WorldWideScience

Sample records for ascidian ciona intestinalis

  1. Spermiotoxicity of nickel nanoparticles in the marine invertebrate Ciona intestinalis (ascidians).

    Science.gov (United States)

    Gallo, Alessandra; Boni, Raffaele; Buttino, Isabella; Tosti, Elisabetta

    2016-10-01

    Nickel nanoparticles (Ni NPs) are increasingly used in modern industries as catalysts, sensors, and in electronic applications. Due to this large use, their inputs into marine environment have significantly increased; however, the potential ecotoxicological effects in marine environment have so far received little attention. In particular, little is known on the impact of NPs on gamete quality of marine organisms and on the consequences on fertility potential. The present study examines, for the first time, the impact of Ni NPs exposure on sperm quality of the marine invertebrate Ciona intestinalis (ascidian). Several parameters related with sperm status such as plasma membrane lipid peroxidation, mitochondrial membrane potential (MMP), intracellular pH, DNA integrity, and fertilizing ability were assessed as toxicity end points after exposure to different Ni NPs concentrations. Ni NPs generate oxidative stress that in turn induces lipid peroxidation and DNA fragmentation, and alters MMP and sperm morphology. Furthermore, sperm exposure to Ni NPs affects their fertilizing ability and causes developmental anomalies in the offspring. All together, these results reveal a spermiotoxicity of Ni NPs in ascidians suggesting that the application of these NPs should be carefully assessed as to their potential toxic effects on the health of marine organisms that, in turn, may influence the ecological system. This study shows that ascidian sperm represent a suitable and sensitive tool for the investigation of the toxicity of NPs entered into marine environment, for defining the mechanisms of toxic action and for the environmental monitoring purpose. PMID:27080039

  2. Local database and the search program for proteomic analysis of sperm proteins in the ascidian Ciona intestinalis

    International Nuclear Information System (INIS)

    Separation of proteins by two-dimensional electrophoresis and following mass spectrometry (MS) is now a conventional technique for proteomic analysis. For proteomic analysis of a certain tissue with a limited information of primary structures of proteins, we have developed an analytical system for peptide mass fingerprinting in gene products in the testis of the ascidian Ciona intestinalis. Ciona sperm proteins were separated by two-dimensional gel electrophoresis and the tryptic fragments were subjected to MALDI-TOF/MS. The mass pattern was searched against on-line databases but resulted in less identification of these proteins. We have constructed a MS database from Ciona testis ESTs and the genome draft sequence, along with a newly devised, perl-based search program PerMS for peptide mass fingerprinting. This system could identify more than 80% of Ciona sperm proteins, suggesting that it could be widely applied for proteomic analysis for a limited tissue with less genomic information

  3. Proteomics of ionomycin-induced ascidian sperm reaction: Released and exposed sperm proteins in the ascidian Ciona intestinalis.

    Science.gov (United States)

    Nakazawa, Shiori; Shirae-Kurabayashi, Maki; Otsuka, Kei; Sawada, Hitoshi

    2015-12-01

    Sperm proteins mediating sperm-egg interaction should be exhibited on the sperm surface, or exposed or released when sperm approach an egg. In ascidians (protochordates), sperm undergo a sperm reaction, characterized by enhanced sperm motility and mitochondrial swelling and shedding on contact with the vitelline coat (VC) or by treatment with Ca(2+) ionophore. Here, proteomic analysis was conducted on sperm exudates and sperm surface proteins using ionomycin-induced sperm reaction and cell-impermeable labeling in Ciona intestinalis type A (C. robusta). In the exudate from sperm treated with ionomycin, membrane proteins including a possible VC receptor CiUrabin were abundant, indicating the release of membranous compartments during sperm reaction. Among the surface proteins XP_009859314.1 (uncharacterized protein exhibiting homology to HrTTSP-1) was most abundant before the sperm reaction, but XP_004227079.1 (unknown Ig superfamily protein) appears to be most abundantly exposed by the sperm reaction. Moreover, proteins containing a notable set of domains, astacin-like metalloprotease domain and thrombospondin type 1 repeat(s), were found in this fraction. Possible roles in fertilization as well as localizations and behaviors of these proteins are discussed. PMID:26223815

  4. Taxonomy Icon Data: Ciona intestinalis (Sea squirt) [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available ttp://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Ciona+intestinalis&t=L http://biosciencedbc.jp/taxonomy_icon.../icon.cgi?i=Ciona+intestinalis&t=NL http://biosciencedbc.jp/taxonomy_icon/icon.cg...i?i=Ciona+intestinalis&t=S http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Ciona+intestinalis&t=NS ... ...data Ciona_intestinalis_L.png Ciona_intestinalis_NL.png Ciona_intestinalis_S.png Ciona_intestinalis_NS.png h

  5. Characterization and metal-induced gene transcription of two new copper zinc superoxide dismutases in the solitary ascidian Ciona intestinalis

    Energy Technology Data Exchange (ETDEWEB)

    Ferro, Diana [Department of Biology, University of Padova, Padova (Italy); Institute for Evolution and Biodiversity, Westfälische Wilhelms-Universität, Münster (Germany); Franchi, Nicola [Department of Biology, University of Padova, Padova (Italy); Department of Biological, Chemical, Pharmaceutical Science and Technology, University of Palermo, Palermo (Italy); Mangano, Valentina [Department of Biological, Chemical, Pharmaceutical Science and Technology, University of Palermo, Palermo (Italy); Bakiu, Rigers [Department of Crop Production, Agricultural University of Tirana, Tirana (Albania); Cammarata, Matteo; Parrinello, Nicolò [Department of Biological, Chemical, Pharmaceutical Science and Technology, University of Palermo, Palermo (Italy); Santovito, Gianfranco, E-mail: gianfranco.santovito@unipd.it [Department of Biology, University of Padova, Padova (Italy); Ballarin, Loriano [Department of Biology, University of Padova, Padova (Italy)

    2013-09-15

    Highlights: •Ciona intestinalis express two copper-zinc superoxide dismutases (Cu,Zn SODs), one extracellular (Ci-SODa) and one intracellular isoform (Ci-SODb). •Promoters contain consensus sequences similar to mammalian MRE. •Metal exposure results in a significant increase of gene transcription: ci-soda is induced especially by copper and zinc, the increase of ci-sodb transcription is more evident after cadmium exposure. •Genes are mostly transcribed in circulating hemocytes and in ovarian follicular cells. -- Abstract: Antioxidant enzymes are known to protect living organisms against the oxidative stress risk, also induced by metals. In the present study, we describe the purification and molecular characterization of two Cu,Zn superoxide dismutases (SODs), referred to as Ci-SODa and Ci-SODb, from Ciona intestinalis, a basal chordate widely distributed in temperate shallow seawater. The putative amino acid sequences were compared with Cu,Zn SODs from other metazoans and phylogenetic analyses indicate that the two putative Ci-SODs are more related to invertebrate SODs than vertebrate ones. Both phylogenetic and preliminary homology modeling analyses suggest that Ci-SODa and Ci-SODb are extracellular and intracellular isoform, respectively. The mRNA of the two Cu,Zn SODs was localized in hemocytes and in ovarian follicular cells, as revealed by in situ hybridization. The time course of SOD mRNA levels in the presence of three different metals showed upregulation of ci-soda and inhibition of ci-sodb. Spectrophotometric analysis confirms the presence of SOD activity in Ciona tissues. Our in silico analyses of the ci-soda promoter region revealed putative consensus sequences similar to mammalian metal-responsive elements (MRE), suggesting that the transcription of these genes directly depends on metals. These data emphasize the importance of complex metal regulation of ci-soda and ci-sodb transcription, as components of an efficient detoxification pathway

  6. Characterization and metal-induced gene transcription of two new copper zinc superoxide dismutases in the solitary ascidian Ciona intestinalis

    International Nuclear Information System (INIS)

    Highlights: •Ciona intestinalis express two copper-zinc superoxide dismutases (Cu,Zn SODs), one extracellular (Ci-SODa) and one intracellular isoform (Ci-SODb). •Promoters contain consensus sequences similar to mammalian MRE. •Metal exposure results in a significant increase of gene transcription: ci-soda is induced especially by copper and zinc, the increase of ci-sodb transcription is more evident after cadmium exposure. •Genes are mostly transcribed in circulating hemocytes and in ovarian follicular cells. -- Abstract: Antioxidant enzymes are known to protect living organisms against the oxidative stress risk, also induced by metals. In the present study, we describe the purification and molecular characterization of two Cu,Zn superoxide dismutases (SODs), referred to as Ci-SODa and Ci-SODb, from Ciona intestinalis, a basal chordate widely distributed in temperate shallow seawater. The putative amino acid sequences were compared with Cu,Zn SODs from other metazoans and phylogenetic analyses indicate that the two putative Ci-SODs are more related to invertebrate SODs than vertebrate ones. Both phylogenetic and preliminary homology modeling analyses suggest that Ci-SODa and Ci-SODb are extracellular and intracellular isoform, respectively. The mRNA of the two Cu,Zn SODs was localized in hemocytes and in ovarian follicular cells, as revealed by in situ hybridization. The time course of SOD mRNA levels in the presence of three different metals showed upregulation of ci-soda and inhibition of ci-sodb. Spectrophotometric analysis confirms the presence of SOD activity in Ciona tissues. Our in silico analyses of the ci-soda promoter region revealed putative consensus sequences similar to mammalian metal-responsive elements (MRE), suggesting that the transcription of these genes directly depends on metals. These data emphasize the importance of complex metal regulation of ci-soda and ci-sodb transcription, as components of an efficient detoxification pathway

  7. Nitric oxide affects ERK signaling through down-regulation of MAP kinase phosphatase levels during larval development of the ascidian Ciona intestinalis.

    Directory of Open Access Journals (Sweden)

    Immacolata Castellano

    Full Text Available In the ascidian Ciona intestinalis larval development and metamorphosis require a complex interplay of events, including nitric oxide (NO production, MAP kinases (ERK, JNK and caspase-3 activation. We have previously shown that NO levels affect the rate of metamorphosis, regulate caspase activity and promote an oxidative stress pathway, resulting in protein nitration. Here, we report that NO down-regulates MAP kinase phosphatases (mkps expression affecting positively ERK signaling. By pharmacological approach, we observed that the reduction of endogenous NO levels caused a decrease of ERK phosphorylation, whereas increasing levels of NO induced ERK activation. We have also identified the ERK gene network affected by NO, including mpk1, mpk3 and some key developmental genes by quantitative gene expression analysis. We demonstrate that NO induces an ERK-independent down-regulation of mkp1 and mkp3, responsible for maintaining the ERK phosphorylation levels necessary for transcription of key metamorphic genes, such as the hormone receptor rev-erb and the van willebrand protein vwa1c. These results add new insights into the role played by NO during larval development and metamorphosis in Ciona, highlighting the cross-talk between different signaling pathways.

  8. Huntingtin gene evolution in Chordata and its peculiar features in the ascidian Ciona genus

    OpenAIRE

    Cattaneo Elena; Pesole Graziano; Gissi Carmela; Tartari Marzia

    2006-01-01

    Abstract Background To gain insight into the evolutionary features of the huntingtin (htt) gene in Chordata, we have sequenced and characterized the full-length htt mRNA in the ascidian Ciona intestinalis, a basal chordate emerging as new invertebrate model organism. Moreover, taking advantage of the availability of genomic and EST sequences, the htt gene structure of a number of chordate species, including the cogeneric ascidian Ciona savignyi, and the vertebrates Xenopus and Gallus was reco...

  9. A genomewide analysis of genes for the heat shock protein 70 chaperone system in the ascidian Ciona intestinalis

    OpenAIRE

    Wada, Shuichi; Hamada, Mayuko; Satoh, Nori

    2006-01-01

    Molecular chaperones play crucial roles in various aspects of the biogenesis and maintenance of proteins in the cell. The heat shock protein 70 (HSP70) chaperone system, in which HSP70 proteins act as chaperones, is one of the major molecular chaperone systems conserved among a variety of organisms. To shed light on the evolutionary history of the constituents of the chordate HSP70 chaperone system and to identify all of the components of the HSP70 chaperone system in ascidians, we carried ou...

  10. Natural variation of model mutant phenotypes in Ciona intestinalis.

    Directory of Open Access Journals (Sweden)

    Paolo Sordino

    Full Text Available BACKGROUND: The study of ascidians (Chordata, Tunicata has made a considerable contribution to our understanding of the origin and evolution of basal chordates. To provide further information to support forward genetics in Ciona intestinalis, we used a combination of natural variation and neutral population genetics as an approach for the systematic identification of new mutations. In addition to the significance of developmental variation for phenotype-driven studies, this approach can encompass important implications in evolutionary and population biology. METHODOLOGY/PRINCIPAL FINDINGS: Here, we report a preliminary survey for naturally occurring mutations in three geographically interconnected populations of C. intestinalis. The influence of historical, geographical and environmental factors on the distribution of abnormal phenotypes was assessed by means of 12 microsatellites. We identified 37 possible mutant loci with stereotyped defects in embryonic development that segregate in a way typical of recessive alleles. Local populations were found to differ in genetic organization and frequency distribution of phenotypic classes. CONCLUSIONS/SIGNIFICANCE: Natural genetic polymorphism of C. intestinalis constitutes a valuable source of phenotypes for studying embryonic development in ascidians. Correlating genetic structure and the occurrence of abnormal phenotypes is a crucial focus for understanding the selective forces that shape natural finite populations, and may provide insights of great importance into the evolutionary mechanisms that generate animal diversity.

  11. Morphological Differences between Larvae of the Ciona intestinalis Species Complex: Hints for a Valid Taxonomic Definition of Distinct Species

    OpenAIRE

    Roberta Pennati; Gentile Francesco Ficetola; Riccardo Brunetti; Federico Caicci; Fabio Gasparini; Francesca Griggio; Atsuko Sato; Thomas Stach; Sabrina Kaul-Strehlow; Carmela Gissi; Lucia Manni

    2015-01-01

    The cosmopolitan ascidian Ciona intestinalis is the most common model species of Tunicata, the sister-group of Vertebrata, and widely used in developmental biology, genomics and evolutionary studies. Recently, molecular studies suggested the presence of cryptic species hidden within the C. intestinalis species, namely C. intestinalis type A and type B. So far, no substantial morphological differences have been identified between individuals belonging to the two types. Here we present morphome...

  12. Synthesis of fucosyl-containing glycoproteins of the vitelline coat in oocytes of Ciona intestinalis (Ascidia).

    OpenAIRE

    F.Rosati; Cotelli, F.; De Santis, R.; A. Monroy; Pinto, M. R.

    1982-01-01

    The sperm receptors of the ascidian oocyte are located at the outer surface of the vitelline coat (formerly called the chorion). The fucose residues are the receptor's most important components for sperm recognition and binding. We asked whether the fucosyl-containing glycoproteins of the vitelline coat are a product of the oocyte, the follicle cells, or the test cells. Ovaries of Ciona intestinalis were injected with L-[3H]fucose and the progress of its incorporation was followed by using au...

  13. Ciona intestinalis as a model for cardiac development

    OpenAIRE

    Davidson, Brad

    2006-01-01

    The primitive chordate Ciona intestinalis has emerged as a significant model system for the study of heart development. The Ciona embryo employs a conserved heart gene network in the context of extremely low cell numbers and reduced genetic redundancy. Here, I review recent studies on the molecular genetics of Ciona cardiogenesis as well as classic work on heart anatomy and physiology. I also discuss the potential of employing Ciona to decipher a comprehensive chordate gene network and to det...

  14. Ciona intestinalis as an emerging model organism: its regeneration under controlled conditions and methodology for egg dechorionation*

    OpenAIRE

    Liu, Li-Ping; Xiang, Jian-hai; Dong, Bo; Natarajan, Pavanasam; Yu, Kui-jie; Cai, Nan-er

    2006-01-01

    The ascidian Ciona intestinalis is a model organism of developmental and evolutionary biology and may provide crucial clues concerning two fundamental matters, namely, how chordates originated from the putative deuterostome ancestor and how advanced chordates originated from the simplest chordates. In this paper, a whole-life-span culture of C. intestinalis was conducted. Fed with the diet combination of dry Spirulina, egg yolk, Dicrateria sp., edible yeast and weaning diet for shrimp, C. int...

  15. Ascidian bioresources: common and variant chemical compositions and exploitation strategy - examples of Halocynthia roretzi, Styela plicata, Ascidia sp. and Ciona intestinalis.

    Science.gov (United States)

    Zhao, Yadong; Li, Jiebing

    2016-01-01

    To explore abundant marine ascidian bioresources, four species from two orders have been compared in their chemical compositions. After a universal separation of the animal body into two fractions, all tunics have been found rich in carbohydrate contents, while all inner body tissues are richer in proteins. Cellulose is present almost exclusively in the tunics and more in the order Stolidobranchia, while more sulfated polysaccharides are present in Phlebobranchia species. Almost all proteins are collagens with a high essential amino acid index and high delicious amino acid (DAA) content. All fractions also have high contents of good-quality fatty acids and trace minerals but low toxic element contents, with different sterols and glycosaminoglycans. There are species-specific characteristics observed for vanadium accumulation and sterol structures which are also meaningful for ascidian chemotaxonomy and resource exploitation. It is suggested that in addition to the present utilizations of tunics for cellulose production and of some species' inner body tissues as human food, one should explore all species' inner body tissues as human foods and all tunics as food or animal feed with the contained cellulose as dietary fiber. Collagens, sulfated polysaccharides, glycosaminoglycans, sterols and trace elements could be explored as byproducts for, e.g. pharmaceutical and chemical industries. PMID:27049617

  16. Genetic and Genomic Toolbox of the Chordate Ciona intestinalis

    OpenAIRE

    Stolfi, Alberto; Christiaen, Lionel

    2012-01-01

    The experimental malleability and unique phylogenetic position of the sea squirt Ciona intestinalis as part of the sister group to the vertebrates have helped establish these marine chordates as model organisms for the study of developmental genetics and evolution. Here we summarize the tools, techniques, and resources available to the Ciona geneticist, citing examples of studies that employed such strategies in the elucidation of gene function in Ciona. Genetic screens, germline transgenesis...

  17. Huntingtin gene evolution in Chordata and its peculiar features in the ascidian Ciona genus

    Directory of Open Access Journals (Sweden)

    Cattaneo Elena

    2006-11-01

    Full Text Available Abstract Background To gain insight into the evolutionary features of the huntingtin (htt gene in Chordata, we have sequenced and characterized the full-length htt mRNA in the ascidian Ciona intestinalis, a basal chordate emerging as new invertebrate model organism. Moreover, taking advantage of the availability of genomic and EST sequences, the htt gene structure of a number of chordate species, including the cogeneric ascidian Ciona savignyi, and the vertebrates Xenopus and Gallus was reconstructed. Results The C. intestinalis htt transcript exhibits some peculiar features, such as spliced leader trans-splicing in the 98 nt-long 5' untranslated region (UTR, an alternative splicing in the coding region, eight alternative polyadenylation sites, and no similarities of both 5' and 3'UTRs compared to homologs of the cogeneric C. savignyi. The predicted protein is 2946 amino acids long, shorter than its vertebrate homologs, and lacks the polyQ and the polyP stretches found in the the N-terminal regions of mammalian homologs. The exon-intron organization of the htt gene is almost identical among vertebrates, and significantly conserved between Ciona and vertebrates, allowing us to hypothesize an ancestral chordate gene consisting of at least 40 coding exons. Conclusion During chordate diversification, events of gain/loss, sliding, phase changes, and expansion of introns occurred in both vertebrate and ascidian lineages predominantly in the 5'-half of the htt gene, where there is also evidence of lineage-specific evolutionary dynamics in vertebrates. On the contrary, the 3'-half of the gene is highly conserved in all chordates at the level of both gene structure and protein sequence. Between the two Ciona species, a fast evolutionary rate and/or an early divergence time is suggested by the absence of significant similarity between UTRs, protein divergence comparable to that observed between mammals and fishes, and different distribution of repetitive

  18. The repertoire of G protein-coupled receptors in the sea squirt Ciona intestinalis

    Directory of Open Access Journals (Sweden)

    Manoj Narayanan

    2008-05-01

    Full Text Available Abstract Background G protein-coupled receptors (GPCRs constitute a large family of integral transmembrane receptor proteins that play a central role in signal transduction in eukaryotes. The genome of the protochordate Ciona intestinalis has a compact size with an ancestral complement of many diversified gene families of vertebrates and is a good model system for studying protochordate to vertebrate diversification. An analysis of the Ciona repertoire of GPCRs from a comparative genomic perspective provides insight into the evolutionary origins of the GPCR signalling system in vertebrates. Results We have identified 169 gene products in the Ciona genome that code for putative GPCRs. Phylogenetic analyses reveal that Ciona GPCRs have homologous representatives from the five major GRAFS (Glutamate, Rhodopsin, Adhesion, Frizzled and Secretin families concomitant with other vertebrate GPCR repertoires. Nearly 39% of Ciona GPCRs have unambiguous orthologs of vertebrate GPCR families, as defined for the human, mouse, puffer fish and chicken genomes. The Rhodopsin family accounts for ~68% of the Ciona GPCR repertoire wherein the LGR-like subfamily exhibits a lineage specific gene expansion of a group of receptors that possess a novel domain organisation hitherto unobserved in metazoan genomes. Conclusion Comparison of GPCRs in Ciona to that in human reveals a high level of orthology of a protochordate repertoire with that of vertebrate GPCRs. Our studies suggest that the ascidians contain the basic ancestral complement of vertebrate GPCR genes. This is evident at the subfamily level comparisons since Ciona GPCR sequences are significantly analogous to vertebrate GPCR subfamilies even while exhibiting Ciona specific genes. Our analysis provides a framework to perform future experimental and comparative studies to understand the roles of the ancestral chordate versions of GPCRs that predated the divergence of the urochordates and the vertebrates.

  19. The identification of transcription factors expressed in the notochord of Ciona intestinalis adds new potential players to the Brachyury gene regulatory network

    OpenAIRE

    Diana S José-Edwards; Kerner, Pierre; Kugler, Jamie E.; Deng, Wei; Jiang, Di; Di Gregorio, Anna

    2011-01-01

    The notochord is the distinctive characteristic of chordates; however, the knowledge of the complement of transcription factors governing the development of this structure is still incomplete. Here we present the expression patterns of seven transcription factor genes detected in the notochord of the ascidian Ciona intestinalis at various stages of embryonic development. Four of these transcription factors, Fos-a, NFAT5, AFF and Klf15, have not been directly associated with the notochord in p...

  20. SNPs and Hox gene mapping in Ciona intestinalis

    Directory of Open Access Journals (Sweden)

    Biffali Elio

    2008-01-01

    Full Text Available Abstract Background The tunicate Ciona intestinalis (Enterogona, Ascidiacea, a major model system for evolutionary and developmental genetics of chordates, harbours two cryptic species. To assess the degree of intra- and inter-specific genetic variability, we report the identification and analysis of C. intestinalis SNP (Single Nucleotide Polymorphism markers. A SNP subset was used to determine the genetic distance between Hox-5 and -10 genes. Results DNA fragments were amplified from 12 regions of C. intestinalis sp. A. In total, 128 SNPs and 32 one bp indels have been identified within 8 Kb DNA. SNPs in coding regions cause 4 synonymous and 12 non-synonymous substitutions. The highest SNP frequency was detected in the Hox5 and Hox10 intragenic regions. In C. intestinalis, these two genes have lost their archetypal topology within the cluster, such that Hox10 is located between Hox4 and Hox5. A subset of the above primers was used to perform successful amplification in C. intestinalis sp. B. In this cryptic species, 62 SNPs were identified within 3614 bp: 41 in non-coding and 21 in coding regions. The genetic distance of the Hox-5 and -10 loci, computed combining a classical backcross approach with the application of SNP markers, was found to be 8.4 cM (Haldane's function. Based on the physical distance, 1 cM corresponds to 39.5 Kb. Linkage disequilibrium between the aforementioned loci was calculated in the backcross generation. Conclusion SNPs here described allow analysis and comparisons within and between C. intestinalis cryptic species. We provide the first reliable computation of genetic distance in this important model chordate. This latter result represents an important platform for future studies on Hox genes showing deviations from the archetypal topology.

  1. Ciona intestinalis as an emerging model organism: its regeneration under controlled conditions and methodology for egg dechorionation

    Institute of Scientific and Technical Information of China (English)

    LIU Li-ping; XIANG Jian-hai; DONG Bo; NATARAJAN Pavanasam; YU Kui-jie; CAI Nan-er

    2006-01-01

    The ascidian Ciona intestinalis is a model organism of developmental and evolutionary biology and may provide crucial clues concerning two fundamental matters, namely, how chordates originated from the putative deuterostome ancestor and how advanced chordates originated from the simplest chordates. In this paper, a whole-life-span culture of C. intestinalis was conducted. Fed with the diet combination of dry Spirulina, egg yolk, Dicrateria sp., edible yeast and weaning diet for shrimp, C.intestinalis grew up to average 59 mm and matured after 60 d cultivation. This culture process could be repeated using the artificially cultured mature ascidians as material. When the fertilized eggs were maintained under 10, 15, 20, 25 ℃, they hatched within 30 h, 22 h, 16 h and 12 h 50 min respectively experiencing cleavage, blastulation, gastrulation, neurulation, tailbud stage and tadpole stage. The tadpole larvae were characterized as typical but simplified chordates because of their dorsal nerve cord, notochord and primordial brain. After 8~24 h freely swimming, the tadpole larvae settled on the substrates and metamorphosized within 1~2 d into filter feeding sessile juvenile ascidians. In addition, unfertilized eggs were successfully dechorionated in filtered seawater containing 1% Tripsin, 0.25% EDTA at pH of 10.5 within 40 min. After fertilization, the dechorionated eggs developed well and hatched at normal hatching rate. In conclusion, this paper presented feasible methodology for rearing the tadpole larvae of C. intestinalis into sexual maturity under controlled conditions and detailed observations on the embryogenesis of the laboratory cultured ascidians, which will facilitate developmental and genetic research using this model system.

  2. Germ-line transgenesis of the Tc1/mariner superfamily transposon Minos in Ciona intestinalis

    OpenAIRE

    Sasakura, Yasunori; Awazu, Satoko; Chiba, Shota; Satoh, Nori

    2003-01-01

    The tadpole larva of the basal chordate Ciona intestinalis has the most simplified, basic body-plan of chordates. Because it has a compact genome with a complete draft sequence, a large quantity of EST/cDNA information, and a short generation time, Ciona is a suitable model for future genetics. We establish here a transgenic technique in Ciona that uses the Tc1/mariner superfamily transposon Minos. Minos was integrated efficiently into the genome of germ cells and transmitted stably to ...

  3. How Fast Is the Sessile Ciona?

    OpenAIRE

    Giuseppe D'Onofrio; Fernando Alvarez-Valin; Luisa Berná

    2009-01-01

    Genomewide analyses of distances between orthologous gene pairs from the ascidian species Ciona intestinalis and Ciona savignyi were compared with those of vertebrates. Combining this data with a detailed and careful use of vertebrate fossil records, we estimated the time of divergence between the two ascidians nearly 180 My. This estimation was obtained after correcting for the different substitution rates found comparing several groups of chordates; indeed we determine here that on average ...

  4. The significance of Ciona intestinalis as a stem organism in integrative studies of functional evolution of the chordate endocrine, neuroendocrine, and nervous systems.

    Science.gov (United States)

    Matsubara, Shin; Kawada, Tsuyoshi; Sakai, Tsubasa; Aoyama, Masato; Osugi, Tomohiro; Shiraishi, Akira; Satake, Honoo

    2016-02-01

    Ascidians are the closest phylogenetic neighbors to vertebrates and are believed to conserve the evolutionary origin in chordates of the endocrine, neuroendocrine, and nervous systems involving neuropeptides and peptide hormones. Ciona intestinalis harbors various homologs or prototypes of vertebrate neuropeptides and peptide hormones including gonadotropin-releasing hormones (GnRHs), tachykinins (TKs), and calcitonin, as well as Ciona-specific neuropeptides such as Ciona vasopressin, LF, and YFV/L peptides. Moreover, molecular and functional studies on Ciona tachykinin (Ci-TK) have revealed the novel molecular mechanism of inducing oocyte growth via up-regulation of vitellogenesis-associated protease activity, which is expected to be conserved in vertebrates. Furthermore, a series of studies on Ciona GnRH receptor paralogs have verified the species-specific regulation of GnRHergic signaling including unique signaling control via heterodimerization among multiple GnRH receptors. These findings confirm the remarkable significance of ascidians in investigations of the evolutionary processes of the peptidergic systems in chordates, leading to the promising advance in the research on Ciona peptides in the next stage based on the recent development of emerging technologies including genome-editing techniques, peptidomics-based multi-color staining, machine-learning prediction, and next-generation sequencing. These technologies and bioinformatic integration of the resultant "multi-omics" data will provide unprecedented insights into the comprehensive understanding of molecular and functional regulatory mechanisms of the Ciona peptides, and will eventually enable the exploration of both conserved and diversified endocrine, neuroendocrine, and nervous systems in the evolutionary lineage of chordates. PMID:26031189

  5. A novel third complement component C3 gene of Ciona intestinalis expressed in the endoderm at the early developmental stages

    Directory of Open Access Journals (Sweden)

    T Hibino

    2013-04-01

    Full Text Available The third complement component (C3 in ascidian was reported to function as an opsonin to enhance phagocytosis and as a chemotactic factor for phagocytes, indicating that ascidian C3 works in mesodermal cavity as a humoral factor like vertebrate C3s. In the basal Eumetazoa, Cnidaria lacking mesodermal tissues, C3 was reported to work in an endodermal cavity. Evolution of structure and function of C3 is still to be clarified. Here we report the identification of the third C3 gene, CiC3-3, in the genome of an ascidian, Ciona intestinalis. Phylogenetic analysis using the entire amino acid sequences of Eumetazoan C3s indicated that CiC3-3 possess a closer relationship to vertebrate C3, C4 and C5 than other ascidian C3s. Although CiC3-3 retained the α-β processing site and 6 cysteine residues in the C3a region, it lacked the intra-molecular thioester bond and the catalytic histidine residue. Instead, CiC3-3 had a unique insertion of about 70 residues long Lys/Arg-rich sequence. CiC3-3 was expressed highly in the embryonic stages, but little in the adult in contradistinction to CiC3-1 and CiC3-2. The expression of CiC3-3 in early embryonic stages was restricted to endoderm similar to cnidarian C3s. Thus, the ascidian complement system could represent a unique evolutionary stage sharing a primitive endodermal function with Cnidaria, and newly developed humoral function with vertebrates.

  6. How Fast Is the Sessile Ciona?

    Directory of Open Access Journals (Sweden)

    Luisa Berná

    2009-01-01

    Full Text Available Genomewide analyses of distances between orthologous gene pairs from the ascidian species Ciona intestinalis and Ciona savignyi were compared with those of vertebrates. Combining this data with a detailed and careful use of vertebrate fossil records, we estimated the time of divergence between the two ascidians nearly 180 My. This estimation was obtained after correcting for the different substitution rates found comparing several groups of chordates; indeed we determine here that on average Ciona species evolve 50% faster than vertebrates.

  7. ANP (Atrial Natriuretic Peptide presence in the heart of a tunicate, Ciona intestinalis.

    Directory of Open Access Journals (Sweden)

    Aldo Gerbino

    2010-06-01

    Full Text Available Atrial natriuretic peptide was found in the heart of vertebrates, we studied the ANP presence in the heart of Ciona intestinalis. This is animal is very important because of the its evolutionary position between invertebrates and vertebrates. ANP presence was only revealed in myoepithelial cells of the myocardium. Results suggest the hypothesis that ANP is present not only in the vertebrates but also in the invertebrates and in Ciona heart ANP might play a similar role like in the heart of vertebrates.

  8. Morphological Differences between Larvae of the Ciona intestinalis Species Complex: Hints for a Valid Taxonomic Definition of Distinct Species.

    Directory of Open Access Journals (Sweden)

    Roberta Pennati

    Full Text Available The cosmopolitan ascidian Ciona intestinalis is the most common model species of Tunicata, the sister-group of Vertebrata, and widely used in developmental biology, genomics and evolutionary studies. Recently, molecular studies suggested the presence of cryptic species hidden within the C. intestinalis species, namely C. intestinalis type A and type B. So far, no substantial morphological differences have been identified between individuals belonging to the two types. Here we present morphometric, immunohistochemical, and histological analyses, as well as 3-D reconstructions, of late larvae obtained by cross-fertilization experiments of molecularly determined type A and type B adults, sampled in different seasons and in four different localities. Our data point to quantitative and qualitative differences in the trunk shape of larvae belonging to the two types. In particular, type B larvae exhibit a longer pre-oral lobe, longer and relatively narrower total body length, and a shorter ocellus-tail distance than type A larvae. All these differences were found to be statistically significant in a Discriminant Analysis. Depending on the number of analyzed parameters, the obtained discriminant function was able to correctly classify > 93% of the larvae, with the remaining misclassified larvae attributable to the existence of intra-type seasonal variability. No larval differences were observed at the level of histology and immunohistochemical localization of peripheral sensory neurons. We conclude that type A and type B are two distinct species that can be distinguished on the basis of larval morphology and molecular data. Since the identified larval differences appear to be valid diagnostic characters, we suggest to raise both types to the rank of species and to assign them distinct names.

  9. Morphological Differences between Larvae of the Ciona intestinalis Species Complex: Hints for a Valid Taxonomic Definition of Distinct Species

    Science.gov (United States)

    Pennati, Roberta; Ficetola, Gentile Francesco; Brunetti, Riccardo; Caicci, Federico; Gasparini, Fabio; Griggio, Francesca; Sato, Atsuko; Stach, Thomas; Kaul-Strehlow, Sabrina; Gissi, Carmela; Manni, Lucia

    2015-01-01

    The cosmopolitan ascidian Ciona intestinalis is the most common model species of Tunicata, the sister-group of Vertebrata, and widely used in developmental biology, genomics and evolutionary studies. Recently, molecular studies suggested the presence of cryptic species hidden within the C. intestinalis species, namely C. intestinalis type A and type B. So far, no substantial morphological differences have been identified between individuals belonging to the two types. Here we present morphometric, immunohistochemical, and histological analyses, as well as 3-D reconstructions, of late larvae obtained by cross-fertilization experiments of molecularly determined type A and type B adults, sampled in different seasons and in four different localities. Our data point to quantitative and qualitative differences in the trunk shape of larvae belonging to the two types. In particular, type B larvae exhibit a longer pre-oral lobe, longer and relatively narrower total body length, and a shorter ocellus-tail distance than type A larvae. All these differences were found to be statistically significant in a Discriminant Analysis. Depending on the number of analyzed parameters, the obtained discriminant function was able to correctly classify > 93% of the larvae, with the remaining misclassified larvae attributable to the existence of intra-type seasonal variability. No larval differences were observed at the level of histology and immunohistochemical localization of peripheral sensory neurons. We conclude that type A and type B are two distinct species that can be distinguished on the basis of larval morphology and molecular data. Since the identified larval differences appear to be valid diagnostic characters, we suggest to raise both types to the rank of species and to assign them distinct names. PMID:25955391

  10. CiMT-1, an unusual chordate metallothionein gene in Ciona intestinalis genome: structure and expression studies.

    Science.gov (United States)

    Franchi, Nicola; Boldrin, Francesco; Ballarin, Loriano; Piccinni, Ester

    2011-02-01

    The present article reports on the characterization of the urochordate metallothionein (MT) gene, CiMT-1, from the solitary ascidian Ciona intestinalis. The predicted protein is shorter than other known deuterostome MTs, having only 39 amino acids. The gene has the same tripartite structure as vertebrate MTs, with some features resembling those of echinoderm MTs. The promoter region shows the canonical cis-acting elements recognized by transcription factors that respond to metal, ROS, and cytokines. Unusual sequences, described in fish and echinoderms, are also present. In situ hybridization suggests that only a population of hemocytes involved in immune responses, i.e. granular amebocytes, express CiMT-1 mRNA. These observations support the idea that urochordates perform detoxification through hemocytes, and that MTs may play important roles in inflammatory humoral responses in tunicates. The reported data offer new clues for better understanding the evolution of these multivalent proteins from non-vertebrate to vertebrate chordates and reinforce their functions in detoxification and immunity. PMID:21328559

  11. The Simple Chordate Ciona intestinalis Has a Reduced Complement of Genes Associated with Fanconi Anemia

    Science.gov (United States)

    Stanley, Edward C.; Azzinaro, Paul A.; Vierra, David A.; Howlett, Niall G.; Irvine, Steven Q.

    2016-01-01

    Fanconi anemia (FA) is a human genetic disease characterized by congenital defects, bone marrow failure, and increased cancer risk. FA is associated with mutation in one of 24 genes. The protein products of these genes function cooperatively in the FA pathway to orchestrate the repair of DNA interstrand cross-links. Few model organisms exist for the study of FA. Seeking a model organism with a simpler version of the FA pathway, we searched the genome of the simple chordate Ciona intestinalis for homologs of the human FA-associated proteins. BLAST searches, sequence alignments, hydropathy comparisons, maximum likelihood phylogenetic analysis, and structural modeling were used to infer the likelihood of homology between C. intestinalis and human FA proteins. Our analysis indicates that C. intestinalis indeed has a simpler and potentially functional FA pathway. The C. intestinalis genome was searched for candidates for homology to 24 human FA and FA-associated proteins. Support was found for the existence of homologs for 13 of these 24 human genes in C. intestinalis. Members of each of the three commonly recognized FA gene functional groups were found. In group I, we identified homologs of FANCE, FANCL, FANCM, and UBE2T/FANCT. Both members of group II, FANCD2 and FANCI, have homologs in C. intestinalis. In group III, we found evidence for homologs of FANCJ, FANCO, FANCQ/ERCC4, FANCR/RAD51, and FANCS/BRCA1, as well as the FA-associated proteins ERCC1 and FAN1. Evidence was very weak for the existence of homologs in C. intestinalis for any other recognized FA genes. This work supports the notion that C. intestinalis, as a close relative of vertebrates, but having a much reduced complement of FA genes, offers a means of studying the function of certain FA proteins in a simpler pathway than that of vertebrate cells. PMID:27279728

  12. An exceptional salt tolerant antimicrobial peptide derived from a novel gene family of hemocytes of the marine invertebrate Ciona intestinalis

    OpenAIRE

    Fedders, Henning; Michalek, Matthias; Grötzinger, Joachim; Leippe, Matthias

    2008-01-01

    Abstract A novel gene family coding for putative antimicrobial peptides was identified in the EST data base of the sea squirt Ciona intestinalis, and one of these genes was molecularly cloned from the Northern European Ciona subspecies. In situ hybridisation and immunocytochemical analysis revealed that the natural peptide is synthesized and stored in a distinct hemocyte type, the univacuolar non-refractile granulocytes. By semiquantitative RT-PCR analysis it was shown that the exp...

  13. A saturation screen for cis-acting regulatory DNA in the Hox genes of Ciona intestinalis

    Energy Technology Data Exchange (ETDEWEB)

    Keys, David N.; Lee, Byung-in; Di Gregorio, Anna; Harafuji, Naoe; Detter, Chris; Wang, Mei; Kahsai, Orsalem; Ahn, Sylvia; Arellano, Andre; Zhang, Quin; Trong, Stephan; Doyle, Sharon A.; Satoh, Noriyuki; Satou, Yutaka; Saiga, Hidetoshi; Christian, Allen; Rokhsar, Dan; Hawkins, Trevor L.; Levine, Mike; Richardson, Paul

    2005-01-05

    A screen for the systematic identification of cis-regulatory elements within large (>100 kb) genomic domains containing Hox genes was performed by using the basal chordate Ciona intestinalis. Randomly generated DNA fragments from bacterial artificial chromosomes containing two clusters of Hox genes were inserted into a vector upstream of a minimal promoter and lacZ reporter gene. A total of 222 resultant fusion genes were separately electroporated into fertilized eggs, and their regulatory activities were monitored in larvae. In sum, 21 separable cis-regulatory elements were found. These include eight Hox linked domains that drive expression in nested anterior-posterior domains of ectodermally derived tissues. In addition to vertebrate-like CNS regulation, the discovery of cis-regulatory domains that drive epidermal transcription suggests that C. intestinalis has arthropod-like Hox patterning in the epidermis.

  14. The repertoire of heterotrimeric G proteins and RGS proteins in Ciona intestinalis.

    Directory of Open Access Journals (Sweden)

    R Prasobh

    Full Text Available BACKGROUND: Heterotrimeric G proteins and regulators of G protein signaling (RGS proteins are key downstream interacting partners in the G protein coupled receptor (GPCR signaling pathway. The highly versatile GPCR transmembrane signaling system is a consequence of the coupling of a diverse set of receptors to downstream partners that include multiple subforms of G proteins and regulatory proteins including RGS proteins, among others. While the GPCR repertoire of Ciona intestinalis, representing the basal chordate is known, the repertoire of the heterotrimeric G proteins and RGS proteins is unknown. METHODOLOGY/PRINCIPAL FINDINGS: In the present study, we performed an in-silico genome-wide search of C. intestinalis for its complement of G proteins and RGS proteins. The identification of several one-to-one orthologs of human G proteins at the levels of families, subfamilies and types and of homologs of the human RGS proteins suggests an evolutionarily conserved structure function relationship of the GPCR signaling mechanism in the chordates. CONCLUSIONS: The C. intestinalis genome encodes a highly conserved, albeit, limited repertoire of the heterotrimeric G protein complexes with the size of subunit types comparable with that in lower eukaryotes.

  15. Genomic analyses reveal a conserved glutathione homeostasis pathway in the invertebrate chordate Ciona intestinalis

    Science.gov (United States)

    Nava, Gerardo M.; Lee, David Y.; Ospina, Javier H.; Cai, Shi-Ying

    2009-01-01

    The major thiol redox buffer glutathione (l-γ-glutamyl-l-cysteinylglycine, GSH) is central to cell fate determination, and thus, associated metabolic and regulatory pathways are exquisitely sensitive to a wide range of environmental cues. An imbalance of cellular redox homeostasis has emerged as a pathologic hallmark of a diverse range of human gene-environment disorders. Despite the central importance of GSH in cellular homeostasis, underlying genetic regulatory pathways remain poorly defined. This report describes the annotation and expression analysis of genes contributing to GSH homeostasis in the invertebrate chordate Ciona intestinalis. A core pathway comprising 19 genes contributing to the biosynthesis of GSH and its use as both a redox buffer and a conjugate in phase II detoxification as well as known transcriptional regulators were analyzed. These genes exhibit a high level of sequence conservation with corresponding human, rat, and mouse homologs and were expressed constitutively in tissues of adult animals. The GSH biosynthetic genes Gclc and Gclm were also responsive to the prototypical antioxidant tert-butylhydroquinone. The present evidence of a conserved GSH homeostasis pathway in C. intestinalis together with its phylogenetic position as a basal chordate and lifestyle as a filter feeder constantly exposed to natural marine toxins introduces this species as an important animal model for defining molecular mechanisms that potentially underlie genetic susceptibility to environmentally associated stress. PMID:19470804

  16. Metamorphosis of the invasive ascidian Ciona savignyi: environmental variables and chemical exposure.

    Science.gov (United States)

    Cahill, Patrick L; Atalah, Javier; Selwood, Andrew I; Kuhajek, Jeanne M

    2016-01-01

    In this study, the effects of environmental variables on larval metamorphosis of the solitary ascidian Ciona savignyi were investigated in a laboratory setting. The progression of metamorphic changes were tracked under various temperature, photoperiod, substrate, larval density, and vessel size regimes. Metamorphosis was maximised at 18 °C, 12:12 h subdued light:dark, smooth polystyrene substrate, and 10 larvae mL(-1) in a twelve-well tissue culture plate. Eliminating the air-water interface by filling culture vessels to capacity further increased the proportion of metamorphosed larvae; 87 ± 5% of larvae completed metamorphosis within 5 days compared to 45 ± 5% in control wells. The effects of the reference antifouling compounds polygodial, portimine, oroidin, chlorothalonil, and tolylfluanid on C. savignyi were subsequently determined, highlighting (1) the sensitivity of C. savignyi metamorphosis to chemical exposure and (2) the potential to use C. savignyi larvae to screen for bioactivity in an optimised laboratory setting. The compounds were bioactive in the low ng mL(-1) to high µg mL(-1) range. Polygodial was chosen for additional investigations, where it was shown that mean reductions in the proportions of larvae reaching stage E were highly repeatable both within (repeatability = 14 ± 9%) and between (intermediate precision = 17 ± 3%) independent experiments. An environmental extract had no effect on the larvae but exposing larvae to both the extract and polygodial reduced potency relative to polygodial alone. This change in potency stresses the need for caution when working with complex samples, as is routinely implemented when isolating natural compounds from their biological source. Overall, the outcomes of this study highlight the sensitivity of C. savignyi metamorphosis to environmental variations and chemical exposure. PMID:26966668

  17. Evidence that talin alternative splice variants from Ciona intestinalis have different roles in cell adhesion

    Directory of Open Access Journals (Sweden)

    McCann Richard O

    2006-12-01

    Full Text Available Abstract Background Talins are large, modular cytoskeletal proteins found in animals and amoebozoans such as Dictyostelium discoideum. Since the identification of a second talin gene in vertebrates, it has become increasingly clear that vertebrate Talin1 and Talin2 have non-redundant roles as essential links between integrins and the actin cytoskeleton in distinct plasma membrane-associated adhesion complexes. The conserved C-terminal I/LWEQ module is important for talin function. This structural element mediates the interaction of talins with F-actin. The I/LWEQ module also targets mammalian Talin1 to focal adhesion complexes, which are dynamic multicomponent assemblies required for cell adhesion and cell motility. Although Talin1 is essential for focal adhesion function, Talin2 is not targeted to focal adhesions. The nonvertebrate chordate Ciona intestinalis has only one talin gene, but alternative splicing of the talin mRNA produces two proteins with different C-terminal I/LWEQ modules. Thus, C. intestinalis contains two talins, Talin-a and Talin-b, with potentially different activities, despite having only one talin gene. Results We show here that, based on their distribution in cDNA libraries, Talin-a and Talin-b are differentially expressed during C. intestinalis development. The I/LWEQ modules of the two proteins also have different affinities for F-actin. Consistent with the hypothesis that Talin-a and Talin-b have different roles in cell adhesion, the distinct I/LWEQ modules of Talin-a and Talin-b possess different subcellular targeting determinants. The I/LWEQ module of Talin-a is targeted to focal adhesions, where it most likely serves as the link between integrin and the actin cytoskeleton. The Talin-b I/LWEQ module is not targeted to focal adhesions, but instead preferentially labels F-actin stress fibers. These different properties of C. intestinalis the Talin-a and Talin-b I/LWEQ modules mimic the differences between mammalian

  18. Ciona Genetics

    OpenAIRE

    Veeman, Michael T.; Chiba, Shota; Smith, William C.

    2011-01-01

    Ascidians, such as Ciona, are invertebrate chordates with simple embryonic body plans and small, relatively non-redundant genomes. Ciona genetics is in its infancy compared to many other model systems, but it provides a powerful method for studying this important vertebrate outgroup. Here we give basic methods for genetic analysis of Ciona, including protocols for controlled crosses both by natural spawning and by the surgical isolation of gametes; the identification and propagation of mutant...

  19. Expression of the Ciona intestinalis alternative oxidase (AOX) in Drosophila complements defects in mitochondrial oxidative phosphorylation.

    Science.gov (United States)

    Fernandez-Ayala, Daniel J M; Sanz, Alberto; Vartiainen, Suvi; Kemppainen, Kia K; Babusiak, Marek; Mustalahti, Eero; Costa, Rodolfo; Tuomela, Tea; Zeviani, Massimo; Chung, Jongkyeong; O'Dell, Kevin M C; Rustin, Pierre; Jacobs, Howard T

    2009-05-01

    Defects in mitochondrial OXPHOS are associated with diverse and mostly intractable human disorders. The single-subunit alternative oxidase (AOX) found in many eukaryotes, but not in arthropods or vertebrates, offers a potential bypass of the OXPHOS cytochrome chain under conditions of pathological OXPHOS inhibition. We have engineered Ciona intestinalis AOX for conditional expression in Drosophila melanogaster. Ubiquitous AOX expression produced no detrimental phenotype in wild-type flies. However, mitochondrial suspensions from AOX-expressing flies exhibited a significant cyanide-resistant substrate oxidation, and the flies were partially resistant to both cyanide and antimycin. AOX expression was able to complement the semilethality of partial knockdown of both cyclope (COXVIc) and the complex IV assembly factor Surf1. It also rescued the locomotor defect and excess mitochondrial ROS production of flies mutated in dj-1beta, a Drosophila homolog of the human Parkinson's disease gene DJ1. AOX appears to offer promise as a wide-spectrum therapeutic tool in OXPHOS disorders. PMID:19416715

  20. Development of translationally active mRNA for larval muscle acetylcholinesterase during ascidian embryogenesis.

    OpenAIRE

    Meedel, T H; Whittaker, J R

    1983-01-01

    Relative quantities of translationally active acetylcholinesterase (acetylcholine acetylhydrolase, EC 3.1.1.7) mRNA present at various developmental stages were compared in embryos of the ascidian Ciona intestinalis. Purified RNA was tested for its translational capacity by microinjection into Xenopus laevis oocytes; the acetylcholinesterase produced was immunoprecipitated with antibody to Ciona acetylcholinesterase and enzyme activity was assayed radiometrically. With this protocol, enzyme s...

  1. An Otx/Nodal Regulatory Signature for Posterior Neural Development in Ascidians

    OpenAIRE

    Agnès Roure; Patrick Lemaire; Sébastien Darras

    2014-01-01

    In chordates, neural induction is the first step of a complex developmental process through which ectodermal cells acquire a neural identity. In ascidians, FGF-mediated neural induction occurs at the 32-cell stage in two blastomere pairs, precursors respectively of anterior and posterior neural tissue. We combined molecular embryology and cis-regulatory analysis to unveil in the ascidian Ciona intestinalis the remarkably simple proximal genetic network that controls posterior neural fate acqu...

