0-0 dimetilfosforo ditioato de dietil mercapto - succinato foi usado para combater o Panstrongylus megistus, principal vector da doença de Chagas, numa zona endêmica do Estado da Bahia. A eficácia do malathion no controle desse triatomíneo foi constatada após ter sido aplicado três vezes, no período de um ano e meio, em intervalos senjestrais. A ação letal do inseticida tanto se faz sobre as formas ambulantes, como sobre os ovos de P. megistus. Em vista da eficácia para o controle do triatomíneo, de não terem sido observados efeitos tóxicos colaterais para o homem e do custo operacional ser relativamente baixo, os Autores concluem que o malathion é uma arma valiosa para uso nas campanhas contra os transmissores da doença de Chagas.Concentrated Malathion was used against Panstrongylus megistus, the principal local vector of Chagas' Disease, in an endemic area in the State of Bahia, Brasil. The efficacy of malathion in the controle of this triatominae was demonstrated after three applications six months apart. The insecticide is lethal to all stages of vector including the eggs. In view of its effectiveness in the control of the triatomine, the absence of any noticeable signs of intoxication in the personnel applying the insecticide and in residents of the treated houses or domestic animals, and the relatively low operational cost, the Authors conclude that malathion is a valuable weapon in campaigns to control the veçtors of Chagas Disease.

  6. Percepção do consumidor frente aos riscos associados aos alimentos, sua segurança e rastreabilidade

    Directory of Open Access Journals (Sweden)

    Juliana Cunha de Andrade

    2013-09-01

    mostrou relevante nos três grupos, pois esta deve contribuir para o recolhimento mais eficiente de produtos, caso seja necessário. No entanto, sob a ótica do consumidor, a rastreabilidade leva ao aumento dos preços, embora aumente a confiança em relação à segurança dos alimentos. Muitas das preocupações dos consumidores refletem as informações publicadas em revistas e jornais, como o caso da crença de que hormônios são utilizados na cadeia da carne de frango. Indústria e varejistas devem incrementar a comunicação de informações científicas sobre a segurança dos alimentos, contribuindo, assim, na educação do consumidor.

  7. Reliability and Reproducibility of the OTA/AO Classification for Humeral Shaft Fractures

    NARCIS (Netherlands)

    K.C. Mahabier (Kiran); E.M.M. van Lieshout (Esther); B.C. van der Schaaf (Boyd); G.R. Roukema (Gert); B.J. Punt (Bas); M.H.J. Verhofstad (Michiel); D. den Hartog (Dennis); H.W. Bolhuis (Hugo); P.K. Bos (Koen); M.W.G.A. Bronkhorst (Maarten); M.M.M. Bruijninckx (Milko); P.Th. den Hoed (Pieter); B.J. Dwars (Boudewijn); J.C. Goslings (Carel); R. Haverlag (Robert); M.J. Heetveld (Martin); A.J.H. Kerver (Albert J.H.); K.A. Kolkman (Karel); K. Leenhouts (Kees); R. Onstenk (Ron); H. Poeze; R.W. Poolman (Rudolf); W.H. Roerdink (Herbert); J.B. Sintenie (Jan Bernard); N.M.R. Soesman (Nicolaj); F.H.W.M. van der Heijden (Frank); P. van der Zwaal (Peer); J.P. van Dijk (Johannes); H.P.W. van Jonbergen; E.J.M.M. Verleisdonk (Egbert); J.P.A.M. Vroemen (Jos); M. Waleboer (Marco); W.P. Zuidema (Wietse)

    2017-01-01

    textabstractObjectives: This study aimed to determine interobserver reliability and intraobserver reproducibility of the OTA/AO classification for humeral shaft fractures, and to evaluate differences between fracture types, fracture groups, and surgical specializations. Methods: Thirty observers (25

  8. Additions to the marine algal flora of Curaçao, Netherlands Antilles

    NARCIS (Netherlands)

    Stegenga, H.; Vroman, M.

    1988-01-01

    Nine species of benthic marine algae are reported from the Caribbean island of Curaçao for the first time: Chlorophyta: Derbesia marina and Trichosolen longipedicellata; Phaeophyta: Ectocarpus rhodochortonoides, Feldmannia elachistaeformis, Hecatonema floridanum, Herponema tortugense and Sphacelaria

  9. Tense, But in the Mood: Diachronic Perspectives on the Representation of Time in Ao

    National Research Council Canada - National Science Library

    Coupe, Alexander R

    2013-01-01

    印度東北部的Ao 語呈現一些從類型學的角度來說很有意思的特徵,我們從這些特徵可以看到Ao 語時標誌歷史發展的一些線索。作者認為Ao 語原來有二元的語氣系統:實然 (realis) 和非實然 (irrealis),前者無標誌,後者有標誌。Ao 語把其中兩個名物化標誌的作用延伸到標記時的不同範疇,而原來的無標誌的實然範疇卻...

  10. Ciberespaço cubano: uma forma de resistência ao poder e à censura

    Directory of Open Access Journals (Sweden)

    Lia Hecker Luz

    2011-01-01

    Full Text Available A entrada do corpo e da vida nos cálculos do poder corresponde ao que Foucault chamou de biopolítica. Entretanto, o próprio Foucault intuiu que aquilo mesmo que o poder investia – a vida – era o que doravante ancoraria a resistência a ele. Assim, ao poder sobre a vida deveria responder a potência da vida, capaz de operar uma resistência possível ao sequestro da vida pelo poder. Apoiando-nos no pensamento de Lévy, levantamos a hipótese, a partir da análise do blog Generación Y, de que a blogosfera cubana é uma expressão micropolítica de resistência ao poder, de biopotência da multidão.

  11. Bicolumnar 90–90 plating of AO 13C type fractures

    National Research Council Canada - National Science Library

    Cemal Kural; Ersin Ercin; Mehmet Erkilinc; Evren Karaali; Mustafa Gokhan Bilgili; Suleyman Altun

    2017-01-01

    Objective: The aim of this study was to evaluate functional results and complication rate of patients who underwent medial-dorsolateral plating for intra-articular distal humeral fracture (Müller AO type 13C). Methods...

  12. Control algorithms and applications of the wavefront sensorless adaptive optics

    Science.gov (United States)

    Ma, Liang; Wang, Bin; Zhou, Yuanshen; Yang, Huizhen

    2017-10-01

    Compared with the conventional adaptive optics (AO) system, the wavefront sensorless (WFSless) AO system need not to measure the wavefront and reconstruct it. It is simpler than the conventional AO in system architecture and can be applied to the complex conditions. Based on the analysis of principle and system model of the WFSless AO system, wavefront correction methods of the WFSless AO system were divided into two categories: model-free-based and model-based control algorithms. The WFSless AO system based on model-free-based control algorithms commonly considers the performance metric as a function of the control parameters and then uses certain control algorithm to improve the performance metric. The model-based control algorithms include modal control algorithms, nonlinear control algorithms and control algorithms based on geometrical optics. Based on the brief description of above typical control algorithms, hybrid methods combining the model-free-based control algorithm with the model-based control algorithm were generalized. Additionally, characteristics of various control algorithms were compared and analyzed. We also discussed the extensive applications of WFSless AO system in free space optical communication (FSO), retinal imaging in the human eye, confocal microscope, coherent beam combination (CBC) techniques and extended objects.

  13. Desempenho de vacas Charolês e Nelore desterneiradas aos três ou sete meses

    Directory of Open Access Journals (Sweden)

    Restle João

    2001-01-01

    Full Text Available Foi avaliado o desempenho de vacas Charolês (C e Nelore (N, agrupadas em três classes de idade, jovens (3 e 4 anos, adultas (5 a 7 anos e velhas (8 ou mais anos, desmamadas aos três (precoce ou sete meses no outono (tradicional. O peso no outono das vacas desterneiradas aos três meses (T3 foi 45 kg superior ao das vacas com remoção do bezerro aos sete meses (T7. O estado corporal aos sete meses também foi melhor nas vacas do T3 (3,3 contra 2,1 pontos. Vacas do T3 apresentaram maior ganho de peso do parto ao final do período reprodutivo e apresentaram maiores porcentagem de cio (81 contra 51% e prenhez (67,2 contra 37,3% e menor intervalo do parto ao primeiro cio pós-parto (102 contra 114 dias que vacas do T7. Vacas adultas apresentaram melhor estado corporal aos sete meses e tiveram melhor desempenho reprodutivo do que vacas velhas e jovens. A diferença na porcentagem de prenhez entre o T3 e T7 foi mais evidente nas vacas jovens (42,11 contra 12,5% e velhas (51,72 contra 35,71% que nas adultas (62,50 contra 53,33%. Vacas C foram mais pesadas que as N, ao parto, aos três e sete meses pós-parto e apresentaram melhor estado corporal aos sete meses. O efeito do desmame precoce no desempenho reprodutivo foi mais evidente nas vacas C. A porcentagem de fêmeas prenhes nas C foi de 80,60% para o T3 e 41,90% para o T7, já nas N as porcentagens foram de 45,50 e 30,00%, respectivamente, para o T3 e T7. Nas vacas C, a produção de leite e a amamentação apresentaram efeito inibidor, sobre a reprodução, mais marcante que nas vacas N.

  14. Attitude toward contraception and abortion among Curaçao women. Ineffective contraception due to limited sexual education?

    NARCIS (Netherlands)

    Brink, M.J.; Boersma, A.A.; Meyboom-deJong, B; Bruijn, de J.G.M.

    2011-01-01

    Background In Curaçao is a high incidence of unintended pregnancies and induced abortions. Most of the induced abortions in Curaçao are on request of the woman and performed by general practitioners. In Curaçao, induced abortion is strictly prohibited, but since 1999 there has been a policy of

  15. Te Ao Kori as Expressive Movement in Aotearoa New Zealand Physical Education Teacher Education (PETE): A Narrative Account

    Science.gov (United States)

    Legge, Maureen

    2011-01-01

    A unique aspect of Aotearoa/New Zealand physical education is the inclusion of Maori culture in the form of te ao kori. Te ao kori translates to mean the world of movement and is represented by the interpretation of indigenous movement, games and pastimes. Participation in te ao kori means the sports-based normative frame of reference for physical…

  16. Safety evaluation of pectin-derived acidic oligosaccharides (pAOS): Genotoxicity and sub-chronic studies

    NARCIS (Netherlands)

    Garthoff, J.A.; Heemskerk, S.; Hempenius, R.A.; Lina, B.A.R.; Krul, C.A.M.; Koeman, J.H.; Speijers, G.J.A.

    2010-01-01

    Pectin-derived acidic oligosaccharides (pAOS) are non-digestible carbohydrates to be used in infant formulae and medical nutrition. To support its safety, the genotoxic potential of pAOS was evaluated. pAOS was not mutagenic in the Ames test. Positive results were obtained in the chromosome

  17. Safety evaluation of pectin-derived acidic oligosaccharides (pAOS): genotoxicity and sub-chronic studies.

    NARCIS (Netherlands)

    Garthoff, J.A.; Heemskerk, S.; Hempenius, R.A.; Lina, B.A.; Krul, C.A.; Koeman, J.H.; Speijers, G.J.

    2010-01-01

    Pectin-derived acidic oligosaccharides (pAOS) are non-digestible carbohydrates to be used in infant formulae and medical nutrition. To support its safety, the genotoxic potential of pAOS was evaluated. pAOS was not mutagenic in the Ames test. Positive results were obtained in the chromosome

  18. Aerosol Observing System Greenhouse Gas (AOS GhG) Handbook

    Energy Technology Data Exchange (ETDEWEB)

    Biraud, S. C. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Reichl, K. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States)

    2016-03-01

    The Greenhouse Gas (GhG) Measurement system is a combination of two systems in series: (1) the Tower Gas Processing (TGP) System, an instrument rack which pulls, pressurizes, and dries air streams from an atmospheric sampling tower through a series of control and monitoring components, and (2) the Picarro model G2301 cavity ringdown spectrometer (CRDS), which measures CO2, CH4, and H2O vapor; the primary measurements of the GhG system.

  19. Fatores associados ao baixo peso ao nascimento entre adolescentes no Sudeste do Brasil Factors associated with low birth weight among adolescents in the Brazil Southeast region

    Directory of Open Access Journals (Sweden)

    Fernanda Garanhani Castro Surita

    2011-10-01

    Full Text Available OBJETIVOS: Conhecer a prevalência e alguns fatores associados ao baixo peso ao nascer entre gestantes adolescentes. MÉTODOS: Estudo de corte transversal, realizado entre outubro de 1994 a dezembro de 2009, com os partos ocorridos em uma maternidade de Campinas, utilizando informações coletadas em uma Ficha Obstétrica Informatizada. Foram selecionados os casos de partos entre adolescentes e, posteriormente, separados em dois grupos com e sem baixo peso ao nascer. Foram calculados o risco relativo e o intervalo de confiança (IC de 95% para as variáveis independentes (fatores de risco, e calculou-se o teste do Χ2 para comparação dos resultados perinatais. Assumiu-se nível de significância de 5%. RESULTADOS: No período ocorreram 24.000 partos no Centro de Atenção à Saúde da Mulher (CAISM, com 2.404 em 2.357 adolescentes (10,02%, sendo a frequência de baixo peso ao nascer de 15,1%. A gestação neste grupo foi recorrente em 294 (8,2%. A idade menor que 15 anos, anemia, tabagismo e hipertensão não se associaram ao baixo peso ao nascer. O antecedente de aborto e a associação com lúpus eritematoso sistêmico elevaram o risco de baixo peso ao nascer. A necessidade de cesariana e o Apgar menor que sete também foram mais prevalentes entre as adolescentes com baixo peso ao nascer, e 85% das adolescentes realizaram menos de seis consultas durante o pré-natal. CONCLUSÕES: A prevalência de baixo peso ao nascer é maior entre as adolescentes do que na população geral. Também chamou a atenção o grande número de adolescentes com menos de seis consultas durante o pré-natal. O antecedente de aborto e a presença de lúpus eritematoso sistêmico foram fatores de risco para ocorrência de baixo peso ao nascer em gestantes adolescentes.PURPOSES: To determine the rate of low birth weight and some of the risk factors associated with this event among adolescents. METHODS: A cross-sectional study conducted between October 1994 and

  20. 6th September 2011 - Argentine Minister of Science, Technology and Innovation J. L. Barañao signing the guest book with CERN Director-General R. Heuer.

    CERN Multimedia

    2011-01-01

    In the ATLAS Visitors Centre with Collaboration Spokesperson F. Gianotti and National Contact Physicist M. T. Dova. ATLAS Collaboration M. Mikenberg present. CERN-HI-1109229 24: In the CERN Control centre, from left to right: First Secretary at the Permanent Mission R. Bardoneschi, National Contact Physicist M.T. Dova, CERN Adviser for Latin America J. Salicio Diez, Minister Barañao and Beams Operation Group M. Benedikt.

  1. Functional analysis of AoAtg11 in selective autophagy in the filamentous fungus Aspergillus oryzae.

    Science.gov (United States)

    Tadokoro, Takayuki; Kikuma, Takashi; Kitamoto, Katsuhiko

    2015-07-01

    Autophagy is a highly conserved cellular degradation process in eukaryotes and consists of both non-selective and selective types. Selective autophagic processes include pexophagy, mitophagy, and the cytoplasm-to-vacuole targeting (Cvt) pathway of yeast, in which particular vacuolar proteins, such as aminopeptidase I (Ape1), are selectively transported to vacuoles. Although selective autophagy has been mainly studied in the yeasts Saccharomyces cerevisiae and Pichia pastoris, there is evidence for selective autophagy in filamentous fungi; however, the details are poorly understood. In S. cerevisiae, Atg11 is a selective autophagy-specific protein that recognizes and transports substrates to the pre-autophagosomal structure (PAS). Here, we first identified an ATG11 homologue in the filamentous fungus Aspergillus oryzae and analyzed the localization of the corresponding protein, designated AoAtg11, fused to enhanced green fluorescent protein (EGFP). Imaging analysis revealed that AoAtg11-EGFP was localized to PAS-like structures. We next constructed an Aoatg11 disruptant of A. oryzae and showed that AoAtg11 is involved in pexophagy and mitophagy. In addition, AoAtg11 was found to be dispensable for non-selective autophagy and for transporting AoApe1 to vacuoles. Taken together, these results suggest that AoAtg11 is a selective autophagy-specific protein in A. oryzae, and has distinct molecular functions from that of S. cerevisiae Atg11. Copyright © 2015 The British Mycological Society. Published by Elsevier Ltd. All rights reserved.

  2. Instituto SEQUOIA : Um serviço privado,  multidisciplinar e de cuidado aos idosos SEQUOIA Institute: A multidisciplinary private service for the care of senior citizens L’Institut SEQUOIA : Un service privé multidisciplinaire pour les soins des personnes du troisième âge Instituto SEQUOIA : Un servicio privado y multidisciplinario de atención a las personas de la tercera edad

    Directory of Open Access Journals (Sweden)

    Anelise Fonseca

    2011-10-01

    apresenta um crescimento de 10% ao ano na assistencia médica, 20% no números de atendimentos psicológicos, além de 50% a mais na participação em palestras.

  3. The effect of different acute concentrations of cadmium chloride on the frequency of micronuclei in AO rats

    Directory of Open Access Journals (Sweden)

    Popović-Bubujuk Slavica

    2013-01-01

    Full Text Available Cadmium (Cd is highly toxic heavy metal which may cause severe biological effects in vivo and in vitro. In this study, an evaluation of the acute Cd ability to trigger micronuclei (MNi formation was carried out on 3-monthold male and female Albino Oxford (AO rats using micronucleus (MN test. Experimental animals were treated intraperitoneally with three different concentrations of cadmium chloride (CdCl2: 0.5, 1, and 2 mg CdCl2 per kg of body weight. Control animals received equal volume of sterile phosphate buffered saline. The results showed that 2 mg CdCl2 per kg b.w. concentration caused a highly statistically significant (P < 0.001 increase in MNi formation in the bone marrow polychromatic erythrocytes (PCEs, exerting a clear-cut concentration-dependent effect. Lower concentrations of CdCl2 used (0.5 and 1 mg/kg b.w. also caused MNi formation, but with lower statistical significance. Sex differences in MNi production in bone marrow PCEs after acute exposure to different experimental concentrations of CdCl2 were not observed in our study. Our results indicate the ability of CdCl2 to exerts genotoxic effects in bone marrow of AO rats, and complement previous data on the genotoxicity of this important environmental contaminant, burdening the body from different sources - major being industrial exposure, food and cigarette smoking. [Projekat Ministarstva nauke Republike Srbije, br. III46002

  4. Curva Característica de Secagem da Madeira de Tectona grandis e Acacia mangium ao Ar Livre

    Directory of Open Access Journals (Sweden)

    Rafael Leite Braz

    Full Text Available A secagem natural é uma alternativa que pode ser empregada como pré-secagem ou secagem definitiva para diversas madeiras com baixo custo e condições simples de trabalho. O presente trabalho foi realizado com o objetivo de estudar o comportamento das curvas características de secagem ao ar livre de tábuas de Acacia mangium e Tectona grandis. Árvores de cada espécie com idade de 15 anos foram abatidas, com toras de aproximadamente 3 m. Essas foram desdobradas utilizando-se o sistema de cortes tangenciais para a obtenção das tábuas de 3,0 cm de espessura. Instalada a pilha de madeira para a secagem, a umidade inicial das amostras foi determinada e o acompanhamento foi realizado por meio de pesagens periódicas das amostras de controle. Observou-se que nas condições ambientais expostas, a madeira de Acacia mangium secou mais lentamente ao ar livre que a madeira de Tectona grandis. Recomenda-se a análise da curva de secagem para cada espécie separadamente.

  5. A reação dos evangélicos ao novo código civil

    Directory of Open Access Journals (Sweden)

    Mariano, Ricardo

    2006-01-01

    Full Text Available O objetivo principal deste paper consiste em analisar a reação evangélica ao novo código civil, que procurou ampliar o controle legal que o Estado brasileiro exerce sobre os grupos religiosos, ao fixar novas regras para o funcionamento e a organização das associações religiosas no país. A implementação dessas normas tenderia a promover e efetivar significativas mudanças nas organizações religiosas, principalmente naquelas cujos estatutos e funcionamento efetivo, caso das pentecostais, acham-se mais distantes das disposições, contidas nas novas regras. Temendo o pagamento de multas, a prisão de pastores, processos na justiça por descumprimento das normas, lideranças eclesiásticas e parlamentares evangélicas promoveram intensa mobilização por todo o país, politizaram sua identidade religiosa e articularam um poderoso e bem-sucedido lobby no Congresso Nacional. Com isso, conseguiram alterar o código civil, o que as desobrigou de realizar as mudanças legais previstas inicialmente pela nova normatividade jurídica

  6. Combate ao Panstrongylus megistus com o Malathion concentrado

    Directory of Open Access Journals (Sweden)

    Ítalo A. Sherlock

    1975-12-01

    Full Text Available O Malathion concentrado (0-0 dimetilfosforo ditioato de dietil mercapto - succinato foi usado para combater o Panstrongylus megistus, principal vector da doença de Chagas, numa zona endêmica do Estado da Bahia. A eficácia do malathion no controle desse triatomíneo foi constatada após ter sido aplicado três vezes, no período de um ano e meio, em intervalos senjestrais. A ação letal do inseticida tanto se faz sobre as formas ambulantes, como sobre os ovos de P. megistus. Em vista da eficácia para o controle do triatomíneo, de não terem sido observados efeitos tóxicos colaterais para o homem e do custo operacional ser relativamente baixo, os Autores concluem que o malathion é uma arma valiosa para uso nas campanhas contra os transmissores da doença de Chagas.

  7. Instrumento mensurador de adesao para hipertensos: contribuicao da Teoria da Resposta ao Item

    Directory of Open Access Journals (Sweden)

    Malvina Thais Pacheco Rodrigues

    2013-06-01

    Full Text Available OBJETIVO: Analisar instrumento de medição da adesão ao tratamento da hipertensão por meio da "Teoria da Resposta ao Item". MÉTODOS: Estudo analítico com 406 hipertensos com complicações associadas, atendidos na atenção básica em Fortaleza, CE, 2011, pela "Teoria da Resposta ao Item". As etapas de execução foram: teste de dimensionalidade, calibração dos itens; tratamento dos dados e construção da escala, analisadas com base no modelo de resposta gradual. Estudo da dimensionalidade do instrumento foi feito pela análise da matriz de correlação policórica e análise fatorial de informação completa. Utilizou-se o software Multilog para calibração dos itens e estimação dos escores. RESULTADOS: Os itens referentes ao tratamento medicamentoso foram os mais diretamente relacionados à adesão, enquanto aqueles referentes ao tratamento não medicamentoso precisam ser reformulados, pois possuíram menor quantidade de informação psicométrica e baixa discriminação. A independência dos itens, o reduzido número de níveis da escala e as baixas variâncias explicadas no ajuste dos modelos mostraram as principais fragilidades do instrumento analisado. A "Teoria da Resposta ao Item" mostrou-se relevante para análise, pois avaliou o respondente quanto à adesão ao tratamento da hipertensão, ao nível de dificuldade dos itens e à sua capacidade de discriminação entre indivíduos com diferentes níveis de adesão, o que gerou maior quantidade de informação. CONCLUSÕES: O instrumento analisado é limitado para medir a adesão ao tratamento da hipertensão, mediante análise pela "Teoria da Resposta ao Item", e necessita de ajustes. A adequada formulação dos itens é importante para medir precisamente o traço latente desejado.

  8. Review of adaptive optics OCT (AO-OCT): principles and applications for retinal imaging [Invited].

    Science.gov (United States)

    Pircher, Michael; Zawadzki, Robert J

    2017-05-01

    In vivo imaging of the human retina with a resolution that allows visualization of cellular structures has proven to be essential to broaden our knowledge about the physiology of this precious and very complex neural tissue that enables the first steps in vision. Many pathologic changes originate from functional and structural alterations on a cellular scale, long before any degradation in vision can be noted. Therefore, it is important to investigate these tissues with a sufficient level of detail in order to better understand associated disease development or the effects of therapeutic intervention. Optical retinal imaging modalities rely on the optical elements of the eye itself (mainly the cornea and lens) to produce retinal images and are therefore affected by the specific arrangement of these elements and possible imperfections in curvature. Thus, aberrations are introduced to the imaging light and image quality is degraded. To compensate for these aberrations, adaptive optics (AO), a technology initially developed in astronomy, has been utilized. However, the axial sectioning provided by retinal AO-based fundus cameras and scanning laser ophthalmoscope instruments is limited to tens of micrometers because of the rather small available numerical aperture of the eye. To overcome this limitation and thus achieve much higher axial sectioning in the order of 2-5µm, AO has been combined with optical coherence tomography (OCT) into AO-OCT. This enabled for the first time in vivo volumetric retinal imaging with high isotropic resolution. This article summarizes the technical aspects of AO-OCT and provides an overview on its various implementations and some of its clinical applications. In addition, latest developments in the field, such as computational AO-OCT and wavefront sensor less AO-OCT, are covered.