  2. Characterization and transcription studies of a phytochelatin synthase gene from the solitary tunicate Ciona intestinalis exposed to cadmium

    Energy Technology Data Exchange (ETDEWEB)

    Franchi, Nicola [Department of Biology, University of Padova, Padova (Italy); Department of Biological, Chemical, Pharmaceutical Science and Technology, University of Palermo, Palermo (Italy); Piccinni, Ester [Department of Biology, University of Padova, Padova (Italy); Ferro, Diana [Department of Biology, University of Padova, Padova (Italy); Institute for Evolution and Biodiversity, Westfälische Wilhelms-Universität, Münster (Germany); Basso, Giuseppe [Department of Woman and Child Health, University of Padova, Padova (Italy); Spolaore, Barbara [CRIBI Biotechnology Centre, University of Padova, Padova (Italy); Department of Pharmaceutical and Pharmacological Sciences, University of Padova, Padova (Italy); Santovito, Gianfranco, E-mail: gianfranco.santovito@unipd.it [Department of Biology, University of Padova, Padova (Italy); Ballarin, Loriano [Department of Biology, University of Padova, Padova (Italy)

    2014-07-01

    Highlights: • Ciona intestinalis have a functional phytochelatin synthase (PCS) gene (cipcs). • CiPCS amino acid sequence is phylogentically related to other metazoan PCSs. • CiPCS catalyze the synthesis of PC2. • cipcs are mostly transcribed in circulating hemocytes, in both tunic and blood lacunae. • Cadmium exposure results in a significant increase of cipcs and cipcna transcription. - Abstract: The major thiol-containing molecules involved in controlling the level of intracellular ROS in eukaryotes, acting as a nonenzymatic detoxification system, are metallothioneins (MTs), glutathione (GSH) and phytochelatins (PCs). Both MTs and GSH are well-known in the animal kingdom. PC was considered a prerogative of the plant kingdom but, in 2001, a phytochelatin synthase (PCS) gene was described in the nematode Caenorhabditis elegans; additional genes encoding this enzyme were later described in the earthworm Eisenia fetida and in the parasitic nematode Schistosoma mansoni but scanty data are available, up to now, for Deuterostomes. Here, we describe the molecular characteristics and transcription pattern, in the presence of Cd, of a PCS gene from the invertebrate chordate Ciona intestinalis, a ubiquitous solitary tunicate and demonstrate the presence of PCs in tissue extracts. We also studied mRNA localization by in situ hybridization. In addition, we analyzed the behavior of hemocytes and tunic cells consequent to Cd exposure as well as the transcription pattern of the Ciona orthologous for proliferating cell nuclear antigen (PCNA), usually considered a proliferation marker, and observed that cell proliferation occurs after 96 h of Cd treatment. This matches the hypothesis of Cd-induced cell proliferation, as already suggested by previous data on the expression of a metallothionein gene in the same animal.

  3. Characterization and transcription studies of a phytochelatin synthase gene from the solitary tunicate Ciona intestinalis exposed to cadmium

    International Nuclear Information System (INIS)

    Highlights: • Ciona intestinalis have a functional phytochelatin synthase (PCS) gene (cipcs). • CiPCS amino acid sequence is phylogentically related to other metazoan PCSs. • CiPCS catalyze the synthesis of PC2. • cipcs are mostly transcribed in circulating hemocytes, in both tunic and blood lacunae. • Cadmium exposure results in a significant increase of cipcs and cipcna transcription. - Abstract: The major thiol-containing molecules involved in controlling the level of intracellular ROS in eukaryotes, acting as a nonenzymatic detoxification system, are metallothioneins (MTs), glutathione (GSH) and phytochelatins (PCs). Both MTs and GSH are well-known in the animal kingdom. PC was considered a prerogative of the plant kingdom but, in 2001, a phytochelatin synthase (PCS) gene was described in the nematode Caenorhabditis elegans; additional genes encoding this enzyme were later described in the earthworm Eisenia fetida and in the parasitic nematode Schistosoma mansoni but scanty data are available, up to now, for Deuterostomes. Here, we describe the molecular characteristics and transcription pattern, in the presence of Cd, of a PCS gene from the invertebrate chordate Ciona intestinalis, a ubiquitous solitary tunicate and demonstrate the presence of PCs in tissue extracts. We also studied mRNA localization by in situ hybridization. In addition, we analyzed the behavior of hemocytes and tunic cells consequent to Cd exposure as well as the transcription pattern of the Ciona orthologous for proliferating cell nuclear antigen (PCNA), usually considered a proliferation marker, and observed that cell proliferation occurs after 96 h of Cd treatment. This matches the hypothesis of Cd-induced cell proliferation, as already suggested by previous data on the expression of a metallothionein gene in the same animal

  4. An endocrine disruptor, bisphenol A, affects development in the protochordate Ciona intestinalis: Hatching rates and swimming behavior alter in a dose-dependent manner

    International Nuclear Information System (INIS)

    Bisphenol A (BPA) is widely used industrially to produce polycarbonate plastics and epoxy resins. Numerous studies document the harmful effects caused by low-dose BPA exposure especially on nervous systems and behavior in experimental animals such as mice and rats. Here, we exposed embryos of a model chordate, Ciona intestinalis, to seawater containing BPA to evaluate adverse effects on embryonic development and on the swimming behavior of subsequent larvae. Ciona is ideal because its larva develops rapidly and has few cells. The rate of larval hatching decreased in a dose-dependent manner with exposures to BPA above 3 μM; swimming behavior was also affected in larvae emerging from embryos exposed to 1 μM BPA. Adverse effects were most severe on fertilized eggs exposed to BPA within 7 h post-fertilization. Ciona shares twelve nuclear receptors with mammals, and BPA is proposed to disturb the physiological functions of one or more of these. - Highlights: ► Embryos of Ciona intestinalis were exposed to BPA to evaluate its developmental effects. ► The rate of larval hatching decreased in a dose-dependent manner. ► Swimming behavior was affected in larvae that emerge from embryos exposed to 1 μM BPA. ► Our findings will support a new strategy to analyze the developmental effects induced by BPA. - Exposure of fertilized Ciona embryos to BPA decreased their hatch rate in a dose-dependent manner and led to abnormal larval swimming behavior.

  5. Genomics and developmental approaches to an ascidian adenohypophysis primordium.

    Science.gov (United States)

    Kano, Shungo

    2010-07-01

    Ascidians, which are the closest phylogenetic relatives to vertebrates, lack a distinct pituitary gland, which is the major endocrine gland in vertebrates. Nevertheless, for the past 130 years, it has been debated that the ascidian neural complex (NC) is homologous to the pituitary. Of the three major components of the NC, the neural gland (NG) has mainly been thought to be the ascidian counterpart of the pituitary. Recently, however, the ciliated funnel, and not the NG, was postulated to be the adenohypophysis (AH) primordium because it is likely derived from oral ectoderm, and because the expression of several placodal genes is comparable to their expression in vertebrates. An extensive in silico survey of the Ciona intestinalis genome sequence revealed that genes encoding pituitary hormones are absent in ascidians. Under the circumstances, this thesis attempts to find a path that shows that the AH primordium is recognizable in the ascidian by revisiting molecular and developmental data from recent public resources on C. intestinalis, and through the use of advanced bio-imaging techniques. A putative Ciona genetic pathway, which was constructed by referring to data from mammals, shows that only a patchwork of the genetic network exists to achieve terminal differentiation of the AH endocrine cells in the Ciona genome. Re-annotation on glycoprotein hormone related proteins, a GPA2/ARP and two GPB5/BRP ones previously reported, reveals that the GPA2 locus contains two splicing variants, and one variant likely formed a three-dimensional conformation similar to that of human GPA2. No clone of the GPB5/BRP1 locus has been isolated, and another candidate, BRP2, is unlikely to be a GPB5. Next, I argued a possibility that endocrine activities of Ciona species could be specialized in association with its short generation time, and I suggest that not only Ciona species but also other ascidians should be studied in order to understand ascidian endocrinology. Confocal images

  6. Characterization of the teneurin C-terminal associated peptide (TCAP) in the vase tunicate, Ciona intestinalis: A novel peptide system associated with energy metabolism and reproduction.

    Science.gov (United States)

    Colacci, Michael; De Almeida, Reuben; Chand, Dhan; Lovejoy, Sabine R; Sephton, Dawn; Vercaemer, Benedikte; Lovejoy, David A

    2015-05-15

    The vase tunicate, Ciona intestinalis, is a protochordate and is considered a sister lineage to the chordates. The recent sequencing of its genome has made this species a particularly important model to understand the genetic basis of vertebrate evolution. However, C. intestinalis is also a highly invasive species along the Atlantic coast of North America and other regions of the world which have caused considerable economic stress due to its biofouling actions and, in particular, negative impacts on the mussel- and oyster-based aquaculture industry. Despite this background, little is known about C. intestinalis physiology. The teneurin C-terminal associated peptides (TCAP) are a family of highly conserved peptide hormones found in most metazoans. Moreover, these peptides have been implicated in the inhibition of stress and stimulation of feeding-based metabolism. We have, therefore, identified this peptide using an in silico approach and characterized its immunological expression in tissues using a mouse polyclonal antiserum. These data indicate that its primary structure is more similar to invertebrate TCAPs relative to vertebrate TCAPs. Immunological expression indicates that it is highly expressed in the digestive tract and gonads consistent with findings in vertebrates. Synthetic mouse TCAP-1 administered into the brachial basket significantly increases the incidence of non-stress contractile behaviors. These findings support the hypothesis that TCAP is a bioactive peptide in C. intestinalis. Thus, C. intestinalis and tunicates in general may offer a simple model to investigate peptide interaction while providing information on how to control this invasive species. PMID:25687741

  7. Transcript Mapping and Genome Annotation of Ascidian mtDNA Using EST Data

    OpenAIRE

    Gissi, Carmela; Pesole, Graziano

    2003-01-01

    Mitochondrial transcripts of two ascidian species were reconstructed through sequence assembly of publicly available ESTs resembling mitochondrial DNA sequences (mt-ESTs). This strategy allowed us to analyze processing and mapping of the mitochondrial transcripts and to investigate the gene organization of a previously uncharacterized mitochondrial genome (mtDNA). This new strategy would greatly facilitate the sequencing and annotation of mtDNAs. In Ciona intestinalis, the assembled mt-...

  8. Ciona intestinalis as a Marine Model System to Study Some Key Developmental Genes Targeted by the Diatom-Derived Aldehyde Decadienal

    Science.gov (United States)

    Lettieri, Anna; Esposito, Rosaria; Ianora, Adrianna; Spagnuolo, Antonietta

    2015-01-01

    The anti-proliferative effects of diatoms, described for the first time in copepods, have also been demonstrated in benthic invertebrates such as polychaetes, sea urchins and tunicates. In these organisms PUAs (polyunsaturated aldehydes) induce the disruption of gametogenesis, gamete functionality, fertilization, embryonic mitosis, and larval fitness and competence. These inhibitory effects are due to the PUAs, produced by diatoms in response to physical damage as occurs during copepod grazing. The cell targets of these compounds remain largely unknown. Here we identify some of the genes targeted by the diatom PUA 2-trans-4-trans-decadienal (DD) using the tunicate Ciona intestinalis. The tools, techniques and genomic resources available for Ciona, as well as the suitability of Ciona embryos for medium-to high-throughput strategies, are key to their employment as model organisms in different fields, including the investigation of toxic agents that could interfere with developmental processes. We demonstrate that DD can induce developmental aberrations in Ciona larvae in a dose-dependent manner. Moreover, through a preliminary analysis, DD is shown to affect the expression level of genes involved in stress response and developmental processes. PMID:25789602

  9. Evolutionary changes in the notochord genetic toolkit: a comparative analysis of notochord genes in the ascidian Ciona and the larvacean Oikopleura

    Directory of Open Access Journals (Sweden)

    Jiang Di

    2011-01-01

    Full Text Available Abstract Background The notochord is a defining feature of the chordate clade, and invertebrate chordates, such as tunicates, are uniquely suited for studies of this structure. Here we used a well-characterized set of 50 notochord genes known to be targets of the notochord-specific Brachyury transcription factor in one tunicate, Ciona intestinalis (Class Ascidiacea, to begin determining whether the same genetic toolkit is employed to build the notochord in another tunicate, Oikopleura dioica (Class Larvacea. We identified Oikopleura orthologs of the Ciona notochord genes, as well as lineage-specific duplicates for which we determined the phylogenetic relationships with related genes from other chordates, and we analyzed their expression patterns in Oikopleura embryos. Results Of the 50 Ciona notochord genes that were used as a reference, only 26 had clearly identifiable orthologs in Oikopleura. Two of these conserved genes appeared to have undergone Oikopleura- and/or tunicate-specific duplications, and one was present in three copies in Oikopleura, thus bringing the number of genes to test to 30. We were able to clone and test 28 of these genes. Thirteen of the 28 Oikopleura orthologs of Ciona notochord genes showed clear expression in all or in part of the Oikopleura notochord, seven were diffusely expressed throughout the tail, six were expressed in tissues other than the notochord, while two probes did not provide a detectable signal at any of the stages analyzed. One of the notochord genes identified, Oikopleura netrin, was found to be unevenly expressed in notochord cells, in a pattern reminiscent of that previously observed for one of the Oikopleura Hox genes. Conclusions A surprisingly high number of Ciona notochord genes do not have apparent counterparts in Oikopleura, and only a fraction of the evolutionarily conserved genes show clear notochord expression. This suggests that Ciona and Oikopleura, despite the morphological similarities

  10. The ascidian prophenoloxidase activating system

    Directory of Open Access Journals (Sweden)

    M Cammarata

    2009-03-01

    Full Text Available Phenoloxidases/tyrosinases initiate melanin synthesis in almost all organisms, and are involved in different biological activities such as the colour change of human hair and the browning or blackening of fruit skin etc. In many invertebrates, defence reactions are linked to phenoloxidase activity and/or melanization. Contacts with foreign molecules are able to trigger the prophenoloxidase (proPO system that requires serine protease cleavage for activating the zymogen to phenoloxidase (PO. It is generally accepted that the proPO system is fully expressed in arthropods, and, recently, progress in the regulation of crustacean and insect proPO activation steps have been achieved. After cells were stimulated by components of pathogen associated molecular pattern (PAMP, proPO activation takes place via zimogenic serine proteinase in turn activated by PAMPs followed by cascade, spatial and temporal control.The proPO activating system plays a defensive role in arthropods, molluscs, annelids, ascidians and the cephalochordate Branchiostoma belcheri.In the present paper, we report on ascidian proPO system and related molecules, with particular focus on the biochemical, cellular and molecular aspects of the Ciona intestinalis, proPO system of circulating hemocytes from naïve ascidians as well as of body wall following LPS inflammatory challenge.

  11. An otx/nodal regulatory signature for posterior neural development in ascidians.

    Directory of Open Access Journals (Sweden)

    Agnès Roure

    2014-08-01

    Full Text Available In chordates, neural induction is the first step of a complex developmental process through which ectodermal cells acquire a neural identity. In ascidians, FGF-mediated neural induction occurs at the 32-cell stage in two blastomere pairs, precursors respectively of anterior and posterior neural tissue. We combined molecular embryology and cis-regulatory analysis to unveil in the ascidian Ciona intestinalis the remarkably simple proximal genetic network that controls posterior neural fate acquisition downstream of FGF. We report that the combined action of two direct FGF targets, the TGFβ factor Nodal, acting via Smad- and Fox-binding sites, and the transcription factor Otx suffices to trigger ascidian posterior neural tissue formation. Moreover, we found that this strategy is conserved in the distantly related ascidian Phallusia mammillata, in spite of extreme sequence divergence in the cis-regulatory sequences involved. Our results thus highlight that the modes of gene regulatory network evolution differ with the evolutionary scale considered. Within ascidians, developmental regulatory networks are remarkably robust to genome sequence divergence. Between ascidians and vertebrates, major fate determinants, such as Otx and Nodal, can be co-opted into different networks. Comparative developmental studies in ascidians with divergent genomes will thus uncover shared ascidian strategies, and contribute to a better understanding of the diversity of developmental strategies within chordates.

  12. A novel third complement component C3 gene of Ciona intestinalis expressed in the endoderm at the early developmental stages

    OpenAIRE

    Hibino, T.; Nonaka, M

    2013-01-01

    The third complement component (C3) in ascidian was reported to function as an opsonin to enhance phagocytosis and as a chemotactic factor for phagocytes, indicating that ascidian C3 works in mesodermal cavity as a humoral factor like vertebrate C3s. In the basal Eumetazoa, Cnidaria lacking mesodermal tissues, C3 was reported to work in an endodermal cavity. Evolution of structure and function of C3 is still to be clarified. Here we report the identification of the third C3 gene, CiC3-3, in t...

  13. ANISEED 2015: a digital framework for the comparative developmental biology of ascidians.

    Science.gov (United States)

    Brozovic, Matija; Martin, Cyril; Dantec, Christelle; Dauga, Delphine; Mendez, Mickaël; Simion, Paul; Percher, Madeline; Laporte, Baptiste; Scornavacca, Céline; Di Gregorio, Anna; Fujiwara, Shigeki; Gineste, Mathieu; Lowe, Elijah K; Piette, Jacques; Racioppi, Claudia; Ristoratore, Filomena; Sasakura, Yasunori; Takatori, Naohito; Brown, Titus C; Delsuc, Frédéric; Douzery, Emmanuel; Gissi, Carmela; McDougall, Alex; Nishida, Hiroki; Sawada, Hitoshi; Swalla, Billie J; Yasuo, Hitoyoshi; Lemaire, Patrick

    2016-01-01

    Ascidians belong to the tunicates, the sister group of vertebrates and are recognized model organisms in the field of embryonic development, regeneration and stem cells. ANISEED is the main information system in the field of ascidian developmental biology. This article reports the development of the system since its initial publication in 2010. Over the past five years, we refactored the system from an initial custom schema to an extended version of the Chado schema and redesigned all user and back end interfaces. This new architecture was used to improve and enrich the description of Ciona intestinalis embryonic development, based on an improved genome assembly and gene model set, refined functional gene annotation, and anatomical ontologies, and a new collection of full ORF cDNAs. The genomes of nine ascidian species have been sequenced since the release of the C. intestinalis genome. In ANISEED 2015, all nine new ascidian species can be explored via dedicated genome browsers, and searched by Blast. In addition, ANISEED provides full functional gene annotation, anatomical ontologies and some gene expression data for the six species with highest quality genomes. ANISEED is publicly available at: http://www.aniseed.cnrs.fr. PMID:26420834

  14. Genetic perspectives on the ascidian central nervous system

    Directory of Open Access Journals (Sweden)

    A Locascio

    2009-03-01

    Full Text Available In 2002, date of publication of the Ciona intestinalis genome, ascidians entered the post-genomic era. This tool had a fundamental role and has become the starting point for a series of new functional and genomic studies. Recently, great efforts have been done to characterize the genetic cascades of genes having a key role in early embryonic development and to draw the regulatory networks in which they are involved. In this review, we focused our attention on the last advances obtained in the attempt to clarify the complex molecular events governing ascidian central nervous system development with a special interest for anterior neural and sensory structures. We discussed the more recent theories on its early induction and late regionalization. In particular, we used some conserved genes fully or partially characterized as examples to compare ascidian and vertebrate central nervous system (CNS.By integrating the various results obtained with microarray, morpholino loss of function and promoter analyses, we showed that many progresses have been done to unravel the gene networks controlling early CNS induction and formation. Unfortunately, fewer advances have been done in the identification of the regulatory cascades controlling late CNS regionalization and sensory organs differentiation. Some results are discussed to point out the importance of fully characterizing also these specific regulatory cascades.

  15. Ordered expression pattern of Hox and ParaHox genes along the alimentary canal in the ascidian juvenile.

    Science.gov (United States)

    Nakayama, Satoshi; Satou, Kunihiro; Orito, Wataru; Ogasawara, Michio

    2016-07-01

    The Hox and ParaHox genes of bilateria share a similar expression pattern along the body axis and are known to be associated with anterior-posterior patterning. In vertebrates, the Hox genes are also expressed in presomitic mesoderm and gut endoderm and the ParaHox genes show a restricted expression pattern in the gut-related derivatives. Regional expression patterns in the embryonic central nervous system of the basal chordates amphioxus and ascidian have been reported; however, little is known about their endodermal expression in the alimentary canal. We focus on the Hox and ParaHox genes in the ascidian Ciona intestinalis and investigate the gene expression patterns in the juvenile, which shows morphological regionality in the alimentary canal. Gene expression analyses by using whole-mount in situ hybridization reveal that all Hox genes have a regional expression pattern along the alimentary canal. Expression of Hox1 to Hox4 is restricted to the posterior region of pharyngeal derivatives. Hox5 to Hox13 show an ordered expression pattern correlated with each Hox gene number along the postpharyngeal digestive tract. This expression pattern along the anterior-posterior axis has also been observed in Ciona ParaHox genes. Our observations suggest that ascidian Hox and ParaHox clusters are dispersed; however, the ordered expression patterns along the alimentary canal appear to be conserved among chordates. PMID:26837224

  16. Inverse correlation of population similarity and introduction date for invasive ascidians.

    Directory of Open Access Journals (Sweden)

    Nathan Silva

    Full Text Available The genomes of many marine invertebrates, including the purple sea urchin and the solitary ascidians Ciona intestinalis and Ciona savignyi, show exceptionally high levels of heterozygosity, implying that these populations are highly polymorphic. Analysis of the C. savignyi genome found little evidence to support an elevated mutation rate, but rather points to a large population size contributing to the polymorphism level. In the present study, the relative genetic polymorphism levels in sampled populations of ten different ascidian species were determined using a similarity index generated by AFLP analysis. The goal was to determine the range of polymorphism within the populations of different species, and to uncover factors that may contribute to the high level of polymorphism. We observe that, surprisingly, the levels of polymorphism within these species show a negative correlation with the reported age of invasive populations, and that closely related species show substantially different levels of genetic polymorphism. These findings show exceptions to the assumptions that invasive species start with a low level of genetic polymorphism that increases over time and that closely related species have similar levels of genetic polymorphism.

  17. Seeing chordate evolution through the Ciona genome sequence

    OpenAIRE

    Cañestro, Cristian; Bassham, Susan; Postlethwait, John H.

    2003-01-01

    A draft sequence of the compact genome of the sea squirt Ciona intestinalis, a non-vertebrate chordate that diverged very early from other chordates, including vertebrates, illuminates how chordates originated and how vertebrate developmental innovations evolved.

  18. Ultrastructural comparative analysis on the adhesive papillae of the swimming larvae of three ascidian species

    Directory of Open Access Journals (Sweden)

    G Dolcemascolo

    2009-03-01

    Full Text Available This paper presents a preliminary report on the papillae of the swimming larvae of three ascidian species: Ascidia malaca, Phallusia mammillata and Ciona intestinalis. The investigations, carried out at ultrastructural level and at confocal laser microscope, have evidenced, in the adhesive papillae of the three studied species, three different cell-types: axial columnar cells, collocytes, sensory cells respectively. The adhesive papillae of A. malaca and P. mammillata show central axial columnar cells with long microvilli emerging from the apical edge and extending throughout the hyaline cap. Collocytes are elongated secreting cells, lying in middle-lateral side. Sensory cells have a cilium at the apical side and an axon proceeding from the basal side. The adhesive papillae of C. intestinalis present some differences in the ultrastructure of the axial columnar cells, which bear a big digitiform protrusion, extending throughout the hyaline cap and a lot of microtubules along the cell axis. The investigations, carried out at confocal microscopy, have evidentiated a clear fluorescence in the papillae of the three studied species and a network of nervous fibers projecting from the papillar base up to cerebral vesicle of the cephalenteron. The characteristic of simple and coniforme type and the adhesive and sensorial functions of adhesive papillae of three ascidian species examined are confirmed.

  19. THALIACEANS, THE NEGLECTED PELAGIC RELATIVES OF ASCIDIANS: A DEVELOPMENTAL AND EVOLUTIONARY ENIGMA.

    Science.gov (United States)

    Piette, Jacques; Lemaire, Patrick

    2015-06-01

    Most developmental biologists equate tunicates to the sessile ascidians, including Ciona intestinalis, and the pelagic appendicularians, in particular Oikopleura dioica. However, there exists a third group of tunicates with a pelagic lifestyle, the thaliaceans, which include salps, pyrosomes, and doliolids. Although thaliaceans have raised the curiosity offamous zoologists since the 18th century, the difficulty of observing and experimentally manipulating them has led to many controversies and speculations about their life cycles and developmental strategies, the phylogenetic relationship within the group and with other tunicates, and the drivers of speciation in these widely distributed animals living in a seemingly uniform environment. Here, we take a historical perspective to summarize 250 years of work on this intriguing group of animals, and explore how modern genomics and imaging approaches are starting to solve fascinating evolutionary and developmental riddles. Recent molecular analyses support previous morphological evidence that ascidians are not monophyletic and that thaliaceans evolved from a sessile ascidian-like ancestor. In parallel, preliminary live-imaging and gene-expression data offer exciting entry points to understand how the adoption of a pelagic lifestyle led to drastic modifications in the morphology, embryology, and life cycle of these tunicates, compared to their sessile ancestor. PMID:26285352

  20. Tubular Heart Pumping Mechanisms in Ciona Intestinalis

    Science.gov (United States)

    Battista, Nicholas; Miller, Laura

    2015-11-01

    In vertebrate embryogenesis, the first organ to form is the heart, beginning as a primitive heart tube. However, many invertebrates have tubular hearts from infancy through adulthood. Heart tubes have been described as peristaltic and impedance pumps. Impedance pumping assumes a single actuation point of contraction, while traditional peristalsis assumes a traveling wave of actuation. In addition to differences in flow, this inherently implies differences in the conduction system. It is possible to transition from pumping mechanism to the other with a change in the diffusivity of the action potential. In this work we consider the coupling between the fluid dynamics and electrophysiology of both mechanisms, within a basal chordate, the tunicate. Using CFD with a neuro-mechanical model of tubular pumping, we discuss implications of the both mechanisms. Furthermore, we discuss the implications of the pumping mechanism on evolution and development.

  1. Two mannose-binding lectin homologues and an MBL-associated serine protease are expressed in the gut epithelia of the urochordate species Ciona intestinalis

    DEFF Research Database (Denmark)

    Skjødt, Mikkel-Ole; Palarasah, Yaseelan; Rasmussen, Karina Juhl;

    2010-01-01

    The lectin complement pathway has important functions in vertebrate host defence and accumulating evidence of primordial complement components trace its emergence to invertebrate phyla. We introduce two putative mannose-binding lectin homologues (CioMBLs) from the urochordate species Ciona intest...... protease in the epithelia cells lining the stomach and intestine. In conclusion we present two urochordate MBLs and identify an associated serine protease, which support the concept of an evolutionary ancient origin of the lectin complement pathway....

  2. Reprotoxicity of the Antifoulant Chlorothalonil in Ascidians: An Ecological Risk Assessment

    Science.gov (United States)

    Gallo, Alessandra; Tosti, Elisabetta

    2015-01-01

    Chlorothalonil is a widely used biocide in antifouling paint formulation that replaces tin-based compounds after their definitive ban. Although chlorothalonil inputs into the marine environment have significantly increased in recent years, little is known about its effect on marine animals and in particular on their reproductive processes. In this line, the aim of the present study was to investigate the effects of chlorothalonil exposure on the gamete physiology, fertilization rate and transmissible damage to offspring in the marine invertebrate Ciona intestinalis (ascidians). To identify a possible mechanism of action of chlorothalonil, electrophysiological techniques were used to study the impact on oocyte membrane excitability and on the electrical events occurring at fertilization. The pre-exposure of spermatozoa and oocytes to chlorothalonil did not affect the fertilization rate but caused damage to the offspring by inducing larval malformation. The highest toxicity was observed when fertilization was performed in chlorothalonil solutions with the lowest EC50 value. In particular, it was observed that low chlorothalonil concentrations interfered with embryo development and led to abnormal larvae, whereas high concentrations arrested embryo formation. In mature oocytes, a decrease in the amplitudes of the sodium and fertilization currents was observed, suggesting an involvement of plasma membrane ion currents in the teratogenic mechanism of chlorothalonil action. The risk estimation confirmed that the predicted no-effect concentration (PNEC) exceeded the predicted effect concentration (PEC), thus indicating that chlorothalonil may pose a risk to aquatic species. PMID:25875759

  3. Ascidian gene-expression profiles

    OpenAIRE

    William R Jeffery

    2002-01-01

    With the advent of gene-expression profiling, a large number of genes can now be investigated simultaneously during critical stages of development. This approach will be particularly informative in studies of ascidians, basal chordates whose genomes and embryology are uniquely suited for mapping developmental gene networks.

  4. 3D-printed microwell arrays for Ciona microinjection and timelapse imaging.

    Directory of Open Access Journals (Sweden)

    Clint Gregory

    Full Text Available Ascidians such as Ciona are close chordate relatives of the vertebrates with small, simple embryonic body plans and small, simple genomes. The tractable size of the embryo offers considerable advantages for in toto imaging and quantitative analysis of morphogenesis. For functional studies, Ciona eggs are considerably more challenging to microinject than the much larger eggs of other model organisms such as zebrafish and Xenopus. One of the key difficulties is in restraining the eggs so that the microinjection needle can be easily introduced and withdrawn. Here we develop and test a device to cast wells in agarose that are each sized to hold a single egg. This injection mold is fabricated by micro-resolution stereolithography with a grid of egg-sized posts that cast corresponding wells in agarose. This 3D printing technology allows the rapid and inexpensive testing of iteratively refined prototypes. In addition to their utility in microinjection, these grids of embryo-sized wells are also valuable for timelapse imaging of multiple embryos.

  5. Pneumatosis intestinalis after liver transplantation

    International Nuclear Information System (INIS)

    Purpose: To evaluate clinical features and CT findings of pneumatois intestinalis in recipients following liver transplantation and to determine whether certain clinical and CT findings enable differentiation of indolent pneumatois intestinalis from fulminant cases. Materials and methods: This retrospective study was approved by our institutional review board, with informed consent waived. Among 2080 liver transplantation recipients at our institution between January 1998 and April 2008, 22 (1%) presented with pneumatois intestinalis on postoperative follow-up. Patients were divided into recovery and mortality groups, and then clinical features and CT findings were compared between two groups. Results: Although indolent pneumatois intestinalis more frequently presented incidentally (61%) after 2 weeks of surgery (89%) than fulminant pneumatois intestinalis (0, 50%), there were no statistically significant differences (P = .14, .09). Right colon was affected in the recovery group without exception (n = 18,100%), and all four patients (100%) in mortality group showed small bowel involvement (P < .05). Caliber changes of superior mesenteric artery and vein in mortality group were significantly greater (49.6%, 67.0%) than those in recovery group (101.7%, 99.0%) (P < .05, respectively). Pneumatois intestinalis in mortality group more commonly accompanied portomesenteric air-embolism, visceral infarction, hemorrhagic ascites, and small bowel ileus than indolent counterpart (P < .05, respectively). Conclusion: Typical indolent pneumatois intestinalis is found incidentally later than 2 weeks of liver transplantation surgery, but there is some overlap between indolent and fulminant pneumatois intestinalis in terms of onset and mode of presentation. Among CT findings, grave signs are small bowel involvement, caliber changes in mesenteric vessels, portomesenteric air-embolism, visceral infarction, hemorrhagic ascites, and small bowel ileus.

  6. Functional Brachyury binding sites establish a temporal read-out of gene expression in the Ciona notochord.

    Directory of Open Access Journals (Sweden)

    Lavanya Katikala

    2013-10-01

    Full Text Available The appearance of the notochord represented a milestone in Deuterostome evolution. The notochord is necessary for the development of the chordate body plan and for the formation of the vertebral column and numerous organs. It is known that the transcription factor Brachyury is required for notochord formation in all chordates, and that it controls transcription of a large number of target genes. However, studies of the structure of the cis-regulatory modules (CRMs through which this control is exerted are complicated in vertebrates by the genomic complexity and the pan-mesodermal expression territory of Brachyury. We used the ascidian Ciona, in which the single-copy Brachyury is notochord-specific and CRMs are easily identifiable, to carry out a systematic characterization of Brachyury-downstream notochord CRMs. We found that Ciona Brachyury (Ci-Bra controls most of its targets directly, through non-palindromic binding sites that function either synergistically or individually to activate early- and middle-onset genes, respectively, while late-onset target CRMs are controlled indirectly, via transcriptional intermediaries. These results illustrate how a transcriptional regulator can efficiently shape a shallow gene regulatory network into a multi-tiered transcriptional output, and provide insights into the mechanisms that establish temporal read-outs of gene expression in a fast-developing chordate embryo.

  7. Arsenic (+3 oxidation state) methyltransferase and the methylation of arsenicals in the invertebrate chordate Ciona intestinalis

    Science.gov (United States)

    Biotransformation of inorganic arsenic (iAs) involves methylation catalyzed by arsenic (+3 oxidation state) methyltransferase (As3mt), yielding mono- , di- , and trimethylated arsenicals. To investigate the evolution of molecular mechanisms that mediate arsenic biotransformation,...

  8. Characterization of an individual neural crest-like cell lineage in the invertebrate chordate Ciona intestinalis

    OpenAIRE

    Cone, Angela C.

    2008-01-01

    During embryogenesis, all chordate embryos undergo neurulation to form a dorsal, hollow nerve cord. Neural crest cells (NCC), considered a vertebrate innovation, arise during neurulation and later differentiate into a multitude of tissues that account for much of the structural complexity that distinguishes craniates from invertebrate chordates [1, 2]. NCCs are induced and specified at the border of the neural and non-neural ectoderm by a complex network of inductive signals and transcription...

  9. Ecology of ascidians in the macrofouling community of New Mangalore Port

    Digital Repository Service at National Institute of Oceanography (India)

    Venkat, K.; Anil, A.C.; Khandeparker, D.C.; Mokashe, S.S.

    Ascidians constitute a major component of macrofouling community at the New Mangalore Port during the premonsoon season (February-May). The presence of ascidians in these waters is being reported for the first time. Ascidian recruitment...

  10. Conservation of Notochord Gene Expression Across Chordates: Insights From the Leprecan Gene Family

    OpenAIRE

    Capellini, Terence D.; Dunn, Matthew P.; Yale J Passamaneck; Selleri, Licia; Di Gregorio, Anna

    2008-01-01

    The notochord is a defining character of the chordates, and the T-box transcription factor Brachyury has been shown to be required for notochord development in all chordates examined. In the ascidian Ciona intestinalis, at least 44 notochord genes have been identified as bona fide transcriptional targets of Brachyury. We examined the embryonic expression of a subset of murine orthologs of Ciona Brachyury target genes in the notochord to assess its conservation throughout chordate evolution. W...

  11. Biophysical characterization of the fluorescent protein voltage probe VSFP2.3 based on the voltage-sensing domain of Ci-VSP

    DEFF Research Database (Denmark)

    Lundby, Alicia; Akemann, Walther; Knöpfel, Thomas

    2010-01-01

    A voltage sensitive phosphatase was discovered in the ascidian Ciona intestinalis. The phosphatase, Ci-VSP, contains a voltage-sensing domain homologous to those known from voltage-gated ion channels, but unlike ion channels, the voltage-sensing domain of Ci-VSP can reside in the cell membrane as...

  12. Biomixing generated by benthic filterfeeders: A diffusion model for near-bottom phytoplankton depletion

    DEFF Research Database (Denmark)

    Scheel Larsen, Poul; Riisgård, H.U.

    1997-01-01

    polychaete Nereis diversicolor and the ascidian Ciona intestinalis, respectively. The model is based on sinks located at inhalant openings and Fick's law with an effective diffusivity that decreases with distance above the bottom due to the biomixing generated by exhalant and inhalant feeding currents. For N...

  13. Ascidians from Rocas Atoll, northeast Brazil

    OpenAIRE

    Sandra Vieira Paiva; Ronaldo Ruy Oliveira-Filho; Tito Monteiro Da Cruz Lotufo

    2015-01-01

    Rocas Atoll is the only one of its kind in the South Atlantic—and the first Brazilian marine biological reserve. This is the first report about the ascidians from Rocas. A total of 12 species were found, 5 of them not hitherto described: Ascidia viridina sp. nov., Didemnum rochai sp. nov., Leptoclinides crocotulus sp. nov., Polysyncraton maurizeliae sp. nov., and Trididemnum rocasensis sp. nov.). One Caribbean species, Didemnum halimedae, was also discovered in the region for the first time. ...

  14. Ascidians from Rocas Atoll, northeast Brazil

    OpenAIRE

    Paiva, Sandra V.; Oliveira Filho, Ronaldo R. de; Lotufo, Tito M. da Cruz

    2015-01-01

    Rocas Atoll is the only one of its kind in the South Atlantic—and the first Brazilian marine biological reserve. This is the first report about the ascidians from Rocas. A total of 12 species were found, 5 of them not hitherto described: Ascidia viridina sp. nov., Didemnum rochai sp. nov., Leptoclinides crocotulus sp. nov., Polysyncraton maurizeliae sp. nov., and Trididemnum rocasensis sp. nov. One Caribbean species, Didemnum halimedae, was also discovered in the region for the first time. Fu...

  15. Giardia intestinalis and fecal fat analysis

    OpenAIRE

    ÜSTÜN, Şebnem; ORUÇ, Nevin; İLTER, Tankut

    2012-01-01

    Background and Aims: Malabsorption patients in whom fecal fat analysis was performed were also investigated for Giardia intestinalis. Materials and Methods: Fecal fat tests were studied in 75 malabsorption patients who had applied to the Gastroenterology Department of Ege University Medical Faculty in the period 2009-2010. In addition, stools were examined by parasitological methods in terms of Giardia intestinalis. Results: As a result of stool examination of 75 malabsorption cases, Giar...

  16. Amino Alcohols from the Ascidian Pseudodistoma sp.

    Directory of Open Access Journals (Sweden)

    Tae Hyung Won

    2014-06-01

    Full Text Available Seven new amino alcohol compounds, pseudoaminols A–G (1–7, were isolated from the ascidian Pseudodistoma sp. collected off the coast of Chuja-do, Korea. Structures of these new compounds were determined by analysis of the spectroscopic data and from chemical conversion. The presence of an N-carboxymethyl group in two of the new compounds (6 and 7 is unprecedented among amino alcohols. Several of these compounds exhibited moderate antimicrobial activity and cytotoxicity, as well as weak inhibitory activity toward Na+/K+-ATPase.

  17. A Maternal System Initiating the Zygotic Developmental Program through Combinatorial Repression in the Ascidian Embryo

    Science.gov (United States)

    Oda-Ishii, Izumi; Kubo, Atsushi; Kari, Willi; Suzuki, Nobuhiro; Rothbächer, Ute

    2016-01-01

    Maternal factors initiate the zygotic developmental program in animal embryos. In embryos of the chordate, Ciona intestinalis, three maternal factors—Gata.a, β-catenin, and Zic-r.a—are required to establish three domains of gene expression at the 16-cell stage; the animal hemisphere, vegetal hemisphere, and posterior vegetal domains. Here, we show how the maternal factors establish these domains. First, only β-catenin and its effector transcription factor, Tcf7, are required to establish the vegetal hemisphere domain. Second, genes specifically expressed in the posterior vegetal domain have additional repressive cis-elements that antagonize the activity of β-catenin/Tcf7. This antagonizing activity is suppressed by Zic-r.a, which is specifically localized in the posterior vegetal domain and binds to DNA indirectly through the interaction with Tcf7. Third, Gata.a directs specific gene expression in the animal hemisphere domain, because β-catenin/Tcf7 weakens the Gata.a-binding activity for target sites through a physical interaction in the vegetal cells. Thus, repressive regulation through protein-protein interactions among the maternal transcription factors is essential to establish the first distinct domains of gene expression in the chordate embryo. PMID:27152625

  18. Changes in gelsolin expression during ascidian metamorphosis.

    Science.gov (United States)

    Ohtsuka, Y; Okamura, Y; Obinata, T

    2001-05-01

    Gelsolin is an actin regulatory protein that is expressed in a wide variety of tissues and is especially abundant in muscle and blood cells. The role of gelsolin during structural reorganization of the body, such as during metamorphosis or regeneration, is poorly understood. We analyzed changes in gelsolin expression during ascidian embryogenesis and metamorphosis using nucleic acid probes and a monoclonal antibody (AS23) specific for ascidian gelsolin; our results indicated that gelsolin is maternally provided and that its de novo gene transcription is initiated during the neurula stage. In the larva, gelsolin was detectable in specific types of nerve cells, i.e. the adhesive papillae, motor neurons and epidermal sensory neurons. During metamorphosis, the expression of gelsolin changes markedly: the expression is suppressed in nerve tissues after tail resorption but is induced in mesodermal tissues. Gelsolin accumulated in mesenchyme cells until the onset of tail resorption, and following tail resorption, these cells migrated to the tunic and differentiated into tunic cells with many fine processes. Migration of the mesenchyme cells into the tunic was completely inhibited by treatment with cytochalasin B. Gelsolin was colocalized with actin in tunic cells, suggesting that it is involved in the rearrangement of actin filaments during cell locomotion or morphogenesis. PMID:11455440

  19. The central nervous system of ascidian larvae.

    Science.gov (United States)

    Hudson, Clare

    2016-09-01

    Ascidians are marine invertebrate chordates. Their tadpole larvae contain a dorsal tubular nervous system, resulting from the rolling up of a neural plate. Along the anterior-posterior (A-P) axis, the central nervous system (CNS) is organized into a sensory vesicle, neck, trunk ganglion, and tail nerve cord and consists of approximately only 330 cells, of which around 100 are thought to be neurons. The organization of distinct neuronal cell types and neurotransmitter gene expression within the CNS has been described. The unique developmental mode of ascidians, with a small number of cells and a fixed cell division pattern, allows individual cells to be traced throughout development. This feature has led to the complete documentation of the cell lineages of certain cell types in the CNS. Thus, a step-by-step understanding of nervous system development from the initial stages of neural induction to the neurogenesis of individual neurons is a feasible goal. The genetic control of neural fate induction and early neural plate patterning are now well understood. The molecular mechanisms specifying the cholinergic neurons of the trunk ganglion as well as the pigment cells of the sensory organs are also well elucidated. In addition, studies have begun on the morphogenetic processes of neurulation. Remaining challenges include building an embryonic atlas integrating gene expression patterns, cell lineage, and neuronal cell types as well as developing the gene regulatory networks of cell fate specification and integrating them with the genetic control of morphogenesis. WIREs Dev Biol 2016, 5:538-561. doi: 10.1002/wdev.239 For further resources related to this article, please visit the WIREs website. PMID:27328318

  20. Effetti dei biocidi rilasciati dalle vernici antivegetative (Tributil stagno e Diuron) sui meccanismi riproduttivi dell’invertebrato marino Ciona Intestinalis

    OpenAIRE

    Gallo, Alessandra

    2013-01-01

    La riproduzione è il processo biologico con cui un organismo vivente dà origine ad uno o più discendenti garantendo la conservazione della specie. Negli organismi marini a fecondazione esterna gli spermatozoi, gli ovociti e gli embrioni possono essere esposti ad inquinanti ambientali provenienti da attività antropiche che ne possono alterare le funzioni fisiologiche con conseguente riduzione del successo riproduttivo. La membrana plasmatica delle cellule è caratterizzata da proprietà elet...

  1. A Patient Suffering from Pneumatosis Cystoid Intestinalis

    Directory of Open Access Journals (Sweden)

    Mahmoud Aghaei-Afshar

    2012-04-01

    Full Text Available Pneumatosis Cystoid Intestinalis (PCI is a relatively rare disorder that occurs in different parts of the stomach and intestines as gas-filled cysts. It is predicted to be prevalent among 0/2- 0/03% of the population. In 85% of cases, Pneumatosis Cystoid Intestinalis is caused by a specific disease. In this article, a patient will be introduced who was admitted 3 days after the pelvic trauma presented with symptoms of intestinal obstruction. The conducted examinations showed generalized abdominal tenderness and in CXR plenty of free air was observed under the diaphragm. After the primary diagnosis of intestinal obstruction (ileus, the patient was put under laparotomy. During laparotomy, PCI was seen under the intestinal serosa and a significant amount of air was released and many parts of contusion were observed in the small intestine along with fibrin formation without pus which was restored and the patient was discharged in a well general condition.

  2. Pneumatosis intestinalis associated with enteral tube feeding

    OpenAIRE

    Zorgdrager, Marcel; Pol, Robert

    2013-01-01

    A 49-year-old man presented with a Hinchey II perforated diverticulitis and underwent laparoscopic peritoneal lavage. During the postoperative course the patient received enteral tube feeding which was followed by a bowel obstruction accompanied with pneumatosis intestinalis (PI). Explorative laparotomy showed an omental band adhesion without signs of ischaemia. After a short period of total parenteral nutrition PI resolved almost completely and enteral tube feeding could be continued once ag...

  3. Pneumatosis intestinalis related to cytomegalo virus infection - a new etiology?

    International Nuclear Information System (INIS)

    Five patients who developed pneumatosis intestinalis in the course of a cytomegalo virus (CMV) infection after cadaveric kidney transplantation are described. Based on the fact that CMV is known to cause intestinal ulcers, we postulate a causal relationship between CMV and pneumatosis intestinalis. (orig.)

  4. Ascidians and the plasticity of the chordate developmental program

    OpenAIRE

    Lemaire, Patrick; Smith, William C.; Nishida, Hiroki

    2008-01-01

    Little is known about the ancient chordates that gave rise to the first vertebrates, but the descendants of other invertebrate chordates extant at the time still flourish in the ocean. These invertebrates include the cephalochordates and tunicates, whose larvae share with vertebrate embryos a common body plan with a central notochord and a dorsal nerve cord. Tunicates are now thought to be the sister group of vertebrates. However, research based on several species of ascidians, a diverse and ...

  5. Geographic ranges of ascidians from Antarctica and the southeastern Pacific

    Institute of Scientific and Technical Information of China (English)

    Dirk Schories; Karen Sanamyan; Nadja Sanamyan; Mara Jos Daz; Ignacio Garrido; Thomas Heran; Jorge Holtheuer; Gesche Kohlberg

    2015-01-01

    Historical and novel data on the geographic and bathymetric distribution of ascidians from Antarctic, Magellan and Chilean waters are compiled, and an inventory of taxa comprising 162 species reported over a 150 year period from the Antarctic region South Polar Province (SPP) compiled. The ascidian fauna from the South Shetland Islands (SSI) is compared with that of the Magellan region, Patagonia and the Chilean coast. We collected 46 ascidian species along the Chilean coast, and during four expeditions to King George Island (SSI) by SCUBA between 2003–2012. About 15% of King George Island (SSI) species are observed to occur also in shallow waters of southern Chile (SCL). Few species known from warm temperate southeastern Pacific (Northern Chile, NCL) waters are absent from the Chilean part of the Magellan Province (SCL). With most data contributed from the Chilean coast coming from the SCL, and with limited sampling having been undertaken at depths exceeding 100 m in the NCL, apparent differences in species richness along the Chilean coast could be attributabed to differential sampling effort. We detail 12 species from our Antarctic and Chilean collections in detail, including one, Diplosoma listerianum, not previously reported from Chilean waters, and the genus Botryllus, previously known from them on the basis of a single record.

  6. Giardia intestinalis Assemblages A and B Infections in Nepal

    OpenAIRE

    Singh, Anjana; Janaki, Lalitha; Petri, William A.; Houpt, Eric R.

    2009-01-01

    Giardia intestinalis is comprised of two major genotypes, A and B, which may vary in their propensity to cause disease. We tested for the presence of these two genotypes in stool samples from patients with gastrointestinal symptoms in Nepal. A total of 1,096 clinical specimens were screened by microscopy, and 45 samples with G. intestinalis were identified. Giardia infection was confirmed in 35 of 45 samples by a Giardia specific real-time polymerase chain reaction (PCR) assay. Genotyping of ...

  7. Pneumatosis Cystoides Intestinalis: A Rare Benign Cause of Pneumoperitoneum

    Directory of Open Access Journals (Sweden)

    Puneet Devgun

    2013-01-01

    Full Text Available Pneumatosis cystoides intestinalis is a rare gastrointestinal complication in the course of connective tissue diseases, especially in scleroderma, that can lead to pneumoperitoneum or obstruction. Findings on plain radiography may reveal radiolucent linear or bubbly circular air bubbles in the bowel wall, with or without free gas accumulation in the peritoneal cavity. Treatment of pneumatosis cystoides intestinalis ranges from supportive care to laparotomy.

  8. UV irradiation responses in Giardia intestinalis.

    Science.gov (United States)

    Einarsson, Elin; Svärd, Staffan G; Troell, Karin

    2015-07-01

    The response to ultraviolet light (UV) radiation, a natural stressor to the intestinal protozoan parasite Giardia intestinalis, was studied to deepen the understanding of how the surrounding environment affects the parasite during transmission. UV radiation at 10 mJ/cm(2) kills Giardia cysts effectively whereas trophozoites and encysting parasites can recover from UV treatment at 100 mJ/cm(2) and 50 mJ/cm(2) respectively. Staining for phosphorylated histone H2A showed that UV treatment induces double-stranded DNA breaks and flow cytometry analyses revealed that UV treatment of trophozoites induces DNA replication arrest. Active DNA replication coupled to DNA repair could be an explanation to why UV light does not kill trophozoites and encysting cells as efficiently as the non-replicating cysts. We also examined UV-induced gene expression responses in both trophozoites and cysts using RNA sequencing (RNA seq). UV radiation induces small overall changes in gene expression in Giardia but cysts show a stronger response than trophozoites. Heat shock proteins, kinesins and Nek kinases are up-regulated, whereas alpha-giardins and histones are down-regulated in UV treated trophozoites. Expression of variable surface proteins (VSPs) is changed in both trophozoites and cysts. Our data show that Giardia cysts have limited ability to repair UV-induced damage and this may have implications for drinking- and waste-water treatment when setting criteria for the use of UV disinfection to ensure safe water. PMID:25825252

  9. Cytometric Approach for Detection of Encephalitozoon intestinalis, an Emergent Agent▿

    Science.gov (United States)

    Barbosa, Joana; Rodrigues, Acácio Gonçalves; Pina-Vaz, Cidália

    2009-01-01

    Encephalitozoon intestinalis is responsible for intestinal disease in patients with AIDS and immunocompetent patients. The infectious form is a small spore that is resistant to water treatment procedures. Its detection is very important, but detection is very cumbersome and time-consuming. Our main objective was to develop and optimize a specific flow cytometric (FC) protocol for the detection of E. intestinalis in hospital tap water and human feces. To determine the optimal specific antibody (Microspor-FA) concentration, a known concentration of E. intestinalis spores (Waterborne, Inc.) was suspended in hospital tap water and stool specimens with different concentrations of Microspor-FA, and the tap water and stool specimens were incubated under different conditions. The sensitivity limit and specificity were also evaluated. To study spore infectivity, double staining with propidium iodide (PI) and Microspor-FA was undertaken. Distinct approaches for filtration and centrifugation of the stool specimens were used. E. intestinalis spores stained with 10 μg/ml of Microspor-FA at 25°C overnight provided the best results. The detection limit was 5 × 104 spores/ml, and good specificity was demonstrated. Simultaneous staining with Microspor-FA and PI ensured that the E. intestinalis spores were dead and therefore noninfectious. With the stool specimens, better spore recovery was observed with a saturated solution of NaCl and centrifugation at 1,500 × g for 15 min. A new approach for the detection of E. intestinalis from tap water or human feces that ensures that the spores are not viable is now available and represents an important step for the prevention of this threat to public health. PMID:19439525

  10. Endozoicomonas Are Specific, Facultative Symbionts of Sea Squirts

    Science.gov (United States)

    Schreiber, Lars; Kjeldsen, Kasper U.; Funch, Peter; Jensen, Jeppe; Obst, Matthias; López-Legentil, Susanna; Schramm, Andreas

    2016-01-01

    Ascidians are marine filter feeders and harbor diverse microbiota that can exhibit a high degree of host-specificity. Pharyngeal samples of Scandinavian and Mediterranean ascidians were screened for consistently associated bacteria by culture-dependent and -independent approaches. Representatives of the Endozoicomonas (Gammaproteobacteria, Hahellaceae) clade were detected in the ascidian species Ascidiella aspersa, Ascidiella scabra, Botryllus schlosseri, Ciona intestinalis, Styela clava, and multiple Ascidia/Ascidiella spp. In total, Endozoicomonas was detected in more than half of all specimens screened, and in 25–100% of the specimens for each species. The retrieved Endozoicomonas 16S rRNA gene sequences formed an ascidian-specific subclade, whose members were detected by fluorescence in situ hybridization (FISH) as extracellular microcolonies in the pharynx. Two strains of the ascidian-specific Endozoicomonas subclade were isolated in pure culture and characterized. Both strains are chemoorganoheterotrophs and grow on mucin (a mucus glycoprotein). The strains tested negative for cytotoxic or antibacterial activity. Based on these observations, we propose ascidian-associated Endozoicomonas to be commensals, living off the mucus continuously secreted into the pharynx. Members of the ascidian-specific Endozoicomonas subclade were also detected in seawater from the Scandinavian sampling site, which suggests acquisition of the symbionts by horizontal transmission. The combined results indicate a host-specific, yet facultative symbiosis between ascidians and Endozoicomonas. PMID:27462299

  11. Genotypizace izolátů Giardia intestinalis

    OpenAIRE

    ŠRÁMOVÁ, Eliška

    2009-01-01

    The aim of this work was assemble isolates of Giardia intestinalis from humans and other mammals. Stools samples were examined for presence of cysts by concentration settling method. Consequently sequencing of 532 bp parts of the TPI gene after previous amplification by the nested PCR was performed. In vitro cultures of selected isolates were established using experimental model hosts, gerbils.

  12. Antibacterial modified diketopiperazines from two ascidians of the genus Didemnum

    Energy Technology Data Exchange (ETDEWEB)

    Kossuga, Miriam H.; Lira, Simone P.; McHugh, Shayna; Torres, Yohandra R.; Berlinck, Roberto G.S. [Universidade de Sao Paulo (USP), Sao Carlos, SP (Brazil). Inst. de Quimica; Lima, Bruna A.; Goncalves, Reginaldo [Universidade Estadual de Campinas, Piracicaba, SP (Brazil). Faculdade de Odontologia. Dept. de Diagnostico Oral; Veloso, Katyuscya; Ferreira, Antonio G. [Universidade Federal de Sao Carlos, SP (Brazil). Dept. de Quimica; Rocha, Rosana M. [Universidade Federal do Parana (UFPR), Curitiba, PR (Brazil). Centro Politecnico. Setor de Ciencias Biologicas. Dept. de Zoologia

    2009-07-01

    The chemical investigation of the crude extract of an ascidian of the genus Didemnum led to the isolation of the modified diketopiperazine rodriguesines A (1) and (2) as a mixture of homologues, which could be identified by analysis of spectroscopic data including MS/MS experiments. The investigation of a second Didemnum sp. led to the isolation of N-acetyl-rodriguesine A (3) and N-acetyl-rodriguesine B (4). The absolute configuration of compounds 1 and 2 could be established by hydrolysis and Marfey's analysis and comparison with literature data reported for compound 3, previously obtained as a synthetic product. The mixture of 1 and 2 displayed moderate antibiotic activity against a clinical isolate of Streptococcus mutans and against S. mutans UA159 and Staphylococcus aureus ATCC6538. (author)

  13. Nutritional Status of Preschool Children Infected With Giardia Intestinalis

    Directory of Open Access Journals (Sweden)

    SM Sadjjadi

    2005-09-01

    Full Text Available Giardia intestinalis is the most common intestinal parasite in human worldwide. It can produce a wide spectrum of clinical manifestations. In order to assess the nutritional status of preschool children infected with Giardia intestinalis, a cross sectional study was made in Marvdasht city, Fars Province, Southern Iran. A total of 337 preschool boys and girls aged 3-6 years were randomly selected for stool examination of intestinal parasites as well as measurement of height, weight, head and arm circumferences. A total of 77 individuals were infected with G. intestinalis. Seventy-one individuals who had only G. intestinalis and 229 with no parasitic infections were selected as infected and control groups, respectively. Z-Score of -2SD was used as cut off point of malnutrition. A total of 9 (12.7% of infected children and 18 (7.9% of non infected individuals had a height for age Z-score (HAZ below -2SD. Eight (11.3% of former group had a weight for age Z-score (WAZ under-2SD. In control group 4.4% of preschool children had WAZ under-2SD. 4.2% of infected children had a weight for height Z-score (WHZ under-2SD but none of the controls had it. Statistical analysis showed a significant difference in height, weight, head circumference, HAZ, and WAZ between infected and control children (P<0.05. Also, HAZ and WAZ, was significantly different between these two groups, but not for WHZ. A higher infection with G. intestinalis in the children with lower parents’ education was observed. However the distribution of malnutrition was not significantly different between boys and girls. In conclusion the present study indicated that giardiasis retarded growth of preschool children in this region.

  14. Immune response in spirlins (Alburnoides bipunctatus, Bloch 1782) infested by Ligula intestinalis parasite

    OpenAIRE

    Mostafa Halimi; Abasalt Hosseinzadeh Colagar; Mohammad Reza Youssefi

    2014-01-01

    Ligula intestinalis parasite is a cestode that can cause remarkable damages to fishes. SDS-PAGE is one of the methods that can be used to determine the immune serum band polymorphism and immune responses in fishes infested by Ligula intestinalis. This study reports the results of an investigation conducted using SDS-PAGE focusing on immune serum band polymorphism and on the reaction of the immune system in spirlins (Alburnoides bipunctatus) infested by pleurocercoids of Ligula intestinalis pa...

  15. Antioxidant defence systems in the protozoan pathogen Giardia intestinalis.

    Science.gov (United States)

    Mastronicola, Daniela; Falabella, Micol; Forte, Elena; Testa, Fabrizio; Sarti, Paolo; Giuffrè, Alessandro

    2016-01-01

    The microaerophilic protist Giardia intestinalis is the causative agent of giardiasis, one of the most common intestinal infectious diseases worldwide. The pathogen lacks not only respiratory terminal oxidases (being amitochondriate), but also several conventional antioxidant enzymes, including catalase, superoxide dismutase and glutathione peroxidase. In spite of this, since living attached to the mucosa of the proximal small intestine, the parasite should rely on an efficient antioxidant system to survive the oxidative and nitrosative stress conditions found in this tract of the human gut. Here, we review current knowledge on the antioxidant defence systems in G. intestinalis, focusing on the progress made over the last decade in the field. The relevance of this research and future perspectives are discussed. PMID:26672398

  16. Pneumatosis intestinalis and laparoscopic exploration: beware of gas explosion.

    Science.gov (United States)

    Hong, Kwang Dae; Lee, Sun Il; Moon, Hong Young

    2012-04-01

    Colonic gas explosion, although rare, is sometimes a fatal iatrogenic complication in endoscopic procedures or laparotomic surgery, but it has not been reported during port incision of laparoscopy. We report a case of gas detonation in a patient with pneumatosis intestinalis and pneumoperitoneum, on opening the peritoneum with a diathermy for umbilical trocar insertion. Based on our experience, in cases of pneumoperitoneum, surgeons need to avoid using a diathermy in opening the peritoneum. PMID:22288881

  17. Colony specificity and chemotaxis in the compound ascidian Botryllus schlosseri.

    Science.gov (United States)

    Cima, Francesca; Sabbadin, Armando; Zaniolo, Giovanna; Ballarin, Loriano

    2006-11-01

    We re-investigated the behavior of hemocytes during the non-fusion (rejection) reaction between genetically incompatible colonies of the ascidian Botryllus schlosseri. In the course of the reaction, hemocytes - mainly morula cells - crowd inside the blind ends of marginal vascular vessels (known as ampullae) of the colonial leading edge (LE) facing the foreign colony which suggests the occurrence of chemotactic attraction of circulating hemocytes towards the ampullar lumen. Then, cells migrate, through the ampullar tips, into the partially fused tunics and contribute to the formation of the necrotic spots along the contact borders which characterize the reaction. Studies on histological sections clearly indicate that, although morula cell concentration is always higher in ampullae of the LE than in those of the lateral (L) part of the colony, their frequency significantly increases in LE ampullae of rejecting colonies with respect to LE ampullae of both fusing and isolated colonies. In addition, in vitro chemotaxis experiments demonstrated that blood plasma from incompatible colonies can stimulate morula cell migration through polycarbonate filters and this passage is inhibited by antibodies raised against mammalian pro-inflammatory cytokines. The possible nature and role of molecules recognized by anti-cytokine antibodies in hemocyte migration are discussed. PMID:16962802

  18. Pneumatosis Intestinalis of the Small Bowel; Radiological and Intra-operative findings

    OpenAIRE

    Light D; Robinson A; Hennessy C

    2010-01-01

    Pneumatosis Intestinalis is defined as the infiltration of gas into the bowel wall. It is a radiological and intra-operative finding of varying aetiology which varies from benign to life threatening conditions. We describe here a case of a 67 year old woman who presented with diffuse abdominal pain and was found to have Pneumatosis Intestinalis.

  19. Immunobiology of compound ascidians, with particular reference to Botryllus schlosseri: state of art

    Directory of Open Access Journals (Sweden)

    L Ballarin

    2008-05-01

    Full Text Available The phylogenetic position of invertebrate chordates closely related to vertebrates explains the increasing interest towards tunicate immunobiology. Most of the tunicates are ascidians which, like all other invertebrates, rely only on innate immunity for their defense. Compound ascidians differ from solitary species for the presence of colony specificity, i.e. the ability for intraspecific non-self recognition. The immunobiology of compound ascidians has been particularly studied in Botryllus schlosseri, which is an emerging model organism for this kind of studies. In B. schlosseri and related species, immunocytes are represented by phagocytes and cytotoxic morula cells, the former able to ingest foreign cell and particles, the latter representing the effectors of the inflammatory reaction which follows the contact between genetically incompatible colonies. Activated phagocytes release lectins with opsonic activity and are involved in the clearance of apoptotic cells during the colonial generational change. Morula cells recognize the presence of foreign molecules as well as allogeneic soluble factors diffusing from an alien colony and as a consequence they: i release cytokines in the medium which have chemotactic activity and activate phagocytes; ii degranulate and release phenoloxidase which induces necrotic cell death by oxidative stress. A better knowledge of Botryllus genome will allow a deeper insight into open problems in immunobiology of compound ascidians.

  20. Quinone and Hydroquinone Metabolites from the Ascidians of the Genus Aplidium

    OpenAIRE

    Camila Spereta Bertanha; Ana Helena Januário; Tavane Aparecida Alvarenga; Letícia Pereira Pimenta; Silva, Márcio Luis Andrade e; Wilson Roberto Cunha; Patrícia Mendonça Pauletti

    2014-01-01

    Ascidians of the genus Aplidium are recognized as an important source of chemical diversity and bioactive natural products. Among the compounds produced by this genus are non-nitrogenous metabolites, mainly prenylated quinones and hydroquinones. This review discusses the isolation, structural elucidation, and biological activities of quinones, hydroquinones, rossinones, longithorones, longithorols, floresolides, scabellones, conicaquinones, aplidinones, thiaplidiaquinones, and conithiaquinone...

  1. Modiolarca lateralis (Pteryomorphia: Mytilidae: bivalve associated to six species of ascidians from Bocas del Toro, Panama

    Directory of Open Access Journals (Sweden)

    Juan I Cañete

    2013-11-01

    Full Text Available We describe the presence of the bivalve Modiolarca lateralis (Say, 1822 in six tropical ascidians Ascidia curvata, A. sydneiensis, A. panamensis, A. interrupta, Herdmania pallida and Polycarpa spongiabilis collected at depths of 1-3 m on coral reefs, mangrove roots and dock supports in Almirante Bay, Bocas del Toro, Panama (9°18'N, 82°13'W during June-July 2011. Bivalve prevalence varied between 9-30% across species, but was mainly associated with A. panamensis, P. spongiabilis and A. interrupta. Prevalence seems to be influenced by tunic thickness rather than by the ascidian size. Bivalves varied in size (0.6-11 mm shell length, with the smallest individual found in A. sydneiensis. There were only one or two bivalves per ascidians, although a maximum of 18 was found in one A. panamensis. M. lateralis seems to behave similarly to its temperate counterparts: it has a variety of hosts, occurs mainly in the anterior region of the ascidians, and has a variable abundance per host.

  2. An approach to pneumatosis intestinalis: Factors affecting your management.

    Science.gov (United States)

    Tahiri, Mehdi; Levy, Jordan; Alzaid, Saud; Anderson, Dawn

    2015-01-01

    Pneumatosis Intestinalis (PI) is defined as the presence of extra-luminal gas confined to the bowel wall. PI is an ominous condition often requiring emergent surgery. The management can be challenging in some circumstances, as the choice of surgery versus medical treatment can be difficult. In this study, we first report the case of a seventy-seven year old woman presenting to the emergency department with the presence of PI on computed tomography of the abdomen. Secondly, we review the existing literature regarding the management of PI and we suggest a treatment algorithm based on clinical, laboratory and radiological findings. PMID:25531306

  3. AN ATTEMPT TO UNRAVEL FEATURES OF PNEUMATOSIS CYSTOIDES INTESTINALIS

    Directory of Open Access Journals (Sweden)

    Sunil Kumar

    2014-03-01

    Full Text Available Pneumatosis cystoides intestinalis (PCI is a rare disease characterized by presence of multiple gas filled cysts in subserosal or submucosal wall of large intestine or small intestine. PCI are most commonly due to an underlying disease or can be idiopathic. Understanding of etiology and pathogenesis is necessary in each individual case for appropriate management. Thirty eight enteral resected specimens were studied from January 2008 to September 2011 in PESIMSR. Clinical and morphological characteristics of the 3 cases with histological diagnosis of PCI found, were studied and compared with other studies

  4. mRNA 5′-leader trans-splicing in the chordates

    OpenAIRE

    Vandenberghe, Amanda E.; Meedel, Thomas H.; Hastings, Kenneth E.M.

    2001-01-01

    We report the discovery of mRNA 5′-leader trans-splicing (SL trans-splicing) in the chordates. In the ascidian protochordate Ciona intestinalis, the mRNAs of at least seven genes undergo trans-splicing of a 16-nucleotide 5′-leader apparently derived from a 46-nucleotide RNA that shares features with previously characterized splice donor SL RNAs. SL trans-splicing was known previously to occur in several protist and metazoan phyla, however, this is the first report of SL trans-splicing within ...

  5. Etude comparative des conditions environnementales potentiellement limitantes dans l'etablissement d'une espece aquatique envahissante Clona intestinalis (Linnaeus, 1767) dans deux systemes de bassins versants a l'ile-du Prince-Edouard, Canada

    Science.gov (United States)

    Mclaughlin, Janelle

    rate, larval establishment and survival of juvenile tunicates. All these elements can potentially be key factors on limiting the establishment of a population of C. intestinalis in the Orwell Bay aquatic system. Keywords: Invasive species, watershed, biogeography, tunicate, Ciona intestinalis, universal soil loss equation, hydrodynamic modeling, correspondence analysis, turbidity, environmental tolerance.

  6. Pneumatosis cystoides intestinalis after fluorouracil chemotherapy for rectal cancer

    Institute of Scientific and Technical Information of China (English)

    Kenji Mimatsu; Takatsugu Oida; Atsushi Kawasaki; Hisao Kano; Youichi Kuboi; Osamu Aramaki; Sadao Amano

    2008-01-01

    Pneumatosis cystoides intestinalis (PCI) is a relatively rare condition characterized by intraluminal gas in the gastrointestinal tract.Several chemotherapeutic agents have been reported to be associated with PCI,although fluorouracil-related PCI is extremely rare.We report a case of a 76-year old man who received adjuvant chemotherapy for rectal cancer with fluorouracil (FU) and leucovorin (LV).After 1 cycle of the treatment,he presented with diarrhea and abdominal pain.Abdominal radiogram revealed the presence of free air under the diaphragm and intramural gas in the intestine.Laparotomy was performed,showing a suspected diagnosis of perforation in the gastrointestinal tract.Intraoperative findings revealed penumatosis of the intestine without evidence of perforation.He was treated supportively and his symptoms improved.In conclusion,we should consider the possibility of PCI occurring in patients with malignancies during chemotherapy treatment.

  7. Detection and genotyping of Giardia intestinalis isolates using intergenic spacer (IGS)-based PCR

    OpenAIRE

    Lee, Jong-Ho; Lee, Jongweon; Park, Soon-Jung; Yong, Tai-Soon; Hwang, Ui-Wook

    2006-01-01

    Giardia intestinalis infections arise primarily from contaminated food or water. Zoonotic transmission is possible, and at least 7 major assemblages including 2 assemblages recovered from humans have been identified. The determination of the genotype of G. intestinalis is useful not only for assessing the correlation of clinical symptoms and genotypes, but also for finding the infection route and its causative agent in epidemiological studies. In this study, methods to identify the genotypes ...

  8. When shape matters: strategies of different Antarctic ascidians morphotypes to deal with sedimentation.

    Science.gov (United States)

    Torre, Luciana; Abele, Doris; Lagger, Cristian; Momo, Fernando; Sahade, Ricardo

    2014-08-01

    Climate change leads to increased melting of tidewater glaciers in the Western Antarctic Peninsula region and sediment bearing glacial melt waters negatively affects filter feeding species as solitary ascidians. In previous work the erect-forms Molgula pedunculata and Cnemidocarpa verrucosa (Order Stolidobranchiata) appeared more sensitive than the flat form Ascidia challengeri (Order Phlebobranchiata). Sedimentation exposure is expected to induce up-regulation of anaerobic metabolism by obstructing the organs of gas exchange (environmental hypoxia) or causes enhanced squirting activity (functional hypoxia). In this study we evaluated the possible relationship between ascidian morphotype and their physiological response to sedimentation. Together with some behavioural observations, we analysed the response of anaerobic metabolic parameters (lactate formation and glycogen consumption) in different tissues of three Antarctic ascidians, exposed to high sediment concentrations (200 mgL(-1)). The results were compared to experimental hypoxia (10% pO2) and exercise (induced muscular contraction) effects, in order to discriminate the effect of sediment on each species and morpho-type (erect vs. flat forms). Our results suggest that the styled (erect) C. verrucosa increases muscular squirting activity in order to expulse excessive material, while the flat-form A. challengeri reacts more passively by down-regulating its aerobic metabolism under sediment exposure. Contrary, the erect ascidian M. pedunculata did not show any measurable response to the treatments, indicating that filtration and ingestion activities were not reduced or altered even under high sedimentation (low energetic material) which could be disadvantageous on the long-term and could explain why M. pedunculata densities decline in the study area. PMID:24986145

  9. Quinone and Hydroquinone Metabolites from the Ascidians of the Genus Aplidium

    Directory of Open Access Journals (Sweden)

    Camila Spereta Bertanha

    2014-06-01

    Full Text Available Ascidians of the genus Aplidium are recognized as an important source of chemical diversity and bioactive natural products. Among the compounds produced by this genus are non-nitrogenous metabolites, mainly prenylated quinones and hydroquinones. This review discusses the isolation, structural elucidation, and biological activities of quinones, hydroquinones, rossinones, longithorones, longithorols, floresolides, scabellones, conicaquinones, aplidinones, thiaplidiaquinones, and conithiaquinones. A compilation of the 13C-NMR spectral data of these compounds is also presented.

  10. Quinone and hydroquinone metabolites from the ascidians of the genus Aplidium.

    Science.gov (United States)

    Bertanha, Camila Spereta; Januário, Ana Helena; Alvarenga, Tavane Aparecida; Pimenta, Letícia Pereira; Silva, Márcio Luis Andrade E; Cunha, Wilson Roberto; Pauletti, Patrícia Mendonça

    2014-06-01

    Ascidians of the genus Aplidium are recognized as an important source of chemical diversity and bioactive natural products. Among the compounds produced by this genus are non-nitrogenous metabolites, mainly prenylated quinones and hydroquinones. This review discusses the isolation, structural elucidation, and biological activities of quinones, hydroquinones, rossinones, longithorones, longithorols, floresolides, scabellones, conicaquinones, aplidinones, thiaplidiaquinones, and conithiaquinones. A compilation of the 13C-NMR spectral data of these compounds is also presented. PMID:24927227

  11. Distribution and Localised Effects of the Invasive Ascidian Didemnum perlucidum (Monniot 1983) in an Urban Estuary.

    Science.gov (United States)

    Simpson, Tiffany Schenk; Wernberg, Thomas; McDonald, Justin I

    2016-01-01

    Didemnid ascidians are notorious marine invaders, fouling infrastructure in many ecosystems globally. However, there have been few reports of direct interactions with native species in their natural environment. The invasive colonial ascidian Didemnum perlucidum was discovered in the Swan River estuary (Western Australia) growing on the native seagrass Halophila ovalis. Given the known effects of other related Didemnum species it was expected that D. perlucidum could adversely affect the seagrass, with possible flow on effects to the rest of the ecosystem. This study aimed to document the distribution and abundance of D. perlucidum in the estuary, and to determine whether this species had a negative impact on H. ovalis or associated flora and fauna. D. perlucidum was largely present near areas of infrastructure, particularly mooring buoys, suggesting these were the source of D. perlucidum recruits on the seagrasses. It showed a clear seasonal pattern in abundance, with highly variable cover and colony size. D. perlucidum had a measurable effect on H. ovalis, with colonies enveloping all plant tissue, likely restricting the photosynthetic ability of individual leaves and total plant biomass. There were also significantly less seagrass-associated mud snails (Batillaria australis) where D. perlucidum cover was high. These results demonstrate the ability of invasive ascidians to colonise and affect native seagrasses and associated biota. Seagrasses are pivotal to the ecological function of many urban estuaries world-wide. Biodiversity in these systems is already vulnerable to multiple stressors from human activities but the potential stress of fouling ascidians may pose an additional and increasing threat in the future. PMID:27144600

  12. Ultrastructures and Classification of Circulating Hemocytes in 9 Botryllid Ascidians (Chordata: Ascidiacea)

    OpenAIRE

    Hirose, Euichi; Shirae, Maki; Saito, Yasunori

    2003-01-01

    Ultrastructures of circulating hemocytes were studied in 9 botryllid ascidians. The hemocytes are classified into five types: hemoblasts, phagocytes, granulocytes, morula cells, and pigment cells. These five types are always found in the 9 species. They should represent the major hemocyte types of the circulating cells in the blood. Hemoblasts are small hemocytes having a high nucleus/cytoplasm ratio. There are few granular or vacuolar inclusions in the cytoplasm. Phagocytes have phagocytic a...

  13. Solitary ascidians embryos (Chordata, Tunicata) as model organisms for testing coastal pollutant toxicity

    OpenAIRE

    G Zega; R. Pennati; S Candiani; M Pestarino; Bernardi, F

    2009-01-01

    Marine coastal communities are daily exposed to several chemical compounds commonly used in agriculture and industrial activities. Therefore, toxicological studies evaluating the effects of these compounds on marine organisms are of primary importance for marine environment preservation. Different model organisms are used to perform toxicity tests with potential pollutants, under laboratory conditions. In last decades, solitary ascidians have been selected as valuable model organisms to run b...

  14. Solitary ascidians embryos (Chordata, Tunicata as model organisms for testing coastal pollutant toxicity

    Directory of Open Access Journals (Sweden)

    G Zega

    2009-03-01

    Full Text Available Marine coastal communities are daily exposed to several chemical compounds commonly used in agriculture and industrial activities. Therefore, toxicological studies evaluating the effects of these compounds on marine organisms are of primary importance for marine environment preservation. Different model organisms are used to perform toxicity tests with potential pollutants, under laboratory conditions. In last decades, solitary ascidians have been selected as valuable model organisms to run bioassays with embryos and larvae. In fact, by in vitro fertilization, it is easy to obtain thousands of embryos, rapidly developing and therefore allowing a fast screen of pollutant toxicity.The aim of this review was to summarize results from toxicity tests, run with heavy metals, organo-metal and organic compounds, on solitary ascidian development and settlement to evidence that these animals offer several advantages as models to perform these kind of studies. First of all, they have a sensitiveness directly comparable to that of other marine model organisms. Moreover, the effects of toxicants on exposed embryos and larvae could be studied using different approaches, from ultrastructure to genetic analysis. Finally, since ascidians are chordates morphological and gene expression analyses could provide data for comparative studies with vertebrates.

  15. Ascídias (Tunicata, Ascidiacea introduzidas no Arquipélago de Alcatrazes, São Paulo Introduced ascidians (Tunicata, Ascidiacea in the Arquipélago de Alcatrazes, State of São Paulo, Brazil

    Directory of Open Access Journals (Sweden)

    Rosana M. da Rocha

    2009-03-01

    Full Text Available O Arquipélago de Alcatrazes (24º06'S, 45º42'W localiza-se a 36 km da costa e constitui uma Estação Ecológica desde 1987. Estando próximo à região portuária de São Sebastião, São Paulo, está sujeito à introdução de espécies exóticas. Com o objetivo de detectar se está ocorrendo ou não introdução de espécies, foram coletados 40 exemplares de ascídias da principal ilha do arquipélago, a Ilha de Alcatrazes, sendo 15 amostras da Baía do Oratório e 25 do Saco do Funil. Foram encontradas 24 espécies em sete famílias. Dentre estas, apenas cinco espécies podem ser consideradas como nativas para o Atlântico; quatro são atlânticas, mas criptogênicas na região devido à distribuição disjunta; cinco são classificadas como criptogênicas de ampla distribuição mundial; e uma pode ser considerada como um caso certo de introdução, Ciona intestinalis (Linnaeus, 1767. Há ainda nove espécies que não puderam ser identificadas, podendo algumas se tratar de espécies novas. A presença de uma espécie exótica e a grande quantidade de espécies criptogênicas com forte evidência de introdução são indícios de que as ilhas estão sendo ameaçadas por uma fauna não nativa. A conservação do Arquipélago deve levar em consideração a presença do porto como fonte de estresse e o controle das espécies introduzidas como parte do plano de manejo da Unidade de Conservação.Arquipélago de Alcatrazes (24º06'S, 45º42'W is 36 km off the coast and it is an Ecological Station since 1987. It is also located near the port region of São Sebastião, São Paulo, hence subjected to introduction of exotic species. Forty samples were taken in the principal island of the archipelago to detect possible introductions. Fifteen samples were from Baía do Oratório and 25 from Saco do Funil. Twenty four species distributed in seven families were found. Only five of them were classified as native, four are Atlantic but cryptogenic in the

  16. Functional Brachyury binding sites establish a temporal read-out of gene expression in the Ciona notochord.

    OpenAIRE

    Lavanya Katikala; Hitoshi Aihara; Passamaneck, Yale J.; Stefan Gazdoiu; José-Edwards, Diana S.; Kugler, Jamie E.; Izumi Oda-Ishii; Janice H Imai; Yutaka Nibu; Anna Di Gregorio

    2013-01-01

    Author Summary Transcription factors control where and when gene expression is switched on by binding to specific stretches of DNA known as cis-regulatory modules (CRMs). In this study, we investigated the architecture and composition of CRMs that direct gene expression in the notochord—a transient rod-like structure found in all embryos that belong to the phylum chordata, which includes humans. Here we used the sea squirt Ciona, a simple chordate, and analyzed how the transcription factor Br...

  17. A FLUCTUATING SALINITY REGIME MITIGATES THE NEGATIVE EFFECTS OF REDUCED SALINITY ON THE ESTUARINE MACROALGA, ENTEROMORPHA INTESTINALIS (L.) LINK. (R827637)

    Science.gov (United States)

    AbstractWe tested the response of Enteromorpha intestinalis to fluctuating reduced salinity regimes which may occur in coastal estuaries due to both natural and anthropogenic influences. In a fully crossed two factor experiment, we subjected E. intestinalis<...

  18. A FLUCTUATING SALINITY REGIME MITIGATES THE NEGATIVE EFFECTS OF REDUCED SALINITY ON THE ESTUARINE MACROALGA, ENTEROMORPHA INTESTINALIS (L.) LINK. (R825381)

    Science.gov (United States)

    AbstractWe tested the response of Enteromorpha intestinalis to fluctuating reduced salinity regimes which may occur in coastal estuaries due to both natural and anthropogenic influences. In a fully crossed two factor experiment, we subjected E. intestinalis<...

  19. In vitro antimicrobial activities of methanolic extract from marine alga Enteromorpha intestinalis

    Institute of Scientific and Technical Information of China (English)

    Ibrahim Darah; Sheh-Hong Lim

    2015-01-01

    To extract the bioactive compound from Enteromorpha intestinalis (E. intestinalis) and determine its in vitro antimicrobial activity. Methods: E. intestinalis was extracted by methanol and subjected to antimicrobial screening. The antimicrobial activity was studied by using disc diffusion and broth dilution method. The effect of the extract on the growth profile of the bacterial was also examined via time-kill assay. Microscopy observations using SEM was done to determine the major alterations in the microstructure of methicillin-resistant Staphylococcus aureus (MRSA). Results: The results showed methanolic extract of E. intestinalis exhibited a favourable antimicrobial activity against tested bacteria with produced inhibition zone ranging from 8.0-19.0 mm. However, all the tested fungi and yeast were resistant to the extract treatment. Time kill assay suggested that methanolic extract of E. intestinalis had completely inhibited MRSA growth and also exhibited prolonged antibacterial activity. The main abnormalities noted from the microscopic observations were the structural deterioration in the normal morphology and complete collapsed of the bacteria cells after 36 h of treatment. Conclusions: The significant antibacterial activity shown by crude extract suggested its potential against MRSA infection. The extract may have potential to develop as antibacterial agent in pharmaceutical use.

  20. In vitro antimicrobial activities of methanolic extract from marine alga Enteromorpha intestinalis

    Institute of Scientific and Technical Information of China (English)

    Ibrahim; Darah; Sheh-Hong; Lim

    2015-01-01

    Objective:To extract the bioactive compound from Enteromorpha intestinalis(E. intestinalis) and determine its in vitro antimicrobial activity. Methods: E. intestinalis was extracted by methanol and subjected to antimicrobial screening. The antimicrobial activity was studied by using disc diffusion and broth dilution method. The effect of the extract on the growth profile of the bacterial was also examined via time-kill assay. Microscopy observations using SEM was done to determine the major alterations in the microstructure of methicillin-resistant Staphylococcus aureus(MRSA). Results: The results showed methanolic extract of E. intestinalis exhibited a favourable antimicrobial activity against tested bacteria with produced inhibition zone ranging from 8.0-19.0 mm. However, all the tested fungi and yeast were resistant to the extract treatment. Time kill assay suggested that methanolic extract of E. intestinalis had completely inhibited MRSA growth and also exhibited prolonged antibacterial activity. The main abnormalities noted from the microscopic observations were the structural deterioration in the normal morphology and complete collapsed of the bacteria cells after 36 h of treatment. Conclusions: The significant antibacterial activity shown by crude extract suggested its potential against MRSA infection. The extract may have potential to develop as antibacterial agent in pharmaceutical use.

  1. Stable transfection of Eimeria intestinalis and investigation of its life cycle, reproduction and immunogenicity

    Directory of Open Access Journals (Sweden)

    Tuanyuan eShi

    2016-05-01

    Full Text Available Rabbit coccidiosis, caused by infection of Eimeria spp. is one of the most severe parasitic diseases in rabbits. E. intestinalis is one of the most immunogenic species in rabbit coccidia. Due to the lack of genomic information and unsuccessful in vitro cultivation, genetic manipulation of rabbit coccidia lagged behind other apicomplexan parasites. Using regulatory sequences from E. tenella, we obtained a transgenic line of E. intestinalis expressing yellow fluorescent protein (YFP. YFP was continuously expressed throughout the whole life cycle. Morphological features of E. intestinalis in the different developmental stages were dynamically observed with the transgenic line. Some important features in the endogenous development stages were observed. Trophozoites were found as early as 4 h post inoculation. Two-types of schizonts and merozoites were observed in first three of the four schizogonies. Beside jejunum and ileum, gametogony stage and oocysts were also found in the duodenum and vermiform appendix. In addition, the transgenic strain was highly immunogenic but less pathogenic than the wild type. Considering the high immunogenicity of E. intestinalis and amenability to transfection with foreign genes, transgenic E. intestinalis could be a promising oral eukaryotic vaccine vector.

  2. Pneumatosis intestinalis in children after allogeneic bone marrow transplantation

    Energy Technology Data Exchange (ETDEWEB)

    Yeager, A.M.; Kanof, M.E.; Lake, A.M.; Kramer, S.S.; Jones, B.; Saral, R.; Santos, G.W.

    1987-01-01

    Four children, ages 3 to 8 years, developed pneumatosis intestinalis (PI) after allogeneic bone marrow transplantation (BMT) for acute leukemia or severe aplastic anemia. PI was detected at a median of 48 days (range, 10-63 days) after BMT and was associated with abdominal symptoms and clinical signs. All patients had severe systemic and/or highgrade cutaneous acute graft-versus-host disease (AGVHD) at some time after BMT and were receiving corticosteroids at the time of development of PI; however, PI was associated with concomitant severe AGVHD in only one patient. One patient with PI had Hafnia alvei bacteremia and another patient had gastroenteritis due to rotavirus and adenovirus. All patients were treated with supportive care and systemic broad-spectrum antibiotics, and PI resolved 2-16 days after onset. Two patients died with BMT-associated complications unrelated to PI. Multiple factors contribute to the development of PI after BMT, and the prognosis for recovery from PI is good with medical management alone. Overall survival in these patients is dependent on the frequency and severity of other conditions, such as AGVHD and opportunistic infections, after BMT.

  3. Clinical analysis of 20 cases of pneumatosis cystoides intestinalis

    Directory of Open Access Journals (Sweden)

    Rui TONG

    2016-03-01

    Full Text Available Objective  To review the experiences of diagnosis and treatment of pneumatosis cystoides intestinalis (PCI, and study the clinical characteristics of the disease in order to improve the diagnosis and treatment. Methods  Clinical data from 20 patients with endoscopically confirmed PCI were retrospectively analyzed. They were admitted to the Chinese PLA General Hospital from June 1995 to June 2015. Results  Among the patients 16 of them were male,and the other four were female. The main clinical manifestations were abdominal distention, diarrhea, abdominal pain and mucous bloody stool. The diagnosis relied mainly on colonoscopy and pathological examination. Laparoscopy assisted colorectal cancer resection was performed in 1 patient, laparostomy and repair of sigmoid colon perforation in 1, endoscopic treatment in 5 cases, drug administration and hyperbaric oxygen therapy in 2, drug treatment alone in 7, and no treatment in 4. Conclusions  The final diagnosis depends on endoscopic findings. No treatment is recommended to patients with no symptoms. The management of patients with PCI includes antibiotics, oxygen therapy, endoscopic therapy, surgery, and appropriate therapy related to the underlying cause of PCI. The prognosis is good. DOI: 10.11855/j.issn.0577-7402.2016.02.09

  4. The Superoxide Reductase from the Early Diverging Eukaryote Giardia Intestinalis

    International Nuclear Information System (INIS)

    Unlike superoxide dismutases (SODs), superoxidereductases (SORs) eliminate superoxide anion (O2#smbullet#-) not through its dismutation, but via reduction to hydrogen peroxide (H2O2) in the presence of an electron donor. The microaerobic protist Giardia intestinalis, responsible for a common intestinal disease in humans, though lacking SOD and other canonical reactive oxygen species-detoxifying systems, is among the very few eukaryotes encoding a SOR yet identified. In this study, the recombinant SOR from Giardia (SORGi) was purified and characterized by pulse radiolysis and stopped-flow spectrophotometry. The protein, isolated in the reduced state, after oxidation by superoxide or hexachloroiridate(IV), yields a resting species (Tfinal) with Fe3+ ligated to glutamate or hydroxide depending on pH (apparent pKa = 8.7). Although showing negligible SOD activity, reduced SORGi reacts with O2#smbullet#- with a pH-independent second-order rate constant k1 = 1.0 x 109 M-1 s-1 and yields the ferric-(hydro)peroxo intermediate T1; this in turn rapidly decays to the Tfinal state with pH-dependent rates, without populating other detectable intermediates. Immunoblotting assays show that SORGi is expressed in the disease-causing trophozoite of Giardia. We propose that the superoxide-scavenging activity of SOR in Giardia may promote the survival of this air-sensitive parasite in the fairly aerobic proximal human small intestine during infection.

  5. Coordinated Changes in Gene Expression Throughout Encystation of Giardia intestinalis.

    Science.gov (United States)

    Einarsson, Elin; Troell, Karin; Hoeppner, Marc P; Grabherr, Manfred; Ribacke, Ulf; Svärd, Staffan G

    2016-03-01

    Differentiation into infectious cysts through the process of encystation is crucial for transmission and survival of the intestinal protozoan parasite Giardia intestinalis. Hitherto the majority of studies have focused on the early events, leaving late encystation poorly defined. In order to further study encystation, focusing on the later events, we developed a new encystation protocol that generates a higher yield of mature cysts compared to standard methods. Transcriptome changes during the entire differentiation from trophozoites to cysts were thereafter studied using RNA sequencing (RNA-seq). A high level of periodicity was observed for up- and down-regulated genes, both at the level of the entire transcriptome and putative regulators. This suggests the trajectory of differentiation to be coordinated through developmentally linked gene regulatory activities. Our study identifies a core of 13 genes that are consistently up-regulated during initial encystation. Of these, two constitute previously uncharacterized proteins that we were able to localize to a new type of encystation-specific vesicles. Interestingly, the largest transcriptional changes were seen in the late phase of encystation with the majority of the highly up-regulated genes encoding hypothetical proteins. Several of these were epitope-tagged and localized to further characterize these previously unknown genetic components of encystation and possibly excystation. Finally, we also detected a switch of variant specific surface proteins (VSPs) in the late phase of encystation. This occurred at the same time as nuclear division and DNA replication, suggesting a potential link between the processes. PMID:27015092

  6. Nitric oxide acts as a positive regulator to induce metamorphosis of the ascidian Herdmania momus.

    Directory of Open Access Journals (Sweden)

    Nobuo Ueda

    Full Text Available Marine invertebrates commonly have a biphasic life cycle in which the metamorphic transition from a pelagic larva to a benthic post-larva is mediated by the nitric oxide signalling pathway. Nitric oxide (NO is synthesised by nitric oxide synthase (NOS, which is a client protein of the molecular chaperon heat shock protein 90 (HSP90. It is notable, then, that both NO and HSP90 have been implicated in regulating metamorphosis in marine invertebrates as diverse as urochordates, echinoderms, molluscs, annelids, and crustaceans. Specifically, the suppression of NOS activity by the application of either NOS- or HSP90-inhibiting pharmacological agents has been shown consistently to induce the initiation of metamorphosis, leading to the hypothesis that a negative regulatory role of NO is widely conserved in biphasic life cycles. Further, the induction of metamorphosis by heat-shock has been demonstrated for multiple species. Here, we investigate the regulatory role of NO in induction of metamorphosis of the solitary tropical ascidian, Herdmania momus. By coupling pharmacological treatments with analysis of HmNOS and HmHSP90 gene expression, we present compelling evidence of a positive regulatory role for NO in metamorphosis of this species, in contrast to all existing ascidian data that supports the hypothesis of NO as a conserved negative regulator of metamorphosis. The exposure of competent H. momus larvae to a NOS inhibitor or an NO donor results in an up-regulation of NOS and HSP90 genes. Heat shock of competent larvae induces metamorphosis in a temperature dependent manner, up to a thermal tolerance that approaches 35°C. Both larval/post-larval survival and the appearance of abnormal morphologies in H. momus post-larvae reflect the magnitude of up-regulation of the HSP90 gene in response to heat-shock. The demonstrated role of NO as a positive metamorphic regulator in H. momus suggests the existence of inter-specific adaptations of NO regulation

  7. Complete DNA sequence of the mitochondrial genome of the ascidian Halocynthia roretzi (Chordata, Urochordata).

    OpenAIRE

    Yokobori, S i; Ueda, T.; Feldmaier-Fuchs, G; Pääbo, S; Ueshima, R.; Kondow, A; Nishikawa, K.; Watanabe, K.

    1999-01-01

    The complete nucleotide sequence of the 14,771-bp-long mitochondrial (mt) DNA of a urochordate (Chordata)-the ascidian Halocynthia roretzi-was determined. All the Halocynthia mt-genes were found to be located on a single strand, which is rich in T and G rather than in A and C. Like nematode and Mytilus edulis mtDNAs, that of Halocynthia encodes no ATP synthetase subunit 8 gene. However, it does encode an additional tRNA gene for glycine (anticodon TCT) that enables Halocynthia mitochondria to...

  8. HUMAN GIARDIASIS IN MALAYSIA: CORRELATION BETWEEN THE PRESENCE OF CLINICAL MANIFESTATION AND GIARDIA INTESTINALIS ASSEMBLAGE.

    Science.gov (United States)

    Anuar, Tengku Shahrul; Moktar, Norhayati; Salleh, Fatmah Md; Al-Mekhlafi, Hesham M

    2015-09-01

    Clinical manifestations of giardiasis vary from asymptomatic infection to chronic diarrhea. A total of 611 stool samples from Aboriginal participants residing in Jelebu, Gerik and Temerloh States, Malaysia, ages 2 to 74 years were screened for Giardia intestinalis using microscopic examination and sequence analysis of a fragment of nested-PCR amplified triosephosphate isomerase (tpi) gene. Demographic data was collected through a structured questionnaire. tpi was successfully amplified from 98/110 samples microscopically positive for G. intestinalis, with 62 and 36 belonging to assemblage A and B, respectively. There is a significant correlation between assemblage A and symptomatic infection only in participants of < 15 years of age. In the other age group, host factors may have more effects on the presence of clinical signs and symptoms than G. intestinalis assemblage types. PMID:26863854

  9. The Superoxide Reductase from the Early Diverging Eukaryote Giardia Intestinalis

    Energy Technology Data Exchange (ETDEWEB)

    Cabelli, D.E.; Testa, F.; Mastronicola, D.; Bordi, E.; Pucillo, L.P.; Sarti, P.; Saraiva, L.M.; Giuffre, A.; Teixeira, M.

    2011-10-15

    Unlike superoxide dismutases (SODs), superoxidereductases (SORs) eliminate superoxide anion (O{sub 2}{sup {sm_bullet}-}) not through its dismutation, but via reduction to hydrogen peroxide (H{sub 2}O{sub 2}) in the presence of an electron donor. The microaerobic protist Giardia intestinalis, responsible for a common intestinal disease in humans, though lacking SOD and other canonical reactive oxygen species-detoxifying systems, is among the very few eukaryotes encoding a SOR yet identified. In this study, the recombinant SOR from Giardia (SOR{sub Gi}) was purified and characterized by pulse radiolysis and stopped-flow spectrophotometry. The protein, isolated in the reduced state, after oxidation by superoxide or hexachloroiridate(IV), yields a resting species (T{sub final}) with Fe{sup 3+} ligated to glutamate or hydroxide depending on pH (apparent pK{sub a} = 8.7). Although showing negligible SOD activity, reduced SOR{sub Gi} reacts with O{sub 2}{sup {sm_bullet}-} with a pH-independent second-order rate constant k{sub 1} = 1.0 x 10{sup 9} M{sup -1} s{sup -1} and yields the ferric-(hydro)peroxo intermediate T{sub 1}; this in turn rapidly decays to the T{sub final} state with pH-dependent rates, without populating other detectable intermediates. Immunoblotting assays show that SOR{sub Gi} is expressed in the disease-causing trophozoite of Giardia. We propose that the superoxide-scavenging activity of SOR in Giardia may promote the survival of this air-sensitive parasite in the fairly aerobic proximal human small intestine during infection.

  10. DNA barcoding of two solitary ascidians, Herdmania momus Savigny, 1816 and Microcosmus squamiger Michaelsen, 1927 from Thoothukudi coast, India.

    Science.gov (United States)

    Jaffar Ali, H Abdul; Ahmed, N Shabeer

    2016-07-01

    Morphology-based taxonomical studies of ascidians in India are meagre due to lack of ascidian taxonomist and limitations inherent in conventional system-based identification. The use of short fragment of mitochondrial DNA sequence is proving highly useful in identifying species in a situation where, the traditional morphology-based identification is difficult. In the present study, two adult solitary ascidians collected from the Thoothukudi coast were morphologically identified as Herdmania momus Savigny, 1816 and Microcosmus squamiger Michaelsen, 1927. The genomic DNA of these ascidians was isolated, COI gene was amplified, sequenced and submitted to the GenBank under the accession numbers KM058116, KM411616 and KJ944390. Homology search result using BLAST showed that H. momus showed 100% matched with other H. momus, while M. squamiger showed similarity with Pyura herdmani, a member of the same family Pyuridae. The phylogenetic and genetic distance was maximum in interspecies than in intraspecies. These COI sequences will allow the identification of the species through DNA barcoding technique. Here, we report for the first time the COI gene of H. momus, Savigny 1816 from the Indian coast. PMID:26122341

  11. Significant reduction in allergenicity of ovalbumin from chicken egg white following treatment with ascidian viscera N-acetylglucosaminidase.

    Science.gov (United States)

    Hwang, Hye Seong; Park, Heajin; Kim, Jihye; Choi, Jai Yeon; Lee, Young Kwang; Park, Ho-Young; Choi, Hee-Don; Kim, Ha Hyung

    2016-06-17

    Ovalbumin (OA) is the most abundant ingredient of chicken egg-white allergenic proteins. In the present study we investigated the possibility of reducing OA allergenicity by treatment with a natural protein exhibiting N-acetylglucosaminidase (NA) activity. Ascidian is cultivated as a food resource in northeast Asia. The ascidian viscera NA (AVNA) with almost no other exoglycosidases or proteolytic enzymes was isolated by applying size-exclusion chromatography to a protein precipitate of ascidian viscera. Intact OA was mixed with AVNA containing 0.2, 1.0, and 5.0 Units of NA. Anion-exchange chromatography was then used to isolate OA from AVNA-treated OA. The electrophoretic patterns and N-glycans of each isolated OA from AVNA-treated OA (iOA) were analyzed, and the terminal N-acetylglucosamines of iOA were selectively cleaved with no other degradation occurring. A competitive indirect enzyme-linked immunosorbent assay using rabbit anti-OA sera was performed to investigate the allergenicity of iOA, which was found to be significantly reduced depending on the increased NA activity compared to that of intact OA. These results indicate that OA allergenicity was reduced using a simple and mild treatment process with AVNA, and suggest that ascidian NA is an efficient natural protein for reducing the allergenicity of OA without requiring the use of harsh physical treatments or chemical conjugation. PMID:27178210

  12. Accumulation of heavy metals in the Ligula intestinalis plerocercoids (Pseudophyllidea) of different age

    Czech Academy of Sciences Publication Activity Database

    Baruš, Vlastimil; Tenora, F.; Kráčmar, S.; Prokeš, Miroslav

    2001-01-01

    Roč. 38, č. 1 (2001), s. 29-33. ISSN 0440-6605 R&D Projects: GA ČR GA524/01/1314 Institutional research plan: CEZ:MSM 432100001 Keywords : Ligula intestinalis * plerocercoids * heavy metals Subject RIV: EG - Zoology Impact factor: 0.793, year: 2001

  13. Genome analysis and comparative genomics of a Giardia intestinalis assemblage E isolate

    Directory of Open Access Journals (Sweden)

    Andersson Jan O

    2010-10-01

    Full Text Available Abstract Background Giardia intestinalis is a protozoan parasite that causes diarrhea in a wide range of mammalian species. To further understand the genetic diversity between the Giardia intestinalis species, we have performed genome sequencing and analysis of a wild-type Giardia intestinalis sample from the assemblage E group, isolated from a pig. Results We identified 5012 protein coding genes, the majority of which are conserved compared to the previously sequenced genomes of the WB and GS strains in terms of microsynteny and sequence identity. Despite this, there is an unexpectedly large number of chromosomal rearrangements and several smaller structural changes that are present in all chromosomes. Novel members of the VSP, NEK Kinase and HCMP gene families were identified, which may reveal possible mechanisms for host specificity and new avenues for antigenic variation. We used comparative genomics of the three diverse Giardia intestinalis isolates P15, GS and WB to define a core proteome for this species complex and to identify lineage-specific genes. Extensive analyses of polymorphisms in the core proteome of Giardia revealed differential rates of divergence among cellular processes. Conclusions Our results indicate that despite a well conserved core of genes there is significant genome variation between Giardia isolates, both in terms of gene content, gene polymorphisms, structural chromosomal variations and surface molecule repertoires. This study improves the annotation of the Giardia genomes and enables the identification of functionally important variation.