  9. Review of adaptive optics OCT (AO-OCT): principles and applications for retinal imaging [Invited

    Science.gov (United States)

    Pircher, Michael; Zawadzki, Robert J

    2017-01-01

    In vivo imaging of the human retina with a resolution that allows visualization of cellular structures has proven to be essential to broaden our knowledge about the physiology of this precious and very complex neural tissue that enables the first steps in vision. Many pathologic changes originate from functional and structural alterations on a cellular scale, long before any degradation in vision can be noted. Therefore, it is important to investigate these tissues with a sufficient level of detail in order to better understand associated disease development or the effects of therapeutic intervention. Optical retinal imaging modalities rely on the optical elements of the eye itself (mainly the cornea and lens) to produce retinal images and are therefore affected by the specific arrangement of these elements and possible imperfections in curvature. Thus, aberrations are introduced to the imaging light and image quality is degraded. To compensate for these aberrations, adaptive optics (AO), a technology initially developed in astronomy, has been utilized. However, the axial sectioning provided by retinal AO-based fundus cameras and scanning laser ophthalmoscope instruments is limited to tens of micrometers because of the rather small available numerical aperture of the eye. To overcome this limitation and thus achieve much higher axial sectioning in the order of 2-5µm, AO has been combined with optical coherence tomography (OCT) into AO-OCT. This enabled for the first time in vivo volumetric retinal imaging with high isotropic resolution. This article summarizes the technical aspects of AO-OCT and provides an overview on its various implementations and some of its clinical applications. In addition, latest developments in the field, such as computational AO-OCT and wavefront sensor less AO-OCT, are covered. PMID:28663890

  10. Methemoglobinemia associated with loxoscelism Meta-hemoglobinemia associada ao loxoscelismo

    Directory of Open Access Journals (Sweden)

    Orlando C. de O. Barreto

    1990-02-01

    Full Text Available In twenty five patients who presented the cutaneous form of loxoscelism, serum haptoglobin and lactic dehydrogenase, erythrocyte glucose-6-phosphate dehydrogenase, glutathione reductase, glutathione peroxidase, methemoglobin, bilirubin and reticulocytes were investigated after bite. No hemolysis was detected but an increase in methemoglobin was found in 54% of the cases; in 7% it was between 1.1% and 2%, in 27% it ranged from 2.1% to 4%, and in 20% from 4.1% to 8%. Blood samples of a normal, blood group 0 individual and of a patient who exhibited methemoglobinemia after Loxosceles bite were incubated separately with antisera against Loxosceles gaucho, Crotalus terrificus, Bothrops jararaca, with Loxosceles gaucho venom and 0.3% phenol. No methemoglobin was found after 1, 4,8 and 15 days in both sets of samples. At the 25th day all the samples, including the controls, exhibited similar methemoglobin reductase decrease. The data suggest that the methemoglobinemia which occurs in 50% of the patients probably arises from in vivo venom metabolism, inasmuch as the crude venom does not induce methemoglobinemia.Vinte e cinco pacientes que apresentaram a forma cutânea do loxoscelismo foram estudados após a picada, determinando-se a glicose-6-fosfato desidrogenase, glutationa redutase e glutationa peroxidase eritrocitárias, haptoglobina e latico desidrogenase séricas, bilirrubina, reticulócitos e meta-hemoglobina. Não foi observada hemólise aumentada, mas foi detectado aumento da meta-hemoglobina em 54% dos casos: em 7% entre 1,1% e 2%, em 27% variou de 2,1% a 4%, e em 20% de 4,1 a 8%. Amostras de sangue de um indivíduo normal do grupo 0 de uma paciente que exibiu meta-hemoglobina após picada por Loxosceles foram incubadas separadamente com anti-soros contra Loxosceles gancho, Crotalus terrificus e Bothrops jararaca, com veneno de Loxosceles gaucho e fenol a 3%, e não se detectou aumento de meta-hemoglobina depois de 1, 4, 8 e 15 dias em todas

  11. Cuidado ao desenvolvimento: intervenções de proteção ao desenvolvimento inicial de recém-nascidos pré-termo Developmental care: protection approach for early development of preterm infants

    Directory of Open Access Journals (Sweden)

    Cláudia Maria Gaspardo

    2010-03-01

    Full Text Available OBJETIVO: Revisar ensaios clínicos randomizados, publicados entre 2002 e 2009, sobre a eficácia de intervenções em Cuidado ao Desenvolvimento em recém-nascidos pré-termo em Unidade de Terapia Intensiva Neonatal. FONTES DE DADOS: Foram selecionados estudos randomizados dos bancos de dados Medline, PsycINFO, ISI Web of Science, LILACS e SciELO, usando-se as palavras-chave "developmental care" e "neonate". Realizou-se uma análise metodológica dos estudos, com base nos critérios: randomização, estimativa do tamanho amostral, perda amostral, critérios de inclusão e exclusão, controle de variáveis de confusão, validade dos instrumentos, condição "cega" do pesquisador, realização de seguimento, validades externa e ecológica e cuidados éticos. SÍNTESE DOS DADOS: As intervenções em Cuidado ao Desenvolvimento promoveram melhora em curto prazo nos resultados fisiológicos, comportamentais, neurológicos e clínicos dos recém-nascidos. Observou-se diminuição da reatividade à dor nos recém-nascidos durante procedimentos de pesagem e troca de fraldas. Os pais que receberam intervenções em Cuidado ao Desenvolvimento passaram a apresentar maior senso de competência para cuidar do recém-nascido. Os profissionais treinados em Cuidado ao Desenvolvimento demonstraram melhor desempenho na assistência ao recém-nascido e valorizaram mais os estímulos ambientais, físicos e sociais. CONCLUSÕES: Intervenções em Cuidado ao Desenvolvimento na Unidade de Terapia Intensiva Neonatal promoveram benefícios ao desenvolvimento e saúde dos recém-nascidos pré-termo no período neonatal e no primeiro ano de vida. Em estudos futuros, recomenda-se maior rigor metodológico no que se refere à condição de pesquisador "cego" em relação às intervenções e controle das variáveis de confusão. Estudos prospectivo-longitudinais são necessários para avaliar a eficácia das intervenções em médio e longo prazo no desenvolvimento

  12. GERMINAÇAO DE SEMENTES DE Combretum leprosum MART.

    Directory of Open Access Journals (Sweden)

    MAURO VASCONCELOS PACHECO

    2014-01-01

    Full Text Available Combretum leprosum Mart. is a tree species native of the Caatinga, used in the restoration of degraded areas and in folk medicine. Thus, this research aimed to evaluate the germination and vigor of the seeds subjecting them to different pre-germinative treatments, temperatures and substrates. In the first experi- ment, we tested the pre-germinative treatments: mechanical scarification with sandpaper, chemical scarification with H2SO4 for 1, 5, 10 and 20 minutes, immersion in water at 80 oC and imbibition in distilled water for 24 hours, beyond of the control. In the second experiment, after treatment of imbibition in water for 24 hours, the experimental design was completely randomized in a factorial 5 x 4 (five substrates: into paper, sand, coconut fiber, vermiculite and paper towel organized in the form of rolls; and four temperatures: 25, 30, 35 and 20-30 oC. The following parameters were evalueted: seed moisture content, germination, germination speed index, first germination count and seedling length and dry matter weight. The seeds of Combretum leprosum have not coat dormancy. However, pre-germinative treatments of mechanical scarification with sandpaper and imbibi- tion in water for 24 hours allows better expression of seeds vigor. The paper towel and the temperatures of 25, 30 and 20-30 oC provide adequate conditions for evaluating the germination of Combretum leprosum seeds.

  13. Por que as pessoas recorrem ao Judiciário para obter o acesso aos medicamentos? O caso das insulinas análogas na Bahia

    OpenAIRE

    Lisboa, Erick Soares; Souza, Luis Eugenio Portela Fernandes de

    2017-01-01

    Resumo As insulinas análogas são alvo de controvérsias quanto à sua superioridade terapêutica em relação às humanas. Talvez, em parte, devido a isso, são objetos frequentes de ações judicias. A judicialização da saúde tem sido muito estudada, mas pouco se sabe sobre os motivos que levam as pessoas a recorrerem ao Judiciário para obter acesso a medicamentos no SUS. Sendo assim, o presente estudo tem por objetivo analisar os motivos que levaram as pessoas a recorrerem ao Judiciário para obter o...

  14. Fatores ambientais associados ao sobrepeso infantil Environmental factors associated with childhood overweight

    Directory of Open Access Journals (Sweden)

    Juliana Farias de Novaes

    2009-10-01

    Full Text Available OBJETIVO: Avaliar os fatores ambientais intra-uterinos, perinatais e familiares associados ao sobrepeso infantil, ainda controversos na literatura. MÉTODOS: Estudo transversal realizado com 627 crianças, de 6 a 10 anos, matriculadas em escolas urbanas públicas e privadas do município de Viçosa (MG. O estado nutricional das crianças foi classificado pelo índice de massa corporal, segundo a preconização do Centers for Disease Control and Prevention. Foram aferidas as medidas de peso, estatura, pregas cutâneas tricipital e subescapular, circunferências da cintura e do quadril e pressão arterial das crianças, sendo os fatores ambientais obtidos por meio de questionário, segundo informações maternas. Classificou-se o estado nutricional das mães segundo a recomendação do World Health Organization. RESULTADOS: Do total de crianças, 87,9% eram eutróficas e 12,1% apresentavam sobrepeso. De acordo com a análise de regressão logística múltipla, os fatores associados ao sobrepeso infantil foram apresentar mãe obesa (OR: 6,92; pOBJECTIVE: The objective of this study was to assess intrauterine, perinatal and family factors associated with childhood overweight, which are still controversial in the literature. METHODS: This cross-sectional study included a total of 627 children aged 6 to 10 years, who were enrolled in public and private schools in the city of Viçosa, Minas Gerais State. The nutritional status of the children was classified according to their body mass index, as recommended by the Centers for Disease Control and Prevention. The following data were collected: weight, height, tricipital and subscapular skinfold thicknesses, circumferences of the waist and hip, and blood pressure. The environmental factors were determined by means of a questionnaire, answered by the mother. The nutritional status of the mothers was classified according to the World Health Organization criteria. RESULTS: Out of 627 children, 551 were

  15. Dynamic SPECT of the brain using a lipophilic technetium-99m complex, PnAO

    DEFF Research Database (Denmark)

    Holm, S; Andersen, A R; Vorstrup, S

    1985-01-01

    The lipophilic 99mTc-labeled oxime propylene amine oxime (PnAO) should, according to recent reports behave like 133Xe in the human brain. This study compares SPECT images of the two tracers in six subjects: four stroke cases, one transitory ischemic attack case and one normal subject. Technetium-......AO has a high yet incomplete brain extraction yielding a flow dominated initial distribution with limitations mentioned.......The lipophilic 99mTc-labeled oxime propylene amine oxime (PnAO) should, according to recent reports behave like 133Xe in the human brain. This study compares SPECT images of the two tracers in six subjects: four stroke cases, one transitory ischemic attack case and one normal subject. Technetium-99......m PnAO was injected i.v. as a bolus of 15 to 25 mCi. The distribution was followed over 10-sec intervals using a highly sensitive, rapidly rotating SPECT (Tomomatic 64) and compared to 133Xe flow maps. Upon arrival of the PnAO bolus to the brain, a high uptake was found in brain tissue with high...

  16. Production of Alginate Oligosaccharides (AOS as Prebiotic Ingredients through by Alginate lyase enzyme

    Directory of Open Access Journals (Sweden)

    Fahriza Sri Afni

    2017-04-01

    Full Text Available Prebiotics is indigestible foods that can not be digested but can stimulate the growth and activity of bacteria in the digestive tract effecting human health. Alginate oligosaccharides (AOS can be used as a source of prebiotic. That compounds can be produced enzymatically by cutting long chain alginates using alginate lyase. The aim of this study was to produce alginate lyase enzyme then producing Alginate oligosaccharides (AOS as a prebiotic ingredients. The alginate lyase enzyme can be produced from Bacillus megaterium bacteria using a discontinuous fermentor. The enzyme was  optimum temperature of 45°C and an optimum pH of 7.0. Alginate oligosaccharides production was performed with the addition of different enzyme concentrations 25, 50, 75, and 100 U. The result of the addition of enzyme (25, 50,75 U showed that the value of polymerization degrees (DP were between 4-5. However, the addition of enzyme (100 U was in the range of  DP 3-4. Bacterial probiotic growth test results of Bifidobacteria and Lactobacillus showed that 1% added AOS media were able to increase the growth of probiotic bacteria compared to themedia without addition of AOS. The addition Alginate lyase activity of 50 U in AOS production is the best treatment of both probiotic bacteria.

  17. Morfologia e Crescimento dos 6 aos 10 anos de idade em Viana do Castelo, Portugal

    Directory of Open Access Journals (Sweden)

    Luis Paulo Rodrigues

    2008-09-01

    Full Text Available Ao longo de quatro anos, o Estudo Morfofuncional da Criança Vianense observou 1911 crianças entre os 6e os 10 anos de idade, resultando em 4064 observações individuais(2054 de raparigas, 2006 de rapazes.Os resultados encontrados nos indicadores morfológicos simples(altura, peso, pregas adiposas, diâmetros ósseos e perímetros muscularese no somatótipo, são descritos normativamente (valores percentílicose comparados com outros estudos nacionais e internacionais. As crianças vianenses demonstraram possuir uma estatura média ligeiramente superior às reportadas nos estudos portugueses e um ritmo de crescimento diferente das norte-americanas; peso semelhante ao das congéneres nacionais mas inferior ao das EUA; valores de pregas adiposas geralmente inferiores aos encontrados em Portugal e EUA; perímetros musculares e diâmetros ósseos semelhantes aos seus pares portugueses; e uma tendência para o aumento, com a idade, do ectomorfismo nos rapazes e do endomorfismo em ambos os sexos. Este panorama parece indicar que as crianças vianenses apresentam características de aptidão morfologia que estão longe de espelhar as preocupações internacionais nesta matéria.

  18. Relationship between winter AO/NAO and temperature in China: intraseasonal and interdecadal variations

    Science.gov (United States)

    Ren, Hong-Li; Zuo, Jinqing; Li, Weijing

    2017-04-01

    In this study, we focus on the intraseasonal and interdecadal variations in the relationship between winter AO/NAO (Arctic Oscillation / North Atlantic Oscillation) and surface air temperature (SAT) in China. On one hand, our results show that there is an intraseasonal contrast in impacts of AO/NAO on SAT in the central-southern China between early and mid-late winter. The linkage between AO and central-southern China SAT strongly depends on the AO-associated changes in Middle-East Jet Stream (MEJS) and the AO-MEJS relationship is significantly different between early and mid-late winter. On the other hand, our results also clearly show that inter-decadal changes have occurred in the relationship between the winter NAO and southern China surface air temperature anomalies in the past decades. A weak in-phase relationship occurred before the early 1970s, but a significant out-of-phase relationship dominated during 1979-1998, though it has been clearly weaker from the late 1990s onwards. Observational evidence shows that such interdecadal variations are mainly related to variations in the spatial pattern and amplitude of the NAO. The eastward shift and amplitude intensification of the NAO favored a north-south Asian dipole structure of circulation anomalies, which tended to produce cold SAT anomalies in central-southern China in the positive NAO phase and warm in the negative NAO phase.

  19. Toward an experimental validation of new AO concepts for future E-ELT instrumentation

    Science.gov (United States)

    El Hadi, K.; Fusco, T.; Le Roux, B.

    2012-07-01

    For the last few years, LAM has been carrying out several R&D activities in Adaptive Optics (AO) instrumentation for Extremely Large Telescopes (ELTs). In the European ELT framework, a multi-purpose AO bench is developed to allow the experimental validation of new instrumental concepts dedicated to the next generation of ELTs. It is based on the use of a Shack-Hartmann wave-front sensor in front of a 140 actuators micro-deformable mirror (Boston Micromachines), dedicated to “low orders” modes, while a Pyramid wave-front sensor (PWFS) will be combined to a Liquid Crystal Spatial Light Modulator for “high orders” correction. Both systems could be merged in a two stages AO concept allowing to study the coupling of a telescope pre-correction using a dedicated large M4 deformable mirror and a post focal high order AO system. Analysis and optimisation of the spatial and temporal splits of the AO correction between the two systems is therefore essential. Finally, we will use the world’s fastest and most sensitive camera system OCAM (developed at LAM) coupled with the pyramid , to demonstrate the concept of a fast and hyper-sensitive PWFS (up to 100x100 sub-pupils) dedicated to the first generation instruments for ELTs.

  20. Resposta de Sitophilus zeamais Motschulsky 1885 (Coleoptera: Curculionidae frente ao extrato de Capsicum annuum L.

    Directory of Open Access Journals (Sweden)

    Juliana Ferreira da Silva

    2013-08-01

    Full Text Available O uso desenfreado de agrotóxicos vem a ser um caso de saúde pública, pois prejudica a saúde do trabalhador do campo assim como do consumidor final desses produtos. O Sitophilus zeamais é uma praga de armazenamento que ataca o milho, e no combate a essa praga comumente é utilizado produtos tóxicos. Visando essa problemática, a busca por produtos alternativos vem a ser um campo de investigação promissor, pois esse método de controle não gera resíduos para o homem tão pouco ao meio ambiente. O extrato utilizado para avaliar o potencial de repelência foi o de Capsicum annuum L. popularmente conhecido como pimentão. Os testes foram realizados com a utilização de arenas, onde em cada arena foram liberados 30 adultos de S. zeamais, não sexados e após 24 horas, foram registrados o número de insetos em cada recipiente. Os grãos de milho foram tratados com volume de extrato correspondente a 1,0% da massa de grãos, nas concentrações 0,0 (álcool 70%; 25,0; 50,0; 75,0 e 100,0% (volume de extrato/volume álcool. O experimento foi organizado segundo o delineamento inteiramente casualizado e constou de cinco tratamentos e quatro repetições. As maiores repelências foram observadas nas concentrações de 25% e 100%, repelindo 72 e 70% dos insetos respectivamente. Sendo assim a utilização desse extrato pode ser empregado no tratamento de sementes armazenadas, evitando assim uma maior infestação desses insetos, preservando assim a integridade física e fisiológica das sementes.

  1. Cantaria em louvação ao dia do Barroco Mineiro e homenagem ao poeta e ensaísta Affonso Ávila

    Directory of Open Access Journals (Sweden)

    Cristina Ávila

    2013-12-01

    Full Text Available É com profunda comoção que, em nome de minha família, agradeço a prestigiosa homenagem concedida pela Pontifícia Universidade Católica de Minas Gerais – PUCMinas e pela Assembleia Legislativa do Estado de Minas Gerais ao reconhecido e saudoso poeta e ensaísta do Barroco Mineiro, Affonso Ávila. O convite para a participação neste debate acadêmico, feito ao próprio homenageado pela Prof. Dra. Melânia da Silva Aguiar, foi recebido por ele com enorme entusiasmo, mas quis o destino que ele se fosse antes da data prevista. Como historiadora da arte e cultura estou presente apenas para contemplar alguns aspectos de sua obra, especialmente no que se refere aos estudos de Barroco, mas não posso substituir o depoimento do ensaísta que seria, com certeza, bem mais interessante.

  2. Práticas educativas maternas e paternas aos 24 e aos 72 meses de vida da criança

    Directory of Open Access Journals (Sweden)

    Angela Helena Marin

    Full Text Available Este estudo investigou as práticas educativas indutivas, coercitivas e de não interferência maternas e paternas aos 24 e 72 meses de vida da criança. Participaram 24 mães e pais de um único filho/a, que responderam uma entrevista para avaliação dessas práticas. Análises estatísticas revelaram que as mães foram significativamente mais indutivas que os pais aos 24 meses, mas aos 72 meses não houve diferenças. Enfatiza-se que as mães tendem a conversar mais com seus filhos/as, expressar sentimentos, opiniões, estabelecer limites e elogiar comportamentos adequados. As mães também apresentaram médias mais elevadas no total de práticas relatadas, o que pode ser explicado pelo papel predominante que ainda exercem na socialização infantil, embora os pais venham participando mais da educação dos filhos/as.

  3. Níveis NT-Pro-BNP e resposta ao exercício em pacientes com fluxo lento coronariano

    OpenAIRE

    Mustafa Yurtdaş; İsmail Türkay Özcan; Ahmet Çamsar; Dilek Çiçek; Lülüfer Tamer; Veli Gökhan Cin; Oben Döven; Ali Sabri Seyis; Mehmet Necdet Akkuş

    2012-01-01

    FUNDAMENTO: Os peptídeos natriuréticos são liberados pelo coração em resposta ao estresse da parede. OBJETIVO: As concentrações de NT-Pro-BNP em pacientes com Fluxo Lento Coronariano (FLC) foram avaliadas antes e depois do teste de exercício e comparados com os valores dos controles saudáveis. MÉTODOS: A população do estudo foi de 34 pacientes com FLC [22 homens (64,7%), com idade 51,0 ± 6,2 anos], e 34 indivíduos normais com artérias coronarianas normais [21 homens (61,8%), com idade 53,2 ± ...

  4. Efeitos comportamentais e imunológicos da fluoxetina em ratos submetidos ao nado forçado

    Directory of Open Access Journals (Sweden)

    Eduardo Vignoto Fernandes

    Full Text Available No presente trabalho, os efeitos comportamentais e imunomoduladores da fluoxetina foram avaliados num modelo animal de depressão, o nado forçado. Nesse, o comportamento de flutuar é sensível a antidepressivos e é usado como índice de desespero comportamental. Foram utilizados dois grupos experimentais, sendo um grupo controle tratado com salina e outro grupo teste tratado com a fluoxetina, ambos administrados por via intra-peritoneal. Os animais foram tratados três vezes ao dia por 12 dias. Adicionalmente, a resposta imune humoral a uma imunoestimulação (hemácias de carneiro foi avaliada. A fluoxetina provocou aumento no tempo em flutuação, queda na massa corporal e menor produção total de anticorpos. Os resultados indicam uma modulação simultânea do comportamento e do sistema imunológico pela fluoxetina.

  5. Simultaneous removal of nutrients from milking parlor wastewater using an AO2 sequencing batch reactor (SBR) system.

    Science.gov (United States)

    Wu, Xiao; Zhu, Jun

    2015-01-01

    The feasibility of using a lab-scale, anaerobic-aerobic-anoxic-aerobic sequencing batch reactor ((AO)2 SBR) to simultaneously remove biological organics, nitrogen and phosphorus from dairy milking parlor wastewater was investigated in this study. Three hydraulic retention times (HRT = 2.1, 2.7, and 3.5 days) and three mixing-to-process time ratios (TM/TP = 0.43, 0.57, and 0.68) were evaluated as two controlling factors using a 3 × 3 experimental design to determine the optimal combination. Results showed that the HRT of 2.7 days with TM/TP = 0.57 was the best to achieve simultaneous nutrients removal for the influent with initial soluble chemical oxygen demand (SCOD) of about 2000 mg L(-1) (only 0.55 mg L(-1) NH4-N, SBR system to save energy and enhance treatment efficiency.

  6. Up-Regulated Expression of AOS-LOXa and Increased Eicosanoid Synthesis in Response to Coral Wounding

    Science.gov (United States)

    Lõhelaid, Helike; Teder, Tarvi; Tõldsepp, Kadri; Ekins, Merrick; Samel, Nigulas

    2014-01-01

    In octocorals, a catalase–like allene oxide synthase (AOS) and an 8R-lipoxygenase (LOX) gene are fused together encoding for a single AOS-LOX fusion protein. Although the AOS-LOX pathway is central to the arachidonate metabolism in corals, its biological function in coral homeostasis is unclear. Using an acute incision wound model in the soft coral Capnella imbricata, we here test whether LOX pathway, similar to its role in plants, can contribute to the coral damage response and regeneration. Analysis of metabolites formed from exogenous arachidonate before and after fixed time intervals following wounding indicated a significant increase in AOS-LOX activity in response to mechanical injury. Two AOS-LOX isoforms, AOS-LOXa and AOS-LOXb, were cloned and expressed in bacterial expression system as active fusion proteins. Transcription levels of corresponding genes were measured in normal and stressed coral by qPCR. After wounding, AOS-LOXa was markedly up-regulated in both, the tissue adjacent to the incision and distal parts of a coral colony (with the maximum reached at 1 h and 6 h post wounding, respectively), while AOS-LOXb was stable. According to mRNA expression analysis, combined with detection of eicosanoid product formation for the first time, the AOS-LOX was identified as an early stress response gene which is induced by mechanical injury in coral. PMID:24551239

  7. Physical properties of the Algol-type eclipsing binary AO Ser

    Science.gov (United States)

    Chehlaeh, N.; Lampens, P.; Mkrtichian, D.; Van Cauteren, P.; Vermeylen, L.; Komonjinda, S.

    2017-09-01

    We present the results of a combined analysis of photometric time series and spectroscopic observations for the semi-detached eclipsing binary AO Ser aimed to study physical parameters of the system. New CCD photometric light curves in the B and V bands and radial velocities of AO Ser are presented. The Wilson-Devinney technique was used to simultaneously analyze the light and radial velocity curves for determining a new set of the system’s parameters. The solution shows that AO Ser is a semi-detached eclipsing binary system with a mass ratio of 0.183 ± 0.003, an inclination of 89.42 ± 0.04 degrees and a secondary star’s temperature of 4900 K.

  8. A Arqueologia do cuidado: da prática ao discurso

    Directory of Open Access Journals (Sweden)

    Sidi Askofare

    2006-06-01

    Full Text Available A noção de cuidado, assimilada há muito tempo ao tratamento e, então, ao conceito de terapêutica, retorna, logo depois, nos estudos, pesquisas e reflexões nas ciências humanas. Mas, daí em diante, está emancipado de suas aderências e conotações médicas por serem demasiadamente redutoras. O presente artigo propõe uma arqueologia (no sentido foucaultiano do cuidado &– de suas origens animais às suas formas culturalmente e historicamente definidas &– e põe em evidência a subversão que produz no campo do cuidado &– das práticas aos discursos &– a emergência e a dominação do discurso da ciência.

  9. O Ocaso da Utopia Telecomunicacional: regular para quem no tocante ao Direito Fundamental à Privacidade?

    Directory of Open Access Journals (Sweden)

    Conselho Editorial

    2014-05-01

    Full Text Available O presente estudo figura como introdução à Revista de Direito, Estado e Telecomunicações do Grupo de Estudos em Direito das Telecomunicações da Universidade de Brasília, abordando sinteticamente a estrutura, conteúdo e política editorial da revista. Em acréscimo, o texto analisa os principais acontecimentos do setor no Brasil, bem como normas e julgados relativos ao ano de 2013, para registro das principais discussões político-jurídicas do setor de telecomunicações brasileiro referentes ao ano anterior ao da publicação.

  10. Sensibilidade de laranjeiras-doces ao deficit hídrico

    OpenAIRE

    Ramos, Yuri Caires; Mourão Filho, Francisco de Assis Alves; Stuchi, Eduardo Sanches; Sentelhas, Paulo Cesar; Fadel, André Luiz

    2016-01-01

    Resumo: O objetivo deste trabalho foi avaliar a sensibilidade ao deficit hídrico de 17 seleções de laranja-doce enxertadas sobre tangerineira 'Sunki', ao longo de cinco safras. Empregou-se um modelo agrometeorológico de penalização da produtividade pelo deficit hídrico, tendo-se avaliado a relação entre os valores estimados e observados. As seleções podem ser classificadas como de alta, média e baixa sensibilidade ao deficit hídrico, classificação que é inédita para as condições brasileiras. ...

  11. ESTUDO DE PROBLEMAS DE ENFERMAGEM REFERENTES AO CABELO E COURO CABELUDO EM PACIENTES HOSPITALIZADOS

    Directory of Open Access Journals (Sweden)

    Maria Romana Friedlander

    Full Text Available A autora procurou identificar os tipos e os problemas de enfermagem referentes ao cabelo e couro cabeludo, apresentados por pacientes internados em clínicas médicas e cirúrgicas gerais de um hospital governamental de ensino. Identificou 4 classes de problemas: estado de limpeza, lesões, infestações e penteação. Cada classe foi subdividida em graus os quais foram denominados tipos de problemas. A proporção de problemas por paciente encontrada foi 0,80 e a proporção de pacientes com problemas foi 58%. Foram também estudadas algumas condições que podem intervir no cuidado ao cabelo e ao couro cabeludo e foram obtidas informações sobre hábitos e costumes apresentados pelos pacientes.

  12. A Exposição ao Risco das Famílias

    OpenAIRE

    Amaro, Ana Raquel

    2014-01-01

    A presente Dissertação de Mestrado aborda a exposição ao risco financeiro das famílias. Ao longo do trabalho serão abordados temas como a heurística, as finanças comportamentais, a percepção do risco e a exposição ao risco. Estes são os conceitos que foram considerados como sendo fundamentais e os principais responsáveis pela tomada de decisões a nível financeiro das famílias. Este estudo é de natureza quantitativa e pretenderá tirar conclusões da população em geral tendo em consideraçã...

  13. Obtenção de plantas de feijão-caupi resistentes ao Cowpea severe mosaic virus e ao Cowpea aphid-borne mosaic virus

    Directory of Open Access Journals (Sweden)

    Gislanne Brito Barros

    2013-06-01

    Full Text Available Dentre os vírus que infectam o feijão-caupi (Vigna unguiculata L. Walp. destacam-se, respectivamente, pela severidade e ampla ocorrência o Cowpea severe mosaic virus (CPSMV e o Cowpea aphid-borne mosaic virus (CABMV. Portanto, objetivaram-se, no presente trabalho, obter e avaliar plantas de feijão-caupi com resistência ao CPSMV e ao CABMV, visando ao desenvolvimento de cultivares essencialmente derivadas e novas cultivares. Realizaram-se oito cruzamentos seguidos de retrocruzamentos, utilizando a linhagem TE 97-309G-9 e a cultivar Patativa como genitores resistentes, e as cultivares BR3-Tracuateua, BRS-Urubuquara, BRS-Novaera, BRS-Guariba e Pretinho como genitores suscetíveis. As gerações F2 e F2RC1 foram desafiadas quanto à resistência por meio de inoculação mecânica com isolados do CPSMV e do CABMV. Nas gerações F2RC1, além da resistência foram avaliados os caracteres: número de dias para o início da floração, comprimento das vagens, número de grãos. vagem-1, peso de cem grãos e produção de grãos.planta-1. Todos os indivíduos F2 e F2RC1 foram analisados pelo teste χ² e se ajustaram à frequência esperada de 15 plantas suscetíveis 1 planta resistente a ambos os vírus. As médias das plantas F2RC1 resistentes, de cada retrocruzamento, foram comparadas com a média do seu respectivo genitor recorrente pelo teste 't' e as médias dos retrocruzamentos foram comparadas pelo teste de Scott-Knott. Foi detectada variabilidade genética entre os retrocruzamentos para todos os caracteres. Todos os retrocruzamentos foram considerados promissores para produção de cultivares essencialmente derivadas resistentes ao CPSMV e ao CABMV e as plantas selecionadas possuem características que possibilitam a seleção de linhagens com grãos de bom padrão comercial e altamente produtivas.