  14. Prevalence, Risk Factors and Multilocus Genotyping of Giardia intestinalis in Dairy Cattle, Northwest China.

    Science.gov (United States)

    Zhang, Xiao-Xuan; Tan, Qi-Dong; Zhao, Guang-Hui; Ma, Jian-Gang; Zheng, Wen-Bin; Ni, Xiao-Ting; Zhao, Quan; Zhou, Dong-Hui; Zhu, Xing-Quan

    2016-07-01

    Giardia intestinalis is a cosmopolitan protozoan parasite that can infect a range of animals, including dairy cattle. As information regarding the prevalence and genotyping of G. intestinalis infection in dairy cattle in northwestern China is limited, 2,945 feces samples from 1,224 dairy cattle in Gansu Province and from 1,614 in Ningxia Hui Autonomous Region (NXHAR) were examined between December 2012 and March 2014. The overall prevalence of G. intestinalis was 3.63% (107/2,945), with 2.63% and 4.38% in Gansu and NXHAR, respectively. Logistic regression analysis showed region, age and season to be significant risk factors for G. intestinalis infection. Assemblage analysis identified 106 assemblage E and one assemblage A at the triose phosphate isomerase (tpi) locus in this study. Intravariations were also detected at tpi, glutamate dehydrogenase (gdh) and beta giardin (bg) loci within assemblage E, showing seven, three, and five new subtypes, respectively. Moreover, 13 new multilocus genotypes (E20-E32) were observed in assemblage E. Effective strategies and measures should be taken to prevent and control giardiasis in Gansu and NXHAR. PMID:26729604

  15. DETECTION OF GIARDIA INTESTINALIS COPROANTIGENS IN DIARRHEIC SAMPLES BY IMMUNOCHROMATOGRAPHIC AND ELISATECHNIQUES.

    Science.gov (United States)

    Selim, Monira Abd El-Wahab; Taha, Afaf Abd El-Raouf; El-Aal, Naglaa Fathy Abd; Farag, Tahani Ismail; Yousef, Asmaa Mohammed

    2015-08-01

    Giardia intestinalis is one of the most common diarrhea-causing protozoa. The present study aimed to search for specific and sensitive diagnostic tests to avoid loss of infected cases with Giardia intestinalis by detection of G. intestinalis coproantigens in diarrheic samples through comparison between direct parasitological method, an enzyme linked immunosorbent assay (ELISA) and immunochromatographic test (ICT). A comparative cross-sectional study including 75 cases suffering from diarrhea and other gastrointestinal symptoms suggestive of intestinal giardiasis as abdominal distention, abdominal pain, anorexia, nausea, vomiting and weight loss, and 25 cases were without any clinical manifestations enrolled in this study. For every case, complete history taking and full clinical examination were done. Stool samples were collected from all cases and investigated by direct parasitological method, ELISA, and immunochromatographic techniques. The results showed that the sensitivity of immunochromatographic technique was 96% and specificity was 96% while sensitivity of ELISA was 98% and specificity was 96% on comparing their results to the microscopic examination of stool samples for Giardia intestinalis. PMID:26485845

  16. [Prevalence of Encephalitozoon intestinalis and Enterocytozoon bieneusi in cancer patients under chemotherapy].

    Science.gov (United States)

    Hamamcı, Berna; Çetinkaya, Ülfet; Berk, Veli; Kaynar, Leylagül; Kuk, Salih; Yazar, Süleyman

    2015-01-01

    Microsporidia species are obligate intracellular parasites and constitute one of the most important opportunistic pathogens that can cause severe infections especially in immunocompromised patients. Enterocytozoon bieneusi and Encephalitozoon intestinalis are the most common species among 14 microsporidia species identified as human pathogens. The aim of this study was to investigate the prevalence of E.intestinalis and E.bieneusi in cancer patients under chemotherapy by immunofluorescent antibody and conventional staining methods. A total of 123 stool samples obtained from 93 patients (58 male, 35 female) with cancer who were followed in oncology and hematology clinics of our hospital and 30 healthy volunteers (13 male, 17 female) were included in the study. Fifty-one (55%) of the patients had complain of diarrhea. The presence of E.intestinalis and E.bieneusi were investigated by a commercial immunofluorescence antibody test using monoclonal antibodies (IFA-MAbs; Bordier Affinity Products, Switzerland) in all of the samples, and 50 of the samples were also investigated by modified trichrome, acid-fast trichrome and calcofluor staining methods. A total of 65 (69.9%) patients were found positive with IFA-MAbs method, including 43 (46.2%) E.intestinalis, 9 (9.7%) E.bieneusi and 13 (14%) mixed infections. In the control group, 5 (16.7%) subjects were positive with IFA-MAbs method, including 2 (6.7%) E.intestinalis, 1 (3.3%) E.bieneusi and 2 (6.7%) mixed infections. The difference between the positivity rate of the patient and control groups was statistically significant (pmicrosporidian pathogens. PMID:25706736

  17. Spatial and Molecular Epidemiology of Giardia intestinalis Deep in the Amazon, Brazil.

    Directory of Open Access Journals (Sweden)

    Beatriz Coronato Nunes

    Full Text Available Current control policies for intestinal parasitosis focuses on soil-transmitted helminths, being ineffective against Giardia intestinalis, a highly prevalent protozoon that impacts children's nutritional status in developing countries. The objective of this study was to explore spatial and molecular epidemiology of Giardia intestinalis in children of Amerindian descent in the Brazilian Amazon.A cross sectional survey was performed in the Brazilian Amazon with 433 children aged 1 to 14 years. Fecal samples were processed through parasitological techniques and molecular characterization. Prevalence of G. intestinalis infection was 16.9% (73/433, reaching 22.2% (35/158 among children aged 2-5 years, and a wide distribution throughout the city with some hot spots. Positivity-rate was similar among children living in distinct socioeconomic strata (48/280 [17.1%] and 19/116 [16.4%] below and above the poverty line, respectively. Sequencing of the β-giardin gene revealed 52.2% (n = 12 of assemblage A and 47.8% (n = 11 of assemblage B with high haplotype diversity for the latter. The isolates clustered into two well-supported G. intestinalis clades. A total of 38 haplotypes were obtained, with the following subassemblages distribution: 5.3% (n = 2 AII, 26.3% (n = 10 AIII, 7.9% (n = 3 BIII, and 60.5% (n = 23 new B genotypes not previously described.Giardia intestinalis infection presents a high prevalence rate among Amerindian descended children living in Santa Isabel do Rio Negro/Amazon. The wide distribution observed in a small city suggests the presence of multiple sources of infection, which could be related to environmental contamination with feces, possibly of human and animal origin, highlighting the need of improving sanitation, safe water supply and access to diagnosis and adequate treatment of infections.

  18. Spatial and Molecular Epidemiology of Giardia intestinalis Deep in the Amazon, Brazil

    Science.gov (United States)

    Coronato Nunes, Beatriz; Pavan, Márcio G.; Jaeger, Lauren H.; Monteiro, Kerla J. L.; Xavier, Samanta C. C.; Monteiro, Fernando A.; Bóia, Márcio N.; Carvalho-Costa, Filipe A.

    2016-01-01

    Background Current control policies for intestinal parasitosis focuses on soil-transmitted helminths, being ineffective against Giardia intestinalis, a highly prevalent protozoon that impacts children’s nutritional status in developing countries. The objective of this study was to explore spatial and molecular epidemiology of Giardia intestinalis in children of Amerindian descent in the Brazilian Amazon. Methodology/Principal Findings A cross sectional survey was performed in the Brazilian Amazon with 433 children aged 1 to 14 years. Fecal samples were processed through parasitological techniques and molecular characterization. Prevalence of G. intestinalis infection was 16.9% (73/433), reaching 22.2% (35/158) among children aged 2–5 years, and a wide distribution throughout the city with some hot spots. Positivity-rate was similar among children living in distinct socioeconomic strata (48/280 [17.1%] and 19/116 [16.4%] below and above the poverty line, respectively). Sequencing of the β-giardin gene revealed 52.2% (n = 12) of assemblage A and 47.8% (n = 11) of assemblage B with high haplotype diversity for the latter. The isolates clustered into two well-supported G. intestinalis clades. A total of 38 haplotypes were obtained, with the following subassemblages distribution: 5.3% (n = 2) AII, 26.3% (n = 10) AIII, 7.9% (n = 3) BIII, and 60.5% (n = 23) new B genotypes not previously described. Conclusions/Significance Giardia intestinalis infection presents a high prevalence rate among Amerindian descended children living in Santa Isabel do Rio Negro/Amazon. The wide distribution observed in a small city suggests the presence of multiple sources of infection, which could be related to environmental contamination with feces, possibly of human and animal origin, highlighting the need of improving sanitation, safe water supply and access to diagnosis and adequate treatment of infections. PMID:27392098

  19. Two New Tryptamine Derivatives, Leptoclinidamide and (--Leptoclinidamine B, from an Indonesian Ascidian Leptoclinides dubius

    Directory of Open Access Journals (Sweden)

    Michio Namikoshi

    2012-02-01

    Full Text Available Two new tryptamine-derived alkaloids, named as leptoclinidamide (1 and (--leptoclinidamine B (2, were isolated from an Indonesian ascidian Leptoclinides dubius together with C2-α-D-mannosylpyranosyl-L-tryptophan (3. The structure of 1 was assigned on the basis of spectroscopic data for 1 and its N-acetyl derivative (4. Compound 1 was an amide of tryptamine with two β-alanine units. Although the planar structure of 2 is identical to that of the known compound (+-leptoclinidamine B (5, compound 2 was determined to be the enantiomer of 5 based on amino acid analysis using HPLC methods. Compounds 1 to 4 were evaluated for cytotoxicity against two human cancer cell lines, HCT-15 (colon and Jurkat (T-cell lymphoma cells, but none of the compounds showed activity.

  20. Distribution and invasiveness of a colonial ascidian, Didemnum psammathodes, along the southern Indian coastal water

    Directory of Open Access Journals (Sweden)

    H. Abdul Jaffar

    2016-07-01

    Full Text Available Ascidians are well known worldwide for their rapid invasions and also for the presence of potential biomedical molecules. Members of the family Didemnidae are widely distributed in tropical waters and they are reported to be among the families possessing rich bioactive compounds. Didemnum psammathodes has a cosmopolitan distribution in tropical waters. The growing evidence of multifarious potential and ever increasing invasion of this species accentuated the need for additional research into its diversity and distribution for sustainable utilization and conservation. The present study was intended to focus on distribution and invasiveness of colonial ascidian, D. psammathodes, along the southern Indian peninsular waters. The present data are based on our own observations made during 2012–2014 period and also on the published and unpublished records of the last 20 years. Out of 45 stations surveyed, D. psammathodes was encountered at a maximum of 41 stations and was found to be more abundant in Hare Island (n = 42, North Break Water (n = 38 and Vizhinjam bay (n = 32. This species was absent at four different stations. Catch per unit effort was higher (19.6 in Hare Island followed by NBW (16.0 and Vizhinjam bay (6.8. The highest number of colonies (136 was observed in calcareous stones, followed by embedded rocks (54 and molluscan shells (33. Hydrographical parameters showed no significant differences between the stations (p < 0.005. It is concluded that D. psammathodes has the potential to invade most of the stations and its distribution was not influenced by hydrographical parameters rather than substrates.

  1. Draft Genome Sequencing of Giardia intestinalis Assemblage B Isolate GS: Is Human Giardiasis Caused by Two Different Species?

    OpenAIRE

    Franzén, Oscar; Jerlström-Hultqvist, Jon; Castro, Elsie; Sherwood, Ellen; Ankarklev, Johan; Reiner, David S.; Palm, Daniel; Andersson, Jan O.; Andersson, Björn; Svärd, Staffan G.

    2009-01-01

    Author Summary Giardia intestinalis is a major contributor to the enormous burden of diarrheal diseases with 250 million symptomatic infections per year, and it is part of the WHO neglected disease initiative. Nonetheless, there is poor insight into how Giardia causes disease; it is not invasive, secretes no known toxin and both the duration and symptoms of giardiasis are highly variable. Currently, there are seven defined variants (assemblages) of G. intestinalis, with only assemblages A and...

  2. Evaluation of antibacterial activity of crude extracts of ascidian Didemnum psammathodes Sluiter, 1895 against isolated human and fish pathogens

    Institute of Scientific and Technical Information of China (English)

    N Sri Kumaran; S Bragadeeswaran; VK Meenakshi

    2011-01-01

    Objective: To evaluate the antimicrobial activities of ascidian Didemnum psammathodes (D. psammathodes) against human and fish pathogenic organisms. Methods: In this study antimicrobial activities were carried out by standard disc diffusion method. In this experiment 40 human, fish bacterial and fungal pathogens were isolated and assayed against 7 different solvents such as methanol, acetone, ethanol, n-butanol, chloroform, ethyl acetate and dichloromethane. Each solvent were assayed at different concentrations of 25, 50, 75, 100 mg/mL. Results: From this experiment solvent having higher concentrations showed high inhibition activity and the fungi are showed more resistant than the bacterial strains used. Conclusions: These results indicate that the ascidian D. psammathodes is found to have remarkable antimicrobial activities against isolated microbes. Further studies will fulfill for purification and structural elucidation of antimicrobial drugs.

  3. Microenvironmental Ecology of the Chlorophyll b-containing Symbiotic Cyanobacterium Prochloron in the Didemnid Ascidian Lissoclinum patella

    Directory of Open Access Journals (Sweden)

    Michael eKühl

    2012-11-01

    Full Text Available The discovery of the cyanobacterium Prochloron was the first finding of a bacterial oxyphototroph with chlorophyll (Chl b, in addition to Chl a. It was first described as Prochloron didemni but a number of clades have since been described. Prochloron is a conspicuously large (7-25 µm unicellular cyanobacterium living in a symbiotic relationship, primarily with (sub- tropical didemnid ascidians; it has resisted numerous cultivation attempts and appears truly obligatory symbiotic. Recently, a Prochloron draft genome was published, revealing no lack of metabolic genes that could explain the apparent inability to reproduce and sustain photosynthesis in a free-living stage. Possibly, the unsuccessful cultivation is partly due to a lack of knowledge about the microenvironmental conditions and ecophysiology of Prochloron in its natural habitat. We used microsensors, variable chlorophyll fluorescence imaging and imaging of O2 and pH to obtain a detailed insight to the microenvironmental ecology and photobiology of Prochloron in hospite in the didemnid ascidian Lissoclinum patella. The microenvironment within ascidians is characterized by steep gradients of light and chemical parameters that change rapidly with varying irradiances. The interior zone of the ascidians harboring Prochloron thus became anoxic and acidic within a few min of darkness, while the same zone exhibited O2 super-saturation and strongly alkaline pH after a few min of illumination. Photosynthesis showed lack of photoinhibition even at high irradiances equivalent to full sunlight, and photosynthesis recovered rapidly after periods of anoxia. We discuss these new insights on the ecological niche of Prochloron and possible interactions with its host and other microbes in light of its recently published genome and a recent study of the overall microbial diversity and metagenome of L. patella.

  4. Studies on the seasonal variations in the proximate composition of ascidians from the Palk Bay,Southeast coast of India

    Institute of Scientific and Technical Information of China (English)

    Ananthan; G; Karthikeyan; MM; Selva; Prabhu; A; Raghunathan; C

    2012-01-01

    Objective:To investigate the seasonal fluctuations of the proximate composition of the ascidians muscle.Methods:The moisture content was estimated by drying 1 g of fresh tissue at a constant temperature at 105(?)for 24 h.The loss of weight was taken as moisture content.The total protein was estimated using the Biuret method.The total carbohydrate in dried sample was estimated spectrophotometrically following the phenol-sulphuric acid method.The lipid in the dried sample tissue was gravimetrically estimated following the chloroform-methanol mixture method.Ash content was determined gravimetrically by incinerating 1 g dried sample in muffle furnace at about 550℃for 6 h and results are expressed in percentage.Results:It was found very difficult to compare the monthly variations,as all the ten species,exhibited wide fluctuations in their proximate compositions.For the sake of convenience,average seasonal values were calculated by summing the monthly values.Conclusions:The proximate composition of the 10 commonly available ascidians showed high nutritive value and hence these groups especially solitary ascidians can be recommended for human consumption in terms of pickles,soup,curry and others after ensuring the safety of consumers.

  5. Studies on the seasonal variations in the proximate composition of ascidians from the Palk Bay, Southeast coast of India

    Institute of Scientific and Technical Information of China (English)

    Ananthan G; Karthikeyan MM; Selva Prabhu A; Raghunathan C

    2012-01-01

    To investigate the seasonal fluctuations of the proximate composition of the ascidians muscle. Methods: The moisture content was estimated by drying 1 g of fresh tissue at a constant temperature at 105 ℃ for 24 h.The loss of weight was taken as moisture content. The total protein was estimated using the Biuret method. The total carbohydrate in dried sample was estimated spectrophotometrically following the phenol- sulphuric acid method. The lipid in the dried sample tissue was gravimetrically estimated following the chloroform-methanol mixture method. Ash content was determined gravimetrically by incinerating 1 g dried sample in muffle furnace at about 550 ℃ for 6 h and results are expressed in percentage. Results: It was found very difficult to compare the monthly variations, as all the ten species, exhibited wide fluctuations in their proximate compositions. For the sake of convenience, average seasonal values were calculated by summing the monthly values. Conclusions: The proximate composition of the 10 commonly available ascidians showed high nutritive value and hence these groups especially solitary ascidians can be recommended for human consumption in terms of pickles, soup, curry and others after ensuring the safety of consumers.

  6. First report of Enterocytozoon bieneusi and Encephalitozoon intestinalis infection of wild mice in Slovakia.

    Science.gov (United States)

    Danišová, Oľga; Valenčáková, Alexandra; Stanko, Michal; Luptáková, Lenka; Hasajová, Antónia

    2015-01-01

    Increased risk of zoonotic transmission of the potential human pathogenic species Enterocytozoon bieneusi, Encephalitozoon intestinalis and Encephalitozoon cuniculi was detected in wild immunocompetent mice (Mus musculus musculus; n=280). Analysis was conducted with the use of PMP1/PMP2 primers and SYBR Green RT-PCR. Using Real Time PCR and comparing the sequences with sequences in the GenBank, E. bieneusi was detected in 3 samples (1.07 %), E. cuniculi in 1 sample (0.35 %) and E. intestinalis in 1 sample (0.35 %). The results of this report document the low host specificity of detected microsporidia species, and imply the importance of synanthropic rodents as a potential source of human microsporidial infection. PMID:26094518

  7. Azithromycin in the treatment of a dog infected with Giardia intestinalis.

    Science.gov (United States)

    Zygner, W; Jaros, D; Gójska-Zygner, O; Wedrychowicz, H

    2008-01-01

    Giardia intestinalis infection is a common cause of diarrhoea in humans and other mammalian species throughout the world. This report describes a case of a dog suffering from diarrhoea, infected with G. intestinalis, effectively treated with azithromycin. Azithromycin is an azalide, semisynthetic macrolide antibiotic having a large spectrum of activity against bacterial pathogens and some protozoa. In this case, Giardia infection in a dog was confirmed by microscopic examination and PCR. Sequencing of the detected Giardia amplicon confirmed infection with assemblage A-I. The dog received azithromycin administered at dose of 10 mg/kg per os, once a day for 5 days. After the therapy, the diarrhoea stopped. Effectiveness of the treatment was also confirmed by PCR and microscopic examination. This is the first report on the therapy of canine giardiosis with azithromycin. It seems that azithromycin can be considered as promising antibiotic for the control of Giardia infection in dogs. PMID:18942546

  8. Pneumatosis cystoides intestinalis of the ascending colon related to acarbose treatment: a case report

    Directory of Open Access Journals (Sweden)

    Vogel Yilin

    2009-09-01

    Full Text Available Abstract Introduction Pneumatosis cystoides intestinalis is characterized by the presence of multiple gas-filled cysts in the intestinal wall, the submucosa and/or subserosa of the intestine. The term pneumatosis cystoides coli is synonymous with pneumatosis cystoides intestinalis when the disorder is limited to the colon. It is a secondary finding caused by a wide variety of underlying gastrointestinal or extragastrointestinal diseases but rarely occurs in the course of treatment with an α-glucosidase inhibitor. This is the first report of pneumatosis cystoides intestinalis after 12 years of treatment with the α-glucosidase inhibitor acarbose. Case presentation A 65-year-old Caucasian German woman was referred to our hospital for hemicolectomy. She had been treated for type 2 diabetes mellitus with an α-glucosidase inhibitor (acarbose, 150 mg daily for 12 years. Three months before referral, she had complained of left abdominal pain. 'Polyposis coli' in the ascending colon and diverticulosis were diagnosed. Colonoscopy and computed tomography scans of the abdomen were repeated and revealed pneumatosis cystoides coli located in the ascending colon, whereas diverticulosis of the sigmoid colon was confirmed. Histological examination of a biopsy specimen only showed colon mucosa. After discontinuing administration of the α-glucosidase inhibitor for 3 months and on repeated colonoscopy, the polypoid lesions had completely disappeared. Conclusion This case illustrates that pneumatosis cystoides coli can be a source of diagnostic confusion. Pneumatosis cystoides coli must be considered in the initial differential diagnosis of patients especially in the presence of multiple colonic polypoid lesions. It is important to take pneumatosis cystoides intestinalis into consideration when prescribing α-glucosidase inhibitors to patients with diabetes who have diabetic autonomic neuropathy with decreased intestinal motility, or to patients taking steroids.

  9. Screening and isolation of the algicidal compounds from marine green alga Ulva intestinalis

    Science.gov (United States)

    Sun, Xue; Jin, Haoliang; Zhang, Lin; Hu, Wei; Li, Yahe; Xu, Nianjun

    2016-07-01

    Twenty species of seaweed were collected from the coast of Zhejiang, China, extracted with ethanol, and screened for algicidal activity against red tide microalgae Heterosigma akashiwo and Prorocentrum micans. Inhibitory effects of fresh and dried tißsues of green alga Ulva intestinalis were assessed and the main algicidal compounds were isolated, purified, and identified. Five seaweed species, U. intestinalis, U. fasciata, Grateloupia romosissima, Chondria crassicaulis, and Gracilariopsis lemaneiformis, were investigated for their algicidal activities. Fresh tissues of 8.0 and 16.0 mg/mL of U. intestinalis dissolved in media significantly inhibited growth of H. akashiwo and P. micans, respectively. Dried tissue and ethyl acetate (EtOAc) extracts of U. intestinalis at greater than 1.2 and 0.04 mg/mL, respectively, were fatal to H. akashiwo, while its water and EtOAc extracts in excess of 0.96 and 0.32 mg/mL, respectively, were lethal to P. micans. Three algicidal compounds in the EtOAc extracts were identified as 15-ethoxy-(6z,9z,12z)-hexadecatrienoic acid (I), (6E,9E,12E)-(2-acetoxy- β-D-glucose)-octadecatrienoic acid ester (II) and hexadecanoic acid (III). Of these, compound II displayed the most potent algicidal activity with IC50 values of 4.9 and 14.1 µg/mL for H. akashiwo and P. micans, respectively. Compound I showed moderate algicidal activity with IC50 values of 13.4 and 24.7 µg/mL for H. akashiwo and P. micans, respectively. These findings suggested that certain macroalgae or products therefrom could be used as effective biological control agents against red tide algae.

  10. Molecular Diagnosis and Characterization of Two Intestinal Protozoa : Entamoeba histolytica & Giardia intestinalis

    OpenAIRE

    Lebbad, Marianne

    2010-01-01

    Entamoeba histolytica and Giardia intestinalis are two of the most important and most widespread diarrhea-related parasitic protozoa in the world. Approximately 1200 1500 cases of Giardia and 200 400 cases of Entamoeba are reported each year in Sweden, whereas the corresponding numbers are much higher in developing countries like Nicaragua. Traditionally, diagnosis of these parasites depends on microscopic detection of cysts or trophozoites, even though such methodology is ...

  11. Pneumatosis Cystoides Intestinalis: An Unusual Cause of Intestinal Ischemia and Pneumoperitoneum

    OpenAIRE

    Ogul, Hayri; Pirimoglu, Berhan; Kisaoglu, Abdullah; KARACA, Leyla; Havan, Nuri; Ozogul, Bunyami; Kantarci, Mecit

    2015-01-01

    Pneumatosis cystoides intestinalis (PCI), with an unknown etiology, is an uncommon disease characterized by the presence of multiple gas-filled cysts within the submucosa or subserosa of the intestinal wall. Intestinal obstruction and/or perforation are relatively uncommon complications associated with PCI. The patients are often prone to misdiagnosis or mistreatment. The diagnosis of PCI is based on plain radiography or endoscopy. Multidetector computed tomography (MDCT) provides data on oth...

  12. Lack of an Adverse Effect of Giardia intestinalis Infection on the Health of Peruvian Children

    OpenAIRE

    Hollm-Delgado, Maria-Graciela; Gilman, Robert H.; Bern, Caryn; Cabrera, Lilia; Sterling, Charles R.; Black, Robert E.; Checkley, William

    2008-01-01

    Giardia intestinalis is a common gastrointestinal protozoan worldwide, but its effects on childhood growth in developing countries are not clearly understood. The authors aimed to describe its effects on child growth. They followed 220 Peruvian children daily for diarrhea, weekly for stool samples, and monthly for anthropometry. The authors modeled the effect of nutritional status on the risk of Giardia infection and the risk of diarrhea attributable to Giardia using negative binomial regress...

  13. The invasive potential of Giardia intestinalis in an in vivo model

    OpenAIRE

    Reynoso-Robles, R.; Ponce-Macotela, M.; L. E. Rosas-López; A. Ramos-Morales; M. N. Martínez–Gordillo; A. González-Maciel

    2015-01-01

    Giardiasis is a neglected parasitic disease that affects primarily children, in whom it delays physical and mental development. The pathophysiology of giardiasis in not well understood, and most reports have identified Giardia intestinalis trophozoites only in the lumen and on the brush border of the small intestine. We identified Giardia trophozoites within the epithelium of the small intestine of a lactose intolerance patient. The Giardia trophozoites were obtained and cultured in vitro. In...

  14. Cell Cycle Synchrony in Giardia intestinalis Cultures Achieved by Using Nocodazole and Aphidicolin▿

    OpenAIRE

    Poxleitner, Marianne K.; Dawson, Scott C.; Cande, W. Zacheus

    2008-01-01

    Giardia intestinalis is a ubiquitous intestinal protozoan parasite and has been proposed to represent the earliest diverging lineage of extant eukaryotes. Despite the importance of Giardia as a model organism, research on Giardia has been hampered by an inability to achieve cell cycle synchrony for in vitro cultures. This report details successful methods for attaining cell cycle synchrony in Giardia cultures. The research presented here demonstrates reversible cell cycle arrest in G1/S and G...

  15. Arginine Consumption by the Intestinal Parasite Giardia intestinalis Reduces Proliferation of Intestinal Epithelial Cells

    OpenAIRE

    Stadelmann, Britta; Merino, Maria C.; Persson, Lo; Svard, Staffan G.

    2012-01-01

    In the field of infectious diseases the multifaceted amino acid arginine has reached special attention as substrate for the host´s production of the antimicrobial agent nitric oxide (NO). A variety of infectious organisms interfere with this part of the host immune response by reducing the availability of arginine. This prompted us to further investigate additional roles of arginine during pathogen infections. As a model we used the intestinal parasite Giardia intestinalis that actively consu...

  16. The Epidemiology of Ligula intestinalis (Phylum Platyhelminthes) within the Cyprinid Populations Inhabiting the Danubian Delta Area

    OpenAIRE

    Laura Daniela Urdes; Marius Hangan

    2013-01-01

    This prevalence study was conducted between the years 2003 and 2008. The survey aimed at assessing the occurrence of the plerocercoid Ligula intestinalis within five cyprinid populations, cyprinus carpio, carassius gibelio, hypophtalmichthys molitrix, ctenopharingodon idella and abramis brama, from four natural complexes: Sontea-Fortuna, Gorgova-Uzlina, Dunavat-Dranov and Razim-Sinoie. Of the four study sites, the highest frequency of the disease was recorded within the Razim-Sinoie lakes, pr...

  17. Screening and isolation of the algicidal compounds from marine green alga Ulva intestinalis

    Science.gov (United States)

    Sun, Xue; Jin, Haoliang; Zhang, Lin; Hu, Wei; Li, Yahe; Xu, Nianjun

    2015-07-01

    Twenty species of seaweed were collected from the coast of Zhejiang, China, extracted with ethanol, and screened for algicidal activity against red tide microalgae Heterosigma akashiwo and Prorocentrum micans. Inhibitory effects of fresh and dried tißsues of green alga Ulva intestinalis were assessed and the main algicidal compounds were isolated, purified, and identified. Five seaweed species, U. intestinalis, U. fasciata, Grateloupia romosissima, Chondria crassicaulis, and Gracilariopsis lemaneiformis, were investigated for their algicidal activities. Fresh tissues of 8.0 and 16.0 mg/mL of U. intestinalis dissolved in media significantly inhibited growth of H. akashiwo and P. micans, respectively. Dried tissue and ethyl acetate (EtOAc) extracts of U. intestinalis at greater than 1.2 and 0.04 mg/mL, respectively, were fatal to H. akashiwo, while its water and EtOAc extracts in excess of 0.96 and 0.32 mg/mL, respectively, were lethal to P. micans. Three algicidal compounds in the EtOAc extracts were identified as 15-ethoxy- (6z,9z,12z)-hexadecatrienoic acid (I), (6E,9E,12E)-(2-acetoxy-β-D-glucose)-octadecatrienoic acid ester (II) and hexadecanoic acid (III). Of these, compound II displayed the most potent algicidal activity with IC50 values of 4.9 and 14.1 µg/mL for H. akashiwo and P. micans, respectively. Compound I showed moderate algicidal activity with IC50 values of 13.4 and 24.7 µg/mL for H. akashiwo and P. micans, respectively. These findings suggested that certain macroalgae or products therefrom could be used as effective biological control agents against red tide algae.

  18. Molecular characterisation of Giardia intestinalis assemblages from human isolates at a tertiary care centre of India

    Directory of Open Access Journals (Sweden)

    V Tak

    2014-01-01

    Full Text Available Purpose: The aim of the study was to determine the genetic heterogeneity of Giardia intestinalis isolates detected in stool samples of the study population using polymerase chain reaction assay and restriction fragment length polymorphism. We also tried to correlate the association/differences between the clinical symptomatology and infection by different assemblages (genotypes of G. intestinalis. Materials and Methods: This cross-sectional study was conducted from April 2008 to June 2010. A total of 40 adults (n = 40 and 42 children (n = 42 below the age of 12 years with the clinical suspicion of giardiasis and with the onset of one or more of the following five symptoms, i.e., loose stool, nausea, weight loss, fatigue and foul smelling faeces and confirmed laboratory diagnosis of giardiasis at least once during the current episode of diarrhoea were included in this study. Results: Of the 82 patients (males 66 enrolled in the study, 70 (85% presented with diarrhoea (56 males and 12 (15% without diarrhoea (10 males. Out of 70 diarrheic patients, 61 (87% had chronic diarrhoea, 8 (11.5% had acute diarrhoea and 1 (1.5% had persistent diarrhoea. Of the total patients, 63 (77% were clinically assessed and were apparently immunocompetent, whereas, 19 (23% immunocompromised patients had different underlying conditions besides giardiasis. Genotyping identified all 82 (100% isolates as assemblage B. Conclusion: We found that assemblage B of G. intestinalis presents with all kinds of clinical features ranging from asymptomatic carriage to acute, persistent or chronic diarrhoea.

  19. Intestinal microsporidiosis with Septata intestinalis in a patient with AIDS--response to albendazole.

    Science.gov (United States)

    Franzen, C; Müller, A; Schwenk, A; Salzberger, B; Fätkenheuer, G; Mahrle, G; Diehl, V; Schrappe, M

    1995-11-01

    Microsporidiosis is a common finding in HIV-infected patients who have diarrhoea. The species most commonly causing gastrointestinal disease is Enterocytozoon bieneusi. Recently Septata intestinalis has been described as a cause of diarrhoea and disseminated infection in patients with AIDS. A 44-year-old homosexual man with severe immunodeficiency (CD4 cell count 40/microliters) had a history of watery diarrhoea for 2 weeks. Microsporidian spores measuring 1.2 to 1.5 x 2.5 to 3.0 microns were found in stool samples. Electron microscopy of duodenal biopsies confirmed the diagnosis of intestinal microsporidiosis and showed parasitophorous vacuoles with the typical ultrastructure of S. intestinalis. The patient was treated with albendazole (400 mg twice daily) and became asymptomatic within 4 days. No spores could be detected in stool samples after a treatment period of 14 days. About 25 infections with S. intestinalis have been reported to date, and the case presented here is the first in a German patient. PMID:8586846

  20. Enteromorpha intestinalis Derived Seaweed Liquid Fertilizers as Prospective Biostimulant for Glycine max

    Directory of Open Access Journals (Sweden)

    Chetna Mathur

    2015-12-01

    Full Text Available ABSTRACT In the present study, the potential of seaweed liquid fertilizer (SLF of marine algae Enteromorpha intestinalis was evaluated for its effect on seed germination, yield, biochemical parameters and pigment characteristics of Glycine maxE. intestinalis was collected form Mandapam coast of Gulf of Mannar, Tamil Nadu, and the dried seaweeds were used for the preparation of SLF. G. max seeds were germinated with four different concentrations (20, 40, 60, and 100% of SLF; its growth and yield parameters were evaluated and compared with chemical fertilizer and control. The morphological and bio-chemical parameters such as seed germination (100%, root (6.6cm and shoot length (5.4 cm, carbohydrates (0.098 mg/g, protein (0.56 mg/g, pigment (0.444 mg/g chl a; 1.073 mg/g chl b; 3.70 mg/g carotenoids of the plant was found maximum at a concentration of 60% SLF. The phenol content (3.25 mg/g was maximum in 40% SLF. The GC-MS analysis of SLF revealed the presence of notable benzoic compounds involved in plant growth promotion. Results showed thatE. intestinalis derived SLF was potential biostimulant forG. max. Thus, marine algae based fertilizer could be an effective and alternate to the chemical fertilizers emphasizing the need for systematic evaluation programme for SLF on various crops.

  1. Ecological observations on the colonial ascidian Didemnum sp. in a New England tide pool habitat

    Science.gov (United States)

    Valentine, P.C.; Carman, M.R.; Blackwood, D.S.; Heffron, E.J.

    2007-01-01

    The colonial ascidian Didemnum sp. has colonized northwestern Atlantic coastal habitats from southern Long Island, New York, to Eastport, Maine. It is also present in offshore habitats of the Georges Bank fishing grounds. It threatens to alter fisheries habitats and shellfish aquacultures. Observations in a tide pool at Sandwich, MA from December 2003 to February 2006 show that Didemnum sp. tolerates water temperatures ranging from ≤ 1 to > 24 °C, with daily changes of up to 11 °C. It attaches to pebbles, cobbles, and boulders, and it overgrows other tunicates, seaweeds, sponges, and bivalves. From May to mid July, colonies appear as small patches on the bottoms of rocks. Colonies grow rapidly from July to September, with some growth into December, and they range in color from pink to pale yellow to pale orange. Colony health declines from October through April, presumably in response to changes in water temperatures, and this degenerative process is manifested by color changes, by the appearance of small dark brown spots that represent clumps of fecal pellets in the colony, by scavenging by periwinkles, and by a peeling-away of colonies from the sides of cobbles and boulders. At Sandwich, colonies died that were exposed to air at low tide. The species does not exhibit this seasonal cycle of growth and decline in subtidal habitats (40–65 m) on the Georges Bank fishing grounds where the daily climate is relatively stable and annual water temperatures range from 4 to 15 °C. Experiments in the tide pool with small colony fragments (5 to 9 cm2) show they re-attach and grow rapidly by asexual budding, increasing in size 6- to 11-fold in the first 15 days. Didemnum sp. at Sandwich has no known predators except for common periwinkles (Littorina littorea) that graze on degenerating colonies in the October to April time period and whenever colonies are stressed by desiccation. The tendencies of the ascidian (1) to attach to firm substrates, (2) to rapidly overgrow

  2. Recurrent phagocytosis-induced apoptosis in the cyclical generation change of the compound ascidian Botryllus schlosseri.

    Science.gov (United States)

    Franchi, Nicola; Ballin, Francesca; Manni, Lucia; Schiavon, Filippo; Basso, Giuseppe; Ballarin, Loriano

    2016-09-01

    Colonies of the marine, filter-feeding ascidian Botryllus schlosseri undergo cyclical generation changes or takeovers. These events are characterised by the progressive resorption of adult zooids and their replacement by their buds that grow to adult size, open their siphons and start filtering. During the take-over, tissues of adult zooids undergo extensive apoptosis; circulating, spreading phagocytes enter the effete tissues, ingest dying cells acquiring a giant size and a round morphology. Then, phagocytes re-enter the circulation where they represent a considerable fraction (more than 20%) of circulating haemocytes. In this study, we evidence that most of these circulating phagocytes show morphological and biochemical signs of apoptosis. Accordingly, these phagocytes express transcripts of orthologues of the apoptosis-related genes Bax, AIF1 and PARP1. Electron microscopy shows that giant phagocytes contain apoptotic phagocytes inside their own phagocytic vacuole. The transcript of the orthologues of the anti-apoptotic gene IAP7 was detected only in spreading phagocytes, mostly abundant in phases far from the take-over. Therefore, the presented data suggest that, at take-over, phagocytes undergo phagocytosis-induced apoptosis (PIA). In mammals, PIA is assumed to be a process assuring the killing and the complete elimination of microbes, by promoting the disposal of terminally differentiated phagocytes and the resolution of infection. In B. schlosseri, PIA assumes a so far undescribed role, being required for the control of asexual development and colony homeostasis. PMID:27106705

  3. Immune responsiveness associated with experimental Encephalitozoon intestinalis infection in immunocompetent rats

    Directory of Open Access Journals (Sweden)

    Omalu ICJ

    2007-01-01

    Full Text Available Purpose: Microsporidial infections have been recognized as an increasingly important infection in immuncompromised patients, particularly those infected with HIV/AIDS. This study was designed to study immune responses associated with experimental Encephalitozoon intestinalis infection in immunocompetent rats. Materials and Methods: Thirty-four Rats in 3 groups, A (Control, B (Intraperitoneal and C (Oral were given injections of 0.5 ml of 2 x 10 6 of purified spores of Encephalitotozoon intestinalis spores and were observed for serum specific IgG for 21 days using both direct and indirect ELISA. Results: In indirect ELISA, specific lgG were detected on days 7, 14 and 21 for the group B rats and on day 21 for group C and in direct ELISA method, specific lgG were detected in-group B rats on days 7 and 21, for group C rats on day 21 only, while in the control rats, specific lgG were not detected. There was no significant difference between the direct and indirect methods (df=1, X 2 , P>0.05. E. intestinalis was observed in stool samples of rats in 1/12 (08.33% on days 14 and 21 in group B, and in 4/10 (33.33%, 3/10 (25.00% and 2/10 (16.67% on days 7, 14 and 21 respectively in group C. In group A, which is the control rats, no microsporidia were observed on days 0, 7, 14 and 21. Conclusions: There were no changes in the T-lymphocyte counts of rats prior to and after inoculation with spores. Extensive lesions were observed along the intestinal walls especially on the middle and lower sections of group C rats only.

  4. Cryptosporidium spp., Giardia intestinalis, and Enterocytozoon bieneusi in Captive Non-Human Primates in Qinling Mountains.

    Science.gov (United States)

    Du, Shuai-Zhi; Zhao, Guang-Hui; Shao, Jun-Feng; Fang, Yan-Qin; Tian, Ge-Ru; Zhang, Long-Xian; Wang, Rong-Jun; Wang, Hai-Yan; Qi, Meng; Yu, San-Ke

    2015-08-01

    Non-human primates (NHPs) are confirmed as reservoirs of Cryptosporidium spp., Giardia intestinalis, and Enterocytozoon bieneusi. In this study, 197 fresh fecal samples from 8 NHP species in Qinling Mountains, northwestern China, were collected and examined using multilocus sequence typing (MLST) method. The results showed that 35 (17.8%) samples were positive for tested parasites, including Cryptosporidium spp. (3.0%), G. intestinalis (2.0%), and E. bieneusi (12.7%). Cryptosporidium spp. were detected in 6 fecal samples of Macaca mulatta, and were identified as C. parvum (n=1) and C. andersoni (n=5). Subtyping analysis showed Cryptosporidium spp. belonged to the C. andersoni MLST subtype (A4, A4, A4, and A1) and C. parvum 60 kDa glycoprotein (gp60) subtype IId A15G2R1. G. intestinalis assemblage E was detected in 3 M. mulatta and 1 Saimiri sciureus. Intra-variations were observed at the triose phosphate isomerase (tpi), beta giardin (bg), and glutamate dehydrogenase (gdh) loci, with 3, 1, and 2 new subtypes found in respective locus. E. bieneusi was found in Cercopithecus neglectus (25.0%), Papio hamadrayas (16.7%), M. mulatta (16.3%), S. sciureus (10%), and Rhinopithecus roxellana (9.5%), with 5 ribosomal internal transcribed spacer (ITS) genotypes: 2 known genotypes (D and BEB6) and 3 novel genotypes (MH, XH, and BSH). These findings indicated the presence of zoonotic potential of Cryptosporidium spp. and E. bieneusi in NHPs in Qinling Mountains. This is the first report of C. andersoni in NHPs. The present study provided basic information for control of cryptosporidiosis, giardiasis, and microsporidiosis in human and animals in this area. PMID:26323837

  5. Risk of Giardia intestinalis infection in children from an artificially recharged groundwater area in Mexico City.

    Science.gov (United States)

    Cifuentes, Enrique; Suárez, Leticia; Espinosa, Martha; Juárez-Figueroa, Luis; Martínez-Palomo, Adolfo

    2004-07-01

    The objective of this study was to assess the risk of infection with Giardia intestinalis in children living in an area with artificial groundwater recharge and potable water reuse in Mexico City. Eligible wells and surrounding homesteads were defined by using a geographic information system. Five wells were tested for G. intestinalis cysts per 400 liters of water. A total of 750 eligible households were visited during two cross-sectional surveys. Stool samples were provided by 986 children in the rainy season study and 928 children during the dry season survey for parasitologic tests. Their guardians provided information on water, sanitation, hygiene, and socioeconomic variables. The prevalence rates of G. intestinalis infection were 9.4% in the rainy season and 4.4% in the dry season. Higher rates of infection were observed in older individuals (9.5% and 10.6%) and girls had a lower risk of infection than boys (odds ratio [OR] =0.55, 95% confidence interval [CI] = 0.34, 0.88 in the rainy season and OR = 0.47, 95% CI = 0.25, 0.90 in the dry season). During the wet season survey, a health risk was detected among those storing water in unprotected receptacles (OR = 4.00, 4.69, and 5.34 for those using uncovered jars, cisterns or tanks, and buckets, respectively), and bathing outside the dwelling, i.e., using a tap (OR = 1.93, 95% CI = 1.10, 3.39). A health risk was also detected among children from households with unsafe food hygiene practices (OR =2.41, 95% CI =1.10, 5.30) and those with no hand-washing habits (OR = 2.27, 95% CI = 1.00, 5.20). Groundwater reserves are at risk of fecal pollution, as indicated by the presence of G. intestinalis cysts. However, the endemic pattern of intestinal infection reflects low standards of personal hygiene and unsafe drinking water storage and food-related practices at household level. Prevention activities must address health education and environmental protection policies. PMID:15238691

  6. Characterization of RNase MRP RNA and novel snoRNAs from Giardia intestinalis and Trichomonas vaginalis

    Directory of Open Access Journals (Sweden)

    Chen Xiaowei S

    2011-11-01

    Full Text Available Abstract Background Eukaryotic cells possess a complex network of RNA machineries which function in RNA-processing and cellular regulation which includes transcription, translation, silencing, editing and epigenetic control. Studies of model organisms have shown that many ncRNAs of the RNA-infrastructure are highly conserved, but little is known from non-model protists. In this study we have conducted a genome-scale survey of medium-length ncRNAs from the protozoan parasites Giardia intestinalis and Trichomonas vaginalis. Results We have identified the previously 'missing' Giardia RNase MRP RNA, which is a key ribozyme involved in pre-rRNA processing. We have also uncovered 18 new H/ACA box snoRNAs, expanding our knowledge of the H/ACA family of snoRNAs. Conclusions Results indicate that Giardia intestinalis and Trichomonas vaginalis, like their distant multicellular relatives, contain a rich infrastructure of RNA-based processing. From here we can investigate the evolution of RNA processing networks in eukaryotes.

  7. The anti-giardial effectiveness of fungal and commercial chitosan against Giardia intestinalis cysts in vitro.

    Science.gov (United States)

    Yarahmadi, Mohammad; Fakhar, Mahdi; Ebrahimzadeh, Mohammad Ali; Chabra, Aroona; Rahimi-Esboei, Bahman

    2016-03-01

    Chitosan with poly-N-acetylglucosamine sequences is a deacetylated derivative of chitin that can be found in the exoskeletons of crabs, shrimp and lobsters, the cuticles of insects and the cell walls of fungi. The aim of the present study was to compare the effects of fungal chitosan (FC) prepared from the cell walls of Penicillium viridicatum and Penicillium aurantiogriseum with commercially available chitosan (CC) against Giardia intestinalis cysts in vitro. The giardia cysts were isolated using a sucrose method. Four concentrations (50, 100, 200 and 400 μg/ml) of each type of prepared chitosan were applied for 10, 30, 60 and 180 min. The viability of the cysts was checked via 0.1 % eosin staining. Our results indicate that P. viridicatum (with a 47.5 % DD) and P. aurantiogriseum (with a 47.3 % DD) at different concentrations after 180 min precipitated, respectively, 56, 69, 81 and 100 %, and 63, 75, 86 and 100 % mortality rates. CC (with a 54 % DD) showed 79, 84, 93 and 100 % mortality rates. In conclusion, both FC and CC at 400 μg/ml concentrations after 180 min of exposure showed the most potent effect against G. intestinalis cysts. Accordingly, chitosan could be suggested as a new natural nanoform agent for future research in the safe and effective treatment of Giardia infections. PMID:27065602

  8. Characteristics and antioxidant of Ulva intestinalis sulphated polysaccharides extracted with different solvents.

    Science.gov (United States)

    Peasura, Napassorn; Laohakunjit, Natta; Kerdchoechuen, Orapin; Wanlapa, Sorada

    2015-11-01

    Ulva intestinalis, a tubular green seaweed, is a rich source of nutrient, especially sulphated polysaccharides. Sulphated polysaccharides from U. intestinalis were extracted with distilled water, 0.1N HCl, and 0.1N NaOH at 80°C for 1, 3, 6, 12, and 24h to study the effect of the extraction solvent and time on their chemical composition and antioxidant activity. Different types of solvents and extraction time had a significant influence on the chemical characteristics and antioxidant activity (p<0.05). Monosaccharide composition and FT-IR spectra analyses revealed that sulphated polysaccharides from all solvent extractions have a typical sugar backbone (glucose, rhamnose, and sulphate attached at C-2 or C-3 of rhamnose). Sulphated polysaccharides extracted with acid exhibited greater antioxidant activity than did those extracted with distilled water and alkali. The results indicated that solvent extraction could be an efficacious method for enhancing antioxidant activity by distinct molecular weight and chemical characteristic of sulphated polysaccharides. PMID:26400737

  9. Protection against diarrhea associated with Giardia intestinalis is lost with Multi-Nutrient Supplementation: A Study in Tanzanian Children

    NARCIS (Netherlands)

    Veenemans, J.; Mank, T.; Ottenhof, M.; Baidjoe, A.Y.; Mbugi, E.V.; Demir, A.Y.; Wielders, J.P.M.; Savelkoul, H.F.J.; Verhoef, J.C.M.

    2011-01-01

    Background - Asymptomatic carriage of Giardia intestinalis is highly prevalent among children in developing countries, and evidence regarding its role as a diarrhea-causing agent in these settings is controversial. Impaired linear growth and cognition have been associated with giardiasis, presumably

  10. Ultrastructural study of vitellogenesis of Ligula intestinalis (Diphyllobothriidea) reveals the presence of cytoplasmic-like cell death in cestodes

    Czech Academy of Sciences Publication Activity Database

    Yoneva, Aneta; Scholz, Tomáš; Młocicki, D.; Kuchta, Roman

    2015-01-01

    Roč. 12, DEC 4 2015 (2015), s. 35. ISSN 1742-9994 R&D Projects: GA ČR GAP506/12/1632 Institutional support: RVO:60077344 Keywords : Vitellogenesis * Ultrastructure * Paraptosis * Cestoda * Diphyllobothriidea * Ligula intestinalis Subject RIV: EG - Zoology Impact factor: 3.051, year: 2014

  11. Pneumatosis cystoides intestinalis in patients with antinuclear antibody negative systemic lupus erythematosus and dermatomyositis: report of two cases

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Soo Yeon; Cho, On Koo; Koh, Byung Hee; Kim, Yong Soo; Song, Soon Young [College of Medicine, Hanyang University, Seoul (Korea, Republic of)

    2007-04-15

    Pneumatosis cystoides intestinalis (PCI) occurring in association with collagen vascular disease is an unusual combination that presents with intramural gas in the gastrointestinal tract. We report two cases of PCI, one with antinuclear antibody (ANA) negative SLE and the other with dermatomyositis, with a review of the relevant literature.

  12. Portal venous gas and pneumatosis intestinalis. Rare radiological signs in a rare complication of Meckel’s diverticulum

    OpenAIRE

    A Izzidien; Mekhail, P; Farag, M; Gupta, V.; Naguib, N

    2010-01-01

    Portal vein gas is an uncommon ominous radiological sign usually harbouring an intra abdominal catastrophe. When accompanied by pneumatosis intestinalis, it is more predictive of bowel ischemia. We present a case presented with both signs, who suffered from a rare complication of Meckel’s diverticulum.

  13. Ciliary and mucus-net filter feeding, with special reference to fluid mechanical characteristics

    DEFF Research Database (Denmark)

    Jørgensen, C.B.; Kiørboe, Thomas; Møhlenberg, F.;

    1984-01-01

    Filter characteristics were determined and compared in ciliary and mucus-net filter feeders. The ciliary feeders include the polychaete Sabella penicillus, the brachiopod Terebratulina retusa, the marine bivalves Monia squama, Cardium glaucum, and Petricola pholadiformis, and the freshwater...... bivalves Dreissena polymorpha, Unio pictorum and Anodonta cygnea. The mucus-net feeders are the polychaete Chaetopterus variopedatus, the gastropod Crepidula fornicata and the ascidians Styela clava, Ciona intestinalis, Ascidia virginea, A. obliqua and A. mentula. Efficiencies of particle retention as a...... function of particle size was determined by counting of particles in samples of inhalant and exhalant water. The lower threshold for efficient particle retention varied from .apprx. 6 .mu.m in T. retuso to .apprx. 1 .mu.m in D. polymorpha. Mucus nets efficiently retained particles down to 1-2 .mu.m. Filter...

  14. Evolution of anterior Hox regulatory elements among chordates

    Directory of Open Access Journals (Sweden)

    Natale Alfonso

    2011-11-01

    Full Text Available Abstract Background The Hox family of transcription factors has a fundamental role in segmentation pathways and axial patterning of embryonic development and their clustered organization is linked with the regulatory mechanisms governing their coordinated expression along embryonic axes. Among chordates, of particular interest are the Hox paralogous genes in groups 1-4 since their expression is coupled to the control of regional identity in the anterior nervous system, where the highest structural diversity is observed. Results To investigate the degree of conservation in cis-regulatory components that form the basis of Hox expression in the anterior nervous system, we have used assays for transcriptional activity in ascidians and vertebrates to compare and contrast regulatory potential. We identified four regulatory sequences located near the CiHox1, CiHox2 and CiHox4 genes of the ascidian Ciona intestinalis which direct neural specific domains of expression. Using functional assays in Ciona and vertebrate embryos in combination with sequence analyses of enhancer fragments located in similar positions adjacent to Hox paralogy group genes, we compared the activity of these four Ciona cis-elements with a series of neural specific enhancers from the amphioxus Hox1-3 genes and from mouse Hox paralogous groups 1-4. Conclusions This analysis revealed that Kreisler and Krox20 dependent enhancers critical in segmental regulation of the hindbrain appear to be specific for the vertebrate lineage. In contrast, neural enhancers that function as Hox response elements through the action of Hox/Pbx binding motifs have been conserved during chordate evolution. The functional assays reveal that these Hox response cis-elements are recognized by the regulatory components of different and extant species. Together, our results indicate that during chordate evolution, cis-elements dependent upon Hox/Pbx regulatory complexes, are responsible for key aspects of

  15. Some effects of copper and cadmium on Enteromorpha intestinalis (L. ) link

    Energy Technology Data Exchange (ETDEWEB)

    Alexander, L.M.

    1987-01-01

    This thesis describes some effects of copper and cadmium on Enteromorpha intestinalis (L.) Link, a common estuarine and coastal intertidal alga, with particular reference to its use as a bioaccumulator of heavy metals. Exposure to copper and cadmium resulted in loss of color and intracellular disorganization, but not in a predictive manner. Copper also inhibited reproduction, the growth of adult plants,the development of zoospores and sometimes resulted in a loss of biomass. A protocol for the testing of Vital stains was developed and Neutral Red was determined to be a suitable stain to assess cell death in those adult populations investigated but was found unsuitable for work with germlings. Exposure to copper resulted in a greater degree of cell death in otherwise healthy thalli.

  16. The Epidemiology of Ligula intestinalis (Phylum Platyhelminthes within the Cyprinid Populations Inhabiting the Danubian Delta Area

    Directory of Open Access Journals (Sweden)

    Laura Daniela Urdes

    2013-05-01

    Full Text Available This prevalence study was conducted between the years 2003 and 2008. The survey aimed at assessing the occurrence of the plerocercoid Ligula intestinalis within five cyprinid populations, cyprinus carpio, carassius gibelio, hypophtalmichthys molitrix, ctenopharingodon idella and abramis brama, from four natural complexes: Sontea-Fortuna, Gorgova-Uzlina, Dunavat-Dranov and Razim-Sinoie. Of the four study sites, the highest frequency of the disease was recorded within the Razim-Sinoie lakes, probably due to an apparently higher number of piscivorous birds and copepods that may have inhabited this area during the study time period. Only A. brama and H. molitrix were found infected by the helminth, with a mean prevalence of the cases in A. brama of 16.31% and in H. molitrix of 13.06%.

  17. Protozoa Intestinalis

    OpenAIRE

    Hemma Yulfi

    2006-01-01

    Protozoa intestinal terdiri atas amebae, flagellata, dan cilliata. Termasuk amebae intestinal adalah Entamoeba histolytica, Entamoeba coli, Entamoeba hartmanni, Endolimax nana, Iodamoeba butschlii, Dientamoeba fragilis, dan Blastocystis hominis, oleh Hemma Yulfi 06001187

  18. Antiproliferative activity of methanolic extracts from two green algae, Enteromorpha intestinalis and Rizoclonium riparium on HeLa cells

    OpenAIRE

    Paul, Subhabrata; Kundu, Rita

    2013-01-01

    Background Natural compounds can be alternative sources for finding new lead anti-cancer molecules. Marine algae have been a traditional source for bioactive compounds. Enteromorpha intestinalis and Rhizoclonium riparium are two well distributed saline/brackish water algae from Sundarbans. There’s no previous report of these two for their anti-proliferative activities. Methods Cytotoxicity of the algal methanolic extracts (AMEs) on HeLa cells were assayed by 3-(4, 5-dimethylthiazol-2-yl)-2, 5...

  19. Protection against diarrhea associated with Giardia intestinalis is lost with Multi-Nutrient Supplementation: A Study in Tanzanian Children

    OpenAIRE

    Veenemans, J.; Mank, T.; Ottenhof, M.; Baidjoe, A. Y.; Mbugi, E.V.; Demir, A.Y.; Wielders, J.P.M.; Savelkoul, H. F. J.; Verhoef, J.C.M.

    2011-01-01

    BACKGROUND: Asymptomatic carriage of Giardia intestinalis is highly prevalent among children in developing countries, and evidence regarding its role as a diarrhea-causing agent in these settings is controversial. Impaired linear growth and cognition have been associated with giardiasis, presumably mediated by malabsorption of nutrients. In a prospective cohort study, we aim to compare diarrhea rates in pre-school children with and without Giardia infection. Because the study was conducted in...

  20. Antimicrobial Activity of the Crude Extracts of Compound Ascidians, Didemnum candidum and Didemnum psammathodes (Tunicata: Didemnidae from Mandapam (South East Coast of India

    Directory of Open Access Journals (Sweden)

    S. Mohamed Hussain

    2009-10-01

    Full Text Available Many cytotoxic compounds of therapeutic interest have been isolated from marine organisms. In thepresent study two species of compound ascidians Didemnum psammathodes and Didemnum candidum wereassayed for their antimicrobial activity against eight bacterial and four fungal pathogens. The antimicrobialactivity of the crude extract of ascidian shows inhibitory activity against almost all the eight strains. However,D. psammathodes shows prominent antibacterial activity than that of Didemnum candidum. Whereas noremarkable antifungal activity was noticed against the ascidian crude extract. The maximum inhibition zone(15 mm was observed against Salmonella typhi in the crude methanol extract of D. psammathodes and theminimum inhibition zone (1 mm was noticed against Vibrio cholera and Staphylococcus aureas in the crudeacetone extract of Didemnum candidum. In D. psammathodes the crude methanol extract the range of inhibitionof the bacteria varied from 2–15 mm with an average of 4.3 mm. According to fungi only Aspergillus niger andPenicillium sp. were showed the trace activity against few crude extract and remaining two fungal pathogensshows negative result. In the present result two way analysis of variance was showing that there was asignificant difference between the extracts as well as the strains (p<0.05.

  1. Identification of Eusynstyelamide B as a Potent Cell Cycle Inhibitor Following the Generation and Screening of an Ascidian-Derived Extract Library Using a Real Time Cell Analyzer

    Directory of Open Access Journals (Sweden)

    Michelle S. Liberio

    2014-10-01

    Full Text Available Ascidians are marine invertebrates that have been a source of numerous cytotoxic compounds. Of the first six marine-derived drugs that made anticancer clinical trials, three originated from ascidian specimens. In order to identify new anti-neoplastic compounds, an ascidian extract library (143 samples was generated and screened in MDA-MB-231 breast cancer cells using a real-time cell analyzer (RTCA. This resulted in 143 time-dependent cell response profiles (TCRP, which are read-outs of changes to the growth rate, morphology, and adhesive characteristics of the cell culture. Twenty-one extracts affected the TCRP of MDA-MB-231 cells and were further investigated regarding toxicity and specificity, as well as their effects on cell morphology and cell cycle. The results of these studies were used to prioritize extracts for bioassay-guided fractionation, which led to the isolation of the previously identified marine natural product, eusynstyelamide B (1. This bis-indole alkaloid was shown to display an IC50 of 5 µM in MDA-MB-231 cells. Moreover, 1 caused a strong cell cycle arrest in G2/M and induced apoptosis after 72 h treatment, making this molecule an attractive candidate for further mechanism of action studies.

  2. [Impact of Ligula intestinalis (L.1758) (Cestode), on the growth of Barbus setivimensis (Cyprinidae) in a lake system in Algeria].

    Science.gov (United States)

    Hadou-Sanoun, Ghania; Arab, Abdeslem; Lek-Ang, Sithan; Lek, Sovan

    2012-04-01

    The Algerian freshwater fish fauna is mainly represented by the Cyprinidae family, in particular, the genus Barbus. This is represented only by natural populations of the subgenus Barbus. The systematic, based mainly on the methods of biometrics, is quite different from one author to another. However, two nominal species are usually cited: Barbus callensis (Valenciennes, 1842), which is limited to the region of El Kala (eastern Algeria) and Barbus setivimensis (Valenciennes, 1842) in other parts of the North. During the ecological study of this fauna, many individuals were found infested with the tapeworm Ligula intestinalis (Linné, 1758), which led us to study the effect of this parasite on B. setivimensis using the ecological parasites' index (prevalence, abundance and parasite intensity) and to focus on the impact of the parasite on the growth of fish. Tapeworm L. intestinalis presents a wide geographical distribution and a complex lifecycle to multiple hosts: the cycle starts in the body of birds. The life expectancy in the major host is a maximum of 5 days, but in this time, they will lay a multitude of eggs. These eggs are passed into water via the faeces of the bird. Once in the aquatic medium, they hatch and are eaten by a wide range of copepod zooplankton (first intermediate host). The cycle continues when fish (second intermediate host) ingests the copepod. The worm then burrows through the gut wall and continues to develop in the fish's body cavity. The cycle is then complete when the bird (final host) eats the tapeworm-hosting fish. We studied the effects of diet, the hosting period, the habitat on the prevalence, abundance and intensity of the parasitic larvae plerocercoid L. intestinalis and the parasiting effect on the Cyprinids fishs of the genus Barbus in the Keddara dam (Boumerdes, Algeria) during one year. Although L. intestinalis was recorded in several host fish, the available data on the parameters of parasitism are limited and no studies are

  3. Indagine sulle malattie infiammatorie croniche intestinali in un'azienda ULSS veneta

    Directory of Open Access Journals (Sweden)

    G. Moretti

    2003-05-01

    Full Text Available

    Obiettivi: l’epidemiologia delle malattie infiammatorie croniche intestinali fino ad adesso in Italia è stata poco studiata. Da alcuni studi emerge una minor incidenza di questi fenomeni nel Sud Europa rispetto al Nord Europa e agli Stati Uniti. Lo scopo di questa indagine è quello di valutare l’incidenza della Rettocolite Ulcerosa (RU e del Morbo di Crohn (MC nella popolazione dell’Azienda ULSS 17, situata nella provincia di Padova.

    Metodi: per la realizzazione di questa indagine ci si è avvalsi della collaborazione di 23 Medici di Medicina Generale (MMG operanti in 14 comuni dell’ULSS 17. I dati sono stati prelevati dal sistema informatizzato comune ai 23 MMG (Millenium, in base ai codici 555 e 556 dell’ICD9. È stato considerato il periodo di tempo 1995 - 2001. La popolazione media di riferimento è di 29.740 abitanti. Risultati: nel periodo considerato sono stati registrati in totale 45 nuovi casi, 35 casi di RU e 10 di MC. L’incidenza media della RU è stata di 16,76/100.000, quella del MC di 4,7/100.000. La RU ha avuto un’incidenza maggiore nel sesso maschile (rapporto 2:1, mentre per il MC si rileva l’opposto (rapporto 2:3. L’età media alla diagnosi per la RU è stata di 44 anni, quella del MC di 51,9. Dall’analisi temporale si evidenzia un progressivo aumento dell’incidenza del MC, mentre la RCU è più costante.

    Conclusioni: paragonando i risultati ottenuti con quelli di altre indagini condotte in Italia, l’incidenza delle malattie infiammatorie croniche intestinali è apparentemente più elevata nel territorio dell’ULSS 17. Dalla revisione della letteratura nazionale e internazionale emerge che variazioni dell’incidenza di questi fenomeni possono essere ricondotte ad un diverso accesso ai servizi sanitari, a diverse pratiche diagnostiche o alla presenza di fattori di rischio di tipo genetico o ambientale

  4. The invasive potential of Giardia intestinalis in an in vivo model.

    Science.gov (United States)

    Reynoso-Robles, R; Ponce-Macotela, M; Rosas-López, L E; Ramos-Morales, A; Martínez-Gordillo, M N; González-Maciel, A

    2015-01-01

    Giardiasis is a neglected parasitic disease that affects primarily children, in whom it delays physical and mental development. The pathophysiology of giardiasis in not well understood, and most reports have identified Giardia intestinalis trophozoites only in the lumen and on the brush border of the small intestine. We identified Giardia trophozoites within the epithelium of the small intestine of a lactose intolerance patient. The Giardia trophozoites were obtained and cultured in vitro. In addition, we demonstrated Giardia trophozoite invasion in an animal model. Giardia trophozoites invaded the intestinal mucosa and submucosa of infected gerbils. The invasive trophozoites were observed at 21, 30 and 60 days age, and the average numbers of invaded sites were 17 ± 5, 15 ± 4, and 9 ± 3, respectively. We found trophozoites between epithelial cells, at the base of empty goblet cells, in lacteal vessels and within the submucosa. The morphological integrity of the invasive trophozoites was demonstrated via electron microscopy. The analysis of the gerbils infected with the trophozoites of the WB reference strain did not show intraepithelial trophozoites. These results demonstrate another Giardia pathogenic mechanism, opening the door to numerous future studies. PMID:26470844

  5. Pneumatosis intestinalis and portal venous gas secondary to Gefitinib therapy for lung adenocarcinoma

    Directory of Open Access Journals (Sweden)

    Lee Joo

    2012-03-01

    Full Text Available Abstract Background Pneumatosis intestinalis (PI, defined as the presence of gas in the bowel wall, and portal venous gas (PVG are relatively rare radiological findings. Although several chemotherapeutic agents and anti-vascular endothelial growth factor agents are reported to be associated with PI and PVG, an association with anti-epidermal growth factor receptor (EGFR agents has not been described previously. Case presentation The present report describes a case of PI and PVG secondary to treatment with an EGFR tyrosine kinase inhibitor. A 66-year-old woman who had been diagnosed with metastatic lung adenocarcinoma presented with nausea, vomiting and abdominal distension after commencing gefitinib. A computed tomography (CT scan of the abdomen revealed PI extending from the ascending colon to the rectum, hepatic PVG, and infarction of the liver. Gefitinib therapy was discontinued immediately and the patient was managed conservatively. A follow-up CT scan 2 weeks later revealed that the PI and hepatic PVG had completely resolved. Conclusion This is the first report of PI and PVG caused by EGFR tyrosine kinase inhibitor. Although these complications are extremely rare, clinicians should be aware of the risk of PI and PVG in patients undergoing targeted molecular therapy.

  6. Two New Xylanases with Different Substrate Specificities from the Human Gut Bacterium Bacteroides intestinalis DSM 17393

    KAUST Repository

    Hong, Pei-Ying

    2014-01-24

    Xylan is an abundant plant cell wall polysaccharide and is a dominant component of dietary fiber. Bacteria in the distal human gastrointestinal tract produce xylanase enzymes to initiate the degradation of this complex heteropolymer. These xylanases typically derive from glycoside hydrolase (GH) families 10 and 11; however, analysis of the genome sequence of the xylan-degrading human gut bacterium Bacteroides intestinalis DSM 17393 revealed the presence of two putative GH8 xylanases. In the current study, we demonstrate that the two genes encode enzymes that differ in activity. The xyn8A gene encodes an endoxylanase (Xyn8A), and rex8A encodes a reducing-end xylose-releasing exo-oligoxylanase (Rex8A). Xyn8A hydrolyzed both xylopentaose (X5) and xylohexaose (X6) to a mixture of xylobiose (X2) and xylotriose (X3), while Rex8A hydrolyzed X3 through X6 to a mixture of xylose (X1) and X2. Moreover, rex8A is located downstream of a GH3 gene (xyl3A) that was demonstrated to exhibit β-xylosidase activity and would be able to further hydrolyze X2 to X1. Mutational analyses of putative active site residues of both Xyn8A and Rex8A confirm their importance in catalysis by these enzymes. Recent genome sequences of gut bacteria reveal an increase in GH8 Rex enzymes, especially among the Bacteroidetes, indicating that these genes contribute to xylan utilization in the human gut.

  7. Constitutive aneuploidy and genomic instability in the single-celled eukaryote Giardia intestinalis.

    Science.gov (United States)

    Tůmová, Pavla; Uzlíková, Magdalena; Jurczyk, Tomáš; Nohýnková, Eva

    2016-08-01

    Giardia intestinalis is an important single-celled human pathogen. Interestingly, this organism has two equal-sized transcriptionally active nuclei, each considered diploid. By evaluating condensed chromosome numbers and visualizing homologous chromosomes by fluorescent in situ hybridization, we determined that the Giardia cells are constitutively aneuploid. We observed karyotype inter-and intra-population heterogeneity in eight cell lines from two clinical isolates, suggesting constant karyotype evolution during in vitro cultivation. High levels of chromosomal instability and frequent mitotic missegregations observed in four cell lines correlated with a proliferative disadvantage and growth retardation. Other cell lines, although derived from the same clinical isolate, revealed a stable yet aneuploid karyotype. We suggest that both chromatid missegregations and structural rearrangements contribute to shaping the Giardia genome, leading to whole-chromosome aneuploidy, unequal gene distribution, and a genomic divergence of the two nuclei within one cell. Aneuploidy in Giardia is further propagated without p53-mediated cell cycle arrest and might have been a key mechanism in generating the genetic diversity of this human pathogen. PMID:27004936

  8. A study of infestation of Alburnoides bipunctatus with Ligula intestinalis in Latian reservoir Dam Lake, Tehran province, Iran: A histopathological stud

    Directory of Open Access Journals (Sweden)

    Iraj Sohrabi Haghdoos

    2011-06-01

    Full Text Available . Objective: The objective of this study was to report infestation of the fish with Ligula intestinalis as a food borne zoonoses and to study its histopathological effects on one Alburnoides bipunctatus in Latian reservoir Dam Lake, Tehran province, Iran. Material and methods: In July 2010, 6 fish (Alburnoides bipunctatus from Latian reservoir Dam Lake, Tehran province, Iran were referred to Laboratory. After autopsy, two of them (Mature and Female were found infested with plerocercoid of Ligula intestinalis based on taxonomical features. For histopathological studies samples were stained with Haematoxylin and Eosin (H&E and observed under light microscopy. Results: Pathological findings showed inflammation of the reservoir adipose tissue (in the loose conjunctive tissue between lipocytes surrounding intestine. Severe atrophy in follicular cells of ovary was evident. In liver cholangiohepastitis with metaplastic hyperplasia was seen. Conclusion: Considering the importance ofLigula intestinalis as a food borne parasite, performance of other comprehensive studies is a necessity.

  9. Cytotoxicity of actinomycetes associated with the ascidian Eudistoma vannamei (Millar, 1977, endemic of northeastern coast of Brazil

    Directory of Open Access Journals (Sweden)

    Paula C Jimenez

    2013-04-01

    Full Text Available Previous studies demonstrated that the crude extract of the ascidian Eudistoma vannamei, endemic from northeasttern Brazil, strongly hinders growth of tumor cells in vitro by inducing apoptosis due to tryptophan derivatives, which are commonly found in bacteria. This study presents a bioactivity-guided screening among actinomycetes, associated with E. vannamei, aiming at recognizing active principles with biological relevance. Twenty strains of actinomycetes, designated as EVA 0101 through 0120, were isolated from colonies of E. vannamei among which 11 were selected for cytotoxicity evaluation. The extracts from EVA 0102, 0103, 0106, 0109 and 0113 were the most active, and were further studied for IC50 determination and chemical analysis by ¹H NMR. IC50 values obtained ranged from 3.62 µg mL-1 (for EVA 0109 in leukemia cells to 84.65 µg/mL (for EVA 0106 in melanoma cells. All active extracts exhibited the same TLC and spectroscopic profiles, suggesting the presence of quinones and other related secondary metabolites. Furthermore, these strains were identified and compared based on their respective 16S rRNA sequences. The results herein identified the five strains as Micromonospora spp. while phylogenetic analysis suggests that they are possibly two different Micromonospora species producing the cytotoxic compounds.

  10. Msxb is a core component of the genetic circuitry specifying the dorsal and ventral neurogenic midlines in the ascidian embryo.

    Science.gov (United States)

    Roure, Agnès; Darras, Sébastien

    2016-01-01

    The tail ascidian larval peripheral nervous system is made up of epidermal sensory neurons distributed more or less regularly in ventral and dorsal midlines. Their formation occurs in two-steps: the ventral and dorsal midlines are induced as neurogenic territories by Fgf9/16/20 and Admp respectively. The Delta2/Notch interaction then controls the number of neurons that form. The genetic machinery acting between the inductive processes taking place before gastrulation and neuron specification at tailbud stages are largely unknown. The analysis of seven transcription factors expressed in the forming midlines revealed an unexpected complexity and dynamic of gene expression. Their systematic overexpression confirmed that these genes do not interact following a linear cascade of activation. However, the integration of our data revealed the distinct key roles of the two upstream factors Msxb and Nkx-C that are the earliest expressed genes and the only ones able to induce neurogenic midline and ESN formation. Our data suggest that Msxb would be the primary midline gene integrating inputs from the ventral and dorsal inducers and launching a pan-midline transcriptional program. Nkx-C would be involved in tail tip specification, in maintenance of the pan-midline network and in a posterior to anterior wave controlling differentiation. PMID:26592100

  11. First report of zoonotic Cryptosporidium spp., Giardia intestinalis and Enterocytozoon bieneusi in golden takins (Budorcas taxicolor bedfordi).

    Science.gov (United States)

    Zhao, Guang-Hui; Du, Shuai-Zhi; Wang, Hui-Bao; Hu, Xiong-Feng; Deng, Ming-Jun; Yu, San-Ke; Zhang, Long-Xian; Zhu, Xing-Quan

    2015-08-01

    Genetic study of Cryptosporidium spp., Giardia intestinalis and Enterocytozoon bieneusi at species/assemblage/genotype/subtype level facilitates understanding their mechanical transmissions and underpins their control. A total of 191 fresh faecal samples were collected from golden takins in China and examined using multilocus sequence typing (MLST). Cryptosporidium spp. was detected in 15 faecal samples (7.9%), including Cryptosporidium parvum (2/15) and Cryptosporidium andersoni (13/15). MLST tool identified C. andersoni subtypes (A1, A4, A4, A1) and (A4, A4, A4, A1), and C. parvum gp60 gene subtype IId A19G1. The prevalence of G. intestinalis infection was 8.9% (17/191) and assemblage analysis identified 14 assemblage E and three assemblage B. Intra-variations were observed at triose phosphate isomerase (tpi), beta giardin (bg) and glutamate dehydrogenase (gdh) loci within the assemblage E, showing seven, three and three new subtypes in respective locus. Ten and one multilocus genotypes (MLGs) were present in assemblages E and B, respectively. E. bieneusi infection was positive in 14.7% (28/191) of the examined specimens, with three genotypes known (BEB6, D and I) and four novel internal transcribed spacer (ITS) genotypes (TEB1-TEB4). The present study revealed, for the first time, the presence of zoonotic C. parvum IId A19G1, G. intestinalis assemblage B and E. bieneusi genotype D and four novel genotypes in golden takins in China. These findings expand the host range of three zoonotic pathogens and have important implications for controlling cryptosporidiosis, giardiasis and microsporidiosis in humans and animals. PMID:26190449

  12. Ligula intestinalis infection is associated with alterations of both brain and gonad aromatase expression in roach (Rutilus rutilus).

    Science.gov (United States)

    Boulange-Lecomte, C; Geraudie, P; Forget-Leray, J; Gerbron, M; Minier, C

    2011-09-01

    The tapeworm Ligula intestinalis commonly infests roach (Rutilus rutilus) and is responsible for the inhibition of gonad development. In order to better understand the effect of the plerocercoid on fish physiology, and to discriminate parasitization effects from those of endocrine-disrupting compounds (EDC), Cyp19b and Cyp19a aromatase expression was investigated by real-time quantitative polymerase chain reaction (PCR) in brain and gonads of ligulosed roach, caught from a reference site. Data were compared to reproductive and endocrine endpoints previously reported in a larger cohort study (including the sampled population of the present one), such as gonadosomatic index, Fulton index, gonadal histology, plasma sex steroid levels and brain aromatase activity. A decrease in Cyp19b expression in the brain of infected fish was demonstrated, in agreement with the reduction of aromatase activity previously described. In contrast, Cyp19a expression in the gonads appeared to be enhanced in ligulosed fish, in accordance with the presence of immature but differentiated sexual tissues. Together these results show that: (1) L. intestinalis infestation results in an alteration of aromatase expression which, in particular, may have profound effects on the fish brain; and (2) L. intestinalis infection must be considered as a major confounding factor in ecotoxicological studies using aromatase expression as an EDC biomarker. Moreover, the concordance between activity and expression--investigated for the first time in the same population--gives a functional relevance to the transcript aromatase dosage in the brain. Finally, quantitative PCR was confirmed as a sensitive approach, enabling aromatase status to be defined in the poorly developed gonads of ligulosed individuals. PMID:21062527

  13. A Rare Case of Gastric Myiasis in a Lion Caused by Gasterophilus intestinalis (Diptera: Gasterophilidae)-Case Report.

    Science.gov (United States)

    Ganjali, Maryam; Keighobadi, Mojtaba

    2016-09-01

    Myiasis is the infection caused by a variety of dipterous (fly) larvae in vertebrate's tissue (man and domestic or wild animals). Species of Gasterophilus are obligate parasite of horses, donkeys, zebras, elephants and rhinoceroses. There are records worldwide, but mostly, in tropical and subtropical regions. This case report describes a type of gastric myiasis caused by G. intestinalis in an old lion in a zoo in Sistan, southeast Iran. Myiasis in lions is rarely reported and this is the first report of gastric myiasis in lion. PMID:27308300

  14. Encephalitozoon intestinalis Inhibits Dendritic Cell Differentiation through an IL-6-Dependent Mechanism.

    Science.gov (United States)

    Bernal, Carmen E; Zorro, Maria M; Sierra, Jelver; Gilchrist, Katherine; Botero, Jorge H; Baena, Andres; Ramirez-Pineda, Jose R

    2016-01-01

    Microsporidia are a group of intracellular pathogens causing self-limited and severe diseases in immunocompetent and immunocompromised individuals, respectively. A cellular type 1 adaptive response, mediated by IL-12, IFNγ, CD4+, and CD8+ T cells has been shown to be essential for host resistance, and dendritic cells (DC) play a key role at eliciting anti-microsporidial immunity. We investigated the in vitro response of DC and DC precursors/progenitors to infection with Encephalitozoon intestinalis (Ei), a common agent of human microsporidosis. Ei-exposed DC cultures up-regulated the surface expression of MHC class II and the costimulatory molecules CD86 and CD40, only when high loads of spores were used. A vigorous secretion of IL-6 but not of IL-1β or IL-12p70 was also observed in these cultures. Ei-exposed DC cultures consisted of immature infected and mature bystander DC, as assessed by MHC class II and costimulatory molecules expression, suggesting that intracellular Ei spores deliver inhibitory signals in DC. Moreover, Ei selectively inhibited the secretion of IL-12p70 in LPS-stimulated DC. Whereas Ei-exposed DC promoted allogeneic naïve T cell proliferation and IL-2 and IFNγ secretion in DC-CD4+ T cell co-cultures, separated co-cultures with bystander or infected DCs showed stimulation or inhibition of IFNγ secretion, respectively. When DC precursors/progenitors were exposed to Ei spores, a significant inhibition of DC differentiation was observed without shifting the development toward cells phenotypically or functionally compatible with myeloid-derived suppressor cells. Neutralization experiments demonstrated that this inhibitory effect is IL-6-dependent. Altogether this investigation reveals a novel potential mechanism of immune escape of microsporidian parasites through the modulation of DC differentiation and maturation. PMID:26870700

  15. Encephalitozoon intestinalis inhibits dendritic cell differentiation through an IL-6-dependent mechanism

    Directory of Open Access Journals (Sweden)

    Carmen Elisa Bernal Silva

    2016-02-01

    Full Text Available AbstractMicrosporidia are a group of intracellular pathogens causing self-limited and severe diseases in immunocompetent and immunocompromised individuals, respectively. A cellular type 1 adaptive response, mediated by IL-12, IFNg, CD4+ and CD8+ T cells has been shown to be essential for host resistance, and dendritic cells (DC play a key role at eliciting anti-microsporidial immunity. We investigated the in vitro response of DC and DC precursors/progenitors to infection with Encephalitozoon intestinalis (Ei, a common agent of human microsporidosis. Ei-exposed DC cultures up-regulated the surface expression of MHC class II and the costimulatory molecules CD86 and CD40, only when high loads of spores were used. A vigorous secretion of IL-6 but not of IL-1b or IL-12p70 was also observed in these cultures. Ei-exposed DC cultures consisted of immature infected and mature bystander DC, as assessed by MHC class II and costimulatory molecules expression, suggesting that intracellular Ei spores deliver inhibitory signals in DC. Moreover, Ei selectively inhibited the secretion of IL-12p70 in LPS-stimulated DC. Whereas Ei-exposed DC promoted allogeneic naïve T cell proliferation and IL-2 and IFNg secretion in DC-CD4+ T cell co-cultures, separated co-cultures with bystander or infected DCs showed stimulation or inhibition of IFNg secretion, respectively. When DC precursors/progenitors were exposed to Ei spores, a significant inhibition of DC differentiation was observed without shifting the development towards cells phenotypically or functionally compatible with myeloid-derived suppressor cells. Neutralization experiments demonstrated that this inhibitory effect is IL-6-dependent. Altogether this investigation reveals a novel potential mechanism of immune escape of microsporidian parasites through the modulation of DC differentiation and maturation.

  16. Functional characterization of peroxiredoxins from the human protozoan parasite Giardia intestinalis.

    Directory of Open Access Journals (Sweden)

    Daniela Mastronicola

    Full Text Available The microaerophilic protozoan parasite Giardia intestinalis, causative of one of the most common human intestinal diseases worldwide, infects the mucosa of the proximal small intestine, where it has to cope with O2 and nitric oxide (NO. Elucidating the antioxidant defense system of this pathogen lacking catalase and other conventional antioxidant enzymes is thus important to unveil novel potential drug targets. Enzymes metabolizing O2, NO and superoxide anion (O2 (-• have been recently reported for Giardia, but it is yet unknown how the parasite copes with H2O2 and peroxynitrite (ONOO(-. Giardia encodes two yet uncharacterized 2-cys peroxiredoxins (Prxs, GiPrx1a and GiPrx1b. Peroxiredoxins are peroxidases implicated in virulence and drug resistance in several parasitic protozoa, able to protect from nitroxidative stress and repair oxidatively damaged molecules. GiPrx1a and a truncated form of GiPrx1b (deltaGiPrx1b were expressed in Escherichia coli, purified and functionally characterized. Both Prxs effectively metabolize H2O2 and alkyl-hydroperoxides (cumyl- and tert-butyl-hydroperoxide in the presence of NADPH and E. coli thioredoxin reductase/thioredoxin as the reducing system. Stopped-flow experiments show that both proteins in the reduced state react with ONOO(- rapidly (k = 4×10(5 M(-1 s(-1 and 2×10(5 M(-1 s(-1 at 4°C, for GiPrx1a and deltaGiPrx1b, respectively. Consistent with a protective role against oxidative stress, expression of GiPrx1a (but not deltaGiPrx1b is induced in parasitic cells exposed to air O2 for 24 h. Based on these results, GiPrx1a and deltaGiPrx1b are suggested to play an important role in the antioxidant defense of Giardia, possibly contributing to pathogenesis.

  17. The zoonotic potential of Giardia intestinalis assemblage E in rural settings.

    Science.gov (United States)

    Abdel-Moein, Khaled A; Saeed, Hossam

    2016-08-01

    Giardiasis is a globally re-emerging protozoan disease with veterinary and public health implications. The current study was carried out to investigate the zoonotic potential of livestock-specific assemblage E in rural settings. For this purpose, a total of 40 microscopically positive Giardia stool samples from children with gastrointestinal complaints with or without diarrhea were enrolled in the study as well as fecal samples from 46 diarrheic cattle (18 dairy cows and 28 calves). Animal samples were examined by sedimentation method to identify Giardia spp., and then, all Giardia positive samples from human and animals were processed for molecular detection of livestock-specific assemblage E through amplification of assemblage-specific triosephosphate isomerase (tpi) gene using nested polymerase chain reaction (PCR). The results of the study revealed high unexpected occurrence of assemblage E among human samples (62.5 %), whereas the distribution among patients with diarrhea and those without was 42.1 and 81 %, respectively. On the other hand, the prevalence of Giardia spp. among diarrheic dairy cattle was (8.7 %), while only calves yielded positive results (14.3 %) and all bovine Giardia spp. were genetically classified as Giardia intestinalis assemblage E. Moreover, DNA sequencing of randomly selected one positive human sample and another bovine one revealed 100 and 99 % identity with assemblage E tpi gene sequences available at GenBank after BLAST analysis. In conclusion, the current study highlights the wide dissemination of livestock-specific assemblage E among humans in rural areas, and thus, zoonotic transmission cycle should not be discounted during the control of giardiasis in such settings. PMID:27112756

  18. Novel structural components of the ventral disc and lateral crest in Giardia intestinalis.

    Directory of Open Access Journals (Sweden)

    Kari D Hagen

    2011-12-01

    Full Text Available Giardia intestinalis is a ubiquitous parasitic protist that is the causative agent of giardiasis, one of the most common protozoan diarrheal diseases in the world. Giardia trophozoites attach to the intestinal epithelium using a specialized and elaborate microtubule structure, the ventral disc. Surrounding the ventral disc is a less characterized putatively contractile structure, the lateral crest, which forms a continuous perimeter seal with the substrate. A better understanding of ventral disc and lateral crest structure, conformational dynamics, and biogenesis is critical for understanding the mechanism of giardial attachment to the host. To determine the components comprising the ventral disc and lateral crest, we used shotgun proteomics to identify proteins in a preparation of isolated ventral discs. Candidate disc-associated proteins, or DAPs, were GFP-tagged using a ligation-independent high-throughput cloning method. Based on disc localization, we identified eighteen novel DAPs, which more than doubles the number of known disc-associated proteins. Ten of the novel DAPs are associated with the lateral crest or outer edge of the disc, and are the first confirmed components of this structure. Using Fluorescence Recovery After Photobleaching (FRAP with representative novel DAP::GFP strains we found that the newly identified DAPs tested did not recover after photobleaching and are therefore structural components of the ventral disc or lateral crest. Functional analyses of the novel DAPs will be central toward understanding the mechanism of ventral disc-mediated attachment and the mechanism of disc biogenesis during cell division. Since attachment of Giardia to the intestine via the ventral disc is essential for pathogenesis, it is possible that some proteins comprising the disc could be potential drug targets if their loss or disruption interfered with disc biogenesis or function, preventing attachment.

  19. Reduction potential and heme-pocket polarity in low potential cytochrome b5 of Giardia intestinalis.

    Science.gov (United States)

    Yang, Zhen Alice; Pazdzior, Robert; Yee, Janet; Rafferty, Steven

    2016-05-01

    Although it lacks mitochondria and the ability to synthesize heme, the protozoan parasite Giardia intestinalis encodes several heme proteins. This includes four members of the cytochrome b5 family, three of which are of similar size to mammalian cytochromes b5 but with reduction potentials that are 140 to 180mV lower. While no structures have yet been determined for any of these proteins, homology modeling points to an increase in heme pocket polarity as a reason for their low potentials. To test this we measured the reduction potentials of four mutants of Giardia cytochrome b5 isotype-I (gCYTB5-I) in which polar residues at two candidate positions (C84, Y51) in the heme pocket were changed to nonpolar ones (C84A, C84F; Y51L, Y51F). All mutants were expressed with comparable levels of heme incorporation and had UV-visible spectra consistent with low spin bis-histidyl coordination. These mutations increased the reduction potential by 18 to 57mV and highlight the influence of C84, which is a residue unique to gCYTB5-I and whose mutation to alanine caused the largest increase. The influence of these two residues plus that of Y61 reported previously accounts for much of the reduction potential difference between gCYTB5-I and microsomal cytochrome b5. A complementary triple mutant of the latter with the hydrophilic residues found in gCYTB5-I bound heme less effectively but nonetheless had a reduction potential that was 135mV lower than wild type. PMID:27048807

  20. Toll-like receptors of deuterostome invertebrates

    Directory of Open Access Journals (Sweden)

    Honoo eSatake

    2012-02-01

    Full Text Available Defensive systems against pathogens are responsible not only for survival or lifetime of an individual but also for the evolution of a species. Innate immunity is expected to be more important for invertebrates than mammals, given that adaptive immunity has not been acquired in the former. Toll-like receptors (TLRs have been shown to play a crucial role in host defense of pathogenic microbes in innate immunity of mammals. Recent genome-wide analyses have suggested that TLR or their related genes are conserved in invertebrates. In particular, numerous TLR-related gene candidates were detected in deuterostome invertebrates including a sea urchin (222 TLR-related gene candidates and amphioxus (72 TLR-related gene candidates. Molecular phylogenetic analysis verified that most of sea urchin or amphioxus TLR candidates are paralogous, suggesting that these organisms expanded TLR-related genes in a species-specific manner. In contrast, another deuterostome invertebrate, an ascidian, Ciona intestinalis, was found to possess only two TLR genes. Moreover, Ciona TLRs, Ci-TLR1 and -2, were shown to possess hybrid functionality of mammalian TLRs. Such functionality of Ci-TLRs could not be predicted by sequence comparison with vertebrate TLRs, indicating the confounding evolutionary lineages of deuterostome invertebrate TLRs or their candidates. In this review article, we present recent advances in studies of TLRs or their candidates of deuterostome invertebrates, and provide insight into an evolutionary process of TLRs.

  1. Photoresponse and Learning Behavior of Ascidian Larvae, a Primitive Chordate, to Repeated Stimuli of Step-Up and Step-Down of Light

    OpenAIRE

    Kawakami, I.; Shiraishi, S; Tsuda, M

    2002-01-01

    Ascidians are lower chordates and their simple tadpole-like larvae share a basic body plan with vertebrates. Newly hatched larvae show no response to a stimulus of light. 4 h after hatching, the larvae were induced to swim upon a step-down of light and stop swimming upon a step-up of light. At weaker intensity of light, the larvae show the same response to a stimulus after presentation of repeated stimuli. When intensity of actinic light was increased, the larvae show sensitization and habitu...

  2. Genotyping Giardia intestinalis by Using DNA Extracted from Long-Term Preserved Human Specimens Stained with Chlorazol Black E.

    Science.gov (United States)

    Nishida, Yoshie; Morimoto, Norihito; Korenaga, Masataka; Komatsu, Yutaka; Takeuchi, Hiroaki; Matsumura, Yoshihisa; Sugiura, Tetsuro

    2016-05-20

    Giardia intestinalis is a parasitic protozoan that causes diarrhea and abdominal pain in humans. Studies of the Giardia genotypes are thought to be important for understanding their infection routes and prevalence. However, few have reported pathogen genotyping in human giardiasis cases in Japan. In this study, we genotyped G. intestinalis by using DNA extracted from chlorazol black E-stained fecal smears from patients. The triosephosphate isomerase gene was amplified from 21 (91.3%) of 23 human fecal samples. Twelve (52.2%) of pathogens detected were of the genotype A, and 9 (39.1%) of the genotype B. A restriction fragment length polymorphism analysis showed that all genotype A found in the present study were of the genotype AI, which were presumed to be zoonotic. The source of Giardia infections was unclear in the present study. However, patients' histories of international travel appeared not to be associated with the Giardia genotypes. Thus, most cases were thought to be acquired sporadically and domestically. PMID:26255725

  3. Molecular Detection of Giardia intestinalis from Stray Dogs in Animal Shelters of Gyeongsangbuk-do (Province) and Daejeon, Korea.

    Science.gov (United States)

    Shin, Jin-Cheol; Reyes, Alisha Wehdnesday Bernardo; Kim, Sang-Hun; Kim, Suk; Park, Hyung-Jin; Seo, Kyoung-Won; Song, Kun-Ho

    2015-08-01

    Giardia is a major public health concern and considered as reemerging in industrialized countries. The present study investigated the prevalence of giardiosis in 202 sheltered dogs using PCR. The infection rate was 33.2% (67/202); Gyeongsangbuk-do and Daejeon showed 25.7% (39/152, Pdogs (46.7%, Pdogs (21.8%). A higher prevalence (43.5%, Pdogs than purebred (14.1%). Although most of the fecal samples collected were from dogs of ≥1 year of age which showed only 27.4% positive rate, 61.8% (Pdogs (60.8%, Pdogs (23.8%). Furthermore, the analysis of nucleotide sequences of the samples revealed that G. intestinalis Assemblages A and C were found in the feces of dogs from Gyeongsangbuk-do and Daejeon. Since G. intestinalis Assemblage A has been known to infect humans, our results suggest that dogs can act as an important reservoir of giardiosis in Korea. Hence, hygienic management should be given to prevent possible transmission to humans. PMID:26323847

  4. Insights into the structure and inhibition of Giardia intestinalis arginine deiminase: homology modeling, docking, and molecular dynamics studies.

    Science.gov (United States)

    Trejo-Soto, Pedro Josué; Aguayo-Ortiz, Rodrigo; Yépez-Mulia, Lilián; Hernández-Campos, Alicia; Medina-Franco, José Luis; Castillo, Rafael

    2016-04-01

    Giardia intestinalis arginine deiminase (GiADI) is an important metabolic enzyme involved in the energy production and defense of this protozoan parasite. The lack of this enzyme in the human host makes GiADI an attractive target for drug design against G. intestinalis. One approach in the design of inhibitors of GiADI could be computer-assisted studies of its crystal structure, such as docking; however, the required crystallographic structure of the enzyme still remains unresolved. Because of its relevance, in this work, we present a three-dimensional structure of GiADI obtained from its amino acid sequence using the homology modeling approximation. Furthermore, we present an approximation of the most stable dimeric structure of GiADI identified through molecular dynamics simulation studies. An in silico analysis of druggability using the structure of GiADI was carried out in order to know if it is a good target for design and optimization of selective inhibitors. Potential GiADI inhibitors were identified by docking of a set of 3196 commercial and 19 in-house benzimidazole derivatives, and molecular dynamics simulation studies were used to evaluate the stability of the ligand-enzyme complexes. PMID:26017138

  5. Metal specific partitioning in a parasite-host assemblage of the cestode Ligula intestinalis and the cyprinid fish Rastrineobolaargentea

    International Nuclear Information System (INIS)

    When evaluating metal accumulation patterns in parasite-host assemblages species specific metal requirements should be taken into account. The aim of the present study was therefore to determine the metal specific partitioning in a parasite-host assemblage of the cestode Ligula intestinalis and the cyprinid fish Rastrineobola argentea and to determine the effect of the parasites on the metal balance of the fish. To this purpose the host-parasite assemblage was analysed for several metals at sites in the coastal zone of Lake Victoria differing in metal contamination. Our results showed that some elements (Ca, Sr, and Mg) reflected the physiological differences of bone formation and ionic balance and pointed to physiological disturbances of infested R. argentea. Other essential metals including Cu and Co were subject of element competition between fish and parasite, while only a micro-element (Cr) and a non-essential metal (Cd) displayed a partitioning with high concentration in the parasite. The present study clearly demonstrated the impact of the large cestodes on their small fish hosts and it is concluded that the partitioning of metals in the assemblage of R. argentea and L. intestinalis is subject to metal specific mechanisms for essential and non-essential elements.

  6. Metal specific partitioning in a parasite-host assemblage of the cestode Ligula intestinalis and the cyprinid fish Rastrineobolaargentea

    Energy Technology Data Exchange (ETDEWEB)

    Oyoo-Okoth, Elijah [Division of Environmental Health, School of Environmental Studies, Moi University, P.O. Box 3900, Eldoret (Kenya); Department of Aquatic Ecology and Ecotoxicology, Institute of Biodiversity and Ecosystem Dynamics, University of Amsterdam, Kruislaan 320, 1098 SM (Netherlands); Admiraal, Wim [Department of Aquatic Ecology and Ecotoxicology, Institute of Biodiversity and Ecosystem Dynamics, University of Amsterdam, Kruislaan 320, 1098 SM (Netherlands); Osano, Odipo [Division of Environmental Health, School of Environmental Studies, Moi University, P.O. Box 3900, Eldoret (Kenya); Hoitinga, Leo [Department of Earth Surface Process and Materials, Institute of Biodiversity and Ecosystem Dynamics, University of Amsterdam, Nieuwe Achtergracht 166, 1018 WV University of Amsterdam (Netherlands); Kraak, Michiel H.S., E-mail: M.H.S.Kraak@uva.nl [Division of Environmental Health, School of Environmental Studies, Moi University, P.O. Box 3900, Eldoret (Kenya)

    2010-03-01

    When evaluating metal accumulation patterns in parasite-host assemblages species specific metal requirements should be taken into account. The aim of the present study was therefore to determine the metal specific partitioning in a parasite-host assemblage of the cestode Ligula intestinalis and the cyprinid fish Rastrineobola argentea and to determine the effect of the parasites on the metal balance of the fish. To this purpose the host-parasite assemblage was analysed for several metals at sites in the coastal zone of Lake Victoria differing in metal contamination. Our results showed that some elements (Ca, Sr, and Mg) reflected the physiological differences of bone formation and ionic balance and pointed to physiological disturbances of infested R. argentea. Other essential metals including Cu and Co were subject of element competition between fish and parasite, while only a micro-element (Cr) and a non-essential metal (Cd) displayed a partitioning with high concentration in the parasite. The present study clearly demonstrated the impact of the large cestodes on their small fish hosts and it is concluded that the partitioning of metals in the assemblage of R. argentea and L. intestinalis is subject to metal specific mechanisms for essential and non-essential elements.

  7. NK4 antagonizes Tbx1/10 to promote cardiac versus pharyngeal muscle fate in the ascidian second heart field.

    Directory of Open Access Journals (Sweden)

    Wei Wang

    2013-12-01

    Full Text Available The heart and head muscles share common developmental origins and genetic underpinnings in vertebrates, including humans. Parts of the heart and cranio-facial musculature derive from common mesodermal progenitors that express NKX2-5, ISL1, and TBX1. This ontogenetic kinship is dramatically reflected in the DiGeorge/Cardio-Velo-Facial syndrome (DGS/CVFS, where mutations of TBX1 cause malformations in the pharyngeal apparatus and cardiac outflow tract. Cardiac progenitors of the first heart field (FHF do not require TBX1 and segregate precociously from common progenitors of the second heart field (SHF and pharyngeal muscles. However, the cellular and molecular mechanisms that govern heart versus pharyngeal muscle specification within this lineage remain elusive. Here, we harness the simplicity of the ascidian larva to show that, following asymmetric cell division of common progenitors, NK4/NKX2-5 promotes GATAa/GATA4/5/6 expression and cardiac specification in the second heart precursors by antagonizing Tbx1/10-mediated inhibition of GATAa and activation of Collier/Olf/EBF (COE, the determinant of atrial siphon muscle (ASM specification. Our results uncover essential regulatory connections between the conserved cardio-pharyngeal factor Tbx1/10 and muscle determinant COE, as well as a mutual antagonism between NK4 and Tbx1/10 activities upstream of GATAa and COE. The latter cross-antagonism underlies a fundamental heart versus pharyngeal muscle fate choice that occurs in a conserved lineage of cardio-pharyngeal progenitors. We propose that this basic ontogenetic motif underlies cardiac and pharyngeal muscle development and evolution in chordates.

  8. Stochasticity in space, persistence in time: genetic heterogeneity in harbour populations of the introduced ascidian Styela plicata.

    Science.gov (United States)

    Pineda, Mari-Carmen; Lorente, Beatriz; López-Legentil, Susanna; Palacín, Creu; Turon, Xavier

    2016-01-01

    Spatio-temporal changes in genetic structure among populations provide crucial information on the dynamics of secondary spread for introduced marine species. However, temporal components have rarely been taken into consideration when studying the population genetics of non-indigenous species. This study analysed the genetic structure of Styela plicata, a solitary ascidian introduced in harbours and marinas of tropical and temperate waters, across spatial and temporal scales. A fragment of the mitochondrial gene Cytochrome Oxidase subunit I (COI) was sequenced from 395 individuals collected at 9 harbours along the NW Mediterranean coast and adjacent Atlantic waters (> 1,200 km range) at two time points 5 years apart (2009 and 2014). The levels of gene diversity were relatively low for all 9 locations in both years. Analyses of genetic differentiation and distribution of molecular variance revealed strong genetic structure, with significant differences among many populations, but no significant differences among years. A weak and marginally significant correlation between geographic distance and gene differentiation was found. Our results revealed spatial structure and temporal genetic homogeneity in S. plicata, suggesting a limited role of recurrent, vessel-mediated transport of organisms among small to medium-size harbours. Our study area is representative of many highly urbanized coasts with dense harbours. In these environments, the episodic chance arrival of colonisers appears to determine the genetic structure of harbour populations and the genetic composition of these early colonising individuals persists in the respective harbours, at least over moderate time frames (five years) that encompass ca. 20 generations of S. plicata. PMID:27366653

  9. Bigger is not always better: offspring size does not predict growth or survival for seven ascidian species.

    Science.gov (United States)

    Jacobs, Molly W; Sherrard, Kristin M

    2010-12-01

    The presumed trade-off between offspring size and quality predicted by life history theory is often invoked to explain the wide range of propagule sizes observed in animals and plants. This trade-off is broadly supported by intraspecific studies but has been difficult to test in an interspecific context, particularly in animals. We tested the fitness consequences of offspring size both intra- and interspecifically for seven species of ascidians (sessile, suspension-feeding, marine invertebrates) whose offspring volumes varied over three orders of magnitude. We measured two major components of fitness, juvenile growth rates and survival, in laboratory and field experiments encompassing several food conditions. Contrary to the predictions of life history theory, larger offspring size did not result in higher rates of growth or survival, and large offspring did not perform better under nutritional stress, either intraspecifically or interspecifically. In fact, two of the four species with small offspring grew rapidly enough to catch up in size to the species with large offspring in as little as eight weeks, under wild-type food conditions. Trade-offs between growth potential and defense may overwhelm and obscure any trade-offs between offspring size and survival or growth rate. While large initial size may still confer a competitive advantage, we failed to detect any consequences of interspecific variation in initial size. This implies that larger offspring in these species, far from being inherently superior in growth or survival, require compensation in other aspects of life history if reproductive effort is to be efficient. Our results suggest that the importance of initial offspring size is context dependent and often overestimated relative to other life history traits. PMID:21302831

  10. [The nature of changes of some immunophysiological characteristics in bream (Abramis brama) infected with plerocercoids (Ligula intestinalis) at various stages of parasite development].