  14. Fatores associados ao tempo de espera e ao acesso ao transplante renal em Belo Horizonte, Minas Gerais, Brasil Factors associated with waiting time and access to kidney transplants in Belo Horizonte, Minas Gerais State, Brazil'

    Directory of Open Access Journals (Sweden)

    Elaine Leandro Machado

    2012-12-01

    Full Text Available O objetivo deste artigo foi analisar os fatores associados ao acesso ao transplante renal com doador vivo e cadáver em Belo Horizonte, Minas Gerais, Brasil. Foi realizado um estudo de coorte não concorrente com pacientes inscritos na lista de espera por transplante renal, entre 2000 e 2004, os quais foram acompanhados até o transplante, óbito, exclusão ou permanência na fila de espera ao fim do estudo em 31 de dezembro de 2005. Utilizou-se o modelo de Cox para riscos competitivos. Dos 835 pacientes, 22,7% foram transplantados. Apresentaram menor risco de transplante por doador cadáver e vivo os pacientes com maior tempo em diálise e tipo sanguíneo O. Observou-se menor risco de transplante intervivos para residentes em uma área de alto risco à saúde e portadores de diabetes. A maior disparidade de acesso foi para transplante renal intervivos, uma vez que não houve diferenças sociodemográficas significativas para transplante por doador cadáver. Pode-se inferir que o sistema de alocação de órgãos contribuiu para amenizar desigualdades sociodemográficas, sendo as questões clínicas mais relevantes no acesso ao transplante com doador cadáver.The objective of this study was to analyze factors associated with access to kidney transplants from living and cadaver donors in Belo Horizonte, Minas Gerais State, Brazil. The authors conducted a non-concurrent cohort study of patients on the waiting list for kidney transplants from 2000 to 2004 and followed until transplantation, death, exclusion, or continued presence on the line at the end of the study on December 31, 2005. The Cox model was used for competing risks. Of the 835 patients, 22.7% were transplanted. Lower risk of transplantation from living donors and cadavers was observed in patients with more time on dialysis and blood type O. Lower risk of transplantation from living donors was observed in residents in a high health risk area and in recipients with diabetes. The

  15. Atividade antiviral e virucida de extratos hidroalcoólicos de própolis marrom, verde e de abelhas Jataí (Tetragonisca angustula frente ao herpersvírus bovino tipo 1 (BoHV-1 e ao vírus da diarreia viral bovina (BVDV

    Directory of Open Access Journals (Sweden)

    Cristina Mendes Peter

    Full Text Available RESUMO: Dentre as propriedades biológicas da própolis, a atividade antimicrobiana tem merecido destacada atenção. No presente trabalho, descreve-se a ação antiviral e virucida de três extratos hidroalcoólicos de própolis (marrom, verde e de abelhas jataí (Tetragonisca angustula, frente ao Herpesvírus Bovino tipo (BoHV-1 e ao Vírus da Diarreia Viral Bovina (BVDV. Os três extratos hidroalcoólicos foram obtidos de extração etanólica e são oriundos do sul do Brasil. A composição química dos extratos de própolis foi determinada pela cromatografia líquida de alta eficiência acoplada a espectrômetro de massas (UFLC-PDA-ESI-TOF/MS que identificou e quantificou compostos como: ácido cafeico e ácido p-cumárico, ácido clorogênico, ácido ferúlico, além de flavonoides como a rutina. A toxicidade celular bem como a atividade antiviral dos extratos de própolis em monocamadas de células MDBK (Madin-Darby Bovine Kidney foi avaliada através de observação microscópica e quantificada pelo teste de MTT (3-(4,5 dimetiltiazol-2yl-2-5-difenil-2H tetrazolato de bromo. O extrato de própolis de abelhas jataí demonstrou ser menos citotóxico (1,57μg/mL, quando comparado aos extratos verde (0,78μg/mL e marrom (0,39μg/mL. Quanto a atividade antiviral, a própolis verde demostrou maior eficácia em ambos os tratamentos celulares (pós e pré-exposição frente ao BoHV-1 em relação aos outros extratos, ou seja, houve maior viabilidade celular quando comparada aos controles de células e vírus. Já a de jataí apresentou atividade frente aos dois vírus (BoHV-1 e BVDV no método pré-infecção, enquanto a própolis marrom demonstrou ação apenas frente ao BoHV-1 também no método pré-infecção. Para determinação da atividade virucida foram utilizadas diferentes diluições dos vírus, bem como temperaturas e tempos distintos de incubação. A própolis verde a 37°C propiciou a maior redução no título viral (4,33log em

  16. Facilitadores e barreiras de retorno ao trabalho de trabalhadores acometidos por LER/DORT

    Directory of Open Access Journals (Sweden)

    Jorge Henrique Santos Saldanha

    Full Text Available INTRODUÇÃO: As Lesões por Esforços Repetitivos/Distúrbios Osteomusculares Relacionados ao Trabalho (LER/DORT causam afastamento do trabalho de uma grande parcela de trabalhadores. OBJETIVO: Entender e sistematizar de que forma os fatores relacionados ao retorno ao trabalho (RT de trabalhadores acometidos por LER/DORT são descritos na literatura como facilitadores ou barreiras. MÉTODOS: Revisão crítica de literatura do período de janeiro de 2005 a outubro de 2010 disponível nas bases Lilacs, MedLine e SciELO. As informações foram sistematizadas em três categorias de fatores que influenciam o RT e como facilitadores ou barreiras - de ordem pessoal, de ordem organizacional e relacionadas às características dos serviços, sistemas e políticas. RESULTADOS: Dos 633 artigos inicialmente levantados, 21 atenderam aos critérios de inclusão. Fatores identificados como mais relevantes: de ordem pessoal - dor, fatores psicossociais, afastamento do trabalho; organizacionais - modificações nos postos de trabalho, demanda psicológica do trabalho, apoio organizacional, apoio de colegas e da chefia; relacionados aos serviços, sistemas e políticas - programa de retorno ao trabalho, tempo de afastamento e serviços de apoio. CONCLUSÃO: O estudo evidenciou que o RT é um processo complexo, que demanda políticas intersetoriais, cooperação técnica e pactuação de metas entre os atores envolvidos no processo.

  17. Deep-water sponges (Porifera) from Bonaire and Klein Curaçao, Southern Caribbean.

    Science.gov (United States)

    Van Soest, Rob W M; Meesters, Erik H W G; Becking, Leontine E

    2014-10-29

    Four submersible dives off the coast of Bonaire (Caribbean Netherlands) and Klein Curaçao (Curaçao) to depths of 99.5-242 m, covering lower mesophotic and upper dysphotic zones, yielded 52 sponge specimens belonging to 31 species. Among these we identified 13 species as new to science. These are Plakinastrella stinapa n. sp., Pachastrella pacoi n. sp., Characella pachastrelloides n. sp., Geodia curacaoensis n. sp., Caminus carmabi n. sp., Discodermia adhaerens n. sp., Clathria (Microciona) acarnoides n. sp., Antho (Acarnia) pellita n. sp., Parahigginsia strongylifera n. sp., Calyx magnoculata n. sp., Neopetrosia dutchi n. sp., Neopetrosia ovata n. sp. and Neopetrosia eurystomata n. sp. We also report an euretid hexactinellid, which belongs to the rare genus Verrucocoeloidea, recently described (2014) as V. liberatorii Reiswig & Dohrmann. The remaining 18 already known species are all illustrated by photos of the habit, either in situ or 'on deck', but only briefly characterized in an annotated table to confirm their occurrence in the Southern Caribbean. The habitat investigated-steep limestone rocks, likely representing Pleistocene fossil reefs--is similar to deep-water fossil reefs at Barbados of which the sponges were sampled and studied by Van Soest and Stentoft (1988). A comparison is made between the two localities, showing a high degree of similarity in sponge composition: 53% of the present Bonaire-Klein Curaçao species were also retrieved at Barbados. At the level of higher taxa (genera, families) Bonaire-Klein Curaçao shared approximately 80% of its lower mesophotic and upper dysphotic sponge fauna with Barbados, despite a distance between them of 1000 km, indicating high faunal homogeneity. We also preliminarily compared the shallow-water (euphotic) sponge fauna of Curaçao with the combined data available for the Barbados, Bonaire and Klein Curaçao mesophotic and upper dysphotic sponges, which resulted in the conclusion that the two faunas show only

  18. Adesão ao Tratamento em Gestação de Alto Risco

    Directory of Open Access Journals (Sweden)

    Fabíola Langaro

    Full Text Available No Brasil, aproximadamente 15% das gestações são de alto risco, sendo os diagnósticos de diabetes gestacional e hipertensão as causas mais frequentes dessa condição. Para a efetividade dos tratamentos indicados nesses casos, bem como alcance de desfechos favoráveis, é essencial a adesão da paciente às recomendações fornecidas pelas equipes de saúde, o que torna fundamental a avaliação desse indicador. A pesquisa apresentada avaliou a adesão de participantes de um programa de atendimento interdisciplinar a gestantes de alto risco desenvolvido em um hospital geral privado por meio de três instrumentos: Questionário Morisky-Green de adesão ao uso de medicação, Questionário de Adesão ao Tratamento e Pergunta descritiva de avaliação qualitativa. Durante oito meses, 83 gestantes responderam aos questionários, que possibilitaram identificar níveis de adesão ao longo do tempo de participação no programa, situações de não adesão mais frequentes, bem como variáveis que interferem nas medidas de adesão ao uso de medicação e ao tratamento global. Considera-se que os índices levantados são passíveis de uso como indicadores clínicos e gerenciais, possibilitando a comprovação da efetividade e melhoria constante das rotinas de saúde. Tais mecanismos são úteis para definição de protocolos, discussão de casos clínicos e mesmo para feedbackàs próprias pacientes.

  19. Ressalto no canto posteromedial do joelho relacionado ao músculo sartório

    Directory of Open Access Journals (Sweden)

    Marcello Henrique Nogueira-Barbosa

    2011-06-01

    Full Text Available As causas da síndrome de ressalto no joelho relatadas com maior frequência são relacionadas a anormalidades meniscais, ao tendão do músculo bíceps femoral e aos tendões grácil e semitendíneo. Neste trabalho é descrito um caso de ressalto no canto posteromedial relacionado à junção miotendínea do músculo sartório em um paciente do sexo masculino, de 58 anos de idade, com hiperextensão do joelho.

  20. O panorama das Drogas no México: da margem da sociedade ao centro da cultura

    OpenAIRE

    Diana Palaversich

    2013-01-01

    O artigo destaca o percurso das manifestações culturais ligadas ao tráfico de drogas no México, de um lugar marginal, de subcultura, na sociedade mexicana das décadas de 1970 e 1980, expressas principalmente através dos narcocorridos e do narcocine, para um lugar no mainstream cultural mexicano, desde o início do século 21, com destaque especial para a narcoliteratura. O aumento da violência, provocado pela guerra ao narcotráfico, produz uma proliferação da temática nos meios de comunicação e...

  1. The Ashkenazi Jews of Curaçao, a trading minority

    Directory of Open Access Journals (Sweden)

    Eva Abraham-Van der Mark

    2000-07-01

    Full Text Available First describes the early Sephardi presence in Curaçao, the arrival of the Ashkenazi in the 20th c., and the relations between these 2 groups. Author goes on to discuss the Ashkenazis' economic success and the exodus of the 1980s. She asks whether the success and the exodus can be attributed to the characteristics of the group itself or whether conditions and developments in Curaçao account for economic fortune and the departure of the Ashkenazi.

  2. A MEMÕRIA DE JESUS E A MANVFESTAÇAO DO PAI NO QUARTO EVANGELHO

    Directory of Open Access Journals (Sweden)

    Johan Konings

    1988-01-01

    Full Text Available Não somos os primeiros a constatar que as cristologias narrativas pouco se inspiram no Quarto Evangelho (QE, tanto na atual teologia latino-americana como na europeia, de E. Schillebeeckx, por exemplo. Entretanto, as cristologias especulativas usam amplamente pelo menos o prólogo de João como ponto de partida para suas especulações. Será que este tratamento faz jus ao QE, ou repousa num preconceito espiritualista com relação ao evangelho que Clemente de Alexandria chamou de "espiritual"?

  3. [Study on Provenance of Kraak Porcelains from "Nan'ao I" Shipwreck].

    Science.gov (United States)

    Du, Jing-nan; Chen, Yue; Li, Nai-sheng; Ming, Chao-fang; Zhu, Jian; Luo, Wu-gan

    2015-06-01

    The "Kraak Porcelain" was a kind of Blue and White Porcelain which exported from China to Europe in Ming and Qing period. The study of Kraak Porcelain is a focus issue in international field of porcelain research. In 2007, the discovery of "Nan'ao I" Shipwreck of Ming Dynasty and the porcelains loaded in it, provided precious materials for the research on Kraak Porcelain. In this paper, we explored the provenance of 10 Kraak Porcelain samples from Nan'ao I, using both traditional visual method and WDXRF.

  4. Resistência ao Consumo em um Circuito Urbano de Parkour

    Directory of Open Access Journals (Sweden)

    Tatiana Maria Bernardo da Silva

    2011-08-01

    Full Text Available A partir de uma pesquisa alinhada ao método etnográfico, o presente trabalho tem por objetivo investigar os valores e as práticas de resistência ao consumo adotadas pelos membros de um circuito urbano de parkour no Rio de Janeiro. Confiando em uma abordagem indutiva e interpretativa amparada por um estudo empírico de base qualitativa, foram exploradas quatro categorias de análise: (1 a resistência como valor essencial; (2 um percurso de doação; (3 o consumo aprisiona; e (4 mobilização social e resistência.

  5. COMPORTAMENTO ÉTICO E CRÍTICA AO PRECONCEITO BURGUÊS

    OpenAIRE

    Carli, Ranieri

    2014-01-01

    Este artigo procura delinear os componentes mais elementares de uma ética marxista, para então focar na lacuna que há entre o preconceito, que se atém àquilo que existe de particular e imediato no homem, e o comportamento de natureza essencialmente ética, que se eleva à generalidade. A intenção é demonstrar como o preconceito limita-se ao chão raso do cotidiano, ao passo que, no polo oposto, a ética supera-o, purificando o homem singular rumo à universalidade genérica. Enfim, tomaremos alguns...

  6. Perfil das atitudes de formandos em enfermagem frente aos transtornos mentais no Brasil, Chile e Peru

    OpenAIRE

    Luiz Jorge Pedrão; Sueli Aparecida Frari Galera; Maria Concepcion Pezo Silva; Angelica Cazenave Gonzalez; Moacyr Lobo da Costa Júnior; Souza,Maria Conceição Bernardo de Mello e; Gricelda Uceda Senmache

    2005-01-01

    Este estudo teve por objetivo traçar um perfil de atitudes de formandos em enfermagem frente aos transtornos mentais em três culturas diferentes: Brasil, Chile e Peru. Para isso foi utilizada a escala de opiniões sobre a doença mental. Os resultados mostraram diferenças estatisticamente significantes no nível de 5% nos fatores autoritarismo, ideologia de higiene mental, restrição serial e visão minoritária, favoráveis aos estudantes brasileiros. No fator etiologia interpessoal, os resultados ...

  7. Imunidade celular em caninos neonatos - do nascimento ao 45° dia de idade

    Directory of Open Access Journals (Sweden)

    R.P. Klein

    2014-06-01

    Full Text Available O objetivo do presente trabalho foi acompanhar o desenvolvimento imunológico dos neonatos caninos, a fim de avaliar a imunidade celular pela análise dos leucócitos e linfócitos totais e das subpopulações de linfócitos T (CD4+ e CD8+ pela técnica de citometria de fluxo. Foram utilizados 30 cães neonatos de ambos os sexos, sem raça definida, aos três, 10, 17, 24, 31, 38 e 45 dias de idade. A contagem de leucócitos totais aos 45 dias (11.639±3.574 foi significativamente maior que no terceiro dia de idade (8.740±1.812 (P<0,05; não houve diferença entre a contagem total de linfócitos aos 45 dias em relação ao terceiro dia de idade. Quanto às subpopulações de LT CD4+ e LT CD8+, os percentuais de LT CD4+, aos três dias de idade (24,9±16,8%, foram inferiores quando comparados à média entre o 10°, o 24° e o 31°dia (35,5%, e os de CD8+, ao terceiro dia, menores em relação às médias do 10° e do 31° dia de idade. Pode-se concluir que as subpopulações de LT CD4+ e CD8+ sofrem oscilações durante o desenvolvimento pós-natal, sendo estas crescentes em relação aos níveis obtidos aos três dias de idade. A relação CD4+:CD8+ mostrou superioridade para o primeiro tipo celular, sendo que a maior relação entre CD4+ e CD8+ ocorreu no terceiro dia de idade. Com base nos resultados obtidos neste estudo, notaram-se as diferenças semanais nas populações linfocitárias, o que demonstra a dinâmica dessas células durante o período neonatal.

  8. Características individuais e contextuais associadas ao bullying entre escolares no Brasil

    OpenAIRE

    Catarina Machado Azeredo

    2015-01-01

    O bullying escolar é um importante problema de saúde pública que vem sendo extensivamente estudado em países de alta renda. Nos países de baixa e média renda, características individuais e contextuais associadas ao bullying são pouco conhecidas. A presente tese é composta por três estudos. O estudo 1 objetivou realizar revisão sistemática sobre fatores contextuais associados ao bullying escolar. A busca utilizou as bases de dados MEDLINE, PsychInfo, Web of Knowledge e SciELO. Trinta e um estu...

  9. Adesão ao tratamento clínico no transtorno de personalidade borderline

    OpenAIRE

    Tanesi,Patrícia Helena Vaz; Yazigi,Latife; Fiore,Maria Luiza de Mattos; Pitta,José Cássio do Nascimento

    2007-01-01

    Adesão é um comportamento complexo, envolve desde pequenas recusas ao tratamento até o uso inadequado dos serviços de saúde e abandono do tratamento. O presente trabalho é um estudo qualitativo com seis pacientes com transtorno de personalidade borderline sobre adesão ao tratamento, utilizando análise qualitativa em entrevista aberta, questionário psicossocial, classificação diagnóstica pela SCID I e II e acompanhamento clínico. Os resultados mostraram que impulsividade, manipulação, dissocia...

  10. ANÁLISE DAS POLÍTICAS FISCAIS E MONETÁRIAS PARA O SETOR AGROALIMENTAR E SUAS INFLUENCIAS AO BEM ESTAR DO CONSUMIDOR

    Directory of Open Access Journals (Sweden)

    LEANDRO PESSOA LUCENA

    2014-08-01

    Full Text Available Normal 0 21 false false false PT-BR X-NONE X-NONE /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Tabela normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin-top:0cm; mso-para-margin-right:0cm; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0cm; line-height:115%; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;} As cadeias agroalimentares no mundo tem sido alvo de fortes políticas governamentais de controle e segurança nacional nas ultimas décadas. Algumas dessas políticas tem se pautado ao uso intensivo de subsídios agrícolas ou de proteção ao mercado doméstico através de alíquotas de importação e/ou exportação. Proveniente a esse contexto, o trabalho teve como objetivos: determinar quais conseqüências ocorre ao setor alimentício dado à incidência de subsídios governamentais as cadeias agroalimentares. Bem como, análise do bem-estar do consumidor em relação ao custo da cesta básica. Os métodos aplicados foram: versão adaptada do Modelo Mundell Fleming de políticas fiscais e monetárias e a utilização do Método dos Números Índices. Os resultados desse trabalho apontam que uma política monetária expansionista com maiores concessões de crédito e subsídios, tende a trazer fatores positivos ao setor alimentício, consolidando o mesmo ao contexto de ampliação pela produção de bens com maior valor agregado. Quanto ao custo de vida dos consumidores em relação ao consumo da cesta básica, foi caracterizado que suas condições na

  11. Linear quadratic Gaussian control for adaptive optics and multiconjugate adaptive optics: experimental and numerical analysis.

    Science.gov (United States)

    Petit, Cyril; Conan, Jean-Marc; Kulcsár, Caroline; Raynaud, Henri-François

    2009-06-01

    We present a comprehensive analysis of the linear quadratic Gaussian control approach applied to adaptive optics (AO) and multiconjugated AO (MCAO) based on numerical and experimental validations. The structure of the control law is presented and its main properties discussed. We then propose an extended experimental validation of this control law in AO and a simplified MCAO configuration. Performance is compared with end-to-end numerical simulations. Sensitivity of the performance regarding tuning parameters is tested. Finally, extension to full MCAO and laser tomographic AO (LTAO) through numerical simulation is presented and analyzed.

  12. Análise genética de isolados do Haemonchus sp de ruminantes domésticos para identificação da resistência ao anti-helmíntico Benzimidazol

    OpenAIRE

    Ronaldo Luiz Nunes

    2012-01-01

    O objetivo deste trabalho é caracterizar geneticamente a resistência ao anti-helmíntico benzimidazol (BZ) em helmintos Haemonchus sp isolados de ruminantes. Para tanto trinta animais pertencentes a um rebanho de bovinos, um rebanho de Caprinos, um rebanho de Ovinos e um rebanho de Bubalinos, tiveram amostras de fezes coletadas e analisadas para a presença de ovos de Tricostrongilídeos. As propriedades foram avaliadas quanto ao histórico de uso de BZ para controle de nematódeos. Nos rebanhos b...

  13. Manejo de capim pé-de-galinha em lavouras de soja transgênica resistente ao glifosato Management of goose grass on transgenic soybean, resistant to glyphosate

    Directory of Open Access Journals (Sweden)

    André da Rosa Ulguim

    2013-01-01

    Full Text Available O objetivo deste trabalho foi avaliar a resistência de capim pé-de-galinha (Eleusine indica ao glifosato, em lavouras de soja transgênica; avaliar o efeito de aplicações de glifosato em diferentes estádios de desenvolvimento; identificar práticas agronômicas associadas à seleção de biótipos resistentes; e avaliar a eficiência dos herbicidas cletodim, fluazifope-P-butílico, clomazona, glufosinato de amônio e glifosato nas plantas resistentes. Plantas escapes ao tratamento com glifosato foram coletadas em 24 propriedades, no Rio Grande do Sul. As plantas foram cultivadas em casa de vegetação, tendo-se avaliado a sua resistência ao glifosato. Os acessos resistentes foram selecionados e avaliados quanto ao efeito da aplicação do glifosato em diferentes estádios de crescimento e quanto à sensibilidade aos herbicidas. Foi aplicado um questionário aos produtores para identificação das práticas agronômicas associadas às falhas no controle. O controle de E. indica pelo glifosato é mais efetivo com a aplicação em estádios iniciais de desenvolvimento. Práticas agronômicas, como uso contínuo de baixas doses do herbicida, aplicação em estádios de desenvolvimento avançados das plantas daninhas (mais de um afilho e a ausência de rotação de culturas foram relacionadas às falhas de controle observadas. Os herbicidas cletodim, fluazifope-P-butílico e glufosinato de amônio são alternativas eficientes para o controle de E. indica.The objective of this work was to evaluate the resistance of goose grass (Eleusine indica to glyphosate application in transgenic soybean crops; evaluate the effect of glyphosate applications in different growth stages; identify the main agronomic practices associated with the selection of resistant biotypes; and evaluate the effect of the herbicides clethodim, fluazifop-p-butyl, clomazone, glufosinate ammonium, and glyphosate on resistant plants. Plants that survived glyphosate application

  14. Análise do risco da ocorrência de biotipos de plantas daninhas resistentes aos herbicidas The risk of finding herbicide resistant weed biotypes

    Directory of Open Access Journals (Sweden)

    Ribas A. Vidal

    1997-01-01

    Full Text Available A análise do risco da ocorrência de biótipos de planta s daninhas resistentes aos herbicidas dispõe de fundamentos teóricos adequados, porém é limitada pela falta de mais informações genéticas das espécies daninhas. O risco de encontrar uma área infestada com biótipos de plantas daninhas resistentes aos herbicidas depende de dois aspectos: da probabilidade de seleção de um mutante resistente a certo mecanismo de ação herbicida; e da probabilidade de infestação da área com plantas resistentes, a partir daquele mutante selecionado. O objetivo deste trabalho foi estudar a influência de fatores genéticos na probabilidade de seleção de um mutante resistente a determinado mecanismo de ação herbicida e assim prever o risco de serem encontrados biótipos de plantas daninhas resistentes aos herbicidas. Os fatores que determinam a probabilidade de selecionar um mutante resistente aos herbicidas podem ser agrupados em três categorias: os relacionados à genética da resistência; os relacionados ao número de plantas daninhas sob seleção; e os relacionados ao herbicida. Os fatores relacionados à genética da resistência são dependentes da freqüência inicial do alelo de resistência, da dominância e do tipo de polinização da espécie. Os fatores relacionados ao número de indivíduos são a área tratada com o herbicida e o grau de infestação da área. Os fatores relacionados aos herbicidas são o seu mecanismo de ação e a sua freqüência de uso na área. As previsões matemáticas indicam alto risco de ocorrência de resistência em áreas com alta infestação de plantas daninhas e que são aspergidas com herbicidas cujos mecanismos de ação apresentam histórico de alta freqüência inicial do alelo de resistência nas populações de plantas daninhas.The prediction of occurrence of weed resistance to herbicides is limited by the scarcity of informat ion on weed genetics. The risk of finding a resistant weed

  15. Estado e Política Social: considerações sobre a política de atendimento socioeducativo ao adolescente em conflito com a Lei no Brasil a partir da década de 1990

    Directory of Open Access Journals (Sweden)

    Vanessa Gabrielle Woicolesco

    2017-12-01

    Full Text Available Neste artigo, analisa-se a Política de Atendimento Socioeducativo ao adolescente em conflito com a lei, concebida enquanto componente da Política Social que, implementada pelo Estado, contribui para as suas ações de direção e controle social e, ao mesmo tempo, é parte constituinte da repartição da riqueza socialmente produzida. Nesse sentido, busca-se abordar a Política voltada ao adolescente em conflito com a lei, no Brasil, a partir dos seguintes ordenamentos jurídicos e institucionais: Lei nº 8.069/90, Estatuto da Criança e do Adolescente – ECA; e Lei nº 12.594/12, Sistema Nacional de Atendimento Socioeducativo – SINASE.

  16. Eco-Friendly Chitosan Production by Syncephalastrum racemosum and Application to the Removal of Acid Orange 7 (AO7 from Wastewaters

    Directory of Open Access Journals (Sweden)

    Aline Elesbão Nascimento

    2013-07-01

    Full Text Available Due to the existence of new methodologies that have reduced the production costs of microbiological chitosan, this paper puts forward the use of agro-industrial residues in order to produce microbiological chitosan and to apply chitosan as an innovative resource for removing acid orange 7 (AO7 from wastewaters. The best culture conditions were selected by a full 24 factorial design, and the removal of the dye was optimized by a 23 central composite rotational design. The results showed that corn steep liquor (CSL is an agro-industrial residue that can be advantageously used to produce microbiological chitosan with yields up to 7.8 g/kg of substrate. FT-IR spectra of the product showed typical peak distributions like those of standard chitosan which confirmed the extracted product was chitosan-like. The efficiency of removing low concentrations of AO7 by using microbiological chitosan in distilled water (up to 89.96% and tap water (up to 80.60% was significantly higher than the efficiency of the control (chitosan obtained from crustaceans, suggesting that this biopolymer is a better economic alternative for discoloring wastewater where a low concentration of the dye is considered toxic. The high percentage recovery of AO7 from the microbiological chitosan particles used favors this biopolymer as a possible bleaching agent which may be reusable.

  17. Demência reversível e quedas associadas ao biperideno Reversible dementia and falls associated with biperiden

    Directory of Open Access Journals (Sweden)

    Julio César Rigo

    2006-01-01

    Full Text Available As drogas anticolinérgicas podem causar efeitos adversos, mais freqüentemente nos pacientes idosos. Relatamos um caso de demência reversível e quedas, associadas ao uso de biperideno. A paciente, com 82 anos, foi admitida em lar geriátrico devido a quedas freqüentes no domicílio, acentuado déficit cognitivo, tremores de extremidades ao movimento e perda de autonomia. Na verdade, era portadora de tremor essencial, que foi confundido com doença de Parkinson e tratado com biperideno; posteriormente, desenvolveu déficit cognitivo que foi erroneamente diagnosticado como demência do tipo Alzheimer. Após submeter-se à avaliação especializada, foi suspensa a droga anticolinérgica e houve reversão completa do quadro demencial; o tremor essencial foi controlado com uso de propranolol. Ao avaliar um paciente com déficit cognitivo, o clínico deve descartar possíveis causas de demência reversível, em especial, o grupo das iatrogênicas.Anticholinergic drugs may cause adverse effects, more often in the aged patients. We describe a case of reversible dementia and falls, associated with the use of biperiden. The patient was an 82-year old woman, admitted in a geriatric home because of frequent falls at home, progressive cognitive deficit and tremor of extremities with movement, in addition to remarkable loss of autonomy. As a matter of fact, she presented an essential tremor, which was mistakenly diagnosed as Parkinson disease and treated with biperiden; furthermore, she developed a drug-induced cognitive deficit, erroneously interpreted as Alzheimer disease. After submitted to the specialized evaluation, the anticholinergic drug was discontinued and there was a complete improvement of cognition changes; the essential tremor is under control with use of propranolol. When evaluating a patient with cognitive deficit, the clinician must discard possible causes of reversible dementia, especially the iatrogenic group.

  18. Exposição ocupacional ao ruído e acidentes do trabalho Occupational noise exposure and work accidents

    Directory of Open Access Journals (Sweden)

    Adriano Dias

    2006-10-01

    Full Text Available O objetivo deste estudo foi verificar se a exposição ocupacional ao ruído é um fator de risco relevante para acidentes do trabalho na cidade de Piracicaba, São Paulo, Brasil. Foi realizado um estudo caso-controle de base hospitalar. Os casos foram 600 trabalhadores entre 15 e 60 anos que sofreram acidentes ocupacionais típicos entre maio e outubro de 2004, atendidos na Central de Ortopedia e Traumatologia de Piracicaba. Os controles foram 822 trabalhadores entre 15 e 60 anos que sofreram acidente não ocupacional e receberam o primeiro atendimento no serviço ou foram trabalhadores acompanhantes dos acidentados. Foi ajustado um modelo de regressão logística múltipla, tendo como variável independente o acidente do trabalho, controlada por co-variáveis de interesse, entre elas a exposição ao ruído. Estimou-se que o risco de sofrer acidente do trabalho é cerca de duas vezes maior entre trabalhadores expostos ao ruído, controlado para diversas co-variáveis. A exposição ocupacional ao ruído não só deteriora a saúde auditiva do trabalhador, mas também se constitui em fator de risco para acidentes do trabalho.The purpose of this study was to verify whether occupational noise exposure is a significant risk factor for work accidents in the city of Piracicaba, São Paulo State, Brazil. This hospital-based case-control study included 600 workers aged 15-60 who suffered typical occupational accidents between May and October 2004 and were seen at the Piracicaba Orthopedics and Trauma Center. The control group comprised 822 workers, aged 15-60, who were also seen at the Center, and either had a non-occupational accident or were accompanying someone who had suffered an accident. A multiple logistic regression model was adjusted with work accident as an independent variable, controlled by covariables of interest such as noise exposure. The risk of having a work accident was about twice as high among workers exposed to noise, after

  19. Perfil de clientes colostomizados inscritos em programa de atenção aos estomizados

    National Research Council Canada - National Science Library

    Mara Rúbia Violin; Thais Aidar de Freitas Mathias; Taqueco Teruya Uchimura

    2008-01-01

    ..., exploratório, de natureza quantitativa, foi o de identificar o perfil do paciente colostomizado, inscrito no Programa de Atenção ao Estomizado – PAE, da 15ª Regional de Saúde do Paraná...

  20. Rituais aos Mortos da Tradi��o do Batuque e do Candombl�

    OpenAIRE

    de Oliveira, Ricardo Moreira

    2013-01-01

    Resumo: este artigo se prop�e apresentar os rituais dedicados aos mortos na tradi��o do Batuque afro-riograndense, do Candombl� e os raros templos Egungun do Brasil, bem como os procedimentos de desenlace de iniciados nos cultos de matriz africana referidos. Palavras-chave: Egun. Antepassados. Axex�. Aressum. Morte.

  1. Eu gosto da escola: um estudo sobre o apego ao ambiente escolar

    Directory of Open Access Journals (Sweden)

    Pollyana Verissimo de Araújo

    Full Text Available Resumo O presente artigo teve como objetivo analisar o nível de apego dos alunos ao ambiente escolar. Para tanto, adotou-se a perspectiva da relação pessoa-ambiente que busca contribuir para a vertente institucional da psicopedagogia. Participaram do estudo 200 alunos do ensino médio, com idade média de 15,15 (DP=0,98, igualmente distribuídos entre escolas públicas e privadas de uma capital nordestina. Estes responderam à Escala Apego ao Lugar, além de questões sociodemográficas. As análises indicaram que o nível de apego à escola foi considerável em relação ao esperado, evidenciando uma diferença significativa do nível de apego ao lugar em função do tipo de sistema de ensino (t(191 = -2,205; p≤0,03, com destaque para a escola privada (M= 3,36; DP= 0,603. Com base nesses resultados, foi possível discutir a necessidade de desenvolver estratégias voltadas para promoção de identidade com a escola, percepção da escola como comunidade e atitudes positivas frente à escola.

  2. General cognitive distortions and body satisfaction : Findings from the Netherlands and Curaçao

    NARCIS (Netherlands)

    Dijkstra, Pieternel; Barelds, Dick; Van Brummen-Girigori, Odette

    2017-01-01

    The present study examined ten cognitive distortions, as assessed by the Cognitive Distortions Scale (CDS), and their relations to body satisfaction among young women living in The Netherlands (n = 152) and Curaçao (a former colony of the Netherlands; n = 160). Findings showed that, in general,

  3. High prevalence of dermal parasites among coral reef fishes of Curaçao

    NARCIS (Netherlands)

    Bernal, M.A.; Floeter, S.R.; Gaither, M.R.; Longo, G.O.; Morais, R.; Ferreira, C.E.L.; Vermeij, M.J.A.; Rocha, L.A.

    2016-01-01

    During expeditions to Curaçao in August and October of 2013, a large number of fish infected with dermal parasites was observed. Infected individuals presented black spots and white blemishes on their skin and fins that were easily observed by divers, and which have been associated with infections

  4. On the radulae and spines of some Polyplacophora and Archaeogastropoda from Curaçao

    NARCIS (Netherlands)

    Righi, Gilberto

    1968-01-01

    During her stay at Curaçao from December 1965 to March 1966 Prof. Dr. DIVA DINIZ CORRÊA collected several groups of marine invertebrates. I should like to thank her for having entrusted me with the Polyplacophora and Archaeogastropoda for further study of radulae and spines.

  5. Aluminium hydro(oxide)–based (AO) adsorbent for defluoridation of ...

    African Journals Online (AJOL)

    2014-12-17

    Dec 17, 2014 ... In this study, the performance of different aluminium hydroxide–based adsorbents was compared in terms of fluoride adsorption capacity, potential for repetitive regeneration, surface acidity and surface site concentrations. The adsorbents were aluminium hydro(oxide) (AO), activated alumina (AA), and ...

  6. Molecular Evidence for Dissemination of Unique Campylobacter jejuni Clones in Curaçao, Netherlands Antilles

    NARCIS (Netherlands)

    Duim, B.; Godschalk, P.C.R.; Braak, N. van den; Dingle, K.E.; Dijkstra, J.R.; Leyde, E.; Plas, J. van der; Colles, F.M.; Endtz, H.P.; Wagenaar, J.A.; Maiden, M.C.J.; Belkum, A. van

    2003-01-01

    Campylobacter jejuni isolates (n = 234) associated with gastroenteritis and the Guillain-Barré syndrome (GBS) in the island of Curaçao, Netherlands Antilles, and collected from March 1999 to March 2000 were investigated by a range of molecular typing techniques. Data obtained by pulsed-field gel

  7. A new species of the Rodent Baiomys from Aruba and Curaçao

    NARCIS (Netherlands)

    Husson, A.M.

    1960-01-01

    In his paper on the mammals of the islands of Aruba, Curaçao, and Bonaire (situated off the north coast of Venezuela), WAGENAAR HUMMELINCK (1940 a, p. 69) mentioned a juvenile specimen of a cricetine rodent which was identified by Mr. M. A. C. HINTON and Mr. R. W. HAYMAN as probably belonging to the

  8. Exposição ao vivo no tratamento de agorafobia: relato de caso

    Directory of Open Access Journals (Sweden)

    Gustavo J. Fonseca D'El Rey

    Full Text Available Relato de caso, em que a Exposição ao Vivo foi utilizada no tratamento de paciente com diagnóstico de agorafobia. O tratamento foi realizado em doze sessões, apresentando êxito no uso dessa técnica comportamental.

  9. Aluminium hydro(oxide)–based (AO) adsorbent for defluoridation of ...

    African Journals Online (AJOL)

    In this study, the performance of different aluminium hydroxide.based adsorbents was compared in terms of fluoride adsorption capacity, potential for repetitive regeneration, surface acidity and surface site concentrations. The adsorbents were aluminium hydro(oxide) (AO), activated alumina (AA), and pseudoboehmite (PB).

  10. Long-term functional outcome of mandibular reconstruction with stainless steel AO reconstruction plates

    NARCIS (Netherlands)

    van Minnen, B; Nauta, JM; Vermey, A; Bos, RRM; Roodenburg, JLN

    Mandibular continuity defects are usually reconstructed with bone grafts. However, factors associated with the tumour and the patient can still be reasons to choose reconstruction plates. The aim of this study was to find out the results of mandibular reconstructions with stainless steel AO

  11. The groundwater quality of Aruba, Bonaire and Curaçao: a hydrogeochemical study

    NARCIS (Netherlands)

    Sambeek, M.H.G. van; Eggenkamp, H.G.M.; Vissers, M.J.M.

    2000-01-01

    Groundwater resources on the Caribbean Islands of Aruba, Bonaire and Curaçao are limited and of poor quality. The groundwater of the islands is brackish, due to both seawater mixing and the semi-arid climate of the islands.Two hundred and thirty water samples were collected to relate chemical

  12. Social behavior of the Paguridae and Diogenidae of Curaçao

    NARCIS (Netherlands)

    Hazlett, Brian A.

    1966-01-01

    1. The social behavior patterns of twelve species of hermit crabs found in the waters around Curaçao, N.A. are described. All species showed marked similarity in their aggressive displays, the most common of which are movements of the appendages, called here the ambulatory raise and cheliped

  13. Do afro-americanismo ao caucasianismo: um convertido discute o cristianismo ocidental

    Directory of Open Access Journals (Sweden)

    Edison Minami

    2015-04-01

    Foi a partir dessas ideias de fundo que iniciei a leitura do livro de Alex e Donna Jones, Não tem preço. O livro – na verdade são dois textos, um do marido e outro da esposa – relatos da conversão de dois afro-americanos pentecostais ao catolicismo.

  14. Eutrophication threatens Caribbean seagrasses – An example from Curaçao and Bonaire

    NARCIS (Netherlands)

    Govers, L.L.; Lamers, L.P.M.; Bouma, T.J.; de Brouwer, J.H.F.; van Katwijk, M.M.

    2014-01-01

    Seagrass beds are globally declining due to human activities in coastal areas. We here aimed to identify threats from eutrophication to the valuable seagrass beds of Curaçao and Bonaire in the Caribbean, which function as nursery habitats for commercial fish species. We documented surface- and

  15. Resistência ao cisalhamento de dentes submetidos a duas técnicas de clareamento, pós-restaurados ou não

    Directory of Open Access Journals (Sweden)

    SIQUEIRA Evandro Luiz

    1997-01-01

    Full Text Available Os autores testaram a resistência ao cisalhamento de dentes submetidos a duas técnicas de clareamento. Foram utilizados 50 incisivos centrais superiores, divididos em 5 grupos, a saber: controle (só abertura coronária, clareamento sem calor, clareamento catalisado por calor controlado, clareamento catalisado por calor controlado e restauração com resina composta de última geração e dentes hígidos. Após o teste de cisalhamento, constatou-se que, nos dentes submetidos ao clareamento dental com perborato de sódio/Peridrol com ou sem aplicações de calor controlado, apesar de estes apresentarem leve diminuição da resistência ao cisalhamento, esta não é estatisticamente significante quando comparada com a dos dentes em que se executa o acesso endodôntico sem clareamento. A restauração do dente após o clareamento dental com adesivo dentinário de 4ª geração e resina fotopolimerizada aumenta a resistência do elemento dental clareado. Não existem diferenças estatísticas de resistência ao cisalhamento entre dentes clareados sem o uso de calor e aqueles em que o calor foi empregado de forma controlada, como preconizado neste estudo. Dentes hígidos apresentam resistência maior do que os dentes clareados com calor, sem calor e aqueles não clareados, com significância estatística no nível de 5%. Já com os dentes clareados e restaurados, os dentes hígidos não mostraram diferenças estatísticas significantes

  16. The complexity of national identity Construction in Curaçao, Dutch Caribbean

    Directory of Open Access Journals (Sweden)

    Rose Mary Allen

    2010-10-01

    Full Text Available Curaçao, one of the five islands of the Dutch Caribbean federation called the Netherlands Antilles, currently stands at a crossroad of constitutional reform. In the context of these changes at the political level, it is logical that national identities are being redefined and repositioned. The developments in the fashioning of national identities in Curaçao deserve attention locally but also regionally. How do people in Curaçao construct national identities in daily life? How is a national collective constructed on the one hand, and how are differences with other collectivities constructed on the other hand? The historical context of constitutional changes that have occurred over the years is considered as well as an examination of the present discourse on constitutional reform. These identity issues are then placed within a wider Caribbean context.  Resumen: La complejidad de la construcción de la identidad nacional en Curaçao,en el Caribe holandés Curaçao, una de las cinco islas de la federación caribeña neerlandesa llamada Antillas Holandesas, se encuentra hoy en día en una encrucijada de reformas constitucionales. En el contexto de estos cambios a nivel político, es lógico que las identidades nacionales sean redefinidas y reposicionadas. Los desarrollos en la formulación de identidades nacionales en Curaçao merecen atención local, y también regional. ¿Cómo construye la gente en Curaçao identidades nacionales en la vida cotidiana? ¿Cómo, por un lado, se construye el colectivo nacional y, por otro, cómo se construyen las diferencias con otras colectividades? En este análisis se estudia el contexto histórico de los cambios constitucionales que han ocurrido en el curso del tiempo y se realiza igualmente una revisión del actual discurso sobre la reforma constitucional. Estos problemas de identidad son analizados entonces en un contexto caribeño más amplio.

  17. Improved tilt sensing in an LGS-based tomographic AO system based on instantaneous PSF estimation

    Science.gov (United States)

    Veran, Jean-Pierre

    2013-12-01

    Laser guide star (LGS)-based tomographic AO systems, such as Multi-Conjugate AO (MCAO), Multi-Object AO (MOAO) and Laser Tomography AO (LTAO), require natural guide stars (NGSs) to sense tip-tilt (TT) and possibly other low order modes, to get rid of the LGS-tilt indetermination problem. For example, NFIRAOS, the first-light facility MCAO system for the Thirty Meter Telescope requires three NGSs, in addition to six LGSs: two to measure TT and one to measure TT and defocus. In order to improve sky coverage, these NGSs are selected in a so-called technical field (2 arcmin in diameter for NFIRAOS), which is much larger than the on-axis science field (17x17 arcsec for NFIRAOS), on which the AO correction is optimized. Most times, the NGSs are far off-axis and thus poorly corrected by the high-order AO loop, resulting in spots with low contrast and high speckle noise. Accurately finding the position of such spots is difficult, even with advanced methods such as matched-filtering or correlation, because these methods rely on the knowledge of an average spot image, which is quite different from the instantaneous spot image, especially in case of poor correction. This results in poor tilt estimation, which, ultimately, impacts sky coverage. We propose to improve the estimation of the position of the NGS spots by using, for each frame, a current estimate of the instantaneous spot profile instead of an average profile. This estimate can be readily obtained by tracing wavefront errors in the direction of the NGS through the turbulence volume. The latter is already computed by the tomographic process from the LGS measurements as part of the high order AO loop. Computing such a wavefront estimate has actually already been proposed for the purpose of driving a deformable mirror (DM) in each NGS WFS, to optically correct the NGS spot, which does lead to improved centroiding accuracy. Our approach, however, is much simpler, because it does not require the complication of extra DMs

  18. Resistência ao clopidogrel: prevalência e variáveis associadas

    Directory of Open Access Journals (Sweden)

    Fabrício Braga da Silva

    Full Text Available FUNDAMENTO: A dupla terapia antiagregante plaquetária com ácido acetilsalicílico e clopidogrel é pedra angular do tratamento de pacientes submetidos a angioplastia com implante de stents coronarianos. Todavia, parte desses pacientes, a despeito do uso de aspirina e clopidogrel, não se encontram eficazmente antiagregados, fenômeno conhecido como resistência aos antiagregantes plaquetários. A sua prevalência, assim como as condições a ela relacionadas são desconhecidas em nosso meio. OBJETIVO: Determinar a prevalência de resistência ao clopidogrel, assim como as variáveis a ela relacionadas. MÉTODOS: Pacientes admitidos para angioplastia eletiva em uso crônico de aspirina e clopidogrel entre janeiro de 2007 e janeiro de 2010. Uma hora após o procedimento, foi medida a agregação plaquetária utilizando a agregometria óptica com difosfato de adenosina 5 µmoles/l como agonista. Nesse momento, em um coorte transversal, determinou-se a prevalência de resistência ao clopidogrel, definida com um valor de agregação plaquetária > 43% e um modelo de regressão logística às variáveis a ela relacionadas. RESULTADOS: Foram analisados 205 pacientes (66,4 ± 11anos, 61,5% masculino. A prevalência de resistência ao clopidogrel foi 38,5% (IC95% 31,9 - 45,2%. O valor da glicemia (OR = 1,014 IC95% 1,004 - 1,023, infarto do miocárdio prévio (OR = 2,320 IC95% 1,1103 - 4,892 e a resposta terapêutica à aspirina (OR = 1,057 IC95% 1,017 - 1,099 foram as variavéis de associação independente à resistência ao clopidogrel. CONCLUSÃO: A prevalência de resistência ao clopidogrel foi alta. Glicemia, infarto agudo do miocárdio prévio e a resposta ao ácido acetilsalicílico foram variáveis a ela relacionadas. A melhor compreensão desse fenômeno se faz necessária frente às novas propostas de antiagregantes plaquetários.

  19. CONTRIBUIÇÃO AO ENTENDIMENTO DA SENSIBILIDADE AMBIENTAL AO DERRAMAMENTO DE ÓLEO NO LITORAL DE MARICÁ NO ESTADO DO RIO DE JANEIRO

    Directory of Open Access Journals (Sweden)

    Érika Cardoso da Silva Baptista

    2016-01-01

    Full Text Available Desastres associados ao transporte marinho e terrestre de hidrocarbonetos causam sérios impactos aos ambientes costeiros, afetando a fauna e a flora marinha, além de prejudicar diversas atividades econômicas, inclusive àquelas tradicionais, como é o caso da pesca artesanal. Assim, faz-se necessário conhecer a geologia e a geomorfologia da costa, em especial as praias devido à elevada dinâmica e vulnerabilidade desses ambientes. A construção de megaempreendimentos na zona costeira e o tráfego de navios petroleiros e pequenas embarcações, ou mesmo a implantação de dutos, localizados junto à linha de costa, representam uma ameaça ao equilíbrio dos ecossistemas. Para tal, foram analisados diversos aspectos da geomorfologia costeira de Maricá, para posterior identificação do grau de sensibilidade deste litoral a eventos de derramamento de óleo, a partir do Índice de Sensibilidade Ambiental (ISA proposto pelo Ministério do Meio Ambiente. O litoral de Maricá, ao longo de 34 km de extensão entre Itaipuaçú (no extremo oeste e Ponta Negra (a leste, apresenta quatro áreas distintas quanto à sensibilidade à poluição decorrente de derramamento de óleo, sendo: ISA1, para as áreas de costões rochosos localizados nas extremidades leste e oeste deste litoral; ISA4, para a quase totalidade das praias, formadas por areias quartzosas grossa e média, exceto o extremo-oeste de Itaipuaçú, que possui areia muito grossa e cascalhos sendo, portanto, representada pelo ISA5; e ISA10, para as lagoas costeiras e canais na retaguarda das barreiras arenosas, sujeitas à contaminação por meio dos canais e por transposição por grandes ondas de tempestades. Os índices compreendem os extremos dessa classificação, devido à grande variedade de elementos na paisagem costeira de Maricá e mostra a elevada sensibilidade deste litoral, frente à ameaça de desastres causados por derramamento de óleo.

  20. Tolerância do Tifton 85 (Cynodon spp. e da Brachiaria brizantha ao glyphosate Tifton 85 (Cynodon spp. and Brachiaria brizantha tolerance to glyphosate

    Directory of Open Access Journals (Sweden)

    M.V. Santos

    2008-06-01

    Full Text Available Objetivou-se avaliar a tolerância de Tifton 85 e Brachiaria brizantha ao glyphosate e verificar o controle de B. brizantha em área de pastagem de Tifton 85 já estabelecida. O delineamento experimental foi em blocos casualizados, com quatro repetições, em que se testaram as doses: 0, 720, 1.440, 2.160 e 2.880 g ha-1 de glyphosate. Cada parcela possuía dimensões de 3,5 m de comprimento por 3,0 m de largura, totalizando 10,5 m², com área útil de 7,5 m ². A eficiência do herbicida no controle de B. brizantha e o nível de intoxicação nas plantas de Tifton 85 foram avaliados 15, 30 e 60 dias após aplicação (DAA, mediante escala de 0 a 100, em que 0 é ausência de controle e/ou intoxicação e 100, controle total ou morte das plantas. Para avaliação da produção e do potencial de rebrota das forrageiras, as plantas de ambas as espécies foram colhidas aos 300 DAA e secas em estufa. Observou-se controle acima de 90% das plantas de B. brizantha a partir das doses de 1.473,75 e 1.721,25 g ha-1 de glyphosate, aos 30 e 60 DAA, respectivamente. As porcentagens de intoxicação das plantas de Tifton 85, referente a estas doses de controle de B. brizantha, foram, respectivamente, de 24,90 e 4,13% aos 30 e 60 DAA. Além disso, aos 60 DAA, para a maior dose avaliada (2.880 g ha-1 de glyphosate foi observada intoxicação das plantas de Tifton 85 de apenas 18,22%. Aos 300 DAA, observou-se ausência de produção de massa seca de B. brizantha a partir da dose de 2.160 g ha-1 do herbicida, devido ao eficiente controle. Os resultados evidenciam maior tolerância das plantas de Tifton 85 ao glyphosate em relação às plantas de B. brizantha, possibilitando o controle desta espécie em pastagem estabelecida de Tifton 85, sem causar danos à forrageira cultivada.This study aimed to evaluate Tifton 85 and Brachiaria brizantha tolerance glyphosate and verity Brachiaria brizantha control in an established Tifton 85 pasture area. Rates of 0; 720; 1

  1. The Effectiveness of a Mixed-Mode Survey on Domestic Violence in Curaçao: Response and Data Quality

    Science.gov (United States)

    van Wijk, Nikil; de Leeuw, Edith; de Bruijn, Jeanne

    2015-01-01

    To collect reliable statistical data on domestic violence in Curaçao, we conducted a large-scale quantitative study (n = 816). To meet with the special needs of the population and topic, we designed a tailored mixed-mode survey to assess the prevalence of domestic violence in Curaçao and its health consequences. Great care was taken to reduce…

  2. A new species of Hemicyclops (Crustacea, Copepoda, Poecilostomatoida, Clausidiidae) associated with hermit crabs in Curaçao

    NARCIS (Netherlands)

    Stock, Jan H.

    1992-01-01

    STOCK, J. H. 1992. A new species of Hemicyclops (Crustacea, Copepoda, Poecilostomatoida, Clausidiidae) associated with hermit crabs in Curaçao. Stud. Nat. Hist. Caribbean Region 71, Amsterdam 1992: 69-78. Hemicyclops geminatus n. sp. is described from the upper infralittoral zone of Curaçao

  3. Ocorrência de Mycobacterium bovis em queijos coalho artesanais e fatores associados ao consumo de leite e derivados lácteos informais

    OpenAIRE

    Rocha, Bernardo Barbosa

    2013-01-01

    A tuberculose zoonótica cujo agente etiológico é o Mycobacteirum bovis pertencente ao Complexo Mycobacterium tuberculosis (M tuberculosis, M bovis, M africanum, Mmicroti,M canettii e M. caprae) causa doenças em seres humanos, bovinos e outros animais em vários países do mundo. Nos humanos, M. bovis pode determinar as mesmas formas clínicas dos acometimentos que M. tuberculosis. Antes dos programas de controle e erradicação da tuberculose bovina e do evento de pasteurização do leite, a princip...

  4. Insuficiência aguda hepática associada ao ácido valpróico na infância: relato de três casos

    OpenAIRE

    Antoniuk,Sérgio A.; Bruck,Isac; Hönnicke,Léo Ricardo; Martins,Luzilma Terezinha Flenik; Carreiro,José Eduardo; Cat,Rubens

    1996-01-01

    Relatamos três casos da insuficiência aguda hepática associada ao uso de ácido valpróico (AVP) em crianças epilépticas. A idade variou de 2 anos e 8 meses a 5 anos e 1 mês. Todos os pacientes apresentavam epilepsia de difícil controle e dois deles tinham desenvolvimento psicomotor severamente comprometido. O AVP foi usado em associação com outros antiepilépticos (carbamazepina em dois, fenobarbital em um). Todos os pacientes apresentaram sinais clínicos de insuficiência hepática.Vômitos, edem...

  5. Percepção de servidores municipais frente ao diagnóstico de distúrbio osteomuscular relacionado ao trabalho Public officers' perceptions of work-related musculoskeletal disorder diagnosis

    Directory of Open Access Journals (Sweden)

    Mirna Albuquerque Frota

    2008-12-01

    Full Text Available As doenças osteomusculares relacionadas ao trabalho (DORT são distúrbios do aparelho locomotor de etiologia ligada à atividade laboral que vêm apresentando incidência crescente em todo o mundo. Este estudo teve o objetivo de descrever a forma como servidores municipais de Fortaleza, CE, vivenciam as DORT. O estudo qualitativo foi realizado em uma clínica de fisioterapia em 2004. Os informantes foram nove servidores (com idades entre 40 e 57 anos em atendimento fisioterápico na clínica - agentes administrativos, professores e um técnico. Os dados foram coletados por meio da observação participante e de entrevista semi-estruturada. Da análise emergiram as categorias temáticas "reações frente ao diagnóstico e tratamento" e "vivência da doença nas relações interpessoais". Os resultados permitiram inferir o impacto do diagnóstico da DORT no cotidiano do trabalhador: a limitação funcional leva à frustração e indignação; o não-reconhecimento pelos colegas gera a percepção de rejeição ou exclusão social. A reação de negação inicial, que leva o trabalhador a evitar a procura de atendimento especializado, é importante pela subnotificação gerada, que provoca limitação nas medidas de prevenção e controle das DORT.Work-related musculoskeletal disorders (WRMD have shown increasing incidence all over the world. This study aimed at describing how public officers (in Fortaleza, CE react to a WRMD diagnosis. In this qualitative study, data were collected by means of participant observation and interviews with nine informants (aged 40 through 57, recruited at a rehabilitation clinic in 2004; they were office clerks, teachers, and a technician. Two subject-matter categories emerged from data analysis: reactions to diagnosis and treatment; and interpersonal relation changes after diagnosis. Results allowed for inferring the impact of WRMD in workers' daily lives: functional limitation leads to frustration and indignation

  6. Efeito do vinho tinto associado ao exercício físico no sistema cardiovascular de ratos espontaneamente hipertensos

    Directory of Open Access Journals (Sweden)

    Paulo Roberto Soares Filho

    2011-04-01

    Full Text Available FUNDAMENTO: Prática de exercício físico (EF é eficiente no tratamento e na prevenção da hipertensão, associada à melhora do perfil lipídico e da função contrátil cardíaca. Consumo moderado e regular de bebidas alcoólicas, como vinho tinto, desempenha efeito cardiovascular protetor. Polifenóis da bebida apresentam propriedades antioxidantes, beneficiando vasos sanguíneos. Há poucas evidências sobre o consumo de vinho tinto associado ao EF e as influências no sistema cardiovascular. OBJETIVO: Investigar o efeito da interação entre o EF e o consumo moderado de vinho tinto na pressão arterial sistólica (PAS, lipoproteína de alta densidade (HDL, desempenho físico e fração de ejeção do ventrículo esquerdo (FEVE de ratos espontaneamente hipertensos (SHR. MÉTODOS: Amostra de 32 SHR distribuídos em quatro grupos: grupo vinho e exercício (GVE, grupo vinho (GV, grupo exercício (GE e grupo controle (GC. Doses de vinho tinto, equivalentes ao consumo moderado em humanos, foram administradas por gavagem, durante dez semanas, simultâneas ao período de EF, realizado em esteira. Os SHR receberam 3,715 ml/kg/dia de vinho. O desempenho físico foi analisado por teste de esforço (TE, e a FEVE foi obtida por medidas ecocardiográficas. A aferição da PAS ocorreu antes e após o protocolo do EF. RESULTADOS: Demonstrou-se redução significativa da PAS nos grupos de intervenção, comparados ao GC. Ao final do protocolo, o GVE apresentou a maior redução. Assim como na PAS, o GVE apresentou melhor resultado nos níveis de HDL. Não houve diferença significativa no desempenho físico e na FEVE entre os grupos. CONCLUSÃO: O EF associado à ingesta moderada de vinho tinto exerce efeito cardioprotetor na PAS e na HDL de SHR. O desempenho físico e a FEVE não são alterados.