    Science.gov (United States)

    Silkina, N I; Mikriakov, V R; Mikriakov, D V

    2012-01-01

    The data from studies of the antimicrobial properties of blood serum, the content of total lipids, and antioxidant activity of immunocompetent tissues and organs of breams Abramis brama infected with plerocercoids Ligula intestinalis depending on the phase of development of the parasite are presented. The quantitative characteristics of the studied parameters are determined. PMID:23136746

  11. Período de oviposición de Gasterophilus nasalis y G. intestinalis en equinos: VIII Región, Chile Egg laying period of Gasterophilus nasalis and G. intestinalis on horses: 8th Region, Chile

    Directory of Open Access Journals (Sweden)

    G Sievers

    2005-01-01

    Full Text Available Con el objetivo de conocer el período de oviposición de Gasterophilus nasalis y su relación con las condiciones climáticas locales se realizó, cada dos semanas, el conteo de los huevos colocados en los pelos de la región submaxilar de 10 caballos Hackney en un predio de la VIII Región, Chile, desde noviembre del 2002 a mayo del 2003 (37°, 03', S.; 72°, 33' O.. Los caballos se mantuvieron a potrero sin tratamientos antiparasitarios. Después de cada conteo se extrajeron algunos huevos para ser analizados en el laboratorio y luego se procedió a teñir los restantes con una solución de azul de metileno con el fin de poder determinar los nuevos huevos depositados en la próxima fecha de observación. G. nasalis inició la oviposición en la región intermandibular de los caballos a fines de noviembre de 2002. Las posturas máximas de 853 y 945 huevos durante dos semanas se registraron en los 10 caballos a mediados de diciembre de 2002 y a mediados de enero de 2003 respectivamente. Luego se mantuvo la postura en alrededor de 300 huevos cada dos semanas, hasta inicios de abril y concluyó en mayo de 2003. El período de oviposición coincidió con temperaturas medias superiores a los 15°C; las precipitaciones influyeron negativamente sobre la postura de huevos. A inicios de marzo de 2003 se registró sorpresivamente la oviposición de huevos de G. intestinalis en las regiones preesternal, del encuentro, costo-esternal, inguinal y los miembros de los caballos. El número de huevos aumentó en forma constante hasta mediados de abril, superando los 2000 huevos en dos semanas en los 10 caballos. Por la ubicación de la postura de los huevos y su particular morfología se confirma la presencia de G. intestinalis en Chile. No se pudo determinar el momento en que concluye su oviposición ni la relación con las condiciones climáticas. Se concluye que G. nasalis comienza la oviposición a fines de noviembre y dura hasta inicios de mayo

  12. A glycine receptor is involved in the organization of swimming movements in an invertebrate chordate

    Directory of Open Access Journals (Sweden)

    Okamura Yasushi

    2010-01-01

    Full Text Available Abstract Background Rhythmic motor patterns for locomotion in vertebrates are generated in spinal cord neural networks known as spinal Central Pattern Generators (CPGs. A key element in pattern generation is the role of glycinergic synaptic transmission by interneurons that cross the cord midline and inhibit contralaterally-located excitatory neurons. The glycinergic inhibitory drive permits alternating and precisely timed motor output during locomotion such as walking or swimming. To understand better the evolution of this system we examined the physiology of the neural network controlling swimming in an invertebrate chordate relative of vertebrates, the ascidian larva Ciona intestinalis. Results A reduced preparation of the larva consisting of nerve cord and motor ganglion generates alternating swimming movements. Pharmacological and genetic manipulation of glycine receptors shows that they are implicated in the control of these locomotory movements. Morphological molecular techniques and heterologous expression experiments revealed that glycine receptors are inhibitory and are present on both motoneurones and locomotory muscle while putative glycinergic interneurons were identified in the nerve cord by labeling with an anti-glycine antibody. Conclusions In Ciona intestinalis, glycine receptors, glycinergic transmission and putative glycinergic interneurons, have a key role in coordinating swimming movements through a simple CPG that is present in the motor ganglion and nerve cord. Thus, the strong association between glycine receptors and vertebrate locomotory networks may now be extended to include the phylum chordata. The results suggest that the basic network for 'spinal-like' locomotion is likely to have existed in the common ancestor of extant chordates some 650 M years ago.

  13. [Investigation of the presence of Encephalitozoon intestinalis and Enterocytozoon bieneusi in bone marrow transplant patients by IFA-MAbs method].

    Science.gov (United States)

    Çetinkaya, Ülfet; Hamamcı, Berna; Kaynar, Leylagül; Kuk, Salih; Şahin, İzzet; Yazar, Süleyman

    2015-07-01

    Microsporidian pathogens are obligatory intracellular eukaryotic parasites which can be found worldwide. They have been represented in 144 genera and more than 1200 species that may cause infections in both vertebrate and invertebrate hosts. Enterocytozoon bieneusi and Encephalitozoon intestinalis are the most common species among 14 species of microsporidia identified as human pathogens and they cause infections in the gastrointestinal tract. These species may also cause chronic diarrhea particularly in immunocompromised patients, as well as disseminated infections with severe clinical conditions which can be life-threatening. Since the spores of microsporidia are quite small-sized structures, they frequently may be overlooked in routine stool examinations. Therefore, molecular methods and transmission electron microscopy, if possible, are used as the gold standard methods in laboratory diagnosis. In laboratories in which those methods could not be applied, immunofluorescence assay using monoclonal antibodies (IFA-MAbs) may be advantageous compared to conventional methods. The aim of this study was to investigate the presence of E.intestinalis and E.bieneusi in bone marrow transplant (BMT) patients by using IFA-MAbs method. A total of 200 BMT patients (134 male, 66 female; mean age: 43.2±15.01 years), of them 147 with diarrhea and 80 healthy subjects (43 male, 37 female; mean age: 31.9±11.76 years) as control group were included in the study. All of the stool samples were examined by a commercial IFA-MAbs (Bordier Affinity Products, Switzerland) method as well as conventional (native-lugol and modified acid-fast staining) methods. Of the patients 25.5% (51/200) were positive for E.intestinalis, 4% (8/200) for E.bieneusi and 9.5% (19/200) for both of them, giving a total positivity rate of 39% (78/200). Those rates were 5% (4/80), 2.5% (2/80), 3.8% (3/80) and 11.3% (9/80), respectively for control group. The difference between the patient and control groups in

  14. Estudio de los patrones de ubiquitinación y la actividad de proteólisis específica del proteosoma en Giardia Intestinalis / Study of the ubiquitination patterns and the specific activity of the proteasome in Giardia Intestinalis

    OpenAIRE

    Chaparro Gutiérrez, Jenny Jovana

    2011-01-01

    El parásito protozoario Giardia intestinalis es un agente causante de diarrea en humanos alrededor del mundo. Además de su importancia como patógeno es un eucariota que divergió tempranamente y constituye un importante modelo de estudio de procesos celulares básicos. Durante su ciclo de vida, G. intestinalis, presenta dos procesos de diferenciación, la enquistación y la exquistación, los cuales involucran modificaciones intracelulares, transcripción de nuevos genes, síntesis y probablemente ...

  15. CS5931, a Novel Polypeptide in Ciona savignyi, Represses Angiogenesis via Inhibiting Vascular Endothelial Growth Factor (VEGF and Matrix Metalloproteinases (MMPs

    Directory of Open Access Journals (Sweden)

    Ge Liu

    2014-03-01

    Full Text Available CS5931 is a novel polypeptide from Ciona savignyi with anticancer activities. Previous study in our laboratory has shown that CS5931 can induce cell death via mitochondrial apoptotic pathway. In the present study, we found that the polypeptide could inhibit angiogenesis both in vitro and in vivo. CS5931 inhibited the proliferation, migration and formation of capillary-like structures of HUVECs (Human Umbilical Vein Endothelial Cell in a dose-dependent manner. Additionally, CS5931 repressed spontaneous angiogenesis of the zebrafish vessels. Further studies showed that CS5931 also blocked vascular endothelial growth factor (VEGF production but without any effect on its mRNA expression. Moreover, CS5931 reduced the expression of matrix metalloproteinases (MMP-2 and MMP-9 both on protein and mRNA levels in HUVEC cells. We demonstrated that CS5931 possessed strong anti-angiogenic activity both in vitro and in vivo, possible via VEGF and MMPs. This study indicates that CS5931 has the potential to be developed as a novel therapeutic agent as an inhibitor of angiogenesis for the treatment of cancer.

  16. Efficacy of gaseous chlorine dioxide as a sanitizer against Cryptosporidium parvum, Cyclospora cayetanensis, and Encephalitozoon intestinalis on produce.

    Science.gov (United States)

    Ortega, Ynes R; Mann, Amy; Torres, Maria P; Cama, Vitaliano

    2008-12-01

    The efficacy of gaseous chlorine dioxide to reduce parasite and bacterial burden in produce was studied. Basil and lettuce leaves were inoculated with Cryptosporidium parvum and Cyclospora cayetanensis oocysts, Encephalitozoon intestinalis spores, and a cocktail of two isolates of nalidixic acid-resistant Escherichia coli O157:H7. The inoculated samples were then treated for 20 min with gaseous chlorine dioxide at 4.1 mg/liter. Cryptosporidium had a 2.6 and 3.31 most-probable-number log reduction in basil and lettuce, respectively. Reduction of Encephalitozoon in basil and lettuce was 3.58 and 4.58 CFU/g respectively. E. coli loads were significantly reduced (2.45 to 3.97 log), whereas Cyclospora sporulation was not affected by this treatment. PMID:19244892

  17. Protein: FBA5 [TP Atlas

    Lifescience Database Archive (English)

    Full Text Available FBA5 VSOP(voltage sensor -only protein1) HVCN1 VSOP, VSX1 Voltage-gated hydrogen channel 1 Hydrog ... en voltage-gated channel 1, Voltage sensor ... domain-only protein 7719 Ciona intestinalis 778897 ...

  18. Dicty_cDB: Contig-U11773-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e mRN... 30 0.30 AY895050_1( AY895050 |pid:none) Ciona intestinalis isolate 16 clon... 32 0.30 A45517( A45517 ;S27818) coccidiosis...n-1; AltName: Full=F-spondin; Flags... 31 0.023 AY895052_1( AY895052 |pid:none) Ciona intestinalis...58889_1( BC158889 |pid:none) Rattus norvegicus complement facto... 35 0.83 AY895051_1( AY895051 |pid:none) Ciona intestinalis isol...or UNC5B; AltName: Full=Prot... 29 1.3 AY899287_1( AY899287 |pid:none) Ciona intestinalis isolate 13 clon......bits) Value N ( U82516 ) Dictyostelium discoideum random slug cDNA22 protein... 761 0.0 4 ( BJ384324 ) Dictyostelium dis

  19. Suppression of cell-spreading and phagocytic activity on nano-pillared surface: in vitro experiment using hemocytes of the colonial ascidian Botryllus schlosseri

    Directory of Open Access Journals (Sweden)

    L Ballarin

    2015-02-01

    Full Text Available Nano-scale nipple array on the body surface has been described from various invertebrates including endoparasitic and mesoparasitic copepods, but the functions of the nipple array is not well understood. Using the hydrophilized nanopillar sheets made of polystyrene as a mimetic material of the nipple arrays on the parasites’ body surface, we assayed the cell spreading and phagocytosis of the hemocytes of the colonial ascidian Botryllus schlosseri. On the pillared surface, the number of spreading amebocytes and the number of phagocytizing hemocytes per unit area were always smaller than those on the flat surface (Mann-Whitney test, p < 0.05 - 0.001, probably because the effective area for the cell attachment on the pillared surface is much smaller than the area on the flat sheet. The present results supports the idea that the nipple array on the parasites' body surface reduces the innate immune reaction from the host hemocytes.

  20. First report of [i]Enterocytozoon[/i] bieneusi and [i]Encephalitozoon intestinalis[/i] infection of wild mice in Slovakia

    Directory of Open Access Journals (Sweden)

    Oľga Danišová

    2015-05-01

    Full Text Available Increased risk of zoonotic transmission of the potential human pathogenic species [i]Enterocytozoon bieneusi[/i], [i]Encephalitozoon intestinalis[/i] and [i]Encephalitozoon cuniculi [/i]was detected in wild immunocompetent mice (Mus musculus musculus; n=280. Analysis was conducted with the use of PMP1/PMP2 primers and SYBR Green RT-PCR. Using Real Time PCR and comparing the sequences with sequences in the GenBank, [i]E. bieneusi[/i] was detected in 3 samples (1.07 %, [i]E. cuniculi [/i]in 1 sample (0.35 % and [i]E. intestinalis[/i] in 1 sample (0.35 %. The results of this report document the low host specificity of detected microsporidia species, and imply the importance of synanthropic rodents as a potential source of human microsporidial infection.

  1. An ultraviolet-sensitive maternal mRNA encoding a cytoskeletal protein may be involved in axis formation in the ascidian embryo

    International Nuclear Information System (INIS)

    Ultraviolet (uv) irradiation of the vegetal hemisphere of fertilized eggs during ooplasmic segregation inhibits subsequent gastrulation and axis formation in ascidian embryos. The molecular basis of this phenomenon was investigated in by comparing in vivo protein synthesis and in vitro mRNA translation in normal and uv-irradiated embryos of the ascidian Styela clava. Analysis of protein synthesis by [35S]methionine incorporation, two-dimensional (2D) gel electrophoresis, and autoradiography showed that only 21 of 433 labeled polypeptides were missing or decreased in labeling intensity in uv-irradiated embryos. The most prominent of these was a 30,000 molecular weight (pI 6.0) polypeptide (p30). Extraction of gastrulae with the nonionic detergent Triton X-100 showed that p30 is retained in the detergent insoluble residue, suggesting that it is associated with the cytoskeleton. Several lines of evidence suggest that p30 may be involved in axis formation. First, p30 labeling peaks during gastrulation, when the embryonic axis is being established. Second, axis formation and p30 labeling are abolished by the same threshold uv dose, which is distinct from that required to inactivate muscle cell development. Third, the uv sensitivity period for abolishing p30 labeling and axis formation are both restricted to ooplasmic segregation. In vitro translation of egg RNA followed by 2D gel electrophoresis and autoradiography of the protein products showed that p30 is encoded by a maternal mRNA. The translation of p30 mRNA was abolished by uv irradiation of fertilized eggs during ooplasmic segregation suggesting that this message is a uv-sensitive target. The results are consistent with the hypothesis that uv irradiation blocks gastrulation and axis formation by inhibiting the translation of maternal mRNA localized in the vegetal hemisphere of the fertilized egg

  2. Comparison of efficiency of various DNA extraction methods from cysts of Giardia intestinalis measured by PCR and TaqMan real time PCR

    Directory of Open Access Journals (Sweden)

    Adamska M.

    2010-12-01

    Full Text Available The aim of the presented study was to work out an effective method of extraction of DNA from Giardia intestinalis cysts as well as a sensitive and specific method for detection of DNA of this protozoan using a polymerase chain reaction (PCR. Twelve protocols for DNA extraction have been compared. Purification and extraction of DNA were preceded by additional actions in order to destroy the cysts’ wall. The highest effectiveness of DNA extraction was obtained in case of alternating application of freezing the samples in liquid nitrogen and their incubation in water bath in the temperature of 100 ˚C, and then the extraction with the QIAamp DNA Tissue Mini Kit (QIAGEN – T kit – with an all night long incubation with proteinase K in 56 ˚C. Effectiveness of DNA extraction with the use of each kit after extraction with each treatment was measured by nested PCR product of β-giardin gene fragment and CT values of real time PCR of the SSU rRNA gene of G. intestinalis. The detection limit, defined as the lowest number detected in 100 % cases, was 100 cysts per 200 μl when effectiveness was evaluated with nested PCR and 50 oocysts with real time PCR after extraction DNA with T kit. Results of our comparative studies have shown that all stages preceding the molecular detection of G. intestinalis DNA are equally important, and materially influence on the final effect and this version of method seems to be very useful for the sensitive detection of DNA of G. intestinalis.

  3. Comparison of efficiency of various DNA extraction methods from cysts of Giardia intestinalis measured by PCR and TaqMan real time PCR

    OpenAIRE

    Adamska M.; Leońska-Duniec A.; Maciejewska A.; Sawczuk M.; Skotarczak B.

    2010-01-01

    The aim of the presented study was to work out an effective method of extraction of DNA from Giardia intestinalis cysts as well as a sensitive and specific method for detection of DNA of this protozoan using a polymerase chain reaction (PCR). Twelve protocols for DNA extraction have been compared. Purification and extraction of DNA were preceded by additional actions in order to destroy the cysts’ wall. The highest effectiveness of DNA extraction was obtained in case of alternating applicatio...

  4. Prevalence of Giardia intestinalis and other zoonotic intestinal parasites in private household dogs of the Hachinohe area in Aomori prefecture, Japan in 1997, 2002 and 2007

    OpenAIRE

    Itoh, Naoyuki; KANAI, Kazutaka; Hori, Yasutomo; HOSHI, Fumio; HIGUCHI, Seiichi

    2009-01-01

    An epidemiological study on canine intestinal parasites was undertaken to evaluate changes in the prevalence among private household dogs from the Hachinohe region of Aomori prefecture, Japan, in 1997, 2002 and 2007, using the formalin-ethyl acetate sedimentation technique. The risk of zoonotic transmission from household dogs to humans was also discussed. All intestinal parasites detected in the present study (Giardia intestinalis, Isospora spp., Toxocara canis, Ancylostoma caninum, Trichuri...

  5. Prevalence of Giardia intestinalis and other zoonotic intestinal parasites in private household dogs of the Hachinohe area in Aomori prefecture, Japan in 1997, 2002 and 2007.

    Science.gov (United States)

    Itoh, Naoyuki; Kanai, Kazutaka; Hori, Yasutomo; Hoshi, Fumio; Higuchi, Seiichi

    2009-12-01

    An epidemiological study on canine intestinal parasites was undertaken to evaluate changes in the prevalence among private household dogs from the Hachinohe region of Aomori prefecture, Japan, in 1997, 2002 and 2007, using the formalin-ethyl acetate sedimentation technique. The risk of zoonotic transmission from household dogs to humans was also discussed. All intestinal parasites detected in the present study (Giardia intestinalis, Isospora spp., Toxocara canis, Ancylostoma caninum, Trichuris vulpis and Strongyloides stercoralis) showed no changes in prevalence over the past 10 years based on analysis considering canine epidemiological profiles. In particular, prevalence of Giardia intestinalis in dogs under 1 year old, derived from pet shops/breeding kennels and kept indoors was unchanged, remaining at a high level of >15.0% at each time point. Toxocara canis also showed no changes in the group of dogs under 1 year old, bred by private owners and kept outdoors, and the prevalence was >10.0% every year. The present results indicate that the prevalence of Giardia intestinalis and other intestinal parasites in private household dogs has not always decreased, and the potential for direct parasitic zoonotic transmission from dogs to humans may be relatively high level, than from the environment (indoors and outdoors). We recommend careful surveillance of intestinal parasites and aggressive use of anthelminthic in private household dogs under considering the epidemiological factors. PMID:19934595

  6. Biomixing generated by benthic filter feeders: a diffusion model for near-bottom phytoplankton depletion

    Science.gov (United States)

    Larsena, Poul S.; Riisgård, Hans Ulrik

    1997-05-01

    Transient concentration distributions of flagellate cells ( Rhodomonas sp.) previously measured by Riisgård and co-workers in laboratory experiments have been examined to develop a diffusion model for the process of phytoplankton depletion in stagnant seawater above populations of benthic filter feeders, the polychaete Nereis diversicolor and the ascidian Ciona intestinalis, respectively. The model is based on sinks located at inhalant openings and Fick's law with an effective diffusivity that decreases with distance above the bottom due to the biomixing generated by exhalant and inhalant feeding currents. For N. diversicolor, having inhalant and exhalant openings flush with the sediment surface and a moderate exhalant jet velocity of ˜0.01 m s -1, concentration boundary layer growth is retarded and limited by the low values of diffusivity prevailing at heights greater >˜0.05 m above the bottom. For C. intestinalis, having inhalant and exhalant openings situated ˜0.05-0.1 m above the bottom and a higher and inclined exhalant jet velocity of ˜0.1-0.2 m s -1, the concentration distributions show a nearly uniform depletion over a layer reaching a thickness of 0.2-0.3 m above the bottom due to high biomixing in this layer. Numerical predictions of concentration distributions reproduce essential features of experiments, and suggest near-bottom values of effective diffusivity of 0.3 x 10 -6 and 150 x 10 -6 m 2 s -1, for N. diversicolor and C. intestinalis, respectively. It is suggested that the latter value is so large that the induced mixing should be accounted for in modelling benthic concentration boundary layers under flow conditions.

  7. Comparative analysis of enzyme-linked immunosorbent assay and direct microscopy for the diagnosis of Giardia intestinalis in fecal samples

    Directory of Open Access Journals (Sweden)

    Shipra Singhal

    2015-01-01

    Full Text Available Context: Giardiasis is one of the most common nonviral infections causing diarrheal illness worldwide. In this prospective cross-sectional study, we evaluated the RIDASCREEN ® Giardia kit for detection of Giardia intestinalis in stool samples and compared the results with direct microscopy. Materials and methods: A total of 360 fecal samples were collected. They were then processed by wet film, iodine preparation and an enzyme-linked immunosorbent assay (ELISA kit to determine the presence of Giardia trophozoites and cysts. Statistical analysis was performed by sensitivity, specificity, positive predictive value, negative predictive value and diagnostic accuracy. Results and Conclusion: Of the 360 cases, 17.2% samples were positive for Giardia by direct microscopy and 23.6% were found to be positive by ELISA (sensitivity ~97%, but specificity was ~92% only. Because of less specificity, we need to perform ELISA in congruence with direct microscopy, etc. Further studies need to be performed on a larger sample size using other molecular tests in order to get more accurate estimations.

  8. Draft genome sequencing of giardia intestinalis assemblage B isolate GS: is human giardiasis caused by two different species?

    Directory of Open Access Journals (Sweden)

    Oscar Franzén

    2009-08-01

    Full Text Available Giardia intestinalis is a major cause of diarrheal disease worldwide and two major Giardia genotypes, assemblages A and B, infect humans. The genome of assemblage A parasite WB was recently sequenced, and the structurally compact 11.7 Mbp genome contains simplified basic cellular machineries and metabolism. We here performed 454 sequencing to 16x coverage of the assemblage B isolate GS, the only Giardia isolate successfully used to experimentally infect animals and humans. The two genomes show 77% nucleotide and 78% amino-acid identity in protein coding regions. Comparative analysis identified 28 unique GS and 3 unique WB protein coding genes, and the variable surface protein (VSP repertoires of the two isolates are completely different. The promoters of several enzymes involved in the synthesis of the cyst-wall lack binding sites for encystation-specific transcription factors in GS. Several synteny-breaks were detected and verified. The tetraploid GS genome shows higher levels of overall allelic sequence polymorphism (0.5 versus <0.01% in WB. The genomic differences between WB and GS may explain some of the observed biological and clinical differences between the two isolates, and it suggests that assemblage A and B Giardia can be two different species.

  9. IFN-gamma, IL-5, IL-6 and IgE in patients infected with Giardia intestinalis.

    Directory of Open Access Journals (Sweden)

    Violetta Dymicka-Piekarska

    2009-05-01

    Full Text Available The immune system, its cellular and humoral response, is engaged by the host organism to fight against parasitic infections. The study group consisted of 90 patients (58 women and 32 men, aged 18-72 years, infected with G. intestinalis. The diagnosis was established based on laboratory investigations (stool examination, choloscopy, GSA-65. Blood for analysis was collected before (G1, and 2 weeks (G2 and 2 months (G3 after antiparasitic treatment. Control group consisted of 40 healthy subjects (22 women and 18 men, aged 20-45 years. The concentrations of IgE were assayed using a set of VIDAS (bioMerieux and the concentrations of IL-5, IL-6, IFN-gamma were determined using a set of Quantikine human (R&D Systems. It was revealed that in giardiosis the concentrations of IgE and IL-5 in blood serum were twice as high, the concentration of IL-6 was two and a half times higher and the concentration of IFN-gamma was almost four times higher as compared to healthy controls.

  10. Pneumatosis cystoides intestinalis following alpha-glucosidase inhibitor treatment: A case report and review of the literature

    Institute of Scientific and Technical Information of China (English)

    Tatsuhiro Tsujimoto; Hiroshi Fukui; Erika Shioyama; Kei Moriya; Hideto Kawaratani; Yasuyo Shirai; Masahisa Toyohara; Akira Mitoro; Jun-ichi Yarnao; Hisao Fujii

    2008-01-01

    A 69-year-old man was diagnosed as having myasthenia gravis (MG) in September 2004, and treated with thymectomy and prednisolone. He was then diagnosed as having steroid-induced diabetes mellitus, and received sulfonylurea (SU) therapy in May 2005. An alpha-glucosidase inhibitor (αGI) was added in March 2006, resulting in good glycemic control. He experienced symptoms of abdominal distention, increased flatus, and constipation in October 2007, and was admitted into our hospital in late November with hematochezia. Plain abdominal radiography revealed small linear radiolucent clusters in the wall of the colon. Computed tomography (CT) showed intramural air in the sigmoid colon. Colonoscopy revealed multiple smooth surfaced hemispherical protrusions in the sigmoid colon. The diagnosis of pneumatosis cystoides intestinalis (PCI) was made on the basis of these findings. As the αGI voglibose was suspected as the cause of this patient's PCI, treatment was conservative, ceasing voglibose, with fasting and fluid supplementation. The patient progressed well, and was discharged 2 wk later. Recently, several reports of PCI associated with αGI therapy have been published, predominantly in Japan where αGIs are commonly used. If the use of αGIs becomes more widespread, we can expect more reports of this condition on a global scale. The possibility of PCI should be considered in diabetic patients complaining of gastrointestinal symptoms, and the gastrointestinal tract should be thoroughly investigated in these patients.

  11. Pneumatosis Intestinalis as the Initial Presentation of Systemic Sclerosis: A Case Report and Review of the Literature

    Directory of Open Access Journals (Sweden)

    Farshid Ejtehadi

    2012-01-01

    Full Text Available Introduction. Pneumatosis intestinalis (PI is an uncommon pathology characterised by the presence of gas within the intestinal wall. It has been associated with various conditions, including connective tissue diseases. This is the first report of PI being the initial presentation of systemic sclerosis. Case Presentation. The patient, a 75-year-old female, presented with an 8-month history of worsening dysphagia and epigastric pain, as well as other nonspecific symptoms. Initial investigations with an oesophagogastroduodenoscopy diagnosed Candida oesophagitis and also identified an extrinsic compression of the gastric antrum. Subsequently a CT scan of the abdomen and pelvis showed moderately dilated small bowel loops and PI. Due to the patient’s stability, non-critical clinical condition, conservative management was instituted. More detailed investigations confirmed the diagnosis of systemic sclerosis with positive anticentromeric and antinuclear antibodies. The patient improved on methotrexate and was discharged with appropriate outpatient follow-up. Discussion. PI is a rare but well-documented pathology associated with connective tissue diseases, such as systemic sclerosis. In most cases, conservative management is preferable to surgical intervention, depending on the patient’s clinical presentation and progress. This is the first report of PI being the initial presentation of a patient with systemic sclerosis responsive to conservative management.

  12. Dynamics and effects of Ligula intestinalis (L.) infection in the native fish Barbus callensis Valenciennes, 1842 in Algeria.

    Science.gov (United States)

    Rouis, Sonia Ould; Rouis, Abdelhalim Ould; Dumont, Henri J; Magellan, Kit; Arab, Abdeslem

    2016-06-01

    The dynamics of the emergence, duration, and decline phases in epizootic cycles are well known for humans and some crops, but they are poorly understood for host-parasite systems in the wild. Parasites may be particularly insidious as they are often introduced unintentionally, simultaneously with their hosts, and later transferred to species in the new location. Here we investigate the epizootic dynamics of the tapeworm Ligula intestinalis in the Hamiz reservoir, Algeria, and explore its effects on the cyprinid fish Barbus callensis. Regular sampling was conducted from October 2005 to February 2008 with intermittent surveys carried out until 2010. Five percent of the 566 specimens of B. callensis that were caught were infected, with the maximum number of parasites found in spring. There was no obvious difference in weight between uninfected fish and infected ones, and infection did not affect fish condition. However, infected fish were significantly longer than uninfected fish and had inhibited gonad development. The proportion of infected fish caught was significantly higher in year 1 and by the second winter, infection collapsed to zero. The Ligula infection thus appeared to have minimal ecological effects and be of a temporary nature, thus exhibiting an epizootic cycle. Taken together, our data indicates that this infection declined or even failed during our study period. Failure may be due to the specific genetic strain of Ligula, but invasive carp may also have been influential in both the introduction and subsequent decline of this parasite. PMID:27078654

  13. Pneumatosis cystoides intestinalis- a morphological curio or a pitfall for surgeons: report of two cases and literature review

    Directory of Open Access Journals (Sweden)

    Anjali N. Bode

    2014-08-01

    Full Text Available Pneumatosis Cystoides Intestinalis (PCI is an uncommon but well recognised clinical entity in which gas-filled cysts appear in the intestinal wall.PCI can be an incidental finding or it may be detected during radiography or laparotomy. We came across two cases of PCI with characteristic morphological features associated with perforation peritonitis in and sigmoid volvulus respectively. In both cases PCI was not suspected pre-operatively.Both patients underwent urgent surgical exploration for the abdominal emergencies and were discharged in good general condition. It is imperative that the imaging finding of PCI is carefully correlated with the findings of physical examination, clinical history, and laboratory test results to determine which patients can be managed medically by treating the underlying disease and which will require emergency surgery. This decision can be difficult because the origin of the gas is often unclear and the patients symptoms can be volatile, presenting a major dilemma for the surgeon. [Int J Res Med Sci 2014; 2(4.000: 1791-1794

  14. Prevalencia de Giardia intestinalis y predominio de genotipos zoonóticos en ovinos y bovinos de traspatio de cinco estados de la República Mexicana

    OpenAIRE

    Juana Jimena Otero-Negrete; Froylán Ibarra-Velarde; Mario Noé Martínez-Gordillo; Martha Ponce-Macotela

    2011-01-01

    Con el fin de determinar la frecuencia y genotipos de Giardia intestinalis en ovinos y bovinos de traspatio de algunos estados de la República Mexicana, en este trabajo se colectaron heces de 265 ovinos y 174 bovinos, para la búsqueda de Giardia mediante coproparasitoscópicos (CPS) de concentración flotación. De las muestras fecales que resultaron positivas se obtuvieron los quistes por el método de Sheather. Los quistes se desenquistaron in vitro y los trofozoítos se mantuvieron en cultivo T...

  15. Antimicrobial and antioxidant activities of Cystoseira crinita Duby and Ulva intestinalis Linnaeus from the coastal region of Sinop, Turkey

    Institute of Scientific and Technical Information of China (English)

    İsmet Berber; Cumhur Avşar; Hilal Koyuncu

    2015-01-01

    Objective:To evaluate in vitro antimicrobial, antioxidant activities and total phenol contents of Cystoseira crinita and Ulva intestinalis species collected from the coastal region of Sinop. Methods:The antimicrobial activity of each methanolic algae sample was screened by using disc diffusion method against to 15 bacteria and 3 yeasts. The antioxidant potential of the extracts on the stable radical 1,1-diphenyl-2-picrylhydrazyl was determined. The total phenolic content of the 3 methanolic extracts of the seaweed samples were determined by the Folin-Ciocalteu method. Results:The results of antimicrobial assay showed that extracts were more effective against Gram-positive bacteria rather than Gram-negative. In addition, while the algal extracts had antifungal efficacy against Candida krusei, the other yeast strains were not affected at all. According to the findings of antioxidant activity, all methanolic extracts displayed good free radical scavenging activity ranging from IC50=(32.19 ± 0.08) mg/mL to the IC50=(37.57 ± 0.11) mg/mL. The total phenols content of the macroalgal extracts were found as between (5.10 ± 0.16) mg gallic acid equivalent/g and (87.70 ± 1.03) mg gallic acid equivalent/g. In this sense, our findings confirmed that there was a positive linear correlations (r=0.86) between total phenol contents and the IC50 values. Conclusions:The data gathered from this study suggested that the seaweeds can be used as a potential natural seafood sources owing to the antimicrobial efficiency and good antioxidant activity.

  16. Natural products from the ascidian Botrylloides giganteum, from the sponges Verongula gigantea, Ircinia felix, Cliona delitrix and from the nudibranch Tambja eliora, from the Brazilian coastline

    International Nuclear Information System (INIS)

    Two new marine metabolites, 3Z, 6Z, 9Z-dodecatrien-1-ol (1) from the ascidian Botrylloides giganteum and 4H-pyran-2ol acetate from the sponge Ircinia felix (4) are herein reported. The known bromotyrosine compounds, 2-(3,5-dibromo-4-methoxyphenyl)-N,N,Ndimethylethanammonium (2) and 2,6-dibromo-4-(2-(trimethylammonium)ethyl)phenol (3), have been isolated from the sponge Verongula gigantea. Serotonin (5) is reported for the first time from the sponge Cliona delitrix, and tambjamines A (15) and D (16) isolated as their respective salts from the nudibranch Tambja eliora. Only tambjamine D presented cytotoxicity against CEM (IC5)0 12.2 μg/mL) and HL60 (IC50 13.2 μg/mL) human leukemia cells, MCF-7 breast cancer cells (IC50 13.2 μg/mL), colon HCT-8 cancer cells (IC50 10.1 μg/mL) and murine melanoma B16 cancer cells (IC50 6.7 μg/mL). (author)

  17. First in situ observations of the deep-sea carnivorous ascidian Dicopia antirrhinum Monniot C., 1972 in the Western Mediterranean Sea

    Science.gov (United States)

    Mecho, A.; Aguzzi, J.; Company, J. B.; Canals, M.; Lastras, G.; Turon, X.

    2014-01-01

    Dicopia antirrhinum C. Monniot, 1972 is a rare species of deep-sea ascidian belonging to the Family Octacnemidae, reported at depths of 1000-2500 m in European Atlantic waters. Adult individuals have never been reported before in the Mediterranean Sea, where only seven juvenile specimens were found in 1975 at 500 m water depth in the Central basin (Malta). The affinities of these specimens with D. antirrhinum were noted, but lack of some typical characters of the species in juveniles prevented a definite taxonomical identification. No other member of the Octacnemidae has ever been found in the Mediterranean. In this study we describe the sampling of an adult specimen of D. antirrhinum at around 1100 m water depth on the flank of the La Fonera (Palamós) canyon, Northwestern Mediterranean, confirming their presence in the Mediterranean Sea. We also observed 5 individuals of this species on their natural habitat with a Remotely Operated Vehicle (ROV). Our results highlight the potential occurrence of Octacnemidae, the presence of which has been largely overlooked, in several deep-sea canyon areas within the Western Mediterranean basin. These observations are important because they indicate the need for increased sampling effort with new technologies, such as ROVs, in ecologically relevant habitats such as canyons, in order to obtain a more accurate picture of deep-sea biodiversity in the Mediterranean Sea.

  18. Proteomic and ultrastructural analysis of the effect of a new nitazoxanide-N-methyl-1H-benzimidazole hybrid against Giardia intestinalis.

    Science.gov (United States)

    Matadamas-Martínez, Félix; Castillo, Rafael; Hernández-Campos, Alicia; Méndez-Cuesta, Carlos; de Souza, Wanderley; Gadelha, Ana Paula; Nogueda-Torres, Benjamín; Hernández, José Manuel; Yépez-Mulia, Lilián

    2016-04-01

    In an effort to develop alternative drugs for the treatment of giardiasis our research group has synthesized and evaluated a novel nitazoxanide and N-methyl-1H-benzimidazole hybrid molecule, named CMC-20. It showed an IC50 of 0.010μM on Giardia intestinalis, lower than the IC50 values of 0.015, 0.037 and 1.224μM for nitazoxanide, albendazole and metronidazole, respectively. In addition, we report studies carried out on its mechanism of action and effect at the ultrastructural level on G. intestinalis. The proteomic analysis of trophozoites treated with CMC-20 revealed significant changes in the expression level of proteins of the cytoskeleton, alpha and beta tubulin, alpha-1, beta giardin and axoneme-associated protein, among other molecules. Ultrastructural studies demonstrated that CMC-20 induces morphological changes on the parasite that loses its characteristic pear shape. Uncommon large bulbous structure at the flagella end, and parasites showing flange membrane bending and a concave depression in the ventral region, resembling an encystation process, were also observed. In addition, some apoptotic and autophagic-like features, such as membrane blebbing, intense vacuolation, chromatin condensation and multilamellar bodies were detected. Phosphatidylserine externalization was determined as an apoptotic marker by flow cytometry and immunofluorescence microscopy; however, a typical ladder-like DNA fragmentation profile was not detected. Although it was found that CMC-20 triggers the encystation process, damage to the cyst wall indicates loss of viability. PMID:27033928

  19. Protection against diarrhea associated with Giardia intestinalis Is lost with multi-nutrient supplementation: a study in Tanzanian children.

    Directory of Open Access Journals (Sweden)

    Jacobien Veenemans

    2011-06-01

    Full Text Available BACKGROUND: Asymptomatic carriage of Giardia intestinalis is highly prevalent among children in developing countries, and evidence regarding its role as a diarrhea-causing agent in these settings is controversial. Impaired linear growth and cognition have been associated with giardiasis, presumably mediated by malabsorption of nutrients. In a prospective cohort study, we aim to compare diarrhea rates in pre-school children with and without Giardia infection. Because the study was conducted in the context of an intervention trial assessing the effects of multi-nutrients on morbidity, we also assessed how supplementation influenced the relationship between Giardia and diarrhoea rates, and to what extent Giardia modifies the intervention effect on nutritional status. METHODS AND FINDINGS: Data were collected in the context of a randomized placebo-controlled efficacy trial with 2×2 factorial design assessing the effects of zinc and/or multi-micronutrients on morbidity (n=612; height-for-age z-score <-1.5 SD. Outcomes measures were episodes of diarrhea (any reported, or with ≥3 stools in the last 24 h and fever without localizing signs, as detected with health-facility based surveillance. Giardia was detected in stool by enzyme-linked immunosorbent assay. Among children who did not receive multi-nutrients, asymptomatic Giardia infection at baseline was associated with a substantial reduction in the rate of diarrhea (HR 0.32; 0.15-0.66 and fever without localizing signs (HR 0.56; 0.36-0.87, whereas no such effect was observed among children who received multi-nutrients (p-values for interaction 0.03 for both outcomes. This interaction was independent of age, HAZ-scores and distance to the research dispensary. There was no evidence that Giardia modified the intervention effect on nutritional status. CONCLUSION: Although causality of the Giardia-associated reduction in morbidity cannot be established, multi-nutrient supplementation results in a loss

  20. Voltage sensitive phosphatases: emerging kinship to protein tyrosine phosphatases from structure-function research

    Directory of Open Access Journals (Sweden)

    Kirstin eHobiger

    2015-02-01

    Full Text Available The transmembrane protein Ci-VSP from the ascidian Ciona intestinalis was described as first member of a fascinating family of enzymes, the voltage sensitive phosphatases (VSPs. Ci-VSP and its voltage-activated homologs from other species are stimulated by positive membrane potentials and dephosphorylate the head groups of negatively charged phosphoinositide phosphates (PIPs. In doing so, VSPs act as control centers at the cytosolic membrane surface, because they intervene in signaling cascades that are mediated by PIP lipids. The characteristic motif CX5RT/S in the active site classifies VSPs as members of the huge family of cysteine-based protein tyrosine phosphatases (PTPs. Although PTPs have already been well characterized regarding both, structure and function, their relationship to VSPs has drawn only limited attention so far. Therefore, the intention of this review is to give a short overview about the extensive knowledge about PTPs in relation to the facts known about VSPs. Here, we concentrate on the structural features of the catalytic domain which are similar between both classes of phosphatases and their consequences for the enzymatic function. By discussing results obtained from crystal structures, molecular dynamics simulations, and mutagenesis studies, a possible mechanism for the catalytic cycle of VSPs is presented based on that one proposed for PTPs. In this way, we want to link the knowledge about the catalytic activity of VSPs and PTPs.

  1. Cadmium effects in food chain experiments with marine plankton algae (dinophyta) and benthic filter feeders(Tunicata)

    Science.gov (United States)

    Kayser, H.

    The dinoflagellate Scrippsiella faeroense was grown in continuous flow-through cultures (10 1 turbidostat), the outflow leading into vessels containing tunicates of the species Ciona intestinalis, Ascidiella aspersa, Molgula manhattensi and Botryllus schlosseri. The culture medium consisted of natural sea water enriched only with N and P components. CdCl 2 was added to the system at sublethal concentrations. Algal growth wass affected at a Cd ++ concentration of 10 μg·1 -1; sublethal toxicity thresholds of the tunicates ranged from 5 to 10 μg·1 -1. Cadmium accumulation was much higer in the algae than in the tunicates; in spite of the continuous supply of relatively highly Cd contaminated algae, the Cd content of algae-fed tunicates increased insignificantly by comparison with unfed specimens. Only a small percentage of the Cd offered via the food algae was actually assimilated by the ascidians during the first 3 weeks of the experiment. Cd content of the tunicates remained almost constant for the next 2 weeks of the experiment, indicating that ingestion and excretion of the metal was at equilibrium. The concentration factor of Cd decreased through the trophic chain.

  2. The colonial ascidian Didemnum sp. A: current distribution, basic biology and potential threat to marine communities of the northeast and west coasts of North America

    Science.gov (United States)

    Bullard, S.G.; Lambert, G.; Carman, M.R.; Byrnes, J.; Whitlatch, R.B.; Ruiz, G.; Miller, R.J.; Harris, L.; Valentine, P.C.; Collie, J.S.; Pederson, J.; McNaught, D.C.; Cohen, A.N.; Asch, R.G.; Dijkstra, J.; Heinonen, K.

    2007-01-01

    Didemnum sp. A is a colonial ascidian with rapidly expanding populations on the east and west coasts of North America. The origin of Didemum sp. A is unknown. Populations were first observed on the northeast coast of the U.S. in the late 1980s and on the west coast during the 1990s. It is currently undergoing a massive population explosion and is now a dominant member of many subtidal communities on both coasts. To determine Didemnum sp. A's current distribution, we conducted surveys from Maine to Virginia on the east coast and from British Columbia to southern California on the west coast of the U.S. between 1998 and 2005. In nearshore locations Didemnum sp. A currently ranges from Eastport, Maine to Shinnecock Bay, New York on the east coast. On the west coast it has been recorded from Humboldt Bay to Port San Luis in California, several sites in Puget Sound, Washington, including a heavily fouled mussel culture facility, and several sites in southwestern British Columbia on and adjacent to oyster and mussel farms. The species also occurs at deeper subtidal sites (up to 81 m) off New England, including Georges, Stellwagen and Tillies Banks. On Georges Bank numerous sites within a 230 km2 area are 50–90% covered by Didemnum sp. A; large colonies cement the pebble gravel into nearly solid mats that may smother infaunal organisms. These observations suggest that Didemnum sp. A has the potential to alter marine communities and affect economically important activities such as fishing and aquaculture.

  3. Signaling pathways in ascidian oocyte maturation: the roles of cAMP/Epac, intracellular calcium levels, and calmodulin kinase in regulating GVBD.

    Science.gov (United States)

    Lambert, Charles C

    2011-01-01

    Most mature ascidian oocytes undergo germinal vesicle breakdown (GVBD) when released by the ovary into sea water (SW). Acidic SW blocks this but they can be stimulated by raising the pH, increasing intracellular cAMP levels by cell permeant forms, inhibiting its breakdown or causing synthesis. Boltenia villosa oocytes undergo GVBD in response to these drugs. However, the cAMP receptor protein kinase A (PKA) does not appear to be involved, as oocytes are not affected by the kinase inhibitor H-89. Also, the PKA independent Epac agonist 8CPT-2Me-cAMP stimulates GVBD in acidic SW. GVBD is inhibited in calcium free sea water (CaFSW). The intracellular calcium chelator BAPTA-AM blocks GVBD at 10 µM. GVBD is also inhibited when the ryanodine receptors (RYR) are blocked by tetracaine or ruthenium red but not by the IP(3) inhibitor D-609. However, dimethylbenzanthracene (DMBA), a protein kinase activator, stimulates GVBD in BAPTA, tetracaine or ruthenium red blocked oocytes. The calmodulin kinase inhibitor KN-93 blocks GVBD at 10 µM. This and preceding papers support the hypothesis that the maturation inducing substance (MIS) produced by the follicle cells in response to increased pH causes activation of a G protein which triggers cAMP synthesis. The cAMP then activates an Epac molecule, which causes an increase in intracellular calcium from the endoplasmic reticulum ryanodine receptor. The increased intracellular calcium subsequently activates calmodulin kinase, which causes an increase in cdc25 phosphatase activity, activating MPF and the progression of the oocyte into meiosis. PMID:21774024

  4. Giardia intestinalis and nutritional status in children participating in the complementary nutrition program, Antioquia, Colombia, May to October 2006 Giardia intestinalis e estado nutricional em crianças participantes do programa de nutrição complementar, melhoramento alimentar e nutricional da Antioquia (MANA - Instituto Colombiano de Bem-Estar Familiar (ICBF, Antióquia, Colombia, maio a outubro de 2006

    Directory of Open Access Journals (Sweden)

    Jorge H. Botero-Garcés

    2009-06-01

    Full Text Available Giardia intestinalis infection is prevalent throughout the world and widely distributed in developing countries. In general, children display serious consequences to their state of health, including slow height-weight development; therefore, the main aim of this study was to determine the association between Giardia infection and the nutritional status of children who participate in the program of complementary feeding (Mejoramiento Alimentario y Nutricional de Antioquia (MANA - Instituto Colombiano de Bienestar Familiar (ICBF. A cross-sectional study examining the association of giardiasis with nutritional status was conducted. A total of 2035 children aged eight months to six years-old were studied. Data were collected using structured questionnaires, anthropometric measurements and laboratory analysis of blood and stool samples. Analysis of the results showed that 27.6% of children were infected with G. intestinalis, while 8.1% and 1.9% were mildly and significantly underweight, respectively, and 14.1% presented stunting. Giardiasis was statistically identified as a strong predictor of stunting in this study population.A infecção pela Giardia intestinalis está amplamente distribuída no mundo apresentando a maior prevalência nos países em desenvolvimento. Em crianças, esta parasitose pode ter conseqüências graves no estado geral de saúde assim como no ganho de peso e estatura. O objetivo desta pesquisa foi estabelecer a associação entre a infecção com Giardia e o estado nutricional das crianças beneficiárias do programa de complementação alimentar - MANA. Um estudo de corte no qual foram avaliadas 2035 crianças entre os oito meses e os seis anos de idade foi realizado. A informação foi obtida a partir de questionários estruturados, medições antropométricas e exame de fezes. Os resultados mostraram que 27,6% das crianças estavam infectadas com Giardia intestinalis, das quais 8,1% apresentaram desnutrição moderada

  5. Early embryonic expression of a LIM-homeobox gene Cs-lhx3 is downstream of beta-catenin and responsible for the endoderm differentiation in Ciona savignyi embryos.

    Science.gov (United States)

    Satou, Y; Imai, K S; Satoh, N

    2001-09-01

    In early Ciona embryos, nuclear accumulation of beta-catenin is most probably the first step of endodermal cell specification. If beta-catenin is mis- and/or overexpressed, presumptive notochord cells and epidermal cells change their fates into endodermal cells, whereas if beta-catenin nuclear localization is downregulated by the overexpression of cadherin, the endoderm differentiation is suppressed, accompanied with the differentiation of extra epidermal cells ( Imai, K., Takada, N., Satoh, N. and Satou, Y. (2000) Development 127, 3009-3020). Subtractive hybridization screens of mRNAs between beta-catenin overexpressed embryos and cadherin overexpressed embryos were conducted to identify potential beta-catenin target genes that are responsible for endoderm differentiation in Ciona savignyi embryos. We found that a LIM-homeobox gene (Cs-lhx3), an otx homolog (Cs-otx) and an NK-2 class gene (Cs-ttf1) were among beta-catenin downstream genes. In situ hybridization signals for early zygotic expression of Cs-lhx3 were evident only in the presumptive endodermal cells as early as the 32-cell stage, those of Cs-otx in the mesoendodermal cells at the 32-cell stage and those of Cs-ttf1 in the endodermal cells at the 64-cell stage. Later, Cs-lhx3 was expressed again in a set of neuronal cells in the tailbud embryo, while Cs-otx was expressed in the anterior nervous system of the embryo. Expression of all three genes was upregulated in beta-catenin overexpressed embryos and downregulated in cadherin overexpressed embryos. Injection of morpholino oligonucleotides against Cs-otx did not affect the embryonic endoderm differentiation, although the formation of the central nervous system was suppressed. Injection of Cs-ttf1 morpholino oligonucleotides also failed to suppress the endoderm differentiation, although injection of its synthetic mRNAs resulted in ectopic development of endoderm differentiation marker alkaline phosphatase. By contrast, injection of Cs-lhx3 morpholino

  6. Mytilicola intestinalis Steuer en el mejillón de la ría de Vigo (NO de España)

    OpenAIRE

    Figueras Monfort, Antonio; Figueras, Antonio

    1981-01-01

    Los autores llevan a cabo un estudio sobre la infestación del mejillón cultivado, en la ría de Vigo, por Mytilicola intestinalis steurer, con objeto de comprobar si la tasa de infestación actual es la esperada suponiendo que dicha infestación se realiza al azar. Se ha llegado a las conclusiones siguientes: a) la probabilidad de infestación, en las condiciones actuales, es aproximadamente del 58%, el número medio de parásitos por mejillón parasitado es de 2,23. b) la tasa de infestación más al...

  7. The life cycle of Neocladocystis intestinalis (Vaz, 1932) (Digenea: Cryptogonimidae), in Aylacostoma chloroticum (Prosobranchia: Thiaridae), and Salminus brasiliensis (Characiformes: Characidae), in Argentina.