  7. FATORES ASSOCIADOS A NÃO ADESÃO AO TRATAMENTO DA HIPERTENSÃO ARTERIAL SISTÊMICA: UMA REVISÃO INTEGRATIVA

    Directory of Open Access Journals (Sweden)

    Leidiane Mirlla de Oliveira Mendes

    2014-08-01

    Full Text Available O controle inadequado da pressão arterial pode estar relacionado à falta de adesão do paciente hipertenso ao tratamento indicado. Objetivo: Sintetizar o conhecimento produzido e publicado na literatura nacional sobre os fatores associados à não adesão ao tratamento da hipertensão arterial no período de 2006 a 2012. O presente estudo trata-se de uma revisão integrativa da literatura. O levantamento bibliográfico ocorreu mediante a consulta na base de dados online da Biblioteca virtual em Saúde. Critérios de inclusão: artigos nacionais, textos completos, que abordassem a temática e os publicados entre 2006 a 2012. Critérios de exclusão: que não estavam relacionados à temática do estudo e que estavam fora do período determinado. Foram considerados 11 artigos. O ano de 2008 e 2010 concentrou o maior número de publicações com 28% cada. Observaram-se, nos artigos, as abordagens metodológicas qualitativa com 27% e quantitativa com 73%. A região Sudeste se destaca com 37% das publicações. Local de realização das pesquisas, 91% dos artigos foram realizados em Unidades Básicas de Saúde. 19% dos artigos foram publicados na Revista Rene. Procedeu-se uma leitura analítica que possibilitou a formulação da categoria: Fatores que influenciam a não adesão ao tratamento anti-hipertensivo. O estudo realizado permitiu sintetizar a produção de conhecimento nacional acerca dos fatores que influenciam a não adesão ao tratamento da hipertensão. A compreensão dos reais motivos da não adesão ao tratamento da hipertensão se torna importante no que se refere à criação de projetos e ações de saúde pública voltada para esse agravo.

  8. Armazenamento de sementes de cerejas-do-mato (Eugenia involucrata DC. submetidas ao recobrimento com biofilmes e embalagem a vácuo

    Directory of Open Access Journals (Sweden)

    Alexandre Luis Alegretti

    2015-02-01

    Full Text Available Fruteiras como Eugenia involucrata ainda continuam inexploradas, necessitando-se de informações técnicas que incentivem o agricultor a utilizá-las. O método de propagação por sementes é o normalmente adotado; porém, elas devem ser imediatamente semeadas, pois corre-se o risco de perda de sua viabilidade com o armazenamento. O objetivo deste trabalho foi avaliar o hidrocondicionamento e as técnicas de conservação (vácuo e biofilme, durante armazenamento, aos cinco e aos 30 dias, de sementes de cerejeira-do-mato. O trabalho foi realizado na Universidade Tecnológica Federal do Paraná - Câmpus Dois Vizinhos. O delineamento experimental foi em blocos ao acaso, em fatorial 2 × 4 × 2 (pré-hidrocondicionamento x técnica de armazenamento x tempo de armazenamento, com quatro repetições, de 50 sementes por unidade experimental. As sementes extraídas foram separadas em dois lotes, sendo um submetido ao pré-hidrocondicionamento, em água destilada, durante 24 horas, e, outro, não. Sementes hidrocondicionadas, ou não, foram submetidas a quatro técnicas de armazenamento, sendo, estas, a embalagem plástica a vácuo, o revestimento com biofilme de fécula de mandioca (3% m/v, a embalagem plástica a vácuo + biofilme de fécula de mandioca e sem tratamento (controle. Posteriormente, as sementes foram mantidas em câmara fria, em temperatura de 5 ºC e UR 85%, durante cinco e 30 dias. Aos 110 dias após a semeadura, avaliou-se a percentagem de germinação, o índice de velocidade de emergência e a massa da matéria seca total das plântulas. Para o armazenamento das sementes de cerejeira-do-mato, devem-se utilizar técnicas a vácuo, isoladamente, ou com revestimento de biofilme.

  9. Consorciação taro e crotalária manejada com corte rente ao solo e poda na altura do dossel

    Directory of Open Access Journals (Sweden)

    Mário Puiatti

    2015-06-01

    Full Text Available A associação de culturas com leguminosas de adubação verde visa à manutenção ou melhorias da fertilidade do solo. Com o objetivo de avaliar a consorciação do taro 'Japonês' com crotalária, foram conduzidos dois experimentos, em Viçosa, MG, no período de 10/09/2010 a 10/06/2011. No Experimento I, as plantas de crotalária foram cortadas rente ao solo e, no Experimento II, podadas à altura do dossel do taro; em ambos, os tratamentos consistiram em seis épocas de corte ou poda da crotalária (75; 105; 135; 165; 195 e 225 dias após a semeadura da crotalária - DAS, mais a monocultura do taro. As partes cortadas ou podadas foram depositadas sobre o solo e determinaram-se as quantidades de fitomassa e de nutrientes da crotalária. Na colheita do taro, avaliaram-se a produção de classes de rizomas e as alterações químicas do solo. Os cortes realizados após 105 DAS proporcionaram menor produção em massa de rizomas-mães e, em número, por planta, de rizomas-filhos grandes e comerciais, em comparação com os do controle. Comportamento semelhante foi observado para experimento com poda à altura do dossel. Os cortes ou podas realizados aos 135 e 165 DAS foram os que apresentaram maiores quantidades de fitomassas fresca e seca de crotalária, de carbono orgânico e de nutrientes. Aos 165 DAS, o aporte de N ao solo pela crotalária cortada chegou a 308 Kg ha-1 e, pela crotalária podada, a 202 kg ha-1. A associação entre crotalária e taro é viável, sendo indicada a manutenção da consorciação até aos 105 DAS da crotalária.

  10. Truncus arteriosus operado aos 28 anos: importância do diagnóstico diferencial

    Directory of Open Access Journals (Sweden)

    Lilian Maria Lopes

    2011-08-01

    Full Text Available Descrevemos um caso de adulto de 28 anos com suspeita de cardiopatia congênita desde o nascimento, não tratada na infância por opção da família. Aos 27 anos, foi feito diagnóstico de atresia pulmonar com comunicação interventricular e colaterais sistêmico-pulmonares, sendo contraindicada a cirurgia. Uma nova reavaliação em nosso serviço demonstrou tratar-se de um truncus arteriosus atípico. O fato de um tronco arterial comum com shunt esquerda-direita ter sido visualizado ao ecocardiograma foi um dado crucial para a indicação de novo cateterismo, abrindo perspectiva de correção cirúrgica. No momento, o paciente encontra-se bem, com 7 anos de evolução pós-operatória.

  11. As resistências ao poder em Michel Foucault The resistance to power in Michel Foucault

    OpenAIRE

    Guilherme Castelo Branco

    2001-01-01

    Ainda pouco estudada, a última fase do pensamento de Michel Foucault traz contribuições inegáveis ao debate ético e político de nossa época, sobretudo por enfatizar o papel do indivíduo e das coletividades nas lutas de transformação das estruturas de poder ora vigentes. Os modos de ser das lutas de resistência, sua importância no quadro referencial do último Foucault, revelam uma dimensão política antes insuspeitada em sua obra. Essa dimensão, para além da analítica do poder, concede aos pequ...

  12. Escala multidimensional aplicada aos estudos de apreciação musical

    Directory of Open Access Journals (Sweden)

    Raquel Cocenas da Silva

    2009-08-01

    Full Text Available A escala multidimensional (MDS provém de uma família de técnicas de análise de proximidade de dados, obtida por meio do julgamento do participante que compara vários estímulos em vários traços, concomitantemente. A análise dos julgamentos de proximidade produz um espaço em que pontos representam a relação entre os estímulos em um espaço euclidiano. O ordenamento dos estímulos ao longo das dimensões neste espaço permite que inferências possam ser feitas sobre o universo perceptual subjacente ao grupo de pesquisa. A literatura mostra que a MDS vem ampliando o estudo da música e a mensuração de suas propriedades estruturais.

  13. A amizade para Foucault: resistências criativas face ao biopoder

    Directory of Open Access Journals (Sweden)

    Hélio Rebello Cardoso Jr.

    2009-04-01

    Full Text Available O artigo trabalha a noção de amizade em Foucault como um modo de vida que se opõe ao processo de normalização empreendido pelo biopoder. Inicia com uma caracterização acerca do Estado Moderno. Logo após, aborda a historicidade dos processos de subjetivação e de como a atitude frente a estes implica estados de maior autonomia ou sujeição. Em seguida, aborda a amizade como resistência à normalização, situando-a em relação ao prazer e à sexualidade. Por fim, discute o papel da filosofia no processo de constituição da amizade, particularmente quanto à possibilidade de pensá-la por meio de uma teoria das relações.

  14. Evolução da temperatura ambiente em construções sujeitas ao fogo

    OpenAIRE

    Inácio, Pedro Jorge Rita Ledo

    2011-01-01

    Dissertação para a obtenção do Grau de Mestre em Engenharia Civil A perda de bens materiais e de vidas humanas em situações de incêndio tem sido ao longo dos tempos uma preocupação crescente, promovendo assim o conceito de segurança contra incêndio e de diversos mecanismos associados à sua prevenção ou limitação dos danos causados. Um incêndio é algo difícil de prever, assim como a sua consequência nos elementos de construção. Dessa forma, ao longo das ultimas décadas, os elementos d...

  15. Do mundano ao sagrado: o papel da efervescência na teoria moral durkheimiana

    Directory of Open Access Journals (Sweden)

    Raquel Andrade Weiss

    2013-12-01

    Full Text Available Meu objetivo neste artigo é discutir o significado do conceito de efervescência na obra durkheimiana e apontar o papel que esse processo desempenha em relação à sua teoria moral. De modo geral, a argumentação versa em torno da articulação de três pressupostos estruturais da teoria moral durkheimiana, quais sejam, 1 a vinculação entre sagrado e ideal moral, 2 a concepção acerca da natureza humana como sendo essencialmente dual e 3 a proposta normativa de Durkheim de institucionalização de uma moralidade laica. Ao final, proponho ao leitor uma reflexão sobre a pertinência de sua defesa de um "sagrado laico" a partir dos desafios morais que caracterizam o mundo contemporâneo.

  16. Associação entre indicadores de risco ao desenvolvimento infantil e estado emocional materno

    OpenAIRE

    Flores,Mariana Rodrigues; Souza,Ana Paula Ramos de; Moraes,Anaelena Bragança de; Beltrami,Luciane

    2013-01-01

    OBJETIVO: analisar a associação entre os estados emocionais maternos depressivo e ansioso, combinados ou de modo isolado, em relação à presença de risco ao desenvolvimento infantil na faixa etária de 0 a 4 meses. MÉTODO: trata-se de estudo observacional, analítico e de coorte. Para a obtenção dos dados foram utilizados os Inventários de Beck de Depressão e de Ansiedade e analisada a interação mãe-bebê a partir do protocolo de índices de risco ao desenvolvimento infantil em uma amostra de 182 ...

  17. Contribuições ao dimensionamento de torres eólicas de concreto.

    OpenAIRE

    Paulo Vitor Calmon Nogueira da Gama

    2015-01-01

    O trabalho dedica-se ao estudo das torres eólicas protendidas de concreto, com a finalidade de promover a discussão sobre os critérios de dimensionamento, tema de grande relevância na atualidade. Para tal, foi considerada uma torre eólica de 100 m de altura provida de turbina de 5 MW, cujas ações foram obtidas da literatura. O carregamento de vento ao longo da torre foi tratado como estático equivalente de acordo com disposições normativas, através de uma forma simplificada para a adoção de u...

  18. Resistência ao cisalhamento de lajes nervuradas unidirecionais de concreto armado

    Directory of Open Access Journals (Sweden)

    W. M. Souza

    Full Text Available A resistência ao cisalhamento de lajes nervuradas unidirecionais de concreto armado sem estribos nas nervuras ainda gera controvérsias quando sua estimativa não considera a contribuição da capa monolítica. Visando contribuir para o melhor entendimento do comportamento destas lajes, foram confeccionados em laboratório 8 painéis de lajes nervuradas unidirecionais de concreto armado onde as principais variáveis foram a distância entre as nervuras e a espessura da capa. Foram avaliadas as recomendações normativas da NBR 6118, ACI 318 e EUROCODE 2 para as resistências últimas destas lajes. Os resultados experimentais mostraram que houve acréscimo de resistência ao cisalhamento com o aumento da espessura da capa, resultando também em maiores deformações nas armaduras e em flechas mais elevadas.

  19. O exercício do estudar nos cursinhos destinados aos concursos públicos

    Directory of Open Access Journals (Sweden)

    Leonardo Del Puppo Luz

    2008-06-01

    Full Text Available O artigo discute o processo de produção da subjetividade contemporânea elaborado sobre o Estudar em alunos de cursinhos destinados aos concursos públicos. Procura-se discutir as tecnologias de poder, sobretudo na relação saber-poder, engendradas nestes "ambientes educacionais", já que tais construções sobre o Estudar produzem e perpetuam a manifestação de conceitos absolutos e verdadeiros de se pensar o estudo por meio de técnicas e procedimentos de funcionamentos ideais e idealizados. Busca-se problematizar este modelo homogêneo baseado no tecnicismo do estudar e nas falas sobre o verdadeiro visando colocar em análise o estereótipo do "fracasso" atrelado aos alunos vinculados a estes locais.

  20. Analyses of Alternatives (AoAs): Toward a More Rigorous Determination of Scope

    Science.gov (United States)

    2014-03-11

    Inappropriate Treatment of Time Constraints ..................................................... 7  Inappropriate Focus on Existing C/CSS and/or...several reasons why AoAs may be improperly scoped. Inappropriate Treatment of Time Constraints In the first section, we noted the recent trend...Type Memorandum DTM 10-017). Washington, DC: Author. Retrieved from http://www.hsdl.org/?view&did=728880 United States Air Force Office of

  1. Subordinate but proud: Curaçao's free blacks and mulattoes in the eighteenth century

    Directory of Open Access Journals (Sweden)

    Wim Klooster

    1994-07-01

    Full Text Available Focuses on the socio-economic position of free non-whites in 18th-c. Curaçao. The manumission rate was relatively high and consequently a large group of free non-whites was created. Blacks and mulattoes enjoyed religious freedom as well as considerable economic freedom. Their growing numbers and social and economic assertiveness alarmed the whites, who gradually admitted the most successful mulattoes in their circles.

  2. Caminhoneiros de rota curta e sua vulnerabilidade ao HIV, Santos, SP

    Directory of Open Access Journals (Sweden)

    Villarinho Luciana

    2002-01-01

    Full Text Available OBJETIVO: Descrever a vulnerabilidade, de caminhoneiros de rota curta, à transmissão sexual do HIV e da Aids. MÉTODOS: Foram entrevistados 279 caminhoneiros com vínculo de trabalho na cidade de Santos, SP, em locais de concentração na área portuária e suas proximidades, sindicatos e associações, recrutados pela amostragem do tipo "bola-de-neve". Foram realizadas entrevistas utilizando perguntas abertas e fechadas sobre questões sociodemográficas, práticas sexuais, uso de drogas, conhecimento sobre o HIV e a Aids, contato prévio com programas de prevenção à Aids em Santos, percepção de sua vulnerabilidade ao HIV e à Aids. Foi realizada análise descritiva da amostra, e apresentados relatos para ilustrar algumas situações de vulnerabilidade. RESULTADOS: Do total de 279 caminhoneiros entrevistados, 93% declararam ter parceira fixa, 40% referiram manter relações sexuais com parceiras casuais, e 19% referiram manter relações sexuais com parceiras freqüentes. A principal situação de vulnerabilidade ao HIV ocorre devido ao uso inconsistente do preservativo, interligado ao vínculo estabelecido com cada parceira. O tempo fora de casa parece não ser o principal fator para situações de vulnerabilidade, conforme demonstram estudos com caminhoneiros de rota longa. CONCLUSÕES: A cultura "machista" e os papéis tradicionais masculinos são emblemáticos entre os caminhoneiros de rota curta. Certamente é necessário investir mais na prevenção nessa categoria profissional. A prevenção em locais de trabalho parece promissora, pois permite entender melhor seu universo, propiciando intervenções educativas adequadas a essa categoria profissional.

  3. Do corpo histérico ao "corpus" teórico

    Directory of Open Access Journals (Sweden)

    Francisco Ramos de Farias

    1992-09-01

    Full Text Available Este estudo aborda a maneira pela qual Freud, de forma original, efetuou uma leitura no corpo-sintoma da histérica e construiu uma clínica inédita destinada ao tratamento das neuroses. Esta clínica, fundada na transferência, é suportada pelo edifício teórico que tem o inconsciente e a sexualidade como paradigmas.

  4. Diversity and spatial heterogeneity of mangrove associated sponges of Curaçao and Aruba

    OpenAIRE

    Hunting, E.R.; van Soest, R.W.M.; Van der Geest, H. G.; Vos, A; Debrot, A.O.

    2008-01-01

    Sponges are major epibionts of mangrove roots in the Caribbean. Mangrove sponge communities in the Caribbean mainly consist of species that are typical to this habitat and community compositions often differ from those found on coral reefs nearby. Heterogeneity in species distributions between locations and within locations between roots is often reported. This study quantifi es the diversity and abundance of mangrove associated sponges in the inner bays of Curaçao and Aruba and correlates va...

  5. Análise de fatores associados ao significado do trabalho

    Directory of Open Access Journals (Sweden)

    Sergio Hideo Kubo

    2012-12-01

    Full Text Available O trabalho tem sido visto não somente como forma de obter a renda, mas também como atividade que proporciona realização pessoal, status social e possibilidade de estabelecer e manter contatos interpessoais, entre outros. Nesta pesquisa, teve-se como objetivo investigar os fatores que influenciam e conferem sentido ao trabalho, como centralidade do trabalho, normas da sociedade e objetivos e resultados valorizados. Na centralidade do trabalho, procurou-se investigar o grau de importância do trabalho dentro do contexto das diversas áreas da vida das pessoas, como família, lazer, religião e vida comunitária. Em normas da sociedade, foram analisados os pontos mais significativos no tocante ao que a sociedade deveria proporcionar ao indivíduo, assim como o que o indivíduo deveria fazer em prol da sociedade. Nos objetivos e resultados valorizados, foi pesquisado o que as pessoas buscam com o trabalho. A partir da pesquisa na literatura, foi elaborado um modelo inicial que, não se mostrando satisfatório segundo critérios estatísticos, foi substituído por outro que apresentou significância estatística e boa aderência aos dados. O modelo escolhido foi o que melhor goodness-of-fit apresentou, quando se utilizou modelagem de equações estruturais pelo método partial least square. O estudo revelou que o significado do trabalho se reflete, na ordem, na centralidade do trabalho, nos objetivos e resultados valorizados e, por último, nas normas sociais.

  6. Perícia contábil: uma ferramenta de combate ao crime organizado

    Directory of Open Access Journals (Sweden)

    IDALBERTO JOSÉ DAS NEVES JÚNIOR

    2011-11-01

    Full Text Available No Brasil e no mundo, devido principalmente à ausência do Estado no cumprimento do seu papel de garantidor da lei e da ordem, as organizações criminosas cresceram significativamente, e as suas ações passaram a ocorrer de formas planejadas e estratégicas. Para combatê-las e reprimi-las, a Perícia Contábil, materializada nos laudos periciais elaborados pelos peritos criminalistas, surge como importante ferramenta de Inteligência. Nesse contexto, o objetivo desta pesquisa foi identificar a relevância da Perícia Contábil como meio de prova para a solução de controvérsias relativas ao crime organizado. Para tanto, houve a realização de pesquisa de campo por meio de questionário aplicado aos Delegados, Escrivães e Agentes de Polícia das divisões da Diretoria de Combate ao Crime organizado – DCOR do Departamento de Polícia Federal. Também, houve a utilização de técnicas de estatística multivariada de análise de cluster para o estudo dos registros (K-Means clusters do software SPSS, que resultou na formação de dois agrupamentos. Considerando a pesquisa de campo e o referencial teórico, verificou-se que a Perícia Contábil, no limite de suas atribuições, é um relevante meio de prova para a solução de controvérsias relativas ao crime organizado.

  7. Avaliação da sensibilidade da goiabeira 'Pedro Sato' ao ozônio

    Directory of Open Access Journals (Sweden)

    Regina Maria de Moraes

    2011-09-01

    Full Text Available O objetivo deste trabalho foi avaliar a sensibilidade da goiabeira 'Pedro Sato' ao ozônio (O3, em comparação à cultivar Paluma, descrita como sensível. Oito plantas de cada cultivar foram submetidas separadamente a ar filtrado e a ar filtrado + O3, cinco horas por dia, durante quatro dias. Foram avaliadas fotossíntese (Asat, injúrias foliares visíveis e concentração de antocianinas e taninos. Plantas das duas cultivares também foram expostas, durante três meses, a condições ambientais em local contaminado por O3, tendo-se avaliado fotossíntese, injúrias foliares e crescimento. Plantas fumigadas com O3 apresentaram redução de Asat e da atividade fotoquímica, além de manifestação de injúrias foliares. 'Paluma' apresentou maior redução de Asat, injúrias foliares mais severas e redução de taninos. Quando exposta ao ambiente contaminado, 'Paluma' apresentou trocas gasosas mais altas, mas apresentou redução de Asat 30 dias antes que 'Pedro Sato'. O crescimento não foi afetado em 'Pedro Sato', cujas injúrias foliares tiveram menor incidência, severidade e precocidade do que em 'Paluma'. A menor taxa de crescimento de 'Paluma' indica maior sensibilidade ao O3. Apesar de responder com menor intensidade ao estresse induzido pelo O3, a cultivar Pedro Sato não pode ser considerada tolerante, pois apresenta danos fotoquímicos, injúrias foliares e alterações nos conteúdos de metabólitos secundários quando exposta a esse poluente.

  8. Potencial de fertilizantes e corretivos no aporte de micronutrientes ao solo

    OpenAIRE

    Vinícius Gedeão Bezerra de Carvalho; Clístenes Williams Araújo do Nascimento; Caroline Miranda Biondi

    2012-01-01

    Fertilizantes e corretivos, ao serem aplicados nos solos, fornecem micronutrientes como impurezas residuais da sua fabricação, os quais podem ser importantes fontes para as culturas. Em decorrência disso, o objetivo deste trabalho foi quantificar os teores dos micronutrientes Zn, Cu, Fe, Mn e Ni em fertilizantes e corretivos comercializados no Nordeste brasileiro, visando avaliar o potencial desses insumos no fornecimento indireto de micronutrientes às culturas agrícolas. Os insumos analisado...

  9. Do valor intrínseco e de sua aplicabilidade ao meio ambiente

    Directory of Open Access Journals (Sweden)

    Tânia Ap. Kuhnen

    2004-01-01

    Full Text Available O tema deste estudo é a teoria do valor sagrado da vida e sua aplicabilidade às questões de ética prática, mais especificamente ao meio ambiente. O objetivo geral consiste em apontar os limites da concepção de Dworkin sobre a teoria do sagrado, quando aplicada ao meio ambiente, e a solução que Singer oferece para a atribuição de valor ao mesmo. Justifica-se esse trabalho em decorrência da importância de se discutir, a partir da análise dessas teorias filosóficas, questões vinculadas ao estabelecimento de um princípio ético que, além de englobar, no campo da ação moral, todos os seres sencientes, envolva também o meio ambiente como um todo. Além disso, o tema que aqui se desenvolve é uma contribuição do raciocínio filosófico-teórico para a discussão de problemas relevantes no campo da ética prática. Esse estudo ainda se justifica por abordar a questão da linha moral divisória entre os seres que são ou não incluídos na comunidade moral, o que representa outro problema que concerne à ética. As diferentes formas de classificação não foram capazes de incluir todos os seres vivos no âmbito da comunidade moral. Há sempre exclusões, as quais tendem a diminuir com o surgimento de teorias éticas inovadoras, dentre elas as que serão abordadas a seguir.

  10. Clinical use of AO three-dimensionally preformed titanium mesh plates for orbital fractures

    Directory of Open Access Journals (Sweden)

    Ming Chen

    2015-01-01

    Full Text Available AIM:To evaluate the accuracy and practicability of three-dimensionally preformed Arbeitsgemeinschaft Osteosynthese AO titanium mesh plates for orbital fractures.METHODS:Forty-seven patients with isolated blow-out orbital fractures were included in this study. Fracture locations were as follows: floor/medial wall(n=26, 55%, medial wall(n=12, 26%, and floor(n=9, 19%. The floor fractures were exposed by a standard transconjunctival approach, whereas a combined transcaruncular transconjunctival approach was used in patients with medial wall fractures with temporary dissection of inferior oblique muscle. A three-dimensionally preformed AO titanium mesh plate was selected according to the size of the defect previously measured on the preoperative computed tomographic scan examination and fixed at the inferior orbital rim with 2 screws. The accuracy of plate positioning of the reconstructed orbit was assessed on the postoperative computed tomography(CTscan. The practicability of clinical use of AO three-dimensionally preformed titanium mesh plates was assessed on the preoperative and postoperative clinical data.RESULTS: Postoperative orbital CT scan showed an anatomic three-dimensional placement of the orbital mesh plates in all of the patients. All patients had a successful treatment outcome without clinical complications. 40 patients(87%had a successful enophthalmos correction. 25 patients(86%had a successful recovery from diplopia.CONCLUSION: Three-dimensionally preformed AO titanium mesh plates for orbital fracture reconstruction results in an accurate anatomic restoration of the bony orbital contour with a high rate of success to correctenophthalmos and diplopia.

  11. Software interativo: ecocardiografia na avaliaçao da hipertensao arterial

    Directory of Open Access Journals (Sweden)

    Fábio Abdalla Segamarchi

    Full Text Available A hipertensao arterial é uma doença muito prevalente, evoluindo com lesoes em órgaos-alvo, alta morbidade e mortalidade. A avaliaçao das repercussoes cardíacas pela ecocardiografia tem papel importante na conduçao clínica dos indivíduos hipertensos, e suas imagens podem ser utilizadas como ferramenta para o ensino. OBJETIVOS: Desenvolver e avaliar um software, construído com base em imagens ecocardiográficas, abordando de forma ilustrativa e interativa a estrutura e funçao cardíacas normais,bem como as alteraçoes induzidas pela hipertensao arterial. MÉTODOS: Foram selecionadas imagens ecocardiográficas de indivíduos normais e com comprometimento cardíaco determinado pela hipertensao (hipertrofia ventricular esquerda, miocardiopatia dilatada e infarto do miocárdio. Com estas imagens foi construído um software no programa multimídia Flash, que foi avaliado por estudantes de Medicina (n=38 e Enfermagem (n=18, também submetidos a pré- e pós-teste. RESULTADOS: Os alunos consideraram o software útil, atraente e adequado as atuais metodologias educacionais proativas,promovendo ganho de conhecimento na compreensao do comprometimento cardíaco na hipertensao arterial. Conclusao: O software foi bem avaliado e considerado útil na aquisiçao de conhecimento numa área específica mais prevalente do comprometimento da saúde do adulto.

  12. Fatores associados ao sedentarismo no lazer em idosos, Campinas, São Paulo, Brasil

    Directory of Open Access Journals (Sweden)

    Maria Paula do Amaral Zaitune

    2007-06-01

    Full Text Available O objetivo deste estudo foi conhecer a prevalência de sedentários no lazer (que referem não praticar nenhum exercício físico no lazer ao menos uma vez por semana em idosos de Campinas, São Paulo, Brasil, segundo fatores demográficos e sócio-econômicos, outros comportamentos relacionados à saúde e à presença de morbidades. Trata-se de um estudo transversal, de base populacional, com amostragem em múltiplos estágios. A análise dos dados levou em conta o desenho amostral. A prevalência de sedentários foi 70,9%, sendo que as razões de prevalências foram significativamente maiores que um para os idosos de menor renda (1,31: 1,11-1,55, tabagistas (1,39: 1,23-1,57, com transtorno mental comum (1,20: 1,04-1,39 e do sexo feminino (1,16: 1,00-1,35. A prevalência de caminhada foi 23,5%, seguida por ginástica ou musculação (3,8% e por natação ou hidroginástica (3,6%. Os resultados apontam para a necessidade do desenvolvimento de ações globais com respeito aos comportamentos relacionados à saúde. Atenção especial deve ser dada aos idosos do sexo feminino, àqueles com transtorno mental comum e aos de menor nível sócio-econômico a fim de garantir eqüidade em relação às práticas de promoção da saúde.

  13. Do modernismo ao alívio pós-moderno

    Directory of Open Access Journals (Sweden)

    Simone Regina Dias

    2003-06-01

    Full Text Available Ao traçar um mapeamento dos elementos fundantes da grande crise mundial que se instaurou desde 1789, no livro Crítica e crise, Reinhart Koselleck sustenta: Pertence à natureza da crise que uma decisão esteja pendente mas ainda não tenha sido tomada. Também reside em sua natureza que a decisão a ser tomada permaneça em aberto. Portanto, a insegurança geral de uma situação crítica é atravessada pela certeza de que, sem que se saiba ao certo quando ou como, o fim do estado crítico se aproxima. A solução possível permanece incerta, mas o próprio fim, a transformação das circunstâncias vigentes — ameaçadora, temida ou desejada —, é certo. A crise invoca a pergunta ao futuro histórico. As constatações de Koselleck apontam para o reconhecimento de um estado de crise permanente do mundo. Isto é, um olhar focado em determinado momento da história poderia extrair, em tempos diversos, um quadro em que se detecta a crise, um estado de incertezas.