    Science.gov (United States)

    Quintana, Manuel G; Ostrowski de Núñez, Margarita

    2016-07-01

    The life cycle of Neocladocystis intestinalis (Vaz, 1932) was resolved experimentally. The prosobranchiate snail Aylacostoma chloroticum Hylton Scott (Thiaridae) collected in the Yacyretá Dam, Province of Misiones, Argentina, was found naturally infected with cercariae that possessed pigmented eye spots, 7 pairs of penetration glands, 12 pairs of flame cells, and a V-shaped, or Y-shaped excretory vesicle with very short stem. The cercariae developed in oval cysts, which were found on fin rays, and under scales of naturally and experimentally exposed tetragonopterid fish species and of experimentally exposed poecilid and prochilodont fish species. Adults were obtained experimentally from juvenile Salminus brasiliensis (Characidae), bred in captivity, and infected with metacercariae from albino Gymnocorymbus ternetzi (Tetragonopteridae), which had been exposed to emerging cercariae. PMID:26984207

  8. Dermatan sulfate in tunicate phylogeny: Order-specific sulfation pattern and the effect of [→4IdoA(2-Sulfateβ-1→3GalNAc(4-Sulfateβ-1→] motifs in dermatan sulfate on heparin cofactor II activity

    Directory of Open Access Journals (Sweden)

    Sugahara Kazuyuki

    2011-05-01

    Full Text Available Abstract Background Previously, we have reported the presence of highly sulfated dermatans in solitary ascidians from the orders Phlebobranchia (Phallusia nigra and Stolidobranchia (Halocynthia pyriformis and Styela plicata. Despite the identical disaccharide backbone, consisting of [→4IdoA(2Sβ-1→3GalNAcβ-1→], those polymers differ in the position of sulfation on the N-Acetyl galactosamine, which can occur at carbon 4 or 6. We have shown that position rather than degree of sulfation is important for heparin cofactor II activity. As a consequence, 2,4- and 2,6-sulfated dermatans have high and low heparin cofactor II activities, respectively. In the present study we extended the disaccharide analysis of ascidian dermatan sulfates to additional species of the orders Stolidobranchia (Herdmania pallida, Halocynthia roretzi and Phlebobranchia (Ciona intestinalis, aiming to investigate how sulfation evolved within Tunicata. In addition, we analysed how heparin cofactor II activity responds to dermatan sulfates containing different proportions of 2,6- or 2,4-disulfated units. Results Disaccharide analyses indicated a high content of disulfated disaccharide units in the dermatan sulfates from both orders. However, the degree of sulfation decreased from Stolidobranchia to Phlebobranchia. While 76% of the disaccharide units in dermatan sulfates from stolidobranch ascidians are disulfated, 53% of disulfated disaccharides are found in dermatan sulfates from phlebobranch ascidians. Besides this notable difference in the sulfation degree, dermatan sulfates from phlebobranch ascidians contain mainly 2,6-sulfated disaccharides whereas dermatan sulfate from the stolidobranch ascidians contain mostly 2,4-sulfated disaccharides, suggesting that the biosynthesis of dermatan sulfates might be differently regulated during tunicates evolution. Changes in the position of sulfation on N-acetylgalactosamine in the disaccharide [→4IdoA(2-Sulfateβ-1→3GalNAcβ-1

  9. Reproductive protein evolution in two cryptic species of marine chordate

    Directory of Open Access Journals (Sweden)

    Harrison Richard G

    2011-01-01

    Full Text Available Abstract Background Reproductive character displacement (RCD is a common and taxonomically widespread pattern. In marine broadcast spawning organisms, behavioral and mechanical isolation are absent and prezygotic barriers between species often operate only during the fertilization process. Such barriers are usually a consequence of differences in the way in which sperm and egg proteins interact, so RCD can be manifest as faster evolution of these proteins between species in sympatry than allopatry. Rapid evolution of these proteins often appears to be a consequence of positive (directional selection. Here, we identify a set of candidate gamete recognition proteins (GRPs in the ascidian Ciona intestinalis and showed that these GRPs evolve more rapidly than control proteins (those not involved in gamete recognition. Choosing a subset of these gamete recognition proteins that show evidence of positive selection (CIPRO37.40.1, CIPRO60.5.1, CIPRO100.7.1, we then directly test the RCD hypothesis by comparing divergence (omega and polymorphism (McDonald-Kreitman, Tajima's D, Fu and Li's D and F, Fay and Wu's H statistics in sympatric and allopatric populations of two distinct forms of C. intestinalis (Types A and B between which there are strong post-zygotic barriers. Results Candidate gamete recognition proteins from two lineages of C. intestinalis (Type A and B are evolving more rapidly than control proteins, consistent with patterns seen in insects and mammals. However, ω (dN/dS is not significantly different between the sympatric and allopatric populations, and none of the polymorphism statistics show significant differences between sympatric and allopatric populations. Conclusions Enhanced prezygotic isolation in sympatry has become a well-known feature of gamete recognition proteins in marine broadcast spawners. But in most cases the evolutionary process or processes responsible for this pattern have not been identified. Although gamete

  10. Molecular investigation of zoonotic genotypes of Giardia intestinalis isolates in humans, dogs and cats, sheep, goats and cattle in Araçatuba (São Paulo State, Brazil by the analysis of ß-giardin gene fragments

    Directory of Open Access Journals (Sweden)

    Elenir Alves Macedo de Godoy

    2013-10-01

    Full Text Available In the period from July 2009 to October 2010, fecal samples from 61 animals and 154 humans from the municipality of Aracatuba (São Paulo State, Brazil were studied. Fecal samples from animals were collected in the Municipal Animal Shelter and the Veterinary Hospital of the Universidade Estadual Paulista. Human fecal specimens were collected in playschools in the outskirts of the city by the private network of clinical analysis laboratories of the municipal. Diagnosis was done by optical microscopy using the Faust and Hoffmann, Pons and Janer techniques. The genotypes of Giardia intestinalis were characterized by PCR-RFLP and confirmed by sequencing the ß-giardin gene. Human specimens were positive in 25.3% (39/154 of the cases with 26.8% (36/134 of the specimens from children and 15% (3/20 from adults being positive. The frequency of G. intestinalis among the animals was 23.0% (14/61. A total of 32 isolates of G. intestinalis obtained from human feces and six from dogs and cats were characteristic of the A genotype (AI and AII/AIII. The results of this study in respect to frequency of giardiasis are similar to reported in most studies in Brazil. The prevalence observed in animal populations conforms to worldwide infection rates. G. intestinalis genotypes considered zoonotic were detected in both pets and humans from the city of Aractuba, suggesting a possible zoonotic transmission of the parasite in the northwestern region of São Paulo State. The absence of these genotypes in farm animals may imply that they are not involved in the chain of transmission to humans in this region.

  11. Isolation and biological activities of secondary metabolites from the sponges monanchora aff. arbuscula, aplysina sp. petromica ciocalyptoides and topsentia ophiraphidies, from the ascidian didemnum ligulum and from the octocoral carijoa riisei

    International Nuclear Information System (INIS)

    The investigation of extracts from six species of marine invertebrates yielded one new and several known natural products. Isoptilocaulin from the sponge Monanchora aff. arbuscula displayed antimicrobial activity at 1.3 mg/mL against an oxacillin-resistant strain of Staphylococcus aureus. Five inactive known dibromotyrosine derivatives, 2 6, were isolated from a new species of marine sponge, Aplysina sp. The sponges Petromica ciocalyptoides and Topsentia ophiraphidites yielded the known halistanol sulfate A (7) as an inhibitor of the antileishmanial target adenosine phosphoribosyl transferase. The ascidian Didemnum ligulum yielded asterubin (10) and the new N,N-dimethyl-O-methylethanolamine (11). The octocoral Carijoa riisei yielded the known 18-acetoxypregna-1,4,20-trien-3-one (12), which displayed cytotoxic activity against the cancer cell lines SF295, MDA-MB435, HCT8 and HL60. (author)

  12. Dicty_cDB: Contig-U16391-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 3895 |pid:none) Podospora anserina genomic DNA c... 204 7e-51 AY830393_1( AY830393 |pid:none) Mus musculus myosin.... 48 1e-13 5 ( BW212344 ) Ciona intestinalis cDNA, clone:cieg070c01, 5' end... 48 1e-13 5 ( BW654420 ) Glycin...d,... 70 2e-13 2 ( AV992378 ) Ciona intestinalis cDNA, clone:cicl58n12, 5' end,... 48 ...T80381.fwd Gateway compatible cien cDNA librar... 48 2e-13 5 ( BW212062 ) Ciona intestinalis cDNA, clone:cieg069d24, 5' en...testinalis cDNA, clone:cilv01m24, 5' end,... 48 3e-11 4 ( DR984111 ) JGI_AOKF1594.rev AOKF Acropora

  13. Dicty_cDB: Contig-U11573-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available vf-532-153... 47 0.002 AF072520_1( AF072520 |pid:none) Nicotiana tabacum centrin (CEN2) m... 47 0.002 ( P41041 ) Rec... ( FF956263 ) CBWU84390.b1 Yutaka Satou unpublished cDNA librar... 40 2.3 3 ( BW301102 ) Ciona intestinalis ...clone:cigd021p07, 5' end... 40 2.5 3 ( FG000324 ) CBWU115949.b1 Yutaka Satou unpublished cDNA libra... 40 2....5 3 ( FF937715 ) CBWU72908.b1 Yutaka Satou unpublished cDNA librar... 40 2.5 3 ( BW215316 ) Ciona intestinalis... 2.6 3 ( BW488095 ) Ciona intestinalis cDNA, clone:cima018a12, 3'end,... 40 2.6 3 ( FF858106 ) CBWU6786.b1 Yutaka Satou unpublis

  14. Dicty_cDB: Contig-U10806-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available gton's Disease gene homolo... 72 6e-11 ( P42859 ) RecName: Full=Huntingtin; AltName: Full=Huntington...671_5( AL954671 |pid:none) Zebrafish DNA sequence from clone ... 75 5e-12 ( P51112 ) RecName: Full=Huntingtin; AltName: Full=Huntingt...M162277 |pid:none) Ciona intestinalis mRNA for huntin... 72 4e-11 L28827_1( L28827 |pid:none) Mouse Huntin...on dise... 74 9e-12 AM238514_1( AM238514 |pid:none) Ciona intestinalis mRNA for hun

  15. Ascídias (Tunicata, Ascidiacea da Reserva Biológica Marinha do Arvoredo, Santa Catarina, Brasil Ascidians (Tunicata, Ascidiacea from the Arvoredo Marine Biological Reserve, Santa Catarina, Brazil

    Directory of Open Access Journals (Sweden)

    Rosana M. da Rocha

    2005-06-01

    Full Text Available A Reserva Biológica Marinha de Arvoredo compreende uma extensa área (17.800 ha, onde se elevam as ilhas do Arvoredo, Galé, Deserta e calhau de São Pedro. O levantamento de espécies de ascídias foi realizado por meio de mergulho autônomo m águas rasas (5-17 m de profundidade. Vinte e seis espécies são aqui registradas, entre as quais Lissoclinum perforatum (Giard, 1872, L. verrilli (Van Name, 1902 e Leptoclinides latus Monniot, 1983 representam novos registros para o Brasil, e outras 19 espécies representam novos registros para o Estado de Santa Catarina. Com este resultado, 34 espécies de ascídias já foram registradas em Santa Catarina, das quais 22 são marcadamente tropicais. Este cenário não representa a diversidade total da Reserva, uma vez que três espécies novas serão descritas em outra publicação e os locais mais expostos e profundos das ilhas não foram amostrados.The Arvoredo Marine Biological Reserve covers an extensive area including the islands Arvoredo, Galés and Deserta and a small rocky outcrop called São Pedro. The survey of ascidians was accomplished with scuba dive, only in shallow water (5-17 m deep. Twenty-six species are here registered, among which Lissoclinum perforatum (Giard, 1872, L. verrilli (Van Name, 1902 and Leptoclinides latus Monniot, 1983 represent new reports to Brazil, and other 19 species represent new reports to the State of Santa Catarina. Together with the results of the present work, 34 ascidian species have already been reported from Santa Catarina, of the which 22 are remarkably tropical. This scenery doesn't represent the total diversity of the Reserve, since three new species will be described in another publication and the most exposed and deep places of the islands were not sampled.

  16. Epidemiological survey in Łęczyńsko-Włodawskie Lake District of eastern Poland reveals new evidence of zoonotic potential of Giardia intestinalis.

    Science.gov (United States)

    Stojecki, Krzysztof; Sroka, Jacek; Cencek, Tomasz; Dutkiewicz, Jacek

    2015-01-01

    Faecal samples from 297 farm animals were collected from 18 households in distinct sites of the Łęczyńsko-Włodawskie Lake District of eastern Poland. They included samples from 86 cattle (Bos taurus), 84 pigs (Sus scrofa f. domestica), 81 sheep (Ovis aries), 10 horses (Equus caballus), and 36 dogs (Canis lupus familiaris). The samples were examined for the presence of Giardia intestinalis by the Direct Fluorescence Assay (DFA) and semi-nested PCR. All amplicons were sequenced on both strands. By DFA, cysts of Giardia spp. were detected in 66 of 297 faecal samples (22.2%). Positive specimens for Giardia spp. were derived from 29.8% of examined pigs, 21.0% of sheep, 18.6% of cattle, 10% of horses, and 19.4% of dogs. Based on the detection of the β-giardin gene by PCR, 39 (13.1%) of the 297 examined samples were recognized as positive. Detection of the presence of Giardia cysts by DFA test was overall significantly higher compared to PCR (p=0.0045). By PCR, Giardia was found in 28.1% of sheep, 11.6% of cattle, 10% of horses, 9.5% of pigs and 5.6% of dogs. Partial β-giardin gene sequences were obtained for 73.7% of the PCR positive samples. From sequenced samples derived from the studied animals, Giardia were identified as assemblage A (8 samples), B (1 sample) and E (18 samples). As assemblages A and B may be zoonotic, the farm animals living in eastern Poland could be regarded as a potential source of Giardia infection for humans. PMID:26706961

  17. Investigation of taxa of the family Pasteurellaceae isolated from Syrian and European hamsters and proposal of Mesocricetibacter intestinalis gen. nov., sp. nov. and Cricetibacter osteomyelitidis gen. nov., sp. nov

    DEFF Research Database (Denmark)

    Christensen, Henrik; Nicklas, W.; Bisgaard, Magne

    2014-01-01

    of the family Pasteurellaceae. The strains formed two monophyletic groups based on 16S rRNA gene sequence comparison to other members of the family Pasteurellaceae. Partial rpoB sequencing as well as published data on DNA-DNA hybridization showed high genotypic relationships within both groups....... Menaquinone 7 (MK7) was found in strains of both groups as well as an unknown ubiquinone with shorter chain length than previously reported for any other member of the family Pasteurellaceae. A new genus with one species, Mesocricetibacter intestinalis gen. nov., sp. nov., is proposed to accommodate members...... separated by phenotype from each other and from existing genera of the family Pasteurellaceae. The type strain of Mesocricetibacter intestinalis is HIM 933/7(T) ( =Kunstyr 246/85(T) =CCUG 28030(T) =DSM 28403(T)) while the type strain of Cricetibacter osteomyelitidis is HIM943/7(T) ( =Kunstyr 507/85(T) =CCUG...

  18. Gene : CBRC-CINT-01-0226 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CINT-01-0226 Novel UN D UNKNOWN CLCN2_MOUSE 0.0 56% gb|AAC06344.1| chloride channel 2 [Ratt ... ori Satoh unpublished cDNA library, juvenile whole animal ... Ciona intestinalis cDNA clone cijv408o05 5', mRNA ...

  19. Gene : CBRC-CINT-01-0007 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CINT-01-0007 Novel UN A UNKNOWN SSR2_HUMAN 9e-33 29% gb|AAP91736.1| kappa opioid receptor-l ... 0894 BW180279 Nori Satoh unpublished cDNA library, heart ... Ciona intestinalis cDNA clone rciht018k05 3', mRNA ...

  20. Gene : CBRC-CINT-01-0071 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CINT-01-0071 Novel UN A UNKNOWN SSR5_MOUSE 2e-31 30% gb|AAP91736.1| kappa opioid receptor-l ... 0894 BW180279 Nori Satoh unpublished cDNA library, heart ... Ciona intestinalis cDNA clone rciht018k05 3', mRNA ...

  1. Gene : CBRC-CINT-01-0121 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CINT-01-0121 Novel UN C UNKNOWN DSBD_CAMJR 1.2 21% gb|AAR24077.1| AMO [Drosophila melanogas ... 4677 BW184062 Nori Satoh unpublished cDNA library, heart ... Ciona intestinalis cDNA clone rciht029c01 3', mRNA ...

  2. Gene : CBRC-CINT-01-0018 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CINT-01-0018 Novel UN D UNKNOWN VGLX_EHV1V 2.1 22% dbj|BAC87602.1| unnamed protein product ... 3747 BW310187 Nori Satoh unpublished cDNA library, heart ... Ciona intestinalis cDNA clone ciht006l24 5', mRNA ...

  3. Dicty_cDB: Contig-U12751-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ) RAE00012771 Reclinomonas americana Home made, nor... 48 0.46 1 ( AM830211 ) Nicotiana tabacum EST, clone n...t006087030. 48 0.46 1 ( BW501508 ) Ciona intestinalis cDNA, clone:cima056p22, 3'end,... 48 0.46 1 ( BW500413 ) Ciona intestina...lis cDNA, clone:cima053a12, 3'end,... 48 0.46 1 ( BW456831 ) Ciona intestina...09_1( AK229409 |pid:none) Arabidopsis thaliana mRNA for puta... 37 0.62 (Q9S775) RecName: Full=CHD3-type chroma...pshtfqevlfqhglkkmirvy*lvsinm vmenilkfsliln*iysqm*revnqilfhqiqlvimikiiiiiiiiaiktiliiliviav iiiiktlqlinnnsnsnl

  4. Dicty_cDB: Contig-U05349-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available A, clone: LEFL1016BE03, H... 44 3e-09 4 ( CN612803 ) CssgEST00526 Culicoides sonorensis female salivar... 38...9) RecName: Full=Iron sulfur cluster assembly protein 1, m... 169 1e-40 CP000488_523( CP000488 |pid:none) Candidatus Ruthia mag... H 1.37 0.711 1.31 Gapped Lambda K H 1.37 0.711 1.31 Matrix: blastn matrix:1 -3 Gap Penalties: Existence: 5, Extensi...e-08 3 ( BW336233 ) Ciona intestinalis cDNA, clone:ciem802f24, 5'end,... 46 2e-08... 3 ( BW338300 ) Ciona intestinalis cDNA, clone:ciem808k18, 5'end,... 46 2e-08 3 ( BW198676 ) Ciona intestina

  5. Prevalence of Cryptosporidium spp., Enterocytozoon bieneusi, Encephalitozoon spp. and Giardia intestinalis in Wild, Semi-Wild and Captive Orangutans (Pongo abelii and Pongo pygmaeus) on Sumatra and Borneo, Indonesia

    Science.gov (United States)

    Mynářová, Anna; Foitová, Ivona; Kváč, Martin; Květoňová, Dana; Rost, Michael; Morrogh-Bernard, Helen; Nurcahyo, Wisnu; Nguyen, Cathleen; Supriyadi, Supriyadi; Sak, Bohumil

    2016-01-01

    Background Orangutans are critically endangered primarily due to loss and fragmentation of their natural habitat. This could bring them into closer contact with humans and increase the risk of zoonotic pathogen transmission. Aims To describe the prevalence and diversity of Cryptosporidium spp., microsporidia and Giardia intestinalis in orangutans at seven sites on Sumatra and Kalimantan, and to evaluate the impact of orangutans’ habituation and location on the occurrence of these zoonotic protists. Result The overall prevalence of parasites in 298 examined animals was 11.1%. The most prevalent microsporidia was Encephalitozoon cuniculi genotype II, found in 21 animals (7.0%). Enterocytozoon bieneusi genotype D (n = 5) and novel genotype Pongo 2 were detected only in six individuals (2.0%). To the best of our knowledge, this is the first report of these parasites in orangutans. Eight animals were positive for Cryptosporidium spp. (2.7%), including C. parvum (n = 2) and C. muris (n = 6). Giardia intestinalis assemblage B, subtype MB6, was identified in a single individual. While no significant differences between the different human contact level groups (p = 0.479–0.670) or between the different islands (p = 0.992) were reported in case of E. bieneusi or E. cuniculi, Cryptosporidium spp. was significantly less frequently detected in wild individuals (p < 2×10−16) and was significantly more prevalent in orangutans on Kalimantan than on Sumatra (p < 2×10−16). Conclusion Our results revealed that wild orangutans are significantly less frequently infected by Cryptosporidium spp. than captive and semi-wild animals. In addition, this parasite was more frequently detected at localities on Kalimantan. In contrast, we did not detect any significant difference in the prevalence of microsporidia between the studied groups of animals. The sources and transmission modes of infections were not determined, as this would require repeated sampling of individuals

  6. Is real-time PCR-based diagnosis similar in performance to routine parasitological examination for the identification of Giardia intestinalis, Cryptosporidium parvum/Cryptosporidium hominis and Entamoeba histolytica from stool samples? Evaluation of a new commercial multiplex PCR assay and literature review.

    Science.gov (United States)

    Laude, A; Valot, S; Desoubeaux, G; Argy, N; Nourrisson, C; Pomares, C; Machouart, M; Le Govic, Y; Dalle, F; Botterel, F; Bourgeois, N; Cateau, E; Leterrier, M; Le Pape, P; Morio, F

    2016-02-01

    Microscopy is the reference standard for routine laboratory diagnosis in faecal parasitology but there is growing interest in alternative methods to overcome the limitations of microscopic examination, which is time-consuming and highly dependent on an operator's skills and expertise. Compared with microscopy, DNA detection by PCR is simple and can offer a better turnaround time. However, PCR performances remain difficult to assess as most studies have been conducted on a limited number of positive clinical samples and used in-house PCR methods. Our aim was to evaluate a new multiplex PCR assay (G-DiaParaTrio; Diagenode Diagnostics), targeting Giardia intestinalis, Cryptosporidium parvum/Cryptosporidium hominis and Entamoeba histolytica. To minimize the turnaround time, PCR was coupled with automated DNA extraction (QiaSymphony; Qiagen). The PCR assay was evaluated using a reference panel of 185 samples established by routine microscopic examination using a standardized protocol including Ziehl-Neelsen staining and adhesin detection by ELISA (E. histolytica II; TechLab). This panel, collected from 12 French parasitology laboratories, included 135 positive samples for G. intestinalis (n = 38), C. parvum/C. hominis (n = 26), E. histolytica (n = 5), 21 other gastrointestinal parasites, together with 50 negative samples. In all, the G-DiaParaTrio multiplex PCR assay identified 38 G. intestinalis, 25 C. parvum/C. hominis and five E. histolytica leading to sensitivity/specificity of 92%/100%, 96%/100% and 100%/100% for G. intestinalis, C. parvum/C. hominis and E. histolytica, respectively. This new multiplex PCR assay offers fast and reliable results, similar to microscopy-driven diagnosis for the detection of these gastrointestinal protozoa, allowing its implementation in routine clinical practice. PMID:26548509

  7. Isolation and biological activities of secondary metabolites from the sponges monanchora aff. arbuscula, aplysina sp. petromica ciocalyptoides and topsentia ophiraphidies, from the ascidian didemnum ligulum and from the octocoral carijoa riisei; Isolamento e atividades biologicas de produtos naturais das esponjas monanchora arbuscula, aplysina sp., petromica ciocalyptoides e topsentia ophiraphidites, da ascidia didemnum ligulum e do octocoral carijoa riisei

    Energy Technology Data Exchange (ETDEWEB)

    Kossuga, Miriam H.; Lira, Simone P. de; Nascimento, Andrea M.; Gambardella, Maria Teresa P.; Berlinck, Roberto G.S. [Universidade de Sao Paulo (USP), Sao Carlos, SP (Brazil). Inst. de Quimica]. E-mail: rgsberlinck@iqsc.usp.br; Torres, Yohandra R. [Universidade Estadual do Centro-Oeste, Guarapuava, PR (Brazil). Dept. de Quimica; Nascimento, Gislene G.F. [Universidade Metodista de Piracicaba (UNIMEP), SP (Brazil). Faculdade de Ciencias da Saude; Pimenta, Eli F.; Silva, Marcio; Thiemann, Otavio H.; Oliva, Glaucius [Universidade de Sao Paulo (USP), Sao Carlos, SP (Brazil). Inst. de Fisica; Tempone, Andre G.; Melhem, Marcia S.C. [Instituto Adolfo Lutz, Sao Paulo, SP (Brazil). Div. de Biologia Medica; Souza, Ana O. de; Galetti, Fabio C.S.; Silva, Celio L. [Universidade de Sao Paulo (USP), Ribeirao Preto, SP (Brazil). Faculdade de Medicina. Dept. de Bioquimica e Imunologia; Cavalcanti, Bruno; Pessoa, Claudia O.; Moraes, Manoel O. [Universidade Federal do Ceara (UFC), Fortaleza, CE (Brazil). Faculdade de Medicina. Dept. de Fisiologia e Farmacologia; Hajdu, Eduardo [Universidade Federal do Rio de Janeiro (UFRJ), RJ (Brazil). Museu Nacional; Peixinho, Solange [Universidade Federal da Bahia (UFBA), Salvador, BA (Brazil). Dept. de Biologia; Rocha, Rosana M. [Universidade Federal do Parana (UFPR), Curitiba, PR (Brazil). Setor de Ciencias Biologicas. Dept. de Zoologia

    2007-09-15

    The investigation of extracts from six species of marine invertebrates yielded one new and several known natural products. Isoptilocaulin from the sponge Monanchora aff. arbuscula displayed antimicrobial activity at 1.3 mg/mL against an oxacillin-resistant strain of Staphylococcus aureus. Five inactive known dibromotyrosine derivatives, 2 6, were isolated from a new species of marine sponge, Aplysina sp. The sponges Petromica ciocalyptoides and Topsentia ophiraphidites yielded the known halistanol sulfate A (7) as an inhibitor of the antileishmanial target adenosine phosphoribosyl transferase. The ascidian Didemnum ligulum yielded asterubin (10) and the new N,N-dimethyl-O-methylethanolamine (11). The octocoral Carijoa riisei yielded the known 18-acetoxypregna-1,4,20-trien-3-one (12), which displayed cytotoxic activity against the cancer cell lines SF295, MDA-MB435, HCT8 and HL60. (author)

  8. Isolamento e atividades biológicas de produtos naturais das esponjas monanchora arbuscula, aplysina sp. petromica ciocalyptoides e topsentia ophiraphidites, da ascídia didemnum ligulum e do octocoral carijoa riisei Isolantion and biological activities of secondary metabolites from the sponges monanchora aff. arbuscula, aplysina sp. petromica ciocalyptoides and topsentia ophiraphidies, from the ascidian didemnum ligulum and from the octocoral carijoa riisei

    Directory of Open Access Journals (Sweden)

    Miriam H. Kossuga

    2007-10-01

    Full Text Available The investigation of extracts from six species of marine invertebrates yielded one new and several known natural products. Isoptilocaulin from the sponge Monanchora aff. arbuscula displayed antimicrobial activity at 1.3 mg/mL against an oxacillin-resistant strain of Staphylococcus aureus. Five inactive known dibromotyrosine derivatives, 2 6, were isolated from a new species of marine sponge, Aplysina sp. The sponges Petromica ciocalyptoides and Topsentia ophiraphidites yielded the known halistanol sulfate A (7 as an inhibitor of the antileishmanial target adenosine phosphoribosyl transferase. The ascidian Didemnum ligulum yielded asterubin (10 and the new N,N-dimethyl-O-methylethanolamine (11. The octocoral Carijoa riisei yielded the known 18-acetoxypregna-1,4,20-trien-3-one (12, which displayed cytotoxic activity against the cancer cell lines SF295, MDA-MB435, HCT8 and HL60.

  9. Dicty_cDB: Contig-U14087-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available total letters Score E Sequences producing significant alignments: (bits) Value Contig-U14087-1 (Contig-U14087-1Q) /CSM_Contig/Conti...ne S-transferase Y-b subu... 55 2e-06 (Q9JHF7) RecName: Full=Glutathione-requiring prostaglandin D s...id:none) Bordetella petrii strain DSM 12... 54 6e-06 ( O73888 ) RecName: Full=Glutathione-requiring prostaglandin...( AX886166 |pid:none) Sequence 2029 from Patent EP1033401. 49 3e-04 DQ789057_1( DQ789057 |pid:none) Ciona intestinalis prostaglandin... WO20080... 46 0.002 DQ789056_1( DQ789056 |pid:none) Ciona intestinalis prostaglandin D... 46 0

  10. Dicty_cDB: Contig-U06776-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 68135_1238( CU468135 |pid:none) Erwinia tasmaniensis strain ET1... 38 0.27 AP008971_1217( AP008971 |pid:none) Finegoldia mag...1 ( AA509039 ) MBAFCX6E07T3 Brugia malayi adult female cDNA (SAW... 48 0.38 1 ( AE009951 ) Fusobacterium nuc...n cDNA librar... 40 2.5 2 ( BW347533 ) Ciona intestinalis cDNA, clone:ciem836m11, 5'end,... 40 2....b1 Yutaka Satou unpublished cDNA librar... 40 2.7 2 ( BW396303 ) Ciona intestinalis cDNA, clone:ciem...51( CP000964 |pid:none) Klebsiella pneumoniae 342, comp... 84 2e-15 CP000647_1821

  11. Dicty_cDB: Contig-U16377-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CP001124 |pid:none) Geobacter bemidjiensis Bem, comp... 38 1.2 D00619_3( D00619 |pid:none) Bacillus subtilis genes for ribosoma....37 0.711 1.31 Matrix: blastn matrix:1 -3 Gap Penalties: Existence: 5, Extension: 2 Number of Hits to DB: 24...ipes adult whol... 74 6e-27 5 ( FC647651 ) CAXU9199.fwd CAXU Lottia gigantea from female gon... 103 1e-25 2 ..., 3'end,... 86 3e-24 2 ( BW402016 ) Ciona intestinalis cDNA, clone:ciem838d02, 3'end,... 86 3e-24 2 ( AV9962... clone:rcitb099d04, 3' en... 84 1e-23 2 ( BW396187 ) Ciona intestinalis cDNA, clone:ciem820g08, 3'end,... 84

  12. Dicty_cDB: Contig-U13737-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4905 ) Ciona intestinalis cDNA, clone:ciem816h13, 3'end,... 48 0.016 2 ( FF709347 ) XABT29982.rev Gateway compatible cie...n cDNA librar... 48 0.016 2 ( BW394585 ) Ciona intestinalis cDNA, clone:ciem815h13, 3'end,... 48.... 192 6e-48 AE017226_2247( AE017226 |pid:none) Treponema denticola ATCC 35405,... 192 6e-48 AE017180_2248( A... AP007255_4090( AP007255 |pid:none) Magnetospirillum magneticum AMB... 189 8e-47 CP000927_4520( CP000927 |pi...,... 186 4e-46 AM494969_338( AM494969 |pid:none) Leishmania braziliensis chromoso

  13. Produtos naturais da ascídia Botrylloides giganteum, das esponjas Verongula gigantea, Ircinia felix, Cliona delitrix e do nudibrânquio Tambja eliora, da costa do Brasil Natural products from the ascidian Botrylloides giganteum, from the sponges Verongula gigantea, Ircinia felix, Cliona delitrix and from the nudibranch Tambja eliora, from the Brazilian coastline

    Directory of Open Access Journals (Sweden)

    Ana Claudia Granato

    2005-03-01

    Full Text Available Two new marine metabolites, 3Z, 6Z, 9Z-dodecatrien-1-ol (1 from the ascidian Botrylloides giganteum and 4H-pyran-2ol acetate from the sponge Ircinia felix (4 are herein reported. The known bromotyrosine compounds, 2-(3,5-dibromo-4-methoxyphenyl-N,N,N-dimethylethanammonium (2 and 2,6-dibromo-4-(2-(trimethylammoniumethylphenol (3, have been isolated from the sponge Verongula gigantea. Serotonin (5 is reported for the first time from the sponge Cliona delitrix, and tambjamines A (15 and D (16 isolated as their respective salts from the nudibranch Tambja eliora. Only tambjamine D presented cytotoxicity against CEM (IC50 12.2 µg/mL and HL60 (IC50 13.2 µg/mL human leukemya cells, MCF-7 breast cancer cells (IC50 13.2 µg/mL, colon HCT-8 cancer cells (IC50 10.1 µg/mL and murine melanoma B16 cancer cells (IC50 6.7 µg/mL.

  14. Dicty_cDB: Contig-U08919-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e) Tetrahymena tropicalis copper-indu... 42 0.044 (Q6L8H2) RecName: Full=Keratin-associated protein...... 44 0.009 DQ482581_1( DQ482581 |pid:none) Galleria mellonella lipophorin rec... 44 0.009 AK066765_1( AK066765 |pid:none) Oryza... musculus FEX2 mRNA, complete c... 44 0.011 AF033584_1( AF033584 |pid:none) Giardia intestinalis varia...4 0.011 AB210518_1( AB210518 |pid:none) Ciona intestinalis mRNA for jagged... 44 0.015 EU152252_1( EU152252 |pid:none) Hydra vulgari... d... 43 0.026 AY142135_1( AY142135 |pid:none) Giardia intestinalis isolate WB cl... 43 0.026 ( P60331 ) RecName: Full=Keratin

  15. In silico identification of the sea squirt selenoproteome

    Directory of Open Access Journals (Sweden)

    Jiang Liang

    2010-05-01

    Full Text Available Abstract Background Computational methods for identifying selenoproteins have been developed rapidly in recent years. However, it is still difficult to identify the open reading frame (ORF of eukaryotic selenoprotein gene, because the TGA codon for a selenocysteine (Sec residue in the active centre of selenoprotein is traditionally a terminal signal of protein translation. Although the identification of selenoproteins from genomes through bioinformatics methods has been conducted in bacteria, unicellular eukaryotes, insects and several vertebrates, only a few results have been reported on the ancient chordate selenoproteins. Results A gene assembly algorithm SelGenAmic has been constructed and presented in this study for identifying selenoprotein genes from eukaryotic genomes. A method based on this algorithm was developed to build an optimal TGA-containing-ORF for each TGA in a genome, followed by protein similarity analysis through conserved sequence alignments to screen out selenoprotein genes form these ORFs. This method improved the sensitivity of detecting selenoproteins from a genome due to the design that all TGAs in the genome were investigated for its possibility of decoding as a Sec residue. Using this method, eighteen selenoprotein genes were identified from the genome of Ciona intestinalis, leading to its member of selenoproteome up to 19. Among them a selenoprotein W gene was found to have two SECIS elements in the 3'-untranslated region. Additionally, the disulfide bond formation protein A (DsbA was firstly identified as a selenoprotein in the ancient chordates of Ciona intestinalis, Ciona savignyi and Branchiostoma floridae, while selenoprotein DsbAs had only been found in bacteria and green algae before. Conclusion The method based on SelGenAmic algorithm is capable of identifying eukaryotic selenoprotein genes from their genomes. Application of this method to Ciona intestinalis proves its successes in finding Sec-decoding TGA

  16. Recruitment and colonization of colonial ascidians (Tunicata: Ascidiacea on intertidal rocks in Northeastern Brazil Recrutamento e colonização de ascídias coloniais (Tunicata: Ascidiacea em rochas de entre-marés no nordeste do Brasil

    Directory of Open Access Journals (Sweden)

    Petrônio Bezerra Gama

    2006-06-01

    Full Text Available Recruitment and colonization of colonial ascidians, starting on natural scraped substratum, was observed throughout one year, in quadrats marked on sea- and continental-rock faces in the sublittoral fringe of an exposed beach in the Northeast of Brazil. The species of the Didemnidae, Didemnum duplicatum Monniot, 1983, D. psammathodes Sluiter, 1895, and Polysyncraton amethysteum Van Name, 1902, and an unidentified species of Polycitoridae, Eudistoma sp. 1, were recruited. Presenting continuous recruitment of all species, the density of living and dead recruits and colonies was similar on both faces of the rocks. The highest rainfall during winter, affected significantly the recruits density of D. duplicatum and D. psammathodes. Different permanence periods were observed for colonies of each species. The longest permanence periods were assigned to the colonies of P. amethysteum and D. psammathodes, extending up to four and five months, respectively.A partir de substrato natural raspado, o recrutamento e a colonização de ascídias coloniais foi observado ao longo de um ano, em unidades amostrais delimitadas sobre as faces mar e continente de rochas situadas na franja do infralitoral de uma praia exposta no nordeste do Brasil. Foram recrutadas as espécies de Didemnidae, Didemnum duplicatum Monniot, 1983, D. psammathodes Sluiter, 1895 e Polysyncraton amethysteum Van Name, 1902 e uma espécie não-identificada de Polycitoridae, Eudistoma sp. 1. Apresentando recrutamento contínuo de todas as espécies, a densidade de colônias e de recrutas vivos e mortos foi similar nas duas faces das rochas. Durante o inverno, a densidade de recrutas de D. duplicatum e de D. psammathodes foi significativamente afetada pela intensa pluviosidade. As colônias de cada espécie apresentaram diferentes períodos de permanência sobre as rochas. Com duração de quatro e cinco meses, os maiores períodos de permanência foram assinalados para as colônias de P

  17. New Bioactive Alkyl Sulfates from Mediterranean Tunicates

    Directory of Open Access Journals (Sweden)

    Marialuisa Menna

    2012-10-01

    Full Text Available Chemical investigation of two species of marine ascidians, Aplidium elegans and Ciona edwardsii, collected in Mediterranean area, led to isolation of a series of alkyl sulfates (compounds 1–5 including three new molecules 1–3. Structures of the new metabolites have been elucidated by spectroscopic analysis. Based on previously reported cytotoxic activity of these type of molecules, compounds 1–3 have been tested for their effects on the growth of two cell lines, J774A.1 (BALB/c murine macrophages and C6 (rat glioma in vitro. Compounds 1 and 2 induced selective concentration-dependent mortality on J774A.1 cells.

  18. Dicty_cDB: Contig-U09318-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number...en... 58 7e-04 2 ( EL565943 ) Physarum12351 Physarum polycephalum starvation st... 40 0.001 2 ( BR000263 ) TPA_inf: Ciona intesti...590765_1( AY590765 |pid:none) Cucumis sativus ferric reductase m... 70 6e-19 DQ144235_1( DQ144235 |pid:none) Porphyra yezoensis...rum polycephalum starvation st... 40 2e-06 3 ( BW185868 ) Ciona intestinalis cDNA, clone:rciht034e15, 3' ...es: Existence: 5, Extension: 2 Number of Hits to DB: 34,261 Number of Sequences: 6905 Number of extension

  19. Dicty_cDB: Contig-U15431-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ( EV200506 ) 0101659 Brassica napus Cold acclimation - light B... 44 4.1 1 ( EV091132 ) 0187352 Brassica napus Apical...Matrix: blastn matrix:1 -3 Gap Penalties: Existence: 5, Extension: 2 Number of Hits to DB: 6962 Number of Se...7454 ) XABT209348.b1 Gateway compatible cien cDNA librar... 34 2.7 2 ( BP007860 ) Ciona intestinal...2 ) XABT129983.b1 Gateway compatible cien cDNA librar... 34 2.8 2 ( BW357775 ) Ciona intestinalis cDNA, clon...4 4.1 1 ( AC189231 ) Brassica rapa subsp. pekinensis clone KBrB013M01,... 44 4.1 1 ( U10401 ) Caenorhabditis

  20. Bioadhesion in ascidians: a developmental and functional genomics perspective

    OpenAIRE

    Pennati, Roberta; Rothbächer, Ute

    2015-01-01

    The development of bioadhesives inspired from marine animals is a promising approach to generate new tissue-compatible medical components. A number of marine species, through their adhesive properties, also represent significant foulers that become increasingly problematic to aquaculture, shipping or local biodiversity. In order to develop more sophisticated man-made glues and/or efficient fouling resistant surfaces, it is important to understand the mechanical, structural and molecular prope...

  1. Dicty_cDB: SSA652 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lvnkrnykfnktnngyknn*lvnkkn*nfnkrn*nvn krliinvv*nlnknwrnlkkiklkemqeikkrnkkekqenkkrnkrekkkrnkk...gitnstkptmvtrtinsstrrietstrgiktst rd*sstsfri*trigei*krss*krckrskretrkrskrtkretrerrkretrkggegk- -- ---kinkdki... /CSM/SL/SLF2-D/SLF288Q.Seq.d/ 46 8e-04 own update 2004.12.25 Homology vs DNA Score E Sequences producing si...68 1 BW029366 |BW029366.1 Ciona intestinalis cDNA, clone:cibd012e01, 5' end, single read. 38 0.70 2 AC129853...gion, partial cds. 44 2.7 1 dna update 2003. 7.30 Homology vs Protein Score E Sequences producing sign

  2. Dicty_cDB: SHC678 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s FZB42... 157 1e-37 AP009256_516( AP009256 |pid:none) Bifidobacterium adolescentis ATC......plnlnn*fvvfvvclwvqsi slnv Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits...ogy vs Protein Score E Sequences producing significant alignments: (bits) Value AM05006... 7.6 2 BW151201 |BW151201.1 Ciona intestinalis cDNA, clone:rcigd014m23, 3' end, single read. 30 7.7 2 dna update 2006. 1.20 Homol... producing significant alignments: (bits) Value N BG04340

  3. Dicty_cDB: Contig-U11539-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available iiisrffnfiwimaeyssnfhfsfnnnicnshfsvksfyfqkg*i kvvgidyyckiififnsiniidf**flytfnyfnsnclfnyllf...Contig-U11539-1 gap included 1277 - - - - 1 2 U11539 0 0 0 1 0 0 0 0 0 0 0 0 0 0 Sh...ATTTTAATTATTATCTCAACCTTTGAT TGCAGTAAAAAAAAATAAAACATTTAGNCTTTAATTA Gap gap included Contig length 1277 Chromo...B31, complete genome. 36 8.3 16 ( AV890473 ) Ciona intestinalis cDNA, clone:rcicl28k07, 3' end... 34 8.3 2 (...f*n*nfkf*t riifktfnykfilpk*lynckwyfyi*ciqtrvkyvlfgik*iegyrlsi*r*yyqysng krfqynvsifkffkfnti*ff*filnflfykgfnaiywmqf*pnsn

  4. Dicty_cDB: CHS244 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available d:none) Homo sapiens mRNA for mannosidase,... 121 4e-26 AY099704_1( AY099704 |pid:none) Arabidopsis thaliana alpha-man... sequence. 74 9e-13 2 BW354577 |BW354577.1 Ciona intestinalis cDNA, clone:cima804e24, 5'end, single read. 66...dqicqlhlqvfnilwiqplpvywqiqkeslfmlklhfskdggmnkvqqckill rvwlkvvnwn--- ---hhgi*pwfnqpvvim...M82822.1 Dictyostelium discoideum alpha-mannosidase (manA) gene, complete cds. 1302 0.0 1 CK149800 |CK149800...( P34098 ) RecName: Full=Lysosomal alpha-mannosidase; Sho... 387 e-106 M82822_1(

  5. Dicty_cDB: Contig-U15458-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ntestinalis cDNA, clone:ciem809f22, 5'end,... 72 1e-19 3 ( BW364920 ) Ciona intestinalis cDNA, clone:cima834...1 Hydra EST UCI 5 ALP Hydra magnipapill... 64 6e-19 3 ( FF733140 ) XABT47017.fwd Gateway compatible cie... 212 1e-53 AF049901_1( AF049901 |pid:none) Trypanosoma brucei rhodesiense pro... ... 0.45 CP000826_1147( CP000826 |pid:none) Serratia proteamaculans 568, co... 38 0.45 AP006725_403( AP006725 |pid:none) Klebsie...ylidllv*rikfimkvlillfhglnvlkfmmlelnhvvfhh*lvvkifkwlilqsef yqnqklvnfqpsiehwvkimmkeyyhql*mkf*rvllhnsmhln*slkenkcqd*slkd* livlkisi

  6. Dicty_cDB: Contig-U16106-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available taktyl ecmgknivhcgdvgtgqvakvcnnlvlgismiavseamnlgvkqgmdpkklagifntssa rcwtselynpcpgvietspasrgytggfgsalmtkdlglavdsaksi....31 Gapped Lambda K H 1.37 0.711 1.31 Matrix: blastn matrix:1 -3 Gap Penalties: Existence: 5, Extensi... 2 ( FD461602 ) LARVM85TR Haematobia irritans 1st Instar Larvae H... 30 0.11 4 ( FC697910 ) CAXX6401.fwd CAX...fwd CAXU Lottia gigantea from female gon... 46 0.14 2 ( FC644415 ) CAXU7159.fwd CAXU Lottia gigantea from fema...9 2 ( BW352889 ) Ciona intestinalis cDNA, clone:ciem852o16, 5'end,... 38 0.39 2 (

  7. Dicty_cDB: Contig-U02820-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ces; 5,674,871 total letters Score E Sequences producing significant alignments: (bits) Value Contig-U02820-1 (Cont...ces producing significant alignments: (bits) Value N ( BJ344428 ) Dictyostelium discoideum cDNA clon...e Score E Sequences producing significant alignments: (bits) Value BC081036_1( BC081036 |pid:none) Xen...ce 28 from Patent WO0246454. 36 1.6 4 ( AE014849 ) Plasmodium falciparum 3D7 chromosome 12, section... 44 6.2 1 ( BW404170 ) Ciona intestinalis cDNA, clone:ciem844j10, 3'end,... 44 6.2 1 ( BW106515 ) Cion

  8. TCF/Lef regulates the Gsx ParaHox gene in central nervous system development in chordates

    OpenAIRE

    Garstang, Myles Grant; Osborne, Peter; Ferrier, David Ellard Keith

    2016-01-01

    Background The ParaHox genes play an integral role in the anterior-posterior (A-P) patterning of the nervous system and gut of most animals. The ParaHox cluster is an ideal system in which to study the evolution and regulation of developmental genes and gene clusters, as it displays similar regulatory phenomena to its sister cluster, the Hox cluster, but offers a much simpler system with only three genes. Results Using Ciona intestinalis transgenics, we isolated a regulatory element upstream ...

  9. A Conserved Non-Reproductive GnRH System in Chordates

    OpenAIRE

    Kusakabe, Takehiro G.; Tsubasa Sakai; Masato Aoyama; Yuka Kitajima; Yuki Miyamoto; Toru Takigawa; Yutaka Daido; Kentaro Fujiwara; Yasuko Terashima; Yoko Sugiuchi; Giorgio Matassi; Hitoshi Yagisawa; Min Kyun Park; Honoo Satake; Motoyuki Tsuda

    2012-01-01

    Gonadotropin-releasing hormone (GnRH) is a neuroendocrine peptide that plays a central role in the vertebrate hypothalamo-pituitary axis. The roles of GnRH in the control of vertebrate reproductive functions have been established, while its non-reproductive function has been suggested but less well understood. Here we show that the tunicate Ciona intestinalis has in its non-reproductive larval stage a prominent GnRH system spanning the entire length of the nervous system. Tunicate GnRH recept...