  14. Reconhecimento dos aspectos tacêsicos para o cuidado afetivo e de qualidade ao idoso hospitalizado

    Directory of Open Access Journals (Sweden)

    Teresa Cristina Gioia Schimidt

    2013-04-01

    Full Text Available Verificar os aspectos tacêsicos importantes para serem observados ao tocar o idoso. Estudo de campo, qualitativo e exploratório desenvolvido com 117 graduandos e profissionais de saúde participantes da capacitação em comunicação não verbal em gerontologia. Os resultados revelam que a maioria conseguiu identificar, pelo menos, um fator de atenção que precisa ser respeitado ao tocar o idoso. Os discursos permitiram a construção de nove categorias apontando condições necessárias ao cuidado afetivo e de qualidade prestado no âmbito da tacêsica; quais sejam: autorização para que o toque ocorra; localização do toque; intensidade do toque; condição do idoso; intencionalidade e tipo de toque; duração do toque; sexo e idade de quem toca e quem é tocado; frequência do toque e características das mãos que tocam. O tocar faz parte do cotidiano dos profissionais da saúde e expressa zelo e sentimentos consequentemente, revela a qualidade da assistência prestada.

  15. Dificuldades vividas por pessoas trans no acesso ao Sistema Único de Saúde

    Directory of Open Access Journals (Sweden)

    Pablo Cardozo Rocon

    Full Text Available Resumo Objetivou-se discutir as dificuldades de pessoas trans moradoras da região metropolitana da Grande Vitória/ES em acessarem os serviços de saúde no SUS. Utilizou-se uma abordagem qualitativa por meio de entrevistas semiestruturadas com 15 pessoas trans. Os resultados apontaram o desrespeito ao nome social, a discriminação e o diagnóstico no processo transexualizador como principais limitações no acesso ao sistema de saúde. Afirma-se que o diagnóstico contribui para ocultar a responsabilidade da heteronormatividade e do binarismo de gênero pela marginalização social das pessoas trans. Conclui-se que é necessário modificar o diagnóstico em sua função, já que a existência de uma patologia prévia não é requisito para acessar o SUS. Aponta-se, também, a importância de elaborar programas de educação e campanhas permanentes sobre o direito de acesso ao sistema de saúde livre de discriminação e com uso do nome social.

  16. Simulated Guide Stars: Adapting the Robo-AO Telescope Simulator to UH 88”

    Science.gov (United States)

    Ashcraft, Jaren; Baranec, Christoph

    2018-01-01

    Robo-AO is an autonomous adaptive optics system that is in development for the UH 88” Telescope on the Mauna Kea Observatory. This system is capable of achieving near diffraction limited imaging for astronomical telescopes, and has seen successful deployment and use at the Palomar and Kitt Peak Observatories previously. A key component of this system, the telescope simulator, will be adapted from the Palomar Observatory design to fit the UH 88” Telescope. The telescope simulator will simulate the exit pupil of the UH 88” telescope so that the greater Robo-AO system can be calibrated before observing runs. The system was designed in Code V, and then further improved upon in Zemax for later development. Alternate design forms were explored for the potential of adapting the telescope simulator to the NASA Infrared Telescope Facility, where simulating the exit pupil of the telescope proved to be more problematic. A proposed design composed of solely catalog optics was successfully produced for both telescopes, and they await assembly as time comes to construct the new Robo-AO system.

  17. Currículo universitário: do México ao Brasil neoliberais

    Directory of Open Access Journals (Sweden)

    Dostoiewski Mariatt de Oliveira Champangnatte

    2016-03-01

    Full Text Available Resumo O objetivo deste estudo foi discutir e comparar percepções e ações curriculares de professores universitários mexicanos e brasileiros. Contextualizando as realidades socioeconômicas dos dois países e, principalmente, as políticas governamentais voltadas ao ensino superior, observa-se, nas várias falas dos professores, uma abordagem simplista de currículo, significando-o apenas como preocupações de conteúdos administrados em disciplinas e planos de ensino. Aspectos da realidade social, política e econômica são desatrelados do pensamento e prática curriculares, onde o maior objetivo se tornou a adequação ao mercado de trabalho. Nota-se, direta e indiretamente, influências do pensamento e práticas neoliberais no posicionamento desses professores tanto quanto ao currículo como com a própria funcionalidade do ensino superior, refletindo e reproduzindo, em seus discursos e práticas, as políticas governamentais neoliberais vigentes.

  18. Improvement of small incision transscleral sulcus fixation of Akreos Adapt AO foldable intraocular lens

    Directory of Open Access Journals (Sweden)

    Tao He

    2015-12-01

    Full Text Available AIM:to observe the effect of modified surgery of small incision transscleral sulcus fixation of Akreos Adapt AO foldable intraocular lens.METHODS:The study included 37 patients(37 eyeswho could not be performed the regular implantation of posterior chamber intraocular lens for the rupture of posterior capsule or for the zonular dialysis caused by trauma, congenital or surgery. Bausch & lomb Akreos Adapt AO fordable intraocular lens, VE22000 implantation device were applied in this study. Regular 2.4mm transparent cornea incision and pocket-like sclera incision were made. The intraocular lens were transscleral sulcus fixed by 10/0 prolene suture and the suture was buried within the scleral incision.RESULTS:The intraocular lenses were all well posited and the postoperative visual acuity(VAwas improved in all patients. Three eyes(8%were≥0.8 while 18 eyes(49%>0.4~≤0.6 and the remaining 16(43%were ≤ 0.4 at 3mo after surgery.Cornea astigmatism was 1.73D±1.22D and 1.62±1.34D before and after surgery, no statistic significance was observed(PCONCLUSION:The modified surgery of 2.4mm small incision transscleral sulcus fixation of Akreos Adapt AO foldable intraocular lens has the following advantages such as:good visual results, less postoperative astigmatism, small surgery incision, steady intraocular lens, less manipulation, less complication and more effective.

  19. Atendimento domiciliar ao idoso: problema ou solução?

    Directory of Open Access Journals (Sweden)

    Ciro Augusto Floriani

    Full Text Available O atendimento domiciliar ao idoso tem se tornado um importante instrumento de assistência nos últimos anos, tanto nos países desenvolvidos quanto nos países em desenvolvimento. Vários aspectos éticos, sociais e operacionais têm sido negligenciados e a literatura nacional é escassa em relação a esta temática. A partir de revisão bibliográfica em atendimento domiciliar, este artigo enfoca, do ponto de vista bioético, os potenciais problemas advindos com a implantação dessa crescente e importante modalidade de atendimento. Conclui ser necessário um maior direcionamento ético na implantação do atendimento domiciliar, com políticas de proteção ao paciente, à família e ao cuidador, visando a aperfeiçoar a qualidade dos programas oferecidos.

  20. Escala de atitudes face ao lazer em adolescentes e jovens adultos

    Directory of Open Access Journals (Sweden)

    Teresa Freire

    2007-04-01

    Full Text Available Atualmente, o lazer e as atitudes face ao lazer têm sido alvo de interesse na investigação psicológica, concretamente no domínio da Psicologia Social. O objetivo do presente estudo foi adaptar a escala Leisure Attitude Scale de Raghb e Beard, construída para avaliar as atitudes face ao lazer em função das três componentes de atitude (cognitiva, afetiva e comportamental para a população de estudantes, adolescentes e jovens adultos portugueses. Participaram no estudo 462 sujeitos (57,8% do sexo feminino e 42,2% do sexo masculino, com uma média de idades de 19,97 (desvio padrão de 4,85. Os resultados obtidos confirmam a estrutura e as características psicométricas da versão original, refletindo valores largamente aceitáveis de fidelidade (consistência interna e validade (validade de conteúdo quer para a escala total quer para as várias sub-escalas (cognitiva, afetiva e comportamental. Conclui-se pela adequação da escala na medida das atitudes face ao lazer, no contexto português.

  1. Physical Growth and Nutritional Status among Ao Naga Children of Nagaland, Northeast India

    Directory of Open Access Journals (Sweden)

    Temsumongla Longkumer

    2013-01-01

    Full Text Available The present study was carried out on 571 Ao Naga children including 289 boys and 282 girls aged 8 to 15 years from Mokokchung town, Nagaland. This study tried to find out the physical growth according to the height and weight and nutritional status according to the body mass index (BMI following the classification by Cole et al. Our study revealed that the girls were taller than boys till 13 years and the boys became taller thereafter. As for weight, the girls were heavier during 10 to 14 years. The mean height and weight increased as the age advanced in both boys and girls. The prevalence of underweight was 30.12% and the prevalence of overweight was 2.28% among the Ao Naga children, and the girls were found to have a higher prevalence of overweight and the boys had a higher prevalence of underweight. This revealed that both underweight and overweight coexisted among the Ao Naga children from Mokokchung town, although the prevalence of overweight was not high.

  2. Reconhecimento dos aspectos tacêsicos para o cuidado afetivo e de qualidade ao idoso hospitalizado

    Directory of Open Access Journals (Sweden)

    Teresa Cristina Gioia Schimidt

    Full Text Available Verificar os aspectos tacêsicos importantes para serem observados ao tocar o idoso. Estudo de campo, qualitativo e exploratório desenvolvido com 117 graduandos e profissionais de saúde participantes da capacitação em comunicação não verbal em gerontologia. Os resultados revelam que a maioria conseguiu identificar, pelo menos, um fator de atenção que precisa ser respeitado ao tocar o idoso. Os discursos permitiram a construção de nove categorias apontando condições necessárias ao cuidado afetivo e de qualidade prestado no âmbito da tacêsica; quais sejam: autorização para que o toque ocorra; localização do toque; intensidade do toque; condição do idoso; intencionalidade e tipo de toque; duração do toque; sexo e idade de quem toca e quem é tocado; frequência do toque e características das mãos que tocam. O tocar faz parte do cotidiano dos profissionais da saúde e expressa zelo e sentimentos consequentemente, revela a qualidade da assistência prestada.

  3. Transtorno afetivo bipolar: perfil farmacoterapêutico e adesão ao medicamento

    Directory of Open Access Journals (Sweden)

    Adriana Inocenti Miasso

    2012-06-01

    Full Text Available Este estudo teve como objetivos verificar a adesão de portadores de transtorno afetivo bipolar (TAB à terapêutica medicamentosa e identificar possíveis causas de adesão e não adesão ao medicamento de acordo com o perfil farmacoterapêutico. Trata-se de estudo transversal, descritivo, realizado em Núcleo de Saúde Mental de um município do interior paulista. Participaram do estudo 101 pacientes com TAB. Para coleta dos dados, utilizou-se a entrevista estruturada e o teste de Morisky-Green e, para a análise dos mesmos, o programa Statistical Package for the Social Science. Os resultados mostraram que a maioria (63% dos sujeitos investigados não adere ao medicamento. Apesar de não ter ocorrido diferenças significativas entre o grupo de aderentes e não aderentes, para as variáveis investigadas, foi possível verificar a utilização de polifarmacoterapia e regimes terapêuticos complexos no tratamento do TAB. Permanece como desafio a implementação de estratégias que possam melhorar, na prática, a adesão de pacientes ao tratamento medicamentoso.

  4. O ser-coronariopata: entree o viver autêntico e as amarras ao cotidiano

    Directory of Open Access Journals (Sweden)

    Lucia de Fatima da Silva

    Full Text Available Estudo fenomenológico, cujo objeto é o sentido atribuído pelos coronariopatas às suas experiências vivenciadas. Das entrevistas foram extraídas as significações: temer a morte e o retorno dos sintomas agudos; perceber a transformação na vida social, profissional e sexual; sentir-se vigiado; conformar-se com a nova condição e sentir tristeza e inconformação. Estas significações subsidiaram a análise compreensiva a qual, respaldada na obra Ser e tempo de Martin Heidegger, permitiu captar o sentido nelas velado. Os coronariopatas desvelaram-se existentes inautênticos ao temerem "algo", prenderem-se à tagarelice e ao vigor de ter sido. Ainda, transcendem ao existir autêntico quando angustiam-se, assumindo a coronariopatia como possibilidade de ser-no-mundo; embora fracassem nesta tarefa e voltem às amarras do cotidiano. O estudo reflete a necessidade de privilegiar a dimensão existencial na assistência à saúde e na formação dos profissionais, além da compreensão do outro como esteio para o cuidar.

  5. Profilaxia das úlceras associadas ao estresse Prophylaxis of ulcers associated with stress

    Directory of Open Access Journals (Sweden)

    Carlos Eduardo Pompilio

    2010-06-01

    Full Text Available INTRODUÇÃO: As úlceras da mucosa gastroduodenal que aparecem após graves insultos têm sido chamadas de úlceras associadas ao estresse ou, mais genericamente, de "doença mucosa associada ao estresse" (DMAE. São conhecidas desde a Antiguidade e apesar de relacionarem-se com altos índices de morbidade e mortalidade, esquemas de profilaxia no intuito de minimizar seus riscos, só foram introduzidos recentemente. Os inibidores da bomba de prótons têm desempenhado papel importante nesse cenário. MÉTODOS: O presente artigo é uma breve revisão sobre seu uso dentro do contexto clínico da profilaxia do sangramento gastrointestinal relacionado ao estresse.INTRODUCTION: Gastroduodenal mucosal ulcers that appear after severe insults have been called ulcers associated with stress or, more generally, "mucosal disease associated with stress" (DMAE. Are known since antiquity and although linked with high morbidity and mortality, prevention schemes in order to minimize their risk, were introduced only recently. The proton pump inhibitors have played an important role in this scenario. METHODS: This article is a brief review of its use within the clinical context of prophylaxis of gastrointestinal bleeding due to stress.

  6. Ausência de expectativa de suporte para o cuidado aos idosos da comunidade

    Directory of Open Access Journals (Sweden)

    Déborah Cristina de Oliveira

    2016-06-01

    Full Text Available RESUMO Objetivo: identificar fatores associados à ausência de expectativa de suporte para o cuidado aos idosos da comunidade. Método: foram utilizados parte dos dados do estudo multicêntrico "Fragilidade em Idosos Brasileiros", pesquisa quantitativa, epidemiológica e transversal desenvolvida no período de 2008 a 2009. Foram realizadas análises de comparação e regressão dos dados de 671 idosos. Resultados: a avaliação da expectativa de suporte para o cuidado aos idosos mostrou-se um bom indicador de risco para ausência de expectativa de suporte em mulheres, idosos que residiam sozinhos e com percepção ruim da própria saúde. Conclusão: conclui-se que é preciso refletir sobre o sistema de suporte oferecido aos idosos no Brasil, visto que o perfil destes que estão em risco é cada vez maior na população. Ressalta-se também a importância da inserção de métodos subjetivos para avaliação da percepção dos idosos sobre suporte para o cuidado.

  7. O DUALISMO DO SER ÓRFICO NA EPÍSTOLA DE PAULO AOS ROMANOS

    Directory of Open Access Journals (Sweden)

    Roger Ribeiro da Silva

    2010-01-01

    Full Text Available Este trabalho consiste na comparação de fragmentos de textos encontrados na obra de Platão e na Epístola aos Romanos atribuída à Paulo. Retirados de inúmeros textos atribuídos a Platão, estes fragmentos tiveram confirmados indícios da teologia órfica pelo professor Alberto Bernabé Pajares. E ao aplicar a Metodologia de Analise do Discurso Teológico, desenvolvido especificamente para este trabalho, e comparado os resultados individuais, encontramos pontos de encontro entre as duas teologias, a Órfica e a Paulina, acentuando o que tange a crença no Dualismo do Ser. A problemática levantada neste trabalho se refere a como a representação1 da alma unida ao corpo, encontrada em escritos paulinistas, apresenta indícios de contatos com fundamentos órficos no berço do cristianismo.

  8. O enfermeiro frente ao desmame precoce na consulta de enfermagem à criança

    Directory of Open Access Journals (Sweden)

    Caroline Aparecida Coutinho Monteschio

    2015-10-01

    Full Text Available RESUMOObjetivo:analisar a atuação do enfermeiro frente ao desmame precoce em crianças menores de 6 meses de idade.Método:estudo descritivo de abordagem qualitativa. Participaram do estudo enfermeiros que realizavam consulta de enfermagem à criança de maneira programática em unidades de saúde da família em Cuiabá-MT. Os dados foram coletados nos meses de janeiro e fevereiro de 2012, por meio da observação participante da consulta de enfermagem. Para análise dos dados foi utilizada a análise de conteúdo.Resultados:os enfermeiros, na maioria das vezes, utilizaram estratégias apropriadas para o manejo dos problemas mais comuns na amamentação, apesar de algumas condutas não terem, ainda, evidência científica comprovada, quanto aos benefícios e/ou prejuízos à sua prática.Conclusão:os enfermeiros abordaram aspectos importantes do aleitamento materno durante as consultas e trabalharam em prol da promoção e do resgate ao aleitamento materno exclusivo.

  9. Jovens no trânsito: do sentido do dirigir ao desenvolvimento de consciência

    Directory of Open Access Journals (Sweden)

    Sonia Chébel Mercado Sparti

    2008-12-01

    Full Text Available Introdução: a complexa situação relativa à circulação humana tem suscitado muitas indagações. O advento do automóvel, ao lado das dimensões positivas, também trouxe consigo um conjunto de graves problemas, destacando-se pela sua magnitude e importância, os acidentes de trânsito. Objetivo: esta pesquisa buscou conhecer como a reflexão sobre o sentido do dirigir possibilita o desenvolvimento de consciência de jovens universitários/as. Metodologia: foram utilizadas duas Entrevistas Reflexivas, realizadas de maneira Coletiva, com dez universitários/as da PUC-São Paulo/campus Sorocaba, seguidas de devolução (com pré-análise dos dados. A opção pela Entrevista Reflexiva deveu-se, dentre outros fatores, ao seu caráter de intervenção, uma vez que a escuta atenta e respeitosa pode ser um momento de ajuda. A Grounded Theory foi utilizada para a organização dos dados. Resultados: este procedimento reflexivo possibilitou a compreensão dos aspectos positivos e negativos relativos à circulação humana e levantou fatores indicativos de prevenção: afirmações categóricas a respeito das próprias habilidades ao volante cederam lugar ao reconhecimento de que ainda há espaço para seu aperfeiçoamento; o olhar relativo ao outro foi se modificando, de maneira a considerá-lo parceiro, e não adversário; a preservação da vida sendo considerada um valor, em direção a um que fazer mais prudente, no espaço compartilhado do trânsito. Conclusão: estes resultados ratificam a proposta de que é possível (e desejável pensar a educação para o trânsito na perspectiva do desenvolvimento de consciência.

  10. Seca da semente de café ao sol Effect of sunlight on coffee seed viability

    Directory of Open Access Journals (Sweden)

    Oswaldo Bacchi

    1955-01-01

    Full Text Available O presente trabalho diz respeito a estudos realizados com o objetivo de observar a influência da luz solar sôbre a capacidade germinativa da semente despolpada de café e verificar, portanto, a possibilidade de se efetuar a seca desta semente exclusivamente ao sol. Além de um ensaio preliminar, foram efetuados mais outros dois, compreendendo, ao todo, duas secas ao sol, duas em um secador a baixa temperatura (±28°C, uma a sombra e uma em um secador a alta temperatura (±40°C. Pelas correlações entre as porcentagens de germinação e de umidade, que foram estabelecidas após diferentes períodos de secagem, foram tiradas as duas seguintes conclusões, que são as principais com relação ao objetivo dêstes ensaios : 1 Os raios solares são prejudiciais à capacidade germinativa da semente de café; sua nocividade acha-se, porém, intimamente ligada ao teor de umidade na semente. 2 À vista da conclusão acima, verifica-se que a semente despolpada de café e, muito provavelmente, também a não despolpada, podem ser perfeitamente sêcas a pleno sol sem que haja prejuízo para sua vitalidade, uma vez que sejam recolhidas antes que o seu teor de umidade caia abaixo do ponto crítico de 8% - 9%.In this paper the author deals with the question related to the coffee seed drying, with special attention to the effect of the sun radiations on seed viability. Based on the results obtained, the following conclusions were drawn : (a The sun rays have no specific influence on the viability of hulled coffee seed ; their effect is indirect and related to loss of moisture by the seed. (b Coffee seed can be dried in the sunlight without loss of viability if the water content does not drop under 8% to 9%. Below this critical level seed germination falls rapidly. (c The moisture content of coffee seed dried „in the sun may fall to about 7% in a short time with the consequent injury to viability. (d Under most conditions in the state of São Paulo

  11. Forma clínica e fatores de risco associados ao estrabismo na binocularidade visual

    Directory of Open Access Journals (Sweden)

    Maria Nice Araujo Moraes Rocha

    2016-02-01

    Full Text Available RESUMO Objetivo: Identificar e analisar fatores de risco associados ao estrabismo, dados oftalmológicos e antecedentes pessoais e familiares. Métodos: Estudo prospectivo, descritivo e analítico realizado com 240 pacientes que consultaram pela primeira vez nos ambulatórios de estrabismo. Foram avaliadas a frequência e associação entre estrabismo, dados de exames oftalmológicos e antecedentes pessoais e familiares para identificação dos fatores de risco. Resultados: Observou-se maior prevalência de estrabismo em mulheres (56,96% em relação aos homens (43,02%. A faixa etária mais atendida no ambulatório de estrabismo foi composta de crianças até 15 anos de idade (83,54%. Encontrou-se mais esotropia (55,27% que exotropia (42,20% e parcela menor de estrabismo vertical isolado (2,53%. A prematuridade foi associada ao estrabismo convergente (p=0,023 e não ao divergente (p=0,086. O diabetes mellitus materno foi associado à esotropia (p=0,024 e exotropia (p=0,036 no filho, mas a hipertensão arterial materna, uso de medicamentos para hipertensão e diabetes durante a gravidez e drogas ilícitas não foram estatisticamente significativos. Pacientes com paralisia cerebral tiveram mais associação com exotropia (p=0,008 que esotropia (p=0,019. Malformações congênitas, consanguinidade entre os pais e traumas oculares não apresentaram associação estatisticamente significativa para o estrabismo. A maioria dos pacientes com estrabismo apresentou boa acuidade visual corrigida e fundoscopia normal. Na análise de proporções a hipermetropia foi mais frequente na esotropia (68,7%. Conclusão: Os fatores de riscos internos e externos podem interferir na formação e desenvolvimento do olho na fase de plasticidade ocular, com prejuízo da binocularidade visual, podendo resultar em estrabismo. Há divergências com relação aos fatores de risco realmente associados e mais estudos são necessários para a identificação.

  12. Alterações reprodutivas em ratos machos expostos perinatalmente aos frutos da Solanum lycocarpum

    Directory of Open Access Journals (Sweden)

    Aline Schwarz

    2009-04-01

    Full Text Available Ratas prenhes foram tratadas do dia 06 da gestação (GD 06 ao dia 07 pós-natal (PND 07 com frutos verdes secos e moídos da Solanum lycocarpum (10% na ração. Após nascimento das ninhadas, foi avaliado na prole masculina adulta aos 60 e 90 dias de vida, o número de espermátides e a produção espermática diária nos testículos e o tempo de trânsito espermático no epidídimo. A exposição não foi capaz de promover alterações na produção espermática diária (DSP e no número de espermátides produzidas pelo testículo dos ratos expostos aos frutos verdes da S. lycocarpum durante a gestação e início da lactação. Não foram observadas alterações no tempo de trânsito espermático na cabeça do epidídimo, porém, foi constatado menor número de espermatozóides no corpo/cauda do epidídimo nos machos experimentais com 90 dias de vida, provavelmente resultante do menor tempo de trânsito espermático observado no corpo/cauda do epidídimo aos PND 90. Estes dados sugerem que a exposição de ratos aos frutos verdes da S. lycocarpum durante a gestação e início da lactação, não foi suficiente para promover alterações na produção mas sim no trânsito espermático, indicando possível alteração no eixo hormônio liberador das gonadotrofinas hipotálamo-hipófise-gônada

  13. Sobre o ódio ao professor Entrevista com Fernando Penna

    Directory of Open Access Journals (Sweden)

    Fernando Penna

    2016-01-01

    Full Text Available Ao tomar a decisão de pautar o tema da violência para compor o dossiê do terceiro número de Movimento – revista eletrônica de educação da Universidade Federal Fluminense –, o Conselho Editorial elencou um grande número de facetas da violência que historicamente se manifestam física e presencialmente no interior e fora do espaço escolar. O fenômeno relativamente recente das redes sociais e o vertiginoso processo de crescimento de trocas de informação, interação e mediação virtual a ele agregado, não apenas ampliou o espectro da violência como contribuiu decisivamente para articular o dentro e o fora da escola. Dentre outros exemplos, talvez o mais comum e antigo é o registro de cenas reais de alunos e alunas brigando nos pátios escolares ou nas redondezas da instituição postadas nas redes sociais, muitas delas viralizadas – para usar o barbarismoda ocasião – por um número sempre crescente de adeptos do bullying escolar. Nos últimos cinco anos, nas redes sociais, o exemplo de articulação da violência dentro-fora da escola que mais chama a atenção é o ódio ao professor, conforme observa o professor Fernando Penna na entrevista que publicamos a seguir. Estudioso da manifestação reivindicatória por uma escola sem ideologia trazida nos últimos anos por setores conservadores e reacionários da sociedade brasileira, Penna busca oferecer na entrevista algumas hipóteses para compreendermos o fenômeno do ódio ao professor, bem como algumas pistas para apreendermos os fundamentos que movem aqueles setores no combate ao que denominam de doutrinação ideológica de esquerda, e, concluindo, observa a urgência da resistência ao assédio moral feito dos conservadores ereacionários, chamando a atenção para a importância da ampliação do conhecimento crítico sobre o tema.

  14. Would be the photon a composed particle? / Sobre a possibilidade da quantiza\\c{c}\\~ao dos fluxos de campo na radia\\c{c}\\~ao eletromagn\\'etica

    CERN Document Server

    Duarte, Celso de Araujo

    2013-01-01

    Here it is made a comparative analysis between the classical and the quantum expressions for the energy of electromagnetic radiation (ER). The comparison points to the possibility of the quantization of the magnetic and the electric field fluxes in the ER. ----- Apresenta-se uma an\\'alise comparativa entre as express\\~oes cl\\'assica e qu\\^antica para a energia da radia\\c{c}\\~ao eletromagn\\'etica (RE). A compara\\c{c}\\~ao nos aponta para a possibilidade de haver uma quantiza\\c{c}\\~ao dos fluxos dos campos magn\\'etico e el\\'etrico na RE.

  15. Psychosocial and clinical predictors of retention in outpatient alcoholism treatment Preditores psicossociais e clínicos de retenção ao tratamento para alcoolismo

    Directory of Open Access Journals (Sweden)

    João Maria Corrêa Filho

    2012-12-01

    Full Text Available OBJECTIVE: One of the factors associated with low rates of compliance in the treatment for alcoholism seems to be the intensity of craving for alcohol. This study aimed to evaluate the associations between alcohol craving and biopsychosocial addiction model-related variables and to verify whether these variables could predict treatment retention. METHODS: The sample consisted of 257 male alcoholics who were enrolled in two different pharmacological trials conducted at the Universidade de São Paulo in Brazil. Based on four factors measured at baseline - biological (age, race, and family alcoholism, psychiatric (depression symptoms, social (financial and marital status, and addiction (craving intensity, severity of alcohol dependence, smoking status, drinking history, preferential beverage, daily intake of alcohol before treatment - direct logistic regression was performed to analyze these factors' influence on treatment retention after controlling for medication groups and AA attendance. RESULTS: Increasing age, participation in Alcoholics Anonymous groups, and beer preference among drinkers were independently associated with higher treatment retention. Conversely, higher scores for depression increased dropout rates. CONCLUSION: Health services should identify the treatment practices and therapists that improve retention. Information about patients' characteristics linked to dropouts should be studied to render treatment programs more responsive and attractive, combining pharmacological agents with more intensive and diversified psychosocial interventions.OBJETIVO: Um dos fatores associados com baixas taxas de adesão ao tratamento para alcoolismo parece ser a intensidade da fissura pelo álcool. Este estudo objetiva avaliar a associação entre a fissura pelo álcool e variáveis relacionadas ao modelo biopsicossocial de dependência, bem como verificar se estas variáveis prevêem retenção ao tratamento. MÉTODO: A amostra foi composta por

  16. O profissional de controladoria no mercado Brasileiro: do surgimento da profissão aos dias atuais

    Directory of Open Access Journals (Sweden)

    José Ricardo Maia de Siqueira

    2001-12-01

    Full Text Available Em um trabalho anterior, o pesquisador selecionou quatro anos de anúncios publicados no Jornal do Brasil - 1960, 1970, 1980 e 1989 - buscando a identificação do perfil do profissional de controladoria em cada um destes períodos. O objetivo era avaliar a evolução do controller no Brasil baseado nos anúncios publicados na seção de classificados. Neste trabalho percebe-se no ano de 1960 uma baixa procura por executivos em geral e de controllers em particular. Em contraste com 1960, o ano de 1970 apresentava um número bastante elevado de anúncios um total de 38 - que não se modificaria relevantemente nos demais períodos da pesquisa. Tal constatação é um indício de que em algum momento durante a década de 60 houve um crescimento considerável na demanda por estes profissionais. Este trabalho tem por objetivo identificar quando ocorre este incremento na demanda por controllers, buscando localizar indícios do nascimento da profissão no país. Além disso procura-se traçar um perfil da profissão ao longo dos anos até a atualidade.In a former work, the researcher analyzed ads recruiting controllers published in the "Jornal do Brasil" in 1960, 1970, 1980, and 1989.The objective then was to evaluate the evolution of the profession in Brazil, and to identify the professional profile of the controller in each of these years. It was noticed that the search for executives in general (and controllers in particular was low in 1960 when compared to 1970. The number of ads published in 1970, 38, would not change considerably in the subsequent periods. This indicates that demand for controllers has presented a great variation at some point between 1960 and 1970. The objective of the present work is to detect when this happens. This way, it aims not only to investigate when the profession of the controller was born in Brazil, but also to observe how the characteristics of this professional have changed throughout the years.

  17. Estudo comparativo dos efeitos hemodinâmicos e ventilatórios da ventilação controlada a volume ou a pressão, em cães submetidos ao pneumoperitônio Estudio comparativo de los efectos hemodinámicos y ventilatorios de la ventilación controlada a volumen o a presión, en perros sometidos a pneumoperitoneo Hemodynamic and ventilatory effects of volume or pressure controlled ventilation in dogs submitted to pneumoperitoneum. Comparative study

    Directory of Open Access Journals (Sweden)

    Antonio Roberto Carraretto

    2005-12-01

    Full Text Available JUSTIFICATIVA E OBJETIVOS: A ventilação com pressão controlada (PCV está disponível em aparelhos de anestesia, mas não existem estudos sobre o seu uso, durante o pneumoperitônio com o CO2 (PPC. O objetivo deste estudo foi avaliar a ventilação controlada a pressão bem como as alterações hemodinâmicas e ventilatórias durante o PPC, comparando-a com a ventilação controlada a volume (VCV convencionalmente utilizada. MÉTODO: Dezesseis cães anestesiados com tiopental sódico, citrato de fentanil e brometo de pancurônio, foram divididos aleatoriamente em dois grupos: VC - ventilação controlada a volume (n = 8 e PC - ventilação controlada a pressão (n = 8 Os parâmetros hemodinâmicos e ventilatórios foram monitorizados e registrados em 4 momentos: M1 (antes do PPC, M2 (30 minutos após PPC = 10 mmHg, M3 (30 minutos após PPC = 15 mmHg e M4 (30 minutos após a deflação do PPC. RESULTADOS: Com a aplicação do PPC ocorreu um aumento do volume corrente no grupo PC, aumento das pressões inspiratórias (máxima e de platô, diminuição da complacência proporcional ao aumento do PPC, aumento da freqüência cardíaca, manutenção da pressão arterial média com valores maiores no grupo VC em todos os momentos, aumento da pressão de átrio direito com diminuição significativa após a deflação, diminuição do pH sangüíneo durante o PPC com menor variação no grupo PC, maior estabilidade da pressão parcial do CO2 no sangue arterial no grupo PC, sem alterações da pressão parcial do O2 no sangue arterial. CONCLUSÕES: Apesar das diferenças de alguns parâmetros hemodinâmicos e ventilatórios, entre os dois modos de controle da ventilação, nas condições estudadas foi possível a utilização da ventilação controlada a pressão para procedimentos com a aplicação do PPC. É fundamental observar o controle rigoroso da ventilação alveolar, ajustando a pressão inspiratória para manter eliminação adequada do CO

  18. A Tn5051-like mer-containing transposon identified in a heavy metal tolerant strain Achromobacter sp. AO22

    Directory of Open Access Journals (Sweden)

    Bhave Mrinal

    2009-03-01

    Full Text Available Abstract Background Achromobacter sp. AO22 (formerly Alcaligenes sp. AO22, a bacterial strain isolated from a lead-contaminated industrial site in Australia, was previously found to be resistant to moderate to high levels of mercury, copper and other heavy metals. However, the nature and location of the genetic basis for mercuric ion resistance in this strain, had not been previously identified. Findings Achromobacter sp. AO22 contains a functional mer operon with all four essential genes (merRTPA and shows >99% DNA sequence identity to that of Tn501. The mer operon was present on a transposon, designated TnAO22, captured by introducing a broad-host-range IncP plasmid into Achromobacter sp. AO22 and subsequently transferring it to E. coli recipients. The transposition frequency of TnAO22 was 10-2 to 10-3 per target plasmid transferred. Analysis of TnAO22 sequence revealed it belonged to the Tn21 subgroup of the Tn3 superfamily of transposons, with the transposition module having >99% identity with Tn5051 of a Pseudomonas putida strain isolated from a water sample in New York. Conclusion TnAO22 is thus a new variant of Tn5051 of the Tn3 superfamily and the transposon and its associated mercury resistance system are among the few such systems reported in a soil bacterium. Achromobacter sp. AO22 can thus be exploited for applications such as in situ mercury bioremediation of contaminated sites, or the mobile unit and mer operon could be mobilized to other bacteria for similar purposes.

  19. A Tn5051-like mer-containing transposon identified in a heavy metal tolerant strain Achromobacter sp. AO22.

    Science.gov (United States)

    Ng, Shee Ping; Davis, Belinda; Palombo, Enzo A; Bhave, Mrinal

    2009-03-07

    Achromobacter sp. AO22 (formerly Alcaligenes sp. AO22), a bacterial strain isolated from a lead-contaminated industrial site in Australia, was previously found to be resistant to moderate to high levels of mercury, copper and other heavy metals. However, the nature and location of the genetic basis for mercuric ion resistance in this strain, had not been previously identified. Achromobacter sp. AO22 contains a functional mer operon with all four essential genes (merRTPA) and shows >99% DNA sequence identity to that of Tn501. The mer operon was present on a transposon, designated TnAO22, captured by introducing a broad-host-range IncP plasmid into Achromobacter sp. AO22 and subsequently transferring it to E. coli recipients. The transposition frequency of TnAO22 was 10-2 to 10-3 per target plasmid transferred. Analysis of TnAO22 sequence revealed it belonged to the Tn21 subgroup of the Tn3 superfamily of transposons, with the transposition module having >99% identity with Tn5051 of a Pseudomonas putida strain isolated from a water sample in New York. TnAO22 is thus a new variant of Tn5051 of the Tn3 superfamily and the transposon and its associated mercury resistance system are among the few such systems reported in a soil bacterium. Achromobacter sp. AO22 can thus be exploited for applications such as in situ mercury bioremediation of contaminated sites, or the mobile unit and mer operon could be mobilized to other bacteria for similar purposes.

  20. Trabalho experimental de combate ao acaro rajado Tetranychus urticae Koch, 1836 com formulações aplicadas por "electrodyn"

    OpenAIRE

    Arashiro,F.Y.; Silva, J. M.; Sugamara,C. A.; Motta, R; Raizer,A.J.; MARICONI,F.A.M.

    1987-01-01

    O presente trabalho teve como objetivo o combate experimental ao ácaro rajado Tetranyohus urtioae Koch, 1836 em cultura de algodão. Dois produtos, mediante pulverização eletrodinâmica, foram experimentados: bromopropilato e bifentrina, o primeiro em duas dosagens e o segundo, em três. Aos dias da aplicação, a bifentrina mostra os melhores resultados, embora não se diferencie es tatisticamente do bromopropilato. Aos 09 dias, os melhores são as duas dosagens mais fortes da bifentrina apesar de ...

  1. Avaliação de riscos teratogênicos em gestações expostas ao misoprostol Evaluation of the teratogenic risks in gestations exposed to misoprostol

    Directory of Open Access Journals (Sweden)

    Emérita Sátiro Opaleye

    2010-01-01

    Full Text Available OBJETIVOS: a tentativa de aborto mal sucedida com o uso do misoprostol (Cytotec® sem indicação médica tem sido associada a malformações congênitas. Este estudo teve por objetivo identificar, em recém-nascidos malformados e controles normais, a frequência de exposição ao misoprostol e o espectro de malformações associadas. MÉTODOS: estudo de caso-controle desenvolvido em 2005 nas quatro principais maternidades públicas de Fortaleza (CE. Através de busca ativa diária, foram identificados recém-nascidos com diagnóstico de malformação fetal (caso e controles saudáveis de mesmo sexo nascidos em seguida na mesma maternidade (pareamento 1:1. A amostra foi de 252 parturientes entrevistadas por equipe treinada utilizando questionário estruturado com base no Estudo Colaborativo Latino-Americano de Malformações Congênitas (ECLAMC. Além de abordar questões sociodemográficas e histórico familiar de malformação, o questionário objetivou identificar exposições diversas durante a gestação, incluindo o misoprostol. A análise bivariada com teste do χ2 comparou os grupos quanto às características e fatores associados à malformação e foi calculada a Odds Ratio para verificar a razão de chances de o Grupo Caso apresentar malformação em relação ao Grupo Controle com relação à exposição ao misoprostol. RESULTADOS: não houve diferenças significativas entre os grupos caso e controle quanto à maioria dos fatores de riscos investigados para malformações. O relato de tentativa de aborto foi de 6,8%, havendo uma maior exposição ao misoprostol durante a gestação em neonatos malformados comparados a saudáveis, Odds Ratio (OR=3,65 (IC95%=0,74-17,91. O espectro de malformações encontradas entre os recém-nascidos expostos ao misoprostol foi compatível com a literatura, como os decorrentes de defeitos do tubo neural e disrupção vascular. CONCLUSÕES: os achados deste estudo, apesar de não apresentarem signific

  2. Coma hiperosmolar associado ao transplante de fígado Hyperosmolar coma associated with liver transplantation

    Directory of Open Access Journals (Sweden)

    Olival Cirilo Lucena da Fonseca-Neto

    2009-03-01

    Full Text Available INTRODUÇÃO: O diagnóstico diferencial dos pacientes inconscientes sempre inclui o coma hiperosmolar hiperglicêmico não-cetótico. RELATO DE CASO: Paciente do sexo feminino, 22 anos, tipo sangüíneo O+, branca, natural e procedente do Recife - PE com queixa de icterícia e astenia há um mês. Ao exame físico, havia icterícia 3+/4+, desnutrição leve (IMC 17,5 e asterixis. Os exames laboratoriais sugeriram hepatite fulminante. Após 12 horas da inclusão na lista de espera pelo transplante, recebeu enxerto de fígado de doador cadáver, mediante o uso de técnica de piggback sem intercorrências. No 10º dia pós-operatório evoluiu com trombose de artéria hepática (TAH, diagnosticada por ultra-som com doppler de artéria hepática. Após 48 horas foi retransplantada sem intercorrências. A partir do 13º dia de pós-operatório, evoluiu com hiperglicemia grave (> 600 mg/dl e alteração do nível de consciência (9 pontos na escala de coma de Glasgow. Osmolaridade sérica nesse momento igual a 309 mOsm/kgH2O. O nível sérico de tacrolimus nesse dia foi de 11 ng/dl. Coma hiperosmolar hiperglicêmico não-cetótico foi tratado clinicamente por 48 horas. Recebeu alta no 30º dia de pós-operatório do retransplante, sem diabete mellitus. CONCLUSÃO: O coma hiperosmolar é um evento raro no pós-operatório de transplante de fígado e pode modificar a evolução do paciente.BACKGROUND: The literature described an increased incidence of gastrointestinal stromal tumors (GISTs in patients with neurofibromatosis type 1. These tumors typically occur in the small intestine, and frequently are multiple. Often the behavior of the tumor in this association is more favorable than in sporadic cases. CASE REPORT: Incidental diagnosis of GIST was done in a patient with neurofibromatosis type 1 during treatment for acute abdomen. Trans-operatively was identified a retrocecal perforated appendicitis and a neoplastic mass in the proximal jejunum. The

  3. Resistência de amendoim-bravo aos herbicidas inibidores da enzima acetolactato sintase Wild poinsettia resistance to acetolactate synthase inhibitor herbicides

    Directory of Open Access Journals (Sweden)

    Ribas A. Vidal

    1999-12-01

    Full Text Available O controle contínuo de plantas daninhas através da aplicação de herbicidas que apresentam atividade em um único local de ação nas plantas favorece a seleção de biótipos resistentes a estes herbicidas, em certas espécies vegetais. Quatro experimentos foram conduzidos em condições casa-de-vegetação, na Faculdade de Agronomia da Universidade Federal do Rio Grande do Sul, com os objetivos de avaliar a ocorrência de resistência aos herbicidas inibidores da enzima acetolactato sintase (ALS em vários biótipos de leiteiro ou amendoim-bravo (Euphorbia heterophylla EPHHL e avaliar a ocorrência de resistência múltipla a herbicidas com atividade em outros locais de ação. Biótipo oriundo de Passo Fundo foi resistente ao imazethapyr, enquanto biótipo oriundo de Porto Alegre foi suscetível. O biótipo de Passo Fundo apresentou resistência cruzada aos herbicidas imidazolinonas: imazapyr, imazaquin e imazethapyr; sulfoniluréias: chlorimuron, nicosulfuron e metsulfuron; e sulfonanilida: flumetsulan. Este biótipo não foi resistente aos herbicidas com os seguintes mecanismos de ação: inibidores de EPSPs, mimetizadores de auxina, inibidores dos fotossistemas I e II e inibidores de PROTOX. A confirmação de resistência aos inibidores de ALS em biótipos oriundos de Nãome-Toque, Passo Fundo e Rio Pardo sugere ampla dispersão no Rio Grande do Sul de resistência de E. heterophylla aos herbicidas deste mecanismo de ação.The continuous weed control with herbicides of only one site of action selects biotypes resistant to these herbicides. Four experiments were conducted in greenhouse of UFRGS, Brazil, to confirm the occurence of wild poinsettia (Euphorbia heterophylla biotypes resistance to herbicides inhibitors of acetholactate synthase (ALS, and to determine whether there was cross resistance to herbicides with other site of action. A biotype from Passo Fundo -RS was resistant to imazethapyr, whereas a biotype from Porto Alegre -RS

  4. Cyberbullying – do diagnóstico de necesidades à construçao de um manual de formaçao.

    Directory of Open Access Journals (Sweden)

    Teressa Pessoa

    2011-01-01

    Full Text Available O impacto do cyberbullying na sociedade e junto das crianças e jovens, tão mais complexo quanto mais sofisticadas as ferramentas tecnológicas disponíveis, tem chamado a atenção para a importância, a nível internacional, da definição de estratégias de prevenção e intervenção junto de potenciais agentes educativos, isto é, para o desenvolvimento de uma proposta, com dimensão europeia, de Cyber- Training.Neste trabalho após uma breve apresentação do projectoCyberTraining: A Researchbased Training Manual On Cyberbullying1 dar-se-á a conhecer o processo de desenvolvimento de um manual de formação baseado numa investigação a nível europeu suportada na plataforma Moodle e, nesta, pela ferramenta Fórum. Através de uma análise de necesidades junto de formadores e do estudo, junto de especialistas, do estado de arte no domínio a nível de diferentes países, é mostrado todo um percurso inovador de construção colaborativa de conhecimento relativamente ao conceito cyberbullying assim como relativamente ao desenvolvimento de práticas de formação ou cybertraining.----------------------------------------------------------------The impact of the cyberbullying on society and among children and young people, revealed as ever more complex as more sophisticated technological tools becomeavailable, has called attention to the importance, at the international level, of a definition of strategies for prevention and intervention among potential educational agents, i.e. to develop a proposal for Cyber-Training, with a European dimension.In this paper, after a brief presentation of the European project CyberTraining: A Researchbased Training Manual on Cyberbullying, an account will be given of the process of developing a training manual based on research at European level supported in the Moodle platform, and within this, by the Forum tool. By means of a needs analysis among trainers and analysis by experts of the state of the art in

  5. Estresse Isolado ou Associado ao Etanol Libera Prostanóides em Aorta de Ratos via ?2-Adrenoceptores

    Directory of Open Access Journals (Sweden)

    Rafaela de Fátima Ferreira Baptista

    2014-04-01

    Full Text Available Fundamento: Estresse e etanol são ambos, independentemente, importantes fatores de risco cardiovascular. Objetivo: avaliar o risco cardiovascular do consumo de etanol e exposição ao estresse, isolados e em associação, em ratos machos adultos. Métodos: Os ratos foram separados em quatro grupos: controle, etanol (20% na água de beber durante seis semanas, estresse (imobilização 1h dia/5 dias por semana/ 6 semanas e estresse/etanol. As curvas de concentração-resposta à noradrenalina - na ausência e na presença de ioimbina, L-NAME ou indometacina - ou fenilefrina foram determinadas em aortas torácicas com e sem endotélio. EC50 e resposta máxima (n = 8-12 foram comparadas através de ANOVA de dois fatores (two-way / método de Bonferroni. Resultados: Estresse ou estresse em associação com o consumo de etanol aumentaram as respostas máximas de noradrenalina em aortas intactas. Essa hiper-reatividade foi eliminada pela remoção do endotélio, ou pela presença da indometacina ou ioimbina, mas não foi alterada pela presença de L-NAME. Enquanto isso, o consumo de etanol não alterou a reatividade à noradrenalina. As respostas da fenilefrina em aortas com e sem endotélio também permaneceram inalteradas independentemente do protocolo. Conclusão: O estresse crônico aumentou as respostas aórticas dos ratos à noradrenalina. Esse efeito é dependente do endotélio vascular e envolve a liberação de prostanóides vasoconstritores através da estimulação de α-2 adrenoceptores endoteliais. Além disso, o consumo crônico de etanol pareceu não influenciar as respostas de noradrenalina em aorta de rato, nem modificar o aumento de tais respostas observadas em consequência da exposição ao estresse.

  6. Detecção e monitoramento da resistência do tripes Frankliniella occidentalis ao inseticida espinosade

    Directory of Open Access Journals (Sweden)

    Débora Soller Rais

    Full Text Available O tripes Frankliniella occidentalis (Pergande (Thysanoptera: Thripidae é uma das pragas mais importantes em cultivos protegidos, principalmente de plantas ornamentais e hortícolas. Entre os problemas enfrentados pelos agricultores estão a dificuldade de seu controle com o uso de inseticidas devido à sua preferência pelas partes internas das flores e a evolução de resistência aos agroquímicos. O objetivo da pesquisa foi caracterizar a resistência de F. occidentalis a espinosade e avaliar a frequência de insetos resistentes ao inseticida, em áreas comerciais de crisântemo de diversos municípios do Estado de São Paulo. Seleções para resistência a espinosade foram realizadas em laboratório, utilizando-se uma população de F. occidentalis, coletada em 2007 de um cultivo comercial de crisântemo em Campinas (SP. No decorrer de sete seleções para resistência, a CL50 de espinosade passou de 8,41 mg i.a. L-1 para 1111 mg i.a. L-1. Comparando-se a linhagem resistente (R (selecionada e a suscetível (S, a razão de resistência (CL50 R/CL50 S atingiu valores de ≈280 vezes. Estabeleceu-se uma concentração discriminatória de 98 mg i.a. L-1 para o monitoramento da resistência de F. occidentalis a espinosade. O monitoramento foi realizado coletando-se 19 populações do tripes em áreas comerciais de crisântemo no Estado de São Paulo. Os bioensaios foram realizados com ninfas de segundo ínstar de F. occidentalis, colocadas em arenas de folha de feijão. As aplicações de espinosade, na sua concentração discriminatória, foram realizadas sobre as ninfas em torre de Potter. Os resultados indicaram alta variabilidade entre as populações com relação à suscetibilidade a espinosade. Foram observadas populações com até 40,7% de insetos resistentes. Este é o primeiro relato de resistência de F. occidentalis a espinosade no Brasil.

  7. Assistência de enfermagem perioperatória aos pacientes com câncer de bexiga

    Directory of Open Access Journals (Sweden)

    Helena Megumi Sonobe

    2016-05-01

    Full Text Available Objetivo: O planejamento da assistência de enfermagem perioperatória para pacientes com câncer de bexiga requer conhecimento científico e incorporação tecnológica. Este estudo objetivou caracterizar o perfil de pacientes com câncer de bexiga em uma unidade cirúrgica de um hospital especializado em oncologia do interior paulista e analisar os cuidados de enfermagem realizados para esta clientela. Metodologia: Estudo exploratório retrospectivo, cujos dados foram coletados em 80 prontuários de pacientes submetidos ao tratamento cirúrgico urológico no período de janeiro a setembro de 2008. Resultados: Houve predomínio do sexo masculino, na faixa etária de 60 a 80 anos, com formação fundamental incompleta, de raça branca, estadiamento I e procedimento cirúrgico de Ressecção Transuretral. A assistência de enfermagem perioperatória abarca intervenções educativas de autocuidado, cuidados procedimentais como soroterapia, preparo colônico, administração de medicamentos, posicionamento do paciente, monitorização de sinais vitais, cuidados com sonda e drenos, controle hídrico, passagem de plantão e encaminhamento de prontuário e exames. No caso específico de pacientes com urostomia, é importante a avaliação clínica e das condições do estoma; ensinar as ações específicas do autocuidado; planejar a alta hospitalar, fornecer equipamentos e encaminhar aos recursos da comunidade. Conclusão: Para prestar assistência perioperatória para essa clientela é necessário um planejamento fundamentado em conhecimentos científicos, educação permanente da equipe de enfermagem e supervisão do trabalho pelo enfermeiro.

  8. Programa “VAMOS” (Vida Ativa Melhorando a Saúde: da concepção aos primeiros resultados.

    Directory of Open Access Journals (Sweden)

    Tânia Rosane Bertoldo Benedetti

    2012-11-01

    Full Text Available http://dx.doi.org/10.5007/1980-0037.2012v14n6p723 Apesar do aumento nos incentivos públicos voltados à promoção de um estilode vida ativo entre os brasileiros, o perfil de inatividade física da população é preocupante.Neste sentido, desenvolvemos uma nova estratégia de intervenção na comunidade por meiodo programa “VAMOS: Vida Ativa Melhorando a Saúde”. Neste artigo, serão discutidos informaçõesreferentes à concepção, à criação do nome, ao logotipo, à tradução, às adaptaçõesculturais, às estratégias de avaliação do programa e aos primeiros resultados obtidos no estudopiloto conduzido entre idosos em Centros de Saúde (CS de Florianópolis. Participaram doestudo 100 idosos cadastrados em seis CS. Os idosos foram direcionados aleatoriamente aparticiparem de um dos três grupos do estudo: “VAMOS” (n=33, atividade fisica “tradicional”(n=35, e grupo controle (n=32. “VAMOS” é um programa educacional de mudançade comportamento que consiste em 12 encontros. Baseado no programa norte-americano“Active Living Every Day”, o “VAMOS” foi traduzido e adaptado culturalmente à realidadebrasileira. Vários ajustes foram realizados à versão original americana do programa, especialmente,nos conteúdos de leitura, preenchimento do material, tamanho e dificuldadede compreeenssão de algumas sessões. O estudo piloto apontou uma aceitação muito boaao programa “VAMOS“, por parte dos idosos. Entrevistas com gestores e profissionais doscentros de saúde apontaram a viabilidade e o interesse deles em oferecer o “VAMOS” à comunidadecomo atividade rotineira da rede de saúde pública. Conclue-se que o “VAMOS”tem potencial de uso para a população brasileira, embora seja necessário alguns ajustes parasua utilização com outras faixas etárias e nas diferentes regiões do Brasil.Palavras-chave: Programa de atividade física; Centros de saúde; Idosos; Mudança decomportamento.

  9. A contribution to our knowledge of Leonurus L., i-mu-ts'ao, the Chinese motherwort.

    Science.gov (United States)

    Hu, S

    1976-01-01

    This article deals with the ethnobotanical aspects of the Chinese motherwort. Since time immemorial the Chinese people have used various parts of motherwort to meet different physical needs. By the time a written language was developed and the medical uses were recorded. , motherwort was treated as an article of superior quality. At present, under the name of i-mu-ts'ao, the plant is used for improving bloodflow both by official physicians and herbal practitioners throughout the country as well as by villagers in isolated areas. According to Chinese classical literature on materia medica, the early uses were limited to the parts of the plant which met the most obvious needs of the prehistorical people in their struggle for existence-food and pain reliever. Evidently, in their search for food, the ancient people found that the four nutlets contained in the dry and spinose calyx of the Chinese motherwort resemble the seasame seed in size and oil content. They gathered them and used them for food in similar manner as with the sesame. Consequently, they discovered the good effects to the eyesight, the improvement of strength, and the uplift of spirit. These discoveries led to the use of the seed of the species as an eye medicine for improving the eyesight, and as a tonic for the increase of strength and the elevation of spirit. Contagious skin diseases caused serious problems for the ancient people. The use of the leafy shoot for a bath to release the discomfort of itches and shingles was also recorded in the 42-word first medicinal record of the species in the earliest known Chinese materia medica-the Shen-nung pen-ts'ao-ching. Translators of the Chinese classics have included the records of i-mu-ts'ao. According to my knowledge, these works are all partial translations with the selections of the medicinal properties and the omissions on the methods of preparation. They have the outline and abandon the details. Consequently most of them are not clear. In order to

  10. Relationship between anthropogenic impacts and bleaching-associated tissue mortality of corals in Curaçao (Netherlands Antilles

    Directory of Open Access Journals (Sweden)

    I Nagelkerken

    2006-12-01

    Full Text Available Chronic anthropogenic impacts can have a negative effect on coral health and on coral energy budgets needed for regeneration of lesions. I therefore hypothesise that during massive bleaching events, the degree of corals showing bleaching-related tissue mortality is higher in areas subject to chronic anthropogenic impacts than in relatively pristine areas. In the present study, the degree of bleaching and bleaching-related tissue mortality was estimated for eight abundant coral species in Curaçao, at the onset of a massive Caribbean bleaching event in 1995, and three months afterwards. To study the possible effects of anthropogenic disturbances, the study was done at four unpolluted control sites, two polluted sites (sedimentation, sewage, and four sites at the mouth of lagoons with outflow of nutrient-rich, warm and turbid seawater. No pattern of an overall difference in bleaching between impacted and control sites was found for the degree of bleaching. However, the percentage of corals showing bleaching-related tissue mortality was higher at the impacted sites than at the control sites for the total number of corals and for corals with Los impactos antropogénicos crónicos pueden tener efectos negativos en la salud y en las cantidades de energía necesarias para la regeneración de lesiones en los corales. Mi hipótesis fue que durante los casos de blanqueamiento masivo, el grado en que los corales muestren mortalidades de tejido relacionadas con el blanqueamiento, será mayor en áreas sujetas a impactos antropogénicos crónicos que en áreas relativamente prístinas. Estimé los grados de blanqueamiento y mortalidad tisular en ocho especies de coral abundantes en Curaçao, durante el comienzo de un de blanqueamiento masivo en el Caribe en 1995 y tres meses después. El estudio se realizó en cuatro sitios control no contaminados, dos sitios contaminados (sedimentación, aguas residuales, y cuatro sitios en la boca de lagunas con aguas

  11. Speech Motor Control in Fluent and Dysfluent Speech Production of an Individual with Apraxia of Speech and Broca's Aphasia

    Science.gov (United States)

    van Lieshout, Pascal H. H. M.; Bose, Arpita; Square, Paula A.; Steele, Catriona M.

    2007-01-01

    Apraxia of speech (AOS) is typically described as a motor-speech disorder with clinically well-defined symptoms, but without a clear understanding of the underlying problems in motor control. A number of studies have compared the speech of subjects with AOS to the fluent speech of controls, but only a few have included speech movement data and if…

  12. O acesso ao léxico em crianças com desenvolvimento fonológico normal e desviante

    Directory of Open Access Journals (Sweden)

    Mota, Helena Bolli

    2008-01-01

    Full Text Available O objetivo desta pesquisa foi analisar o desempenho de crianças com desenvolvimento fonológico normal e desviante em tarefa de Nomeação Rápida, comparar esta habilidade entre os grupos, e correlacionar os achados com o sexo das crianças. Foi avaliada a nomeação rápida de 14 crianças (12 do sexo feminino e 2 do masculino com desenvolvimento fenológico normal (Grupo Controle e 14 crianças (8 do sexo feminino e 6 do masculino com diagnóstico de desvio fonológico (Grupo Estudo, todas com 5 anos de idade. Utilizou-se a prova adaptada ao português, Subteste Objetos, que faz parte do Comprehensive Test of Phonological Processing. O número médio de erros do Grupo Estudo foi superior à média de erros do Grupo Controle na parte A da prova e inferior na parte B desta, sendo que no total o Grupo Controle, apresentou média de erros superior ao Grupo Estudo. Porém, o grupo Estudo gastou em média mais tempo para a realização desta prova do que o Grupo Controle. Observou-se que quanto mais erros as crianças apresentam na prova, mais tempo elas gastam na sua realização. Além disso, encontrou-se que as crianças do sexo feminino apresentaram em média mais erros e demandaram mais tempo para a realização da parte A da prova. Estes achados confirmaram em parte as expectativas das autoras, visto que era esperado que as crianças do Grupo Estudo apresentassem desempenho inferior ao das crianças do Grupo Controle, pois há indícios de que as habilidades do processamento fonológico encontram-se defasados no primeiro grupo

  13. Adesão ao tratamento farmacológico de pacientes hipertensos entre participantes do Programa Remédio em Casa

    Directory of Open Access Journals (Sweden)

    Samir Nicola Mansour

    Full Text Available Resumo OBJETIVO: analisar a adesão ao tratamento farmacológico e fatores associados entre portadores de hipertensão arterial participantes do Programa Remédio em Casa. MÉTODOS: estudo transversal, com aplicação de questionário junto a pacientes com pleno acesso a medicamentos, usuários do Programa Remédio em Casa da Secretaria Municipal da Saúde de São Paulo; a análise da adesão ao tratamento segundo características sociodemográficas e comportamentais foi realizada a partir da regressão de Poisson. RESULTADOS: foram entrevistados 106 portadores de hipertensão arterial com pleno acesso a medicamentos e 80,2% deles apresentaram alta adesão terapêutica; participantes aderentes e não aderentes não apresentaram diferenças significativas (p>0,05 quanto às características sociodemográficas, comportamentais e clínicas. CONCLUSÃO: com adequada assistência, cuidados de saúde e pleno acesso a medicamentos, os fatores sociodemográficos, comportamentais e clínicos não influenciaram a determinação da adesão ao tratamento, indicando que a organização dos serviços e as políticas de saúde são fundamentais no controle da hipertensão arterial.

  14. DAS FERRAMENTAS AOS COLABORADORES: a avaliação individual de desempenho em um dos maiores grupos de inspeção veicular do Brasil

    Directory of Open Access Journals (Sweden)

    Victor Ribeiro Martins

    2016-12-01

    Full Text Available A máxima “de aquilo que não se mede não se conhece, não se controle e não melhora” nunca foi tão aplicável como no cenário competitivo atual. O processo de avaliação de desempenho nas organizações visa justamente avaliar o quão bem desenvolvidos são os colaboradores. A investigação e o mapeamento do processo de AD se dão em um dos maiores grupos de organismos de inspeção veicular do país, sediado na cidade de Cuiabá, Mato Grosso. Para isso, ao longo do desenvolvimento, descreve-se a estrutura interna da empresa e são propostas oportunidades para ajustes no modelo atual de avaliação. Os dados foram coletados por meio de entrevista com roteiro semiestruturado cujas questões visavam captar a percepção dos mesmos sobre o processo de AD. Sugere-se, com base nos resultados, o desenvolvimento de um método de AD mais eficiente, em direção ao modelo de Avaliação 360º. Ao fim do estudo, foi possível inferir o quão necessário é a Avaliação de Desempenho para o desenvolvimento do colaborador e por isso propôs-se que a empresa a tome como constante, com o objetivo de incentivar os funcionários a buscarem um constante desenvolvimento profissional.

  15. Adesão ao tratamento no grupo de hipertensos do bairro Joaquim Romão - Jequié/BA

    Directory of Open Access Journals (Sweden)

    Claudio Henrique Meira Mascarenhas

    2006-09-01

    Full Text Available O presente estudo objetivou analisar a adesão/ abandono ao tratamento no grupo de hipertensos do bairro Joaquim Romão, no Município de Jequié-Bahia. Trata-se de um estudo de caráter descritivo com delineamento transversal, no qual participaram trinta e cinco pacientes hipertensos cadastrados em um centro de saúde. Para tal foi utilizada uma entrevista semi-estruturada, onde as informações foram organizadas e tabuladas em um banco de dados no Microsoft Excel, sendo realizado tratamento estatístico descritivo e apresentados através de gráficos. A partir dos resultados encontrados percebeu-se que a falta de adesão dos pacientes ao tratamento da hipertensão arterial ainda atinge níveis elevados, e que o programa desenvolvido pelo centro de saúde apresenta deficiências em sua organização e funcionamento, a partir do momento em que faltam medicamentos, além da dificuldade de acesso do paciente ao sistema de saúde. Por conta disso, urge despertar para a necessidade de desenvolver um trabalho voltado para aumentar o grau de conhecimento da população sobre a importância do controle da hipertensão arterial; capacitar os profissionais para melhor orientar os indivíduos hipertensos; garantir acesso destes pacientes à serviços básicos de saúde, com resolubilidade; e incentivar políticas e programas comunitários.

  16. Ansiedade ao tratamento odontológico em atendimento de urgência

    Directory of Open Access Journals (Sweden)

    Kanegane Kazue

    2003-01-01

    Full Text Available OBJETIVO: Avaliar a freqüência de pacientes com ansiedade ou medo do tratamento odontológico em um setor de urgência. MÉTODOS: Participaram do estudo 252 pacientes, com 18 anos ou mais, que compareceram ao setor de urgência de uma faculdade de odontologia, de São Paulo, SP, entre agosto e novembro de 2001. Para avaliar a ansiedade, foram utilizadas a Modified Dental Anxiety Scale (MDAS, e a Escala de Medo de Gatchel. O grupo estudado respondeu a questões sobre: tempo decorrido desde a última visita ao dentista e desde o início dos sintomas, escolaridade, renda familiar e história prévia de trauma. Os resultados foram analisados pelos testes estatísticos (chi2 e Teste Exato de Fisher. RESULTADOS: Foram identificados 28,2% de indivíduos com algum grau de ansiedade, segundo a MDAS, na qual as mulheres foram consideradas mais ansiosas que os homens (chi2=0,01; e 14,3% de pacientes com alto grau de medo segundo a Escala de Medo de Gatchel. Em 44,4% da amostra a demora para procura de alívio dos sintomas foi > sete dias. Mulheres ansiosas procuraram atendimento mais rapidamente e em maior número. Experiência traumática anterior ocorreu em 46,5% dos pacientes ansiosos. Não foi possível relacionar escolaridade e renda familiar com ansiedade e/ou medo. CONCLUSÕES: Pacientes ansiosos, com destaque para as mulheres, são freqüentes no atendimento odontológico de urgência. Experiência prévia traumática mostrou-se importante para o desenvolvimento da ansiedade em relação ao atendimento odontológico.

  17. Proteinorraquia total: variações relacionadas ao sexo e à idade

    Directory of Open Access Journals (Sweden)

    A. Spina-França

    1963-03-01

    Full Text Available Foi estudada a proteinorraquia total de 1.011 pacientes com LCR normal para investigar a influência da idade e do sexo. O método empregado para a determinação da concentração protêica foi o turbidimétrico do ácido tricloracético. A influência do fator etário foi estudada entre 3 meses e 70 anos de idade. Os resultados permitiram verificar que a concentração protêica do LCR é maior entre 3 e 6 meses de idade. Entre 1 e 40 anos de idade os valores médios são próximos entre si, situando ao redor de 16 e 18 mg por 100 ml. A partir de 40 anos de idade verifica-se tendência para ser progressivamente maior a proteinorraquia total. Essa tendência se acentua com o avançar da idade. Em relação ao sexo, foi verificado que a proteinorraquia total tende a ser maior no homem do que na mulher. A diferença entre as médias encontradas para os homens e mulheres foi estatisticamente significante. Êsses dados confirmam observações anteriores, caracterizando-os em relação ao método empregado para a determinação da concentração protêica do LCR.

  18. Da casa ao hotel: entre a hospitalidade e a economia do turismo

    Directory of Open Access Journals (Sweden)

    Felipe José Comunello

    2015-01-01

    Full Text Available O município de São Joaquim, na região serrana de Santa Catarina, tem sido destacado pela imprensa escrita e televisiva nacional como a cidade mais fria do Brasil, ao longo dos últimos vinte anos. Em pesquisa realizada para tese de doutorado, identifiquei que muitas proprietárias de pousadas, as “pousadeiras” como elas mesmas se chamam, começaram abrigando turistas em dificuldades em dias de frio intenso, quando não há hotéis e pousadas suficientes na cidade. A partir disso, elas acreditaram ser possível transformar suas casas em pousadas, tendo diante de si um problema também compartilhado com os profissionais do turismo, a chamada sazonalidade dos turistas. Tal fato provoca dúvidas sobre a sustentação econômica das pousadas e inquietação aos profissionais quanto ao sucesso econômico do turismo. Nesse artigo, isso é analisado tendo como referência uma proposta de parceria recebida por meus interlocutores por parte da operadora de turismo CVC e da empresa de eventos da RBS, afiliada da Rede Globo em Santa Catarina. A discussão é em torno de questões a partir de uma antropologia da hospitalidade. A análise sugere que essa parceria ameaça uma ordem moral estabelecida com base em determinados valores de hospitalidade para com estranhos, principalmente o aquecimento perante o frio.

  19. AO3D: A Monte Carlo code for modeling of environmental light propagation

    Energy Technology Data Exchange (ETDEWEB)

    Bates, David E. [Hawaii Institute of Geophysics and Planetology, School of Ocean and Environmental Technology, University of Hawaii, 2525 Correa Road, Honolulu, HI 96822 (United States)], E-mail: bates@higp.hawaii.edu; Porter, John N. [Hawaii Institute of Geophysics and Planetology, School of Ocean and Environmental Technology, University of Hawaii, 2525 Correa Road, Honolulu, HI 96822 (United States)

    2008-07-15

    A Monte Carlo radiative transfer program (Atmosphere-Ocean 3-Dimensional, AO3D) for modeling the coupled atmosphere-ocean environment has been developed. The code allows for the specification of optical properties for the atmosphere, land and ocean. Light rays are tracked as they pass between the atmosphere and the ocean, reflect off the ocean surface, the ocean floor, and off land, or are absorbed. In this version the polarization of light rays is not considered. The optical properties of each horizontally homogeneous layer within the atmosphere and ocean can be set on a layer-by-layer basis with a choice of phase functions, absorption and scattering coefficients, and index of refraction. A wind-dependent Cox and Munk ocean surface realization (with whitecaps) is implemented to model refraction and reflection from surface waves. Either spherical- or flat-Earth models can be used, and all refraction and reflection are accounted for. The AO3D model has been tested by parts, and as a whole by comparison with single- and total-scattering calculations from other radiative transfer codes. Comparisons with Monte Carlo calculations by Adams and Kattawar (agreement in TOA radiance within the published precision {approx}2%), MODTRAN4 (agreement in spherical-shell atmosphere (SSA) sky radiance within about 2%) and Coupled DIScrete Ordinate Radiative Transfer (COART) (agreement in plane-parallel (PP) sky radiance within 2%) are shown. Sun photometer measurements (including large air mass values) at the Mauna Loa Observatory are compared to AO3D simulations (for a spherical Earth) and suggest that a thin aerosol layer was present above the observatory at the time of the measurements.

  20. Treatment of AO/OTA 31-A3 intertrochanteric femoral fractures with a percutaneous compression plate

    Directory of Open Access Journals (Sweden)

    Fei Luo

    2014-01-01

    Full Text Available OBJECTIVE: AO/OTA 31-A3 intertrochanteric femoral fractures have completely different fracture line directions and biomechanical characteristics compared with other types of intertrochanteric fractures. The choice of the fixation method has been a focus of dispute among orthopedic trauma surgeons. The purpose of this study was to review the outcomes of these fractures treated with a percutaneous compression plate at our institute. METHOD: Seventeen patients with AO/OTA 31-A3 intertrochanteric femoral fractures were treated with a percutaneous compression plate at our institute from January 2010 to December 2011. The clinical data and imaging results were retrospectively analyzed. RESULTS: The medical complication of popliteal vein thrombosis occurred in one patient. Sixteen patients were followed up for 12 to 21 months. Two patients had malunion and mild pain. Fracture collapse occurred in two patients, with one having head penetration. These two patients had moderate pain. There were no occurrences of nonunion or reoperation. The mean Harris hip score obtained during the last follow-up was 84.1 (61-97. Patients with a poor quality of reduction were more likely to have pain results (p = 0.001. A trend existed toward the presence of a poor quality of reduction (p = 0.05 in patients with a collapse of fracture. Patients with poor preoperative mobility were more likely to have a lower Harris hip score (p = 0.000. CONCLUSION: The percutaneous compression plate is an alternative device for the treatment of AO/OTA 31-A3 intertrochanteric femoral fractures. Good fracture reduction and an ideal placement position of the neck screw are important in the success of the device.

  1. Adesão ao tratamento no transtorno bipolar Compliance to treatment in bipolar disorder

    Directory of Open Access Journals (Sweden)

    Aida Santin

    2005-01-01

    Full Text Available O transtorno bipolar (TB é uma doença crônica, recorrente, presente em 1,5% da população, estando associada a altas taxas de mortalidade e prejuízos socioeconômicos. O lítio, a carbamazepina e o ácido valpróico são os estabilizadores de humor mais usados. Em tratamentos prolongados, como é o caso do TB, a má-adesão dos pacientes é uma das maiores dificuldades. Verifica-se que fatores ligados ao paciente, aos medicamentos e aos médicos possam ser responsáveis pela baixa adesão. A psicoeducação, a terapia cognitivo-comportamental e a terapia focada na família são estratégias propostas para o aumento da adesão.Bipolar disorder (BD is a chronic and recurrent illness that occurs in 1,5% of the population. This illness is associated with high rates of mortality and social/economic burden. Lithium, carbamazepine and valproic acid are the most used mood stabilizers. In long term treatments, as in BD, one of the main difficulties is the patient's adherence. It appears that factors associated to the patient, drug and the physician are responsible for the low adherence. The use of psycho-education, cognitive-behavioral therapy and focused family therapy have been put forward as a means to increase adherence.

  2. Gastrite hemorrágica por alergia ao leite de vaca: relato de dois casos

    Directory of Open Access Journals (Sweden)

    Machado Rodrigo Strehl

    2003-01-01

    Full Text Available OBJETIVO: descrever dois lactentes com gastrite hemorrágica, devido à alergia ao leite de vaca. DESCRIÇÃO DOS CASOS: ambos os pacientes apresentavam hematêmese, vômitos e desnutrição. Os pacientes apresentavam infiltrado eosinofílico em mucosa gástrica biopsiada e resolução dos sintomas após o início de dieta com exclusão da proteína do leite de vaca. COMENTÁRIOS: gastrite hemorrágica devido à alergia ao leite de vaca é um diagnóstico incomum. Até o momento foram relatados 10 pacientes com gastrite alérgica, e as principais manifestações clínicas são vômitos, desnutrição, anemia e hematêmese. A gastrite por alergia ao leite de vaca pode apresentar-se em diferentes graus de gravidade, e pode ser subdiagnosticada em muitos pacientes. A menos que o tratamento correto seja iniciado, o paciente desenvolverá desnutrição protéico-calórica grave e anemia. Doença alérgica do trato gastrointestinal superior deve ser considerada em todos os lactentes com vômitos recorrentes, particularmente se complicado com hematêmese. O diagnóstico de gastrite alérgica é clínico, auxiliado pela endoscopia e anatomia patológica.

  3. Direito ao aborto, gênero e a pesquisa jurídica em direitos fundamentais

    OpenAIRE

    Azevedo, André Freire

    2017-01-01

    Resumo A partir de um retrato da situação atual do abortamento inseguro e de uma breve reconstrução das lutas feministas pela descriminalização do aborto no Brasil, o trabalho discute o papel do constitucionalismo democrático no reconhecimento de novos sujeitos de direitos sexuais e reprodutivos. Recorremos ao fundamento político-filosófico dos direitos sexuais e reprodutivos para apontar que sua regulamentação jurídica só tem validade se os “sujeitos de direitos” construídos e pressupostos p...

  4. Abordagem ao Doente “ABCDE”. Biomecânica do Trauma

    OpenAIRE

    Amaral, T

    2013-01-01

    Apresentação na qual é efectuada uma caracterização epidemiológica do Trauma comparando a distribuição bimodal vs trimodal assim como a causa e local de morte. De seguida são definidos cuidados emergentes a nível pré-hospitalar e as competências indispensáveis à práxis por parte do Enfermeiro. Por último reflectimos de que forma a abordagem e o assegurar do continuum de cuidados desde o pré-hospitalar à UCI (com passagem no SU) contribuem para a melhoria dos cuidados ao doente politraumatizad...

  5. AIDS e religiosidade: influências intersubjetivas aos acometidos pela epidemia

    OpenAIRE

    Silva, Paulo Emanuel

    2009-01-01

    Nos dias atuais, apesar de todas as informações inerentes aos mais diversos tipos de doenças, algumas delas ainda são motivos de angústia, receios e preconceitos. Na antiguidade, a lepra e a peste e, a partir do século XIX, o câncer, a sífilis e a tuberculose permeavam as mentalidades e marcavam seus portadores, uma vez que os significados das doenças iam além de seus diferentes sintomas. Algo semelhante vem ocorrendo no mundo contemporâneo no que diz respeito à Síndrome da Imu...

  6. Educação: pensadores ao longo da história: Seymour Papert

    OpenAIRE

    Sousa, João Sérgio de Pina Carvalho (Ed.); Meirinhos, Manuel; Patrício, Maria Raquel; Gonçalves, Vitor

    2016-01-01

    Seymour Aubrey Papert (1928-2016) natural de Pretória, África do Sul, faleceu aos 88 anos nos Estados Unidos da América. Matemático de renome mundial, pioneiro da inteligência artificial e da computação educacional, foi docente do MIT Media Lab. Este poster evidencia os principais fundamentos teóricos e práticos da sua obra pedagógica, a atualidade da sua pedagogia e as suas implicações na educação. info:eu-repo/semantics/publishedVersion

  7. Future use of silicon photomultipliers for K AOS at MAMI and P¯ANDA at FAIR

    Science.gov (United States)

    Achenbach, P.; Lorente, A. Sanchez; Majos, S. Sánchez; Pochodzalla, J.

    2009-10-01

    A characterization of scintillating fibres with silicon photomultiplier read-out was performed in view of their possible application in fibre tracking detector systems. Such a concept is being considered for the K AOS spectrometer at the Mainz Microtron MAMI and as a time-of-flight start detector for the hypernuclear physics programme at the P¯ANDA experiment of the FAIR project. Results on particle detection efficiency and time resolution are discussed. In summary, the silicon devices are very suitable for the detection of the low light yield from scintillating fibres insofar a trigger scheme is found to cope with the noise rate characteristics.

  8. Concepções de mulheres sobre a terminologia relativa ao aparelho reprodutor feminino

    OpenAIRE

    Celina Deves Marques

    2005-01-01

    Esta é uma pesquisa qualitativa fenomenológica com embasamento filosófico na fenomenologia da percepção de Merleau-Ponty. Tem como propósito conhecer as concepções das mulheres sobre a terminologia relativa ao aparelho reprodutor feminino. Os sujeitos do estudo foram 10 mulheres não-gestantes, não-puérperas e não-nulíparas usuárias do Programa de Saúde da Família (PSF) Jenor Jarros. O instrumento de pesquisa utilizado foi entrevista semi-estruturada no qual perguntava-se sobre o significado d...

  9. On random walk de Lévy aplicado aos mapas de variâncias

    Science.gov (United States)

    Klafke, J. C.

    2003-08-01

    Uma pergunta que surge ao nos confrontarmos com os mapas de variâncias, ou s-Maps [Klafke, J. C. "Estudo da Difusão Caótica em Ressonâncias Asteroidais", Tese de Doutorado, IAG/USP, 2002] diz respeito ao conteúdo físico de tais representações do espaço de fase. Ou seja, o que representa as variâncias das ações obtidas para uma determinada condição inicial e como relacioná-las com o tempo de difusão das órbitas, supondo-se que estas de fato estejam envolvidas em um processo difusivo? Para discutirmos essa questão, lançamos mão da modelagem dos processos estocásticos subjacentes às variâncias determinadas e implementamos uma série de simulações do tipo Monte Carlo a partir das informações registradas nos s-Maps calculados para algumas ressonâncias asteroidais bem estudadas (p.ex. 3: 1, 2: 1 e 3: 2). Para tanto, temos usado uma função de densidade de probabilidade gaussiana ao definir os n passos que permitirão estabelecer uma relação direta entre o Mapa de Difusão e o Mapa de Variâncias. Contudo, os resultados obtidos até agora tem subestimado o tempo de difusão esperado para os fenômenos conhecidos. Tal se deve ao fato de que, no processo difusivo real, é possível existirem passos de comprimento consideravelmente maiores que a média estabelecida pelas distribuições gaussiana ou normal, sobretudo quando se cruza uma região caótica. Neste trabalho, apresentamos os resultados comparativos de simulações de Monte Carlo com base no random walk de Lévy [Klafter, J. et al. 2002. "Beyond Brownian motion", Phys. Today, Feb, 33-39.], o qual possibilita passos esporádicos de comprimento acima do valor médio (saltos) permitindo estabelecer uma escala de tempo mais próxima da esperada para a difusão.

  10. Translation between the Neer- and the AO/OTA-classification for proximal humeral fractures

    DEFF Research Database (Denmark)

    Brorson, Stig; Eckardt, Henrik; Audigé, Laurent

    2013-01-01

    The reporting and interpretation of data from clinical trials of proximal humeral fractures are hampered by the use of two partly incommensurable fracture classification systems: the Neer classification and the AO/OTA classification. It remains difficult to interpret and generalize results......, to conduct prognostic studies, and to obtain consensus on treatment recommendations when concise definitions and a common 'fracture language' are lacking. Thus, we compared both classifications systems using primary data from large clinical studies to assess how thoroughly both systems conveyed clinically...

  11. Peru: cultivo de coca, cocaína e combate ao narcotráfico

    Directory of Open Access Journals (Sweden)

    Marcelo Santos

    2010-06-01

    Full Text Available O artigo apresenta uma breve análise sobre a atual situação dos cultivos de coca, produção de cocaína e combate ao narcotráfico no Peru.

  12. Var??n de 30 a??os con dolor pretibial bilateral

    OpenAIRE

    Vargas-Hitos, Jos?? Antonio; Garc??a-Castro, Jos?? Miguel; Ja??n- ??guila, Fernando; Jim??nez-Alonso, Juan

    2012-01-01

    Var??n de 30 a??os que consultaba por dolor intenso y progresivo de dos meses de evoluci??n localizado en la cara anterior y distal de ambas piernas sin factor desencadenante aparente y mala respuesta a tratamiento analg??sico convencional. El paciente negaba otros s??ntomas a excepci??n de un rash eritematoso no pruriginoso generalizado que hab??a afectado tronco, palmas y plantas y que hab??a sido considerado como una reacci??n de hipersensibilidad a alguna de las medicaciones p...

  13. Fenómenos cognitivos subjacentes ao milenarismo: quando uma profecia falha

    OpenAIRE

    Soares Martins, José; Cameira, Miguel

    2012-01-01

    Apresenta-se o conceito de dissonância cognitiva (Festinger, 1957) como o mecanismo cognitivo explicativo do proselitismo que frequentemente sucede a profecias não verificadas. Pormenorizam-se as características da dissonância cognitiva ao nível individual e as tácticas de redução do desconforto provocado pela existência de cognições contraditórias (crença-evidência empírica). Discriminam-se as condições propostas por Festinger et al (1956) para o surgimento da necessidade de angariar novos c...

  14. Cateterismo cardíaco esquerdo: lacunas nas informações transmitidas aos pacientes

    OpenAIRE

    Cavalcanti,Taciana de Castilhos; Sarmento-Leite, Rogério; Carlos A.M. Gottschall; de Quadros, Alexandre Schaan; Goldmeier,Sílvia; De Souza, Emiliane Nogueira; de Moraes, Maria Antonieta Pereira

    2008-01-01

    INTRODUÇÃO: A prática dos procedimentos na Cardiologia Intervencionista está marcada por grandes avanços, mas o mesmo não se verifica no trato das informações e conhecimento dos pacientes acerca do tema. É imperativa a necessidade de consolidar as orientações transmitidas aos pacientes, instruindo-os sobre os benefícios alcançados pela sua compreensão sobre os exames invasivos. OBJETIVO: Verificar o conhecimento dos pacientes submetidos a cateterismo cardíaco em um hospital especializado em C...

  15. Por uma abordagem relacional ao conceito de vida no ensino de biologia

    OpenAIRE

    Coutinho,Francisco Ângelo; Martins,Rogério Parentoni; Ribeiro, Natália Almeida

    2015-01-01

    Segundo a teoria de perfil conceitual, o conceito “vida” possui três zonas diferenciadas correspondentes a três modos de compreensão. A internalista concebe “vida” como processo, propriedade ou objeto inerente ao vivente. A externalista propõe “vida” desvinculada do vivente, ou seja, vida apenas teria sentido a partir de uma referência externa como, por exemplo, admitem certas concepções religiosas e filosóficas. A relacional admite que vida deva expressar uma relação entre entidades e/ou sis...

  16. Ao serviço do líder: as campanhas eleitorais do Partido Socialista

    OpenAIRE

    Marco Lisi

    2008-01-01

    Este artigo procura analisar a evolução das campanhas eleitorais do Partido Socialista entre 1976 e 2005, evidenciando as suas principais características organizativas ao nível nacional e local. As conclusões apontam para a importância dos especialistas externos e para o reforço da centralização, que contribuem para o aumento da autonomia do líder socialista.This article analyses the development of the Socialist Party's election campaigns between 1976 and 2005, revealing their main organizati...

  17. Novas abordagens terapêuticas no combate ao Envelhecimento Cutâneo

    OpenAIRE

    Santos, Joana Loureiro Marques dos

    2011-01-01

    Trabalho apresentado à Universidade Fernando Pessoa como parte dos requisitos para obtenção do grau de Mestre em Ciências Farmacêuticas. O envelhecimento cutâneo é um processo complexo e multifatorial, que resulta em alterações funcionais e estéticas da pele. Os avanços na biologia da pele têm aumentado a compreensão da homeostasia deste órgão, assim como do seu processo de envelhecimento, levando ao desenvolvimento de tratamentos e técnicas com a finalidade de prevenir este mecanismo e de...

  18. Pela atenção ao comum: entrevista com Muniz Sodré

    Directory of Open Access Journals (Sweden)

    Anelise Angeli De Carli

    2017-09-01

    Full Text Available A entrevista com Muniz Sodré propõe ao teórico da comunicação algumas perguntas que atravessam a sua proposta de pensamento ampliado para o termo comunicação. O autor fala sobre a linguagem na perspectiva da reflexividade e sobre os efeitos e as limitações do bios midiático. Ainda, Sodré propõe pensar o algoritmo das tecnologias de informação como um tipo de imagem do contemporâneo.

  19. A visita de um afro-americano ao paraíso racial

    OpenAIRE

    Petrônio Domingues

    2006-01-01

    Em 1923, o jornalista e empresário afro-americano Robert Abbott visitou o Brasil. De volta aos Estados Unidos, publicou uma série de artigos no jornal Chicago Defender, informando que, aqui, os negros não enfrentavam problemas que dificultasse ou impedisse seu pleno desenvolvimento econômico, social, político, cultural, ou seja, eles viviam numa espécie de paraíso racial. A principal questão que vai ser investigada neste artigo é saber por que Abbott retratou um quadro tão mítico das relações...

  20. [Compression osteosyntheses with the new AO universal nail. Functional principle and biomechanical prerequisites].

    Science.gov (United States)

    Ritter, G

    1991-01-01

    The new AO universal nail, with its special construction, allows extremely stable compression osteosynthesis in correctly selected fractures. Compression osteosynthesis with an intramedullary brace has definite advantages for fracture healing and biomechanics. The basic requirement, especially for the long-term maintenance of pressure, is truly stable anchorage of the locking bolts in the bone. Previous investigations by the author have shown that this is only possible in the shaft of the bone. Anchoring stability is not sufficient in the cancellous juxta-articular bone. Five years of clinical experience fully confirm the theoretical expectations.