  10. Dicty_cDB: Contig-U10384-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 37 |pid:none) Chloroflexus aggregans DSM 9485... 110 1e-22 ( Q00659 ) RecName: Full=Sulfur metabolite repression control...ella nidulans sulfur metabolite ... 108 4e-22 AB076893_1( AB076893 |pid:none) Ciona intestinali... DNA Library Caenorhab... 36 2.4 2 ( CP000728 ) Clostridium botulinum F str. Langeland, co...01097 |pid:none) Chlorobium limicola DSM 245, co... 125 3e-27 AP009552_5466( AP009552 |pid:none) Microcystis aeruginos...tyon phaeoclathratiforme ... 117 9e-25 AC007259_17( AC007259 |pid:none) Arabidopsis thaliana chromos

  11. Dicty_cDB: SHA718 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 00020 |CP000020.1 Vibrio fischeri ES114 chromosome I, complete sequence. 46 0.69 1 BG521055 |BG521055.1 ps05c09.y3 Trichinella... spiralis ML CMVsport jasmer Trichinella spiralis cDNA 5' simil...50920.1 Ciona intestinalis cDNA, clone:cicl05g22, 5' end, single read. 42 0.81 2 BG519938 |BG519938.1 ps05c09.y2 Trichinella... spiralis ML CMVsport jasmer Trichinella spiralis cDNA 5' similar

  12. Dicty_cDB: SLD285 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available cl*tcqsfh*klncqrsrstsycq tms**plalw**sinwfcc*splsfr*kdeei**pkkrwsifk*lnliiiiikkkk...modulin-... 153 8e-36 ( Q63450 ) RecName: Full=Calcium/calmodulin-dependent protein ki...na... 152 1e-35 ( Q14012 ) RecName: Full=Calcium/calmodulin-dependent protein kina... 152 1e-35 PDBF( 1A06 )...) Dictyostelium discoideum chromoso... 163 6e-39 AB076903_1( AB076903 |pid:none) Ciona intestinalis Ci-CaM-K...SL (Link to library) SLD285 (Link to dictyBase) - - - Contig-U11996-1 SLD285P (Link to Original

  13. Dicty_cDB: VSF267 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available cqsfh*klncqrsrstsycqtms**plalw**sinwfxc*splsfr*xmkkykt Translated Amino Acid sequ...AP EVLXGGSYDNAVDMWXIGVITYILLCGFPPFLCFISKLII*knfxr*l*fprtrmdscl* tcqsfh*klncqrsrstsycqtms**plalw**sinwfxc*spl...BC074183 |pid:none) Xenopus laevis MGC82022 protein, m... 118 1e-38 (Q8IU85) RecName: Full=Calcium/cal...modulin-dependent protein kina... 120 2e-38 (Q8BW96) RecName: Full=Calcium/calmodulin-d...G0... 132 2e-42 AB076903_1( AB076903 |pid:none) Ciona intestinalis Ci-CaM-K mRNA f... 118 4e-39 BC074183_1(

  14. Dicty_cDB: SSJ513 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available l*tcqsfh*klncqrsrsts ycqtms**plalw**sinwfcc*splsfr*kdeei**pkkrwsifk*lnliiii Homology vs CSM-cDNA Score E Seq...41721 |pid:none) Xenopus laevis calcium/calmodulin-... 153 3e-36 ( Q63450 ) RecName: Full=Calcium/calmodulin...-dependent protein kina... 152 4e-36 ( Q14012 ) RecName: Full=Calcium/calmodulin-dependent protein kina... 1...yostelium discoideum chromoso... 168 6e-41 AB076903_1( AB076903 |pid:none) Ciona intestinalis Ci-Ca...SS (Link to library) SSJ513 (Link to dictyBase) - - - Contig-U11996-1 SSJ513Z (Link to Original

  15. Dicty_cDB: SLF532 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nvilpnnvlm tfgslvvinqlvlllistlislkr*rnimtkeevvnlqiikfnnnnn Frame B: ---tilcfisklii*knfnr*l*fprtrmdscl*tcqsfh...evis MGC82022 protein, m... 74 1e-12 ( Q63450 ) RecName: Full=Calcium/calmodulin-dependent protein kina... 7...4 2e-12 ( Q14012 ) RecName: Full=Calcium/calmodulin-dependent protein kina... 74 ...B076903 |pid:none) Ciona intestinalis Ci-CaM-K mRNA f... 81 1e-14 BC074183_1( BC074183 |pid:none) Xenopus la...SL (Link to library) SLF532 (Link to dictyBase) - - - Contig-U11996-1 SLF532Z (Link to Original

  16. Dicty_cDB: SSH378 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available wfpti lcfisklii*knfnr*l*fprtrmdscl*tcqsfh*klncqrsrstsycqtms**plalw **sinwfcc*splsfr*kdeei**pkkrwsifk*lnliiii...M-K mRNA f... 142 5e-33 ( Q63450 ) RecName: Full=Calcium/calmodulin-dep...endent protein kina... 136 2e-31 ( Q14012 ) RecName: Full=Calcium/calmodulin-dependent protein kina... 136 2...982 |pid:none) Dictyostelium discoideum chromoso... 147 2e-34 AB076903_1( AB076903 |pid:none) Ciona intestinalis Ci-Ca...SS (Link to library) SSH378 (Link to dictyBase) - - - Contig-U11996-1 SSH378Z (Link to Original

  17. Dicty_cDB: SLF872 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available qinvilpnnvlmtfgslvvinqlvlllistli slkr*rnimtkeevvnlqiikfnnnnn Frame C: ---fprtrmdscl*tcqsfh*klncqrsrstsycqtms**plalw...m... 53 3e-06 AE014135_86( AE014135 |pid:none) Drosophila melanogaster chromosom... 53 3e-06 ( Q63450 ) RecName: Full=Calcium/cal...modulin-dependent protein kina... 51 1e-05 ( Q14012 ) RecName: Full=Calcium/calmodulin-...modulin-dependent ser... 166 3e-40 AB076903_1( AB076903 |pid:none) Ciona intestinalis Ci-CaM-K mRN...SL (Link to library) SLF872 (Link to dictyBase) - - - Contig-U11996-1 SLF872Z (Link to Original

  18. Dicty_cDB: SLH770 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ilcfisklii*knfnr*l*fprtrmdscl*tcqsfh*klncqrsrstsycqtm s**plalw**sinwfcc*splsfr*kd...74183 |pid:none) Xenopus laevis MGC82022 protein, m... 81 1e-14 ( Q63450 ) RecName: Full=Calcium/calmodulin-...dependent protein kina... 80 2e-14 ( Q14012 ) RecName: Full=Calcium/calmodulin-de...... 209 2e-53 AB076903_1( AB076903 |pid:none) Ciona intestinalis Ci-CaM-K mRNA f... 87 2e-16 BC074183_1( BC0...SL (Link to library) SLH770 (Link to dictyBase) - - - Contig-U11996-1 SLH770Z (Link to Original

  19. Dicty_cDB: SFJ553 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available assxplii*knfnr*l*fprtrmdscl*tcqsfhxklncqrsrxtsycqxms**psalw* *sinwfcc*spxsxx*kdxxi* Homology vs CSM-cDNA Sco...cium/calmodulin-... 144 2e-41 (Q8IU85) RecName: Full=Calcium/calmodulin-dependent pr...otein kina... 142 2e-41 (Q8BW96) RecName: Full=Calcium/calmodulin-dependent protein kina... 142 2e-41 protei...GC82022 protein, m... 141 3e-42 AB076903_1( AB076903 |pid:none) Ciona intestinalis Ci-Ca...SF (Link to library) SFJ553 (Link to dictyBase) - - - Contig-U11996-1 SFJ553Z (Link to Original

  20. Dicty_cDB: SLC252 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available i*knfnr*l* fprtrmdscl*tcqsfh*klncqrsrstsycqtms**plalw**sinwfcc*splsfr*k deei**pkkrwsifk*lnliiii Homology vs ...Mus musculus 13 days embryo lung c... 176 5e-43 (Q8IU85) RecName: Full=Calcium/calmodulin-dependent protein ...kina... 176 5e-43 (Q8BW96) RecName: Full=Calcium/calmodulin-dependent protein kin...none) Dictyostelium discoideum chromoso... 192 6e-48 AB076903_1( AB076903 |pid:none) Ciona intestinalis Ci-Ca...SL (Link to library) SLC252 (Link to dictyBase) - - - Contig-U11996-1 SLC252Z (Link to Original

  1. Dicty_cDB: Contig-U15674-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 9807 ) Ciona intestinalis cDNA, clone:rcibd066d24, 3' en... 113 2e-20 2 ( EE005021 ) ROE00010379 Rhizopus oryzae Company...-20 4 ( EE006561 ) ROE00006529 Rhizopus oryzae Company Rhizopus oryz... 86 2e-20 3 ( EE007078 ) ROE00002595 Rhizopus oryzae Company... Rhizopus oryz... 86 2e-20 3 ( EE007685 ) ROE00004444 Rhizopus oryzae Company Rhizopu... ) ROE00003177 Rhizopus oryzae Company Rhizopus oryz... 86 3e-20 3 ( EE009077 ) R...OE00000022 Rhizopus oryzae Company Rhizopus oryz... 86 3e-20 3 ( CB891330 ) EST648299 KV3 Medicago truncatul

  2. Dicty_cDB: Contig-U10050-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 44 0.011 BC115342_1( BC115342 |pid:none) Danio rerio suppression of tumorig... 44 0.011 BC128654_1( BC12865...4 |pid:none) Danio rerio suppression of tumorig... 44 0.011 AY173045_1( AY173045 |pid:none) Morone americana...ne) Giardia intestinalis isolate WB cl... 42 0.042 (Q9Y5Y6) RecName: Full=Suppressor of tumorigenicity prote...: Full=Disintegrin and metalloproteinase domain-... 40 0.16 (Q0IIH7) RecName: Full=Suppressor of tumorigenic...io rerio suppression of tumorig... 38 0.79 AB041857_1( AB041857 |pid:none) Ciona intestinalis mRNA for Ci-ME

  3. Dicty_cDB: Contig-U14888-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e) Paramecium aurelia immobilization anti... 41 0.048 AF448145_3( AF448145 |pid:none) My...Y426751_1( AY426751 |pid:none) Nicotiana attenuata putative 6 rep... 39 0.24 DQ900937_1( DQ900937 |pid:none) Ciona intestinali...s Ci-VWFL1 mRNA f... 39 0.24 (Q8VIK5) RecName: Full=Platelet endothelial aggregation receptor... 39 0...6 1.9 1 ( EJ660326 ) 1092955021308 Global-Ocean-Sampling_GS-30-02-01-1... 46 1.9 1 ( EJ225210 ) 1092351409512 Global-Ocean-Sampli...6 1 ( EJ625288 ) 1092963148730 Global-Ocean-Sampling_GS-29-01-01-1... 44 7.6 1 ( EJ623254 ) 1092963107162 Global-Ocean-Sampli

  4. mlRho – a program for estimating the population mutation and recombination rates from shotgun-sequenced diploid genomes

    Science.gov (United States)

    HAUBOLD, BERNHARD; PFAFFELHUBER, PETER; LYNCH, MICHAEL

    2016-01-01

    Improvements in sequencing technology over the past 5 years are leading to routine application of shotgun sequencing in the fields of ecology and evolution. However, the theory to estimate evolutionary parameters from these data is still being worked out. Here we present an extension and implementation of part of this theory, mlRho. This program can efficiently compute the following three maximum likelihood estimators based on shotgun sequence data obtained from single diploid individuals: the population mutation rate (4Neμ), the sequencing error rate, and the population recombination rate (4Nec). We demonstrate the accuracy of mlRho by applying it to simulated data sets. In addition, we analyse the genomes of the sea squirt Ciona intestinalis and the water flea Daphnia pulex. Ciona intestinalis is an obligate outcrosser, while D. pulex is a cyclic parthenogen, and we discuss how these contrasting life histories are reflected in our parameter estimates. The program mlRho is freely available from http://guanine.evolbio.mpg.de/mlRho. PMID:20331786

  5. Geographically conserved microbiomes of four temperate water tunicates.

    Science.gov (United States)

    Cahill, Patrick L; Fidler, Andrew E; Hopkins, Grant A; Wood, Susanna A

    2016-08-01

    Tunicates are useful models for exploring microbiomes because they have an innate immune system resembling that of chordates. Automated ribosomal RNA intergenic spacer analysis and High-Throughput Sequencing were used to compare the tunic microbiomes of Ciona robusta (formerly Ciona intestinalis type A), Ciona savignyi, Botrylloides leachi and Botryllus schlosseri sampled from three distinct locations with limited genetic connectivity. Bacterial phylotype profiles were conserved within each species, and there were no detectable differences between tunic and tunic + cuticle subsamples from an individual. Bacterial operational taxonomic unit (OTU) diversity was lowest for C. savignyi (320 ± 190 OTUs) and highest for B. schlosseri (1260 ± 190 OTUs). Each species had a distinct set of bacterial OTUs (pseudo-F = 3.0, p > 0.001), with the exception of B. leachi and B. schlosseri from one sampling location (t = 1.2, p = 0.09). Of note were OTUs assigned to Alphaproteobacteria from C. robusta plus Phyllobacteriaceae and Endozoicomonas from C. savignyi. These OTUs contributed 51, 22 and 10% of sequence reads, respectively, and are related to known bacterial symbionts. The within-species conservation of core OTUs across three distinct and co-occurring populations of tunicates provides compelling evidence that these tunicates foster defined microbiomes. PMID:26929150

  6. The Prevalence of Giardia Intestinalis in Dyspeptic and Diabetic Patients

    OpenAIRE

    Gözde Derviş Hakim; Şafak Kızıltaş; Hilmi Çiftçi; Şafak Göktaş; İlyas Tuncer

    2011-01-01

    Background and Aims. We aimed to investigate the prevalence of Giardiasis in patients with dyspepsia and patients with diabetes mellitus. Methods. 400 patients and 100 healthy persons were included in this clinical prospective study. The number of patients in each group was equal, 200 dyspeptic and 200 diabetic, respectively. The antigen of G. lntestinalis was determined in the stool specimens by ELISA method. Results. The frequency of Giardiasis was 7% in dyspeptic and 15% in diabetic patien...

  7. Intraepithelial Giardia Intestinalis: A Case Report and Literature Review

    OpenAIRE

    Martínez-Gordillo, Mario Noé; González-Maciel, Angélica; Reynoso-Robles, Rafael; Montijo-Barrios, Ericka; Ponce-Macotela, Martha

    2014-01-01

    Abstract The giardiasis is a neglected parasitic disease. The WHO has estimated more than 280 million of human infections each year; however, intraepithelial giardiasis is a rare entity, there are only 5 reports showing invasive giardiasis. A pediatric female patient with chronic abdominal pain, diarrhea, or pasty stools, without fever, was seen in the Gastroenterology and Nutrition Service. The stool studies were negative for pathogens and lactose hydrogen breath test was positive. The presu...

  8. Intraepithelial giardia intestinalis: a case report and literature review.

    Science.gov (United States)

    Martínez-Gordillo, Mario Noé; González-Maciel, Angélica; Reynoso-Robles, Rafael; Montijo-Barrios, Ericka; Ponce-Macotela, Martha

    2014-12-01

    The giardiasis is a neglected parasitic disease. The WHO has estimated more than 280 million of human infections each year; however, intraepithelial giardiasis is a rare entity, there are only 5 reports showing invasive giardiasis. A pediatric female patient with chronic abdominal pain, diarrhea, or pasty stools, without fever, was seen in the Gastroenterology and Nutrition Service. The stool studies were negative for pathogens and lactose hydrogen breath test was positive. The presumptive clinical diagnosis was giardiasis and the patient was empirically treated with nitazoxanide. But, the patient persisted with abdominal pain and pasty stools. Endoscopy was indicated to search for Helicobacter and Giardia. Guardian and patient gave written informed consent. Hematological profile was normal. The endoscopy was performed under general anesthesia and the biopsies and duodenal aspirate were obtained. The microscopic analyses of duodenal fluid showed Giardia trophozoites. Electron microscopic analysis was negative for Helicobacter pylori, but Giardia trophozoites with a typical crescent shape within the tissue were found. The patient was treated with tinidazole, subsequent tests showed that lactose absorption was normal, stool examinations were negative for Giardia and abdominal pain had stopped. This case suggest that intraepithelial giardiasis could be a common entity but unseen because the giardiasis diagnosis is usually made on fecal samples. Future studies are necessary to determine the role of intraepithelial trophozoites in giardiasis pathogenic mechanisms. PMID:25546671

  9. β-catenin-driven binary cell fate decisions in animal development.

    Science.gov (United States)

    Bertrand, Vincent

    2016-01-01

    The Wnt/β-catenin pathway plays key roles during animal development. In several species, β-catenin is used in a reiterative manner to regulate cell fate diversification between daughter cells following division. This binary cell fate specification mechanism has been observed in animals that belong to very diverse phyla: the nematode Caenorhabditis elegans, the annelid Platynereis, and the ascidian Ciona. It may also play a role in the regulation of several stem cell lineages in vertebrates. While the molecular mechanism behind this binary cell fate switch is not fully understood, it appears that both secreted Wnt ligands and asymmetric cortical factors contribute to the generation of the difference in nuclear β-catenin levels between daughter cells. β-Catenin then cooperates with lineage specific transcription factors to induce the expression of novel sets of transcription factors at each round of divisions, thereby diversifying cell fate. For further resources related to this article, please visit the WIREs website. PMID:26952169

  10. Intra-species sequence comparisons for annotating genomes

    Energy Technology Data Exchange (ETDEWEB)

    Boffelli, Dario; Weer, Claire V.; Weng, Li; Lewis, Keith D.; Shoukry, Malak I.; Pachter, Lior; Keys, David N.; Rubin, Edward M.

    2004-07-15

    Analysis of sequence variation among members of a single species offers a potential approach to identify functional DNA elements responsible for biological features unique to that species. Due to its high rate of allelic polymorphism and ease of genetic manipulability, we chose the sea squirt, Ciona intestinalis, to explore intra-species sequence comparisons for genome annotation. A large number of C. intestinalis specimens were collected from four continents and a set of genomic intervals amplified, resequenced and analyzed to determine the mutation rates at each nucleotide in the sequence. We found that regions with low mutation rates efficiently demarcated functionally constrained sequences: these include a set of noncoding elements, which we showed in C intestinalis transgenic assays to act as tissue-specific enhancers, as well as the location of coding sequences. This illustrates that comparisons of multiple members of a species can be used for genome annotation, suggesting a path for the annotation of the sequenced genomes of organisms occupying uncharacterized phylogenetic branches of the animal kingdom and raises the possibility that the resequencing of a large number of Homo sapiens individuals might be used to annotate the human genome and identify sequences defining traits unique to our species. The sequence data from this study has been submitted to GenBank under accession nos. AY667278-AY667407.

  11. Dicty_cDB: Contig-U11489-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 9e-18 AJ508667_1( AJ508667 |pid:none) Ciona intestinalis mRNA for Rac1 p... 94 9e-18 ( O14426 ) RecName: Full=Cell division cont...ozoa sp. H2 cell division cont... 74 1e-11 AY168614_1( AY168614 |pid:none) Brassica napus putative ROP fami...i... 88 5e-16 ( Q01112 ) RecName: Full=Cell division control protein 42 homolog;... 88 5e-16 CR382128_622( CR382128 |pid:non...e: Full=Cell division control protein 42; AltName... 86 3e-...e: Full=Transforming protein RhoA; AltName: Full=... 78 5e-13 AY059622_1( AY059622 |pid:none) Entam

  12. Dicty_cDB: Contig-U10482-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4_327( CP000594 |pid:none) Ostreococcus lucimarinus CCE9901... 76 5e-13 CT005263_33( CT005263 |pid:none) Leishmania ma...FN357490_14( FN357490 |pid:none) Schistosoma mansoni genome sequen... 44 0.003 CP000584_115( CP000584 |pid:none) Ostreococcus lucima... troglodytes DNA, clone: RP43-047H13.T7. 44 5.4 1 ( BW361512 ) Ciona intestinalis cDNA, clone:cima8... y*kkixlkwkii*i*liixiiiiiixik*knhyqhylyfvaimv*mklvimvvhqiqkll lywf**vly Frame C: xxxc**fq*sttkgg*hsisnetik*invi...sferase 2;... 157 1e-37 AC006592_5( AC006592 |pid:none) Arabidopsis thaliana chromosome 2 ..

  13. Dicty_cDB: Contig-U14928-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s) Database: CSM 8402 sequences; 8,075,542 total letters Score E Sequences producing significant alignments: (bits) Value Cont.............done Score E Sequences producing significant alignments: (bits) Value N ( AC116979 ) Dictyostelium...CHEL7308.b1_G03.ab1 CHE(LMS) serpentine sunflower... 54 0.030 1 ( BW196083 ) Ciona intestinalis cDNA, clone:cicl038e23, 5' en...ig-U14928-1Q) /CSM_Contig/Contig-U14928-1Q.Seq.d (2817 letters) Database: nrp_B 3,236,559 sequences; 1,051,180,864 total letter...01_4992( CP000001 |pid:none) Bacillus cereus E33L, complete ... 80 5e-13 AY973240_1( AY973240 |pid:none) Equus caball

  14. Dicty_cDB: Contig-U11914-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available (cDN... 83 3e-14 AX399977_1( AX399977 |pid:none) Sequence 148 from Patent WO0218424. 83 3e-14 T46488( T46488 )hypothetical prote...........................................done Score E Sequences producing significant alignments: (bits) Valu....94 1 ( CQ578219 ) Sequence 5977 from Patent WO0171042. 48 0.94 1 ( AE014134 ) Drosophila melanogaster chromosome 2L, complete...s mRNA for latent trans... 106 2e-21 DQ900937_1( DQ900937 |pid:none) Ciona intestinalis gamma-ca...1914-1Q.Seq.d (1451 letters) Database: CSM 6905 sequences; 5,674,871 total letters Score E Sequence

  15. Dicty_cDB: Contig-U02608-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s) Database: CSM 6905 sequences; 5,674,871 total letters Score E Sequences producing significant alignments: (bits) Value Cont.................done Score E Sequences producing significant alignments: (bits) Value N ( BJ340160 ) Dictyoste...... 70 2e-10 3 ( BX732541 ) Xenopus tropicalis EST, clone TTpA073e13 5'. 56 2e-10...d. 46 4e-04 2 ( BW366463 ) Ciona intestinalis cDNA, clone:cima838j20, 5'end,... 56 4e-04 2 ( BC166312 ) Xenopus tropical...7303_1( AY627303 |pid:none) Haloferax volcanii DS2 proteasome-... 148 6e-34 BC122550_1( BC122550 |pid:none) Homo sapiens val

  16. Dicty_cDB: Contig-U05543-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1 ( FF475952 ) G613P6146RA1.T0 Acorn worm blastula/gastrula pCMV... 44 4.5 1 ( DQ366714 ) Uncultured Prochlorococcu...G22, WORKING DRAFT SEQU... 48 0.29 1 ( CV869127 ) PDUts1063D08 Porcine testis cDNA library I Sus sc... 48 0..... 32 0.36 3 ( AV873260 ) Ciona intestinalis cDNA, clone:rcicl43a22, 3' end... 32 0.50 3 ( EF173130 ) Entosthodon serratu...s voucher Bowers 13109 CONN RN... 32 0.55 3 ( EF173135 ) Physcomitrella patens voucher Culture f...133954 ) XABT170247.g1 Gateway compatible cien cDNA librar... 40 5.3 2 ( AC120599 ) Rattus norvegicu

  17. Dicty_cDB: Contig-U15999-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available DQ120986 ) Hucho taimen clone ZB-41 microsatellite sequence. 42 0.38 2 ( FE260308 ) CAZN834.fwd CAZN Naegleria gruberi Flagellat... 0.711 1.31 Gapped Lambda K H 1.37 0.711 1.31 Matrix: blastn matrix:1 -3 Gap Penalties: Existence: 5, Extension: 2 Number...al cds. 40 0.025 2 ( EG551347 ) MM01C22_XP Sugar Beet germination cDNA library Be... 40 0.025 2 ( DH506983 ) Monosiga ovat...e MegEu13 microsatellite ... 40 1.9 2 ( BP024203 ) Ciona intestinalis cDNA, clon...ent US 7314974. 34 4.6 2 ( FE268718 ) CAZO773.fwd CAZO Naegleria gruberi Flagellate Sta... 40 4.6 2 ( DY

  18. Dicty_cDB: Contig-U09041-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ) Dictyostelium discoideum retrotran... 546 e-154 Z36534_1( Z36534 |pid:none) D.discoideum (Ax3-K) ponA gene...V78X000824.... 37 1.8 AJ970254_1( AJ970254 |pid:none) Anopheles stephensi retroposon 1 A... 37 1.8 ( Q35905 ... AJ970256_1( AJ970256 |pid:none) Anopheles stephensi retroposon 1 A... 37 1.8 AM4...m discoideum TipC (tipC) gene, comple... 325 3e-84 1 ( U63600 ) Dictyostelium discoideum Tdd-4 transposable elemen...ium discoideum retrotran... 95 6e-18 AB097146_1( AB097146 |pid:none) Ciona intestinalis retrotr

  19. Dicty_cDB: Contig-U14953-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 7 BA000031_483( BA000031 |pid:none) Vibrio parahaemolyticus RIMD 221... 61 1e-07 AP007255_522( AP007255 |pid:none) Mag...53 |pid:none) Alkaliphilus oremlandii OhILAs, c... 59 6e-07 CP000488_783( CP000488 |pid:none) Candidatus Ruthia mag... 0.711 1.31 Matrix: blastn matrix:1 -3 Gap Penalties: Existence: 5, Extension: 2 Number of Hits to DB: 40,21...019h19, 5'end,... 52 0.065 1 ( BW347955 ) Ciona intestinalis cDNA, clone:ciem838a16, 5'end,... 52 0.06... Dictyostelium discoideum chromosome 2 map 2567470... 32 0.13 15 ( CP000488 ) Candidatus Ruthia magnifica st

  20. Dicty_cDB: Contig-U16314-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rk rkenypflaseilcmdiqplieavyrddlylqqlyeflnkpnfnlglaaytskvainflg rktidtmayikkqdnivekfikhldkspvvdillkiisieeyqggag... ( DR118372 ) RTMG1_12_H03.g1_A029 Roots minus magnesium Pinus ... 48 0.004 3 ( DX570665 ) MUGQ_CH252P048N23...rom chromoso... 44 0.004 2 ( DR118290 ) RTMG1_12_H03.b1_A029 Roots minus magnesiu...) G1146P36FN17.T0 Anolis carolinensis pooled normal... 46 1e-04 3 ( BX641037 ) Homo sapiens mRNA; cDNA DKFZp...e-04 2 ( BW391073 ) Ciona intestinalis cDNA, clone:ciem804i14, 3'end,... 34 7e-04 4 ( CX472410 ) JGI_XZG5544

  1. Dicty_cDB: Contig-U15833-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s cDNA, clone:cits039i02, full i... 64 2e-05 1 ( DY673534 ) STRCT29JX cold-stressed Fragaria vesca seedling...3333( CP000970 |pid:none) Escherichia coli SMS-3-5, compl... 43 0.026 CP000961_3531( CP000961 |pid:none) Shewanella woo...P000020_471( CP000020 |pid:none) Vibrio fischeri ES114 chromosome... 42 0.057 (Q9X719) RecName: Full=Hollida.... 60 1e-05 2 ( CP000496 ) Pichia stipitis CBS 6054 chromosome 2, complete s... 64 2e-05 1 ( AK116608 ) Ciona intestinali...13 |pid:none) Neurospora crassa intermembrane sp... 43 0.026 (Q1PDW5) RecName: Full=Cell division protease ftsH homolog 6, ch

  2. Dicty_cDB: Contig-U16029-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 301514 ) PL04022B2D04 cDNA from sexually mature hermaphodi... 60 2e-21 4 ( DN298105 ) PL04011B1H03 cDNA from sexually... mature hermaphodi... 60 2e-21 4 ( DN298246 ) PL04012A1G09 cDNA from sexually mature hermaphodi... ...60 2e-21 4 ( DN301632 ) PL04023A1G12 cDNA from sexually mature hermaphodi... 60 2...ne:cign052p04, 5' end... 60 7e-20 4 ( DN294541 ) PL030017A20E10 cDNA from sexually...60 1e-19 4 ( BW213634 ) Ciona intestinalis cDNA, clone:cieg074c18, 5' end... 60 1e-19 4 ( DN307194 ) PL05013A2D05 cDNA from sexually

  3. Dicty_cDB: FC-BF21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available yfngiryftnryirygyaiirrcqin*n*sic* sr*rfilccpkiiwyvnlcrsrcslylewfiw*sssfriw*llfncftiilcryycyafg *tftkriwywiryfiiycnqyl*dhcmedi... 4.0 %: nuclear 4.0 %: extracellular, including cell wall >> prediction for FC-BF21 is end 5' end seq. ID FC...FC (Link to library) FC-BF21 (Link to dictyBase) - - - Contig-U16377-1 FC-BF21P (Link to Origina...k to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16377-1 Original site URL http://di...nts: (bits) Value N AL668163 |AL668163.1 Ciona intestinalis; larval mRNA; EST 5PRIM end of clone 030ZH11 of library directiona

  4. Dicty_cDB: Contig-U13406-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 5O16, p... 236 8e-61 AY542969_1( AY542969 |pid:none) Bigelowiella natans guanine nucleo... 236 1e-60 BC08554...Score = 2010 bits (1014), Expect = 0.0 Identities = 1014/1014 (100%) Strand = Plus / Plus Query: 1 aaaaagaaacataatgaagttaaattattatta...ons: 2029 Number of sequences better than 10.0: 277 length of query: 1064 length of data...6 3e-09 2 ( BW255618 ) Ciona intestinalis cDNA, clone:citb081g04, 5' end... 48 3e-09 3 ( FF935005 ) CBWU71199.b1 Yutaka Sat...ou unpublished cDNA librar... 48 4e-09 3 ( FF915066 ) CBWU58117.b1 Yutaka Sat

  5. Dicty_cDB: Contig-U04737-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available entities = 187/187 (100%) Strand = Plus / Plus Query: 385 tcattatgtattaataaattacctattttaacatcagaatttttta...Y-7H8, genomic surve... 48 0.37 1 ( AG625810 ) Macaca fuscata fuscata DNA, clone: MSB2-022E04_F,... 48 0.37 1 ( BX211439 ) Dan... 46 1.5 1 ( BP027525 ) Ciona intestinalis cDNA, clone:cits48i20, 5' end,... 46 1.5 1 ( FD450202 ) EGGA388TR Haematobia irritan...s eggs Haematobia irr... 46 1.5 1 ( FD450201 ) EGGA388TF Haematobia irritans eggs Haematob... BJ419392 ) Dictyostelium discoideum cDNA clone:ddv35p23, 5' ... 36 7.9 2 ( FF860568 ) CBWU8167.g1 Yutaka Sat

  6. Dicty_cDB: Contig-U16263-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2 bits (18), Expect = 0.15 Identities = 21/22 (95%) Strand = Plus / Minus Query: 649 taataatgttttaattgata...GI_CAAJ23360.fwd NIH_XGC_tropBrn2 Xenopus (Silur... 50 0.002 3 ( FD452129 ) EGGAF61TR Haematobia irritan...uts... 54 0.015 1 ( BW039245 ) Ciona intestinalis cDNA, clone:cibd040a11, 5' end... 54 0.015 1 ( FF985828 ) CBWU98429.b1 Yutaka Sat...ou unpublished cDNA librar... 54 0.015 1 ( FF935628 ) CBWU71588.b1 Yutaka Satou unpub...lished cDNA librar... 54 0.015 1 ( FF912191 ) CBWU56358.b1 Yutaka Satou unpublish

  7. Dicty_cDB: Contig-U04312-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lone:cicl034i21, 5' end... 48 0.005 2 ( FF994286 ) CBWU111142.b1 Yutaka Satou unpublished cDNA libra... 48 0...CHPZ3010.b1_D10.ab1 CHP(XYZ) plains sunflower Hel... 38 0.005 2 ( FG001241 ) CBWU116604.b1 Yutaka Satou unpu...0.006 2 ( BW264810 ) Ciona intestinalis cDNA, clone:cign039g20, 5' end... 48 0.006 2 ( FG000620 ) CBWU116165.b1 Yutaka Sat...ou unpublished cDNA libra... 48 0.006 2 ( FF930402 ) CBWU67979.g1 Yutaka Satou unpublished cDN...A librar... 48 0.006 2 ( FF930401 ) CBWU67979.b1 Yutaka Satou unpublished cDNA li

  8. Dicty_cDB: Contig-U01943-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s... 38 0.64 AB196473_1( AB196473 |pid:none) Ciona intestinalis p47phox mRNA fo... 38 0.64 (Q17QS1) RecName: Full=Sor...0.020 BC077503_1( BC077503 |pid:none) Xenopus laevis sorting nexin assoc... 43 0....al-rgf-536-002... 40 0.099 EU002077_1( EU002077 |pid:none) Coryphaenoides rupestris isolate... 0.13 EF033000_1( EF033000 |pid:none) Amia calva SH3 and PX domain-conta... 40 0.13 EU002089_1( EU002089 |pid:none) Monopte...rus albus isolate R40 SH3 a... 40 0.13 EU002090_1( EU002090 |pid:none) Sebastes ruberri

  9. Exploration of genetically encoded voltage indicators based on a chimeric voltage sensing domain

    Directory of Open Access Journals (Sweden)

    Yukiko Mishina

    2014-09-01

    We recently introduced a new VSFP design in which the voltage-sensing domain (VSD is sandwiched between a FRET pair of fluorescent proteins (termed VSFP-Butterflies and also demonstrated a series of chimeric VSD in which portions of the VSD of Ciona intestinalis voltage-sensitive phosphatase (Ci-VSP are substituted by homologous portions of a voltage-gated potassium channel subunit. These chimeric VSD had faster sensing kinetics than that of the native Ci-VSD. Here, we describe a new set of VSFPs that combine chimeric VSD with the Butterfly structure. We show that these chimeric VSFP-Butterflies can report membrane voltage oscillations of up to 200 Hz in cultured cells and report sensory evoked cortical population responses in living mice. This class of GEVIs may be suitable for imaging of brain rhythms in behaving mammalians.

  10. AcEST: DK950528 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 528 Tissue type prothallia Developmental stage gametophyte Contig ID CL2801Contig1 Sequen..........................done Score E Sequences producing significant alignments: (bits) Value sp|Q1EHT7|C3H4_ORYSJ Zinc finger...in, ring finger protein, 1 variant (... 49 3e-04 tr|Q256Y7|Q256Y7_HUMAN Makorin-1 OS=Homo sapien... protein, 2 (Fragment... 48 4e-04 tr|B7Q4B2|B7Q4B2_IXOSC Makorin, putative (Fragment... >tr|Q1RLH2|Q1RLH2_CIOIN Zinc finger protein OS=Ciona intestinalis GN=Ci-ZF(C3H/RING)-1 PE=2 SV=1 Length = 447 Score

  11. AcEST: DK947564 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 564 Tissue type young leaves Developmental stage sporophyte Contig ID CL4109Contig1 Sequen... E Sequences producing significant alignments: (bits) Value sp|Q0JP11|C3H3_ORYSJ Zinc finger CCCH domain-conta... CCCH domain-containing protein... 37 0.058 sp|Q9H000|MKRN2_HUMAN Makorin-2 OS=Homo sapiens G...gth = 468 Score = 40.0 bits (92), Expect = 0.009 Identities = 20/51 (39%), Positives = 25/51 (49%) Frame = +2 Quer...3|Q1RPY3_CIOIN Zinc finger protein OS=Ciona intestinalis... 74 8e-12 tr|Q207M5|Q207M5_ICTPU Zinc finger matrin type 5 (Fragment

  12. Dicty_cDB: Contig-U15446-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available dary xyle... 46 5e-05 2 ( CO212619 ) WS00922.B21_J02 IS-B-N-A-10 Picea engelmannii x P... 46 5e-05 2 ( ES874...lone:ddv19l07, 3' ... 66 1e-08 3 ( EC821477 ) SME00009933 esmbsro2 Sawyeria marylandensis cDNA,... 58 1e-08 ...55.b1 Gateway compatible cien cDNA librar... 40 1e-06 3 ( FK055965 ) XABT121425.b1 Gateway compatib... EST from clone SA0AA... 40 3e-06 3 ( EC824003 ) SME00002535 esmbsro2 Sawyeria marylandensis cDNA,... 66 3e-06 1 ( EC820055 ) SME0000... 4e-06 3 ( BW051244 ) Ciona intestinalis cDNA, clone:cibd071p09, 5' end... 40 4e-06 3 ( FK214509 ) XABT21

  13. Dicty_cDB: Contig-U12053-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e) 43 0.030 AF345905_1( AF345905 |pid:none) Homo sapiens LIM mineralization pr... 43 0.030 AB209531_1( AB209531 |pid:non... 48 0.88 1 ( AC177181 ) Strongylocentrotus purpuratus clone R3-4018C22, W... 48 0.88 1 ( ER286475 ) 1092343573088 Global...e CH251-682B11, ... 38 0.79 6 ( ER415983 ) 1092452150498 Global-Ocean-Sampling_GS-35-01-01-1... 3...us Phytoplasma mali strain AT complete ch... 36 0.72 17 ( AC192970 ) Pan troglodytes chromosome X clon...vegicus protein tyrosine... 91 1e-16 AB183035_1( AB183035 |pid:none) Ciona intestinalis Ci-VSP mRNA for... 8

  14. Dicty_cDB: SSC643 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nwwfi**csryvvnwchylyfimwfptilcfisklii*knfnr *l*fprtrmdscl*tcqsfh*klncqrsrstsycqtms**plalw...AK052401 |pid:none) Mus musculus 13 days embryo lung c... 191 1e-47 (Q8IU85) RecName: Full=Calcium/calmoduli...91 1e-47 (Q8BW96) RecName: Full=Calcium/calmodulin-dependent protein kina... 191 1e-47 BC041721_1( BC041721 ...oso... 212 5e-54 AB076903_1( AB076903 |pid:none) Ciona intestinalis Ci-CaM-K mRNA f... 196 3e-49 BC074183_1(...SS (Link to library) SSC643 (Link to dictyBase) - - - Contig-U11996-1 SSC643Z (Link to Original

  15. Dicty_cDB: SLI715 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available cctrsfnwwfi**csryvvnwchylyfimwfptilcfis klii*knfnr*l*fprtrmdscl*tcqsfh*klncqrsrstsycqtms**plalw...c... 137 2e-31 (Q8IU85) RecName: Full=Calcium/calmodulin-dependent protein kina...... 137 2e-31 (Q8BW96) RecName: Full=Calcium/calmodulin-dependent protein kina... 137 2e-31 BC041721_1( BC0417...romoso... 148 5e-35 AB076903_1( AB076903 |pid:none) Ciona intestinalis Ci-CaM-K mRNA f... 142 4e-33 BC074183...SL (Link to library) SLI715 (Link to dictyBase) - - - Contig-U11996-1 SLI715Z (Link to Original

  16. Dicty_cDB: SSD853 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available cfisklii*knfnr*l*fprtrmdscl*t cqsfh*klncqrsr*rsycqtms**pwalw**singfcc*splsfr*kdeei**pkkrws ifk*lnliiiiikkkkk...vis MGC82022 protein, m... 101 7e-21 ( Q63450 ) RecName: Full=Calcium/calmodulin-dependent protein kina... 1...00 1e-20 ( Q14012 ) RecName: Full=Calcium/calmodulin-dependent protein kina... 100 1e-20 PDBF( 1A06 ) MOL_ID...76903 |pid:none) Ciona intestinalis Ci-CaM-K mRNA f... 103 2e-21 BC074183_1( BC074183 |pid:none) Xenopus lae...SS (Link to library) SSD853 (Link to dictyBase) - - - Contig-U11996-1 SSD853Z (Link to Original

  17. Dicty_cDB: SSD777 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ytrlcctrsfnwwfi**csryvvnwchnlyfimwfptilcfisklii*kn fnr*l*fprtrmdscl*tcqsfh*klncqrsrstsycqtmf**plalw...7e-30 ( Q63450 ) RecName: Full=Calcium/calmodulin-dependent protein kina... 132 9e-30 ( Q14012 ) RecName: Full=Calcium/cal...6982 |pid:none) Dictyostelium discoideum chromoso... 141 1e-32 AB076903_1( AB076903 |pid:none) Ciona intestinalis Ci-Ca...SS (Link to library) SSD777 (Link to dictyBase) - - - Contig-U11996-1 SSD777Z (Link to Original... dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11996-1 Original site URL http://dict

  18. Dicty_cDB: SSJ377 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available fptil csisklii*knfnr*l*fprtrmdscl*tcqsfh*klncqrsrstsycqtms**plalw* *sinwfcc*splsfr*kdeei**pkkrwsifk*lnliiii .... 145 1e-33 ( Q63450 ) RecName: Full=Calcium/calmodulin-dependent protein kina... 144 2e-33 ( Q14012 ) RecName: Full=Calcium/cal...oso... 160 1e-38 AB076903_1( AB076903 |pid:none) Ciona intestinalis Ci-CaM-K mRNA f... 151 1e-35 BC074183_1(...SS (Link to library) SSJ377 (Link to dictyBase) - - - Contig-U11996-1 SSJ377Z (Link to Original... dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11996-1 Original site URL http://dict

  19. Dicty_cDB: VFB154 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available fxwwfi**csryvvnwchylyfimwfptilcfisklii*knfnr*l*fprtrmdscl*tc qsfh*klncqrsrstsycqtms**plalw**sinwfxcxspls Hom... 3e-43 AK052401_1( AK052401 |pid:none) Mus musculus 13 days embryo lung c... 175 6e-43 (Q8IU85) RecName: Full=Calcium/cal... Homo sapiens C... 175 6e-43 (Q8BW96) RecName: Full=Calcium/calmodulin-dependent ...ht chain kinase DDB_G0... 191 6e-48 AB076903_1( AB076903 |pid:none) Ciona intestinalis Ci-CaM-K mRNA f... 17...VF (Link to library) VFB154 (Link to dictyBase) - - - Contig-U11996-1 VFB154Z (Link to Original

  20. Dicty_cDB: AFL836 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available hcxqvvvhqimlhqkf*xvvhmimqsicg qlvslpifyyvvshhsyasslplii*knfxr*l*fprtrmdscl*tcqsfh*klncqrsr stsycqxms**plalw*... BC110966_1( BC110966 |pid:none) Xenopus laevis calcium/calmodulin-... 162 4e-50 (Q8IU85) RecName: Full=Calcium/cal...modulin-dependent protein kina... 160 1e-49 (Q8BW96) RecName: Full=Calcium/cal...1( AB076903 |pid:none) Ciona intestinalis Ci-CaM-K mRNA f... 159 3e-49 protein update 2009. 4. 4 PSORT psg: 0.00 gvh: 0.00 al...AF (Link to library) AFL836 (Link to dictyBase) - - - - AFL836P (Link to Original s

  1. Dicty_cDB: VFG381 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available *knfn r*l*fprtrmdscl*tcqsfh*klncqrsrstsycqtms**plalw**sinwfcc*spls fr*kekkyktkeegsifk*lnlii Frame C: diklqtf...n, m... 191 2e-47 AK052401_1( AK052401 |pid:none) Mus musculus 13 days embryo lung c... 190 5e-47 (Q8IU85) RecName: Full=Calcium/cal...modulin-dependent protein kina... 190 5e-47 (Q8BW96) RecName: Full=Calcium/calmoduli... myosin light chain kinase DDB_G0... 213 4e-54 AB076903_1( AB076903 |pid:none) Ciona intestinalis Ci-Ca...VF (Link to library) VFG381 (Link to dictyBase) - G03036 DDB0216307 Contig-U11996-1

  2. Dicty_cDB: SFH150 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lcctrsfxwwfi**csryvvnwchylyfimwfptilcfisklii* knfxr*l*fprtrmdscl*tcqsfh*klncqrsrstsycqtms**plalw**sinwfxc* s...ulus 13 days embryo lung c... 195 1e-48 (Q8IU85) RecName: Full=Calcium/calmodulin-dependent protein kina... ...195 1e-48 AY335686_1( AY335686 |pid:none) Synthetic construct Homo sapiens C... 195 1e-48 (Q8BW96) RecName: Full=Calcium/cal... AB076903 |pid:none) Ciona intestinalis Ci-CaM-K mRNA f... 197 2e-49 BC074183_1( BC074183 |pid:none) Xenopus...SF (Link to library) SFH150 (Link to dictyBase) - - - Contig-U11996-1 SFH150P (Link to Original

  3. Dicty_cDB: SSK695 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available fnr*l*fprtrmdscl*tcqsf h*klncqrsrstsycqtms**plalw**sinwfcc*splsfr*kdeei**pkkrwsifk* lnliiiiikkkkkikkkkviiikk... 108 4e-23 ( Q63450 ) RecName: Full=Calcium/calmodulin-dependent protein kina... 108 8e-23 ( Q14012 ) RecName: Full=Calcium/cal... AB076903 |pid:none) Ciona intestinalis Ci-CaM-K mRNA f... 114 1e-24 (Q86AD7) RecName: Full=Probable myosin ...SS (Link to library) SSK695 (Link to dictyBase) - - - Contig-U11996-1 SSK695E (Link to Original... dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11996-1 Original site URL http://dict

  4. Dicty_cDB: AFL780 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available qsfh*klncqrsrst sycqtms**plalw**sinwfccdlhshfakreei*dqrrgvnlqkln Homology vs CSM-cDNA Score E Sequences producing significant al...8 (Q8IU85) RecName: Full=Calcium/calmodulin-dependent protein kina... 228 2e-58 AY335686_1( AY335686 |pid:no...ne) Synthetic construct Homo sapiens C... 228 2e-58 (Q8BW96) RecName: Full=Calcium/cal...modulin-dependent protein kina... 228 2e-58 AB076903_1( AB076903 |pid:none) Ciona intestinalis Ci-CaM-K...AF (Link to library) AFL780 (Link to dictyBase) - - - - AFL780P (Link to Original s

  5. Dicty_cDB: SSB277 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ence (All Frames) Frame A: vvnwchylyfimwfptilcfisklii*knfnr*l*fprtrmdscl*tcqsfh*klncqrs rstsycqtms**plalw...0 AK052401_1( AK052401 |pid:none) Mus musculus 13 days embryo lung c... 98 1e-19 (Q8IU85) RecName: Full=Calcium/cal... Synthetic construct Homo sapiens C... 98 1e-19 (Q8BW96) RecName: Full=Calcium/calmodulin-dependent protein ...kina... 98 1e-19 ( Q63450 ) RecName: Full=Calcium/calmodulin-dependent protein kina... 97 3e-19 ( Q14012 ) RecName: Full=Calcium/cal...C82022 protein, m... 100 2e-20 AB076903_1( AB076903 |pid:none) Ciona intestinalis Ci-CaM-K mRNA f... 99 8e-2

  6. Dicty_cDB: VFG501 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available *fprtrmdscl*tcqsfh*klncqrsrstsycqtms**plalw**sinwfcc*splsfrx kmkkyktkeegsifkn*iniix Homology vs CSM-cDNA Sco...M-K mRNA f... 190 2e-47 AK052401_1( AK052401 |pid:none) Mus musculus 13 days embryo lung c... 190 3e-47 (Q8IU85) RecName: Full=Cal... Synthetic construct Homo sapiens C... 190 3e-47 (Q8BW96) RecName: Full=Calcium/cal...022 protein, m... 191 1e-47 AB076903_1( AB076903 |pid:none) Ciona intestinalis Ci-Ca...VF (Link to library) VFG501 (Link to dictyBase) - - - Contig-U11996-1 VFG501Z (Link to Original

  7. Dicty_cDB: AFB623 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available tilcfisklii*knfnr*l*fprtrmdscl*tcqsxh*klxcqrxrst syxqtms**plalw**six Frame B: rykitdi*q*i*KYQYIYLQPYLIVGIVNN...8 1e-55 (Q8IU85) RecName: Full=Calcium/calmodulin-dependent protein kina... 218 1e-55 AY335686_1( AY335686 |...pid:none) Synthetic construct Homo sapiens C... 218 1e-55 (Q8BW96) RecName: Full=Calcium/cal...6903 |pid:none) Ciona intestinalis Ci-CaM-K mRNA f... 222 1e-56 BC074183_1( BC074183 |pid:none) Xenopus laev...AF (Link to library) AFB623 (Link to dictyBase) - - - Contig-U11996-1 AFB623P (Link to Original

  8. Dicty_cDB: VSF265 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SYDNAVDMWSIGVITYILLCGFPPFLCFISXLII*kn fxr*l*fprtrmdscl*tcqsfh*klncqrsrstsycqtms**plalw**sinwxxc*sp lsx Trans...DMTIKIADFGLSKIFG TGXALXTSCGTPDYVAPEVLTGGSYDNAVDMWSIGVITYILLCGFPPFLCFISXLII*kn fxr*l*fprtrmdscl*tcqsfh*klncqrsrstsycqtms**plalw...m... 134 2e-43 (Q8IU85) RecName: Full=Calcium/calmodulin-dependent protein kina... 135 6e-43 (Q8BW96) RecName: Full=Calcium/cal...e-42 AB076903_1( AB076903 |pid:none) Ciona intestinalis Ci-CaM-K mRNA f... 132 4e-42 protein update 2009. 7....VS (Link to library) VSF265 (Link to dictyBase) - - - Contig-U11996-1 VSF265Z (Link to Original

  9. Dicty_cDB: SSH745 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available knkkikiiftnckkkkkkknfrlikskhfd*hkkakkkkk kkkk--- ---*l*fprtrmdscl*tcqsfh*klncqrsrstsycqtms**plalw...e-07 AE014135_86( AE014135 |pid:none) Drosophila melanogaster chromosom... 57 3e-07 ( Q63450 ) RecName: Full=Calcium/cal...modulin-dependent protein kina... 55 1e-06 ( Q14012 ) RecName: Full=Calcium/calmodulin-dependent...modulin-dependent ser... 171 9e-42 AB076903_1( AB076903 |pid:none) Ciona intestinalis Ci-CaM-K mRNA f... 62...19-1 SSH745P (Link to Original site) SSH745F 193 SSH745Z 261 SSH745P 454 - - Show SSH745 Library SS (Link to

  10. Large-scale trends in the evolution of gene structures within 11 animal genomes.

    Directory of Open Access Journals (Sweden)

    Mark Yandell

    2006-03-01

    Full Text Available We have used the annotations of six animal genomes (Homo sapiens, Mus musculus, Ciona intestinalis, Drosophila melanogaster, Anopheles gambiae, and Caenorhabditis elegans together with the sequences of five unannotated Drosophila genomes to survey changes in protein sequence and gene structure over a variety of timescales--from the less than 5 million years since the divergence of D. simulans and D. melanogaster to the more than 500 million years that have elapsed since the Cambrian explosion. To do so, we have developed a new open-source software library called CGL (for "Comparative Genomics Library". Our results demonstrate that change in intron-exon structure is gradual, clock-like, and largely independent of coding-sequence evolution. This means that genome annotations can be used in new ways to inform, corroborate, and test conclusions drawn from comparative genomics analyses that are based upon protein and nucleotide sequence similarities.

  11. Inferring noncoding RNA families and classes by means of genome-scale structure-based clustering.

    Directory of Open Access Journals (Sweden)

    Sebastian Will

    2007-04-01

    Full Text Available The RFAM database defines families of ncRNAs by means of sequence similarities that are sufficient to establish homology. In some cases, such as microRNAs and box H/ACA snoRNAs, functional commonalities define classes of RNAs that are characterized by structural similarities, and typically consist of multiple RNA families. Recent advances in high-throughput transcriptomics and comparative genomics have produced very large sets of putative noncoding RNAs and regulatory RNA signals. For many of them, evidence for stabilizing selection acting on their secondary structures has been derived, and at least approximate models of their structures have been computed. The overwhelming majority of these hypothetical RNAs cannot be assigned to established families or classes. We present here a structure-based clustering approach that is capable of extracting putative RNA classes from genome-wide surveys for structured RNAs. The LocARNA (local alignment of RNA tool implements a novel variant of the Sankoff algorithm that is sufficiently fast to deal with several thousand candidate sequences. The method is also robust against false positive predictions, i.e., a contamination of the input data with unstructured or nonconserved sequences. We have successfully tested the LocARNA-based clustering approach on the sequences of the RFAM-seed alignments. Furthermore, we have applied it to a previously published set of 3,332 predicted structured elements in the Ciona intestinalis genome (Missal K, Rose D, Stadler PF (2005 Noncoding RNAs in Ciona intestinalis. Bioinformatics 21 (Supplement 2: i77-i78. In addition to recovering, e.g., tRNAs as a structure-based class, the method identifies several RNA families, including microRNA and snoRNA candidates, and suggests several novel classes of ncRNAs for which to date no representative has been experimentally characterized.

  12. The truth about mouse, human, worms and yeast

    Directory of Open Access Journals (Sweden)

    Nelson David R

    2004-01-01

    Full Text Available Abstract Genome comparisons are behind the powerful new annotation methods being developed to find all human genes, as well as genes from other genomes. Genomes are now frequently being studied in pairs to provide cross-comparison datasets. This 'Noah's Ark' approach often reveals unsuspected genes and may support the deletion of false-positive predictions. Joining mouse and human as the cross-comparison dataset for the first two mammals are: two Drosophila species, D. melanogaster and D. pseudoobscura; two sea squirts, Ciona intestinalis and Ciona savignyi; four yeast (Saccharomyces species; two nematodes, Caenorhabditis elegans and Caenorhabditis briggsae; and two pufferfish (Takefugu rubripes and Tetraodon nigroviridis. Even genomes like yeast and C. elegans, which have been known for more than five years, are now being significantly improved. Methods developed for yeast or nematodes will now be applied to mouse and human, and soon to additional mammals such as rat and dog, to identify all the mammalian protein-coding genes. Current large disparities between human Unigene predictions (127,835 genes and gene-scanning methods (45,000 genes still need to be resolved. This will be the challenge during the next few years.

  13. Purification of Mitochondrial Proteins HSP60 and ATP Synthase from Ascidian Eggs: Implications for Antibody Specificity

    OpenAIRE

    Chenevert, Janet; Pruliere, Gerard; Ishii, Hirokazu; Sardet, Christian; Nishikata, Takahito

    2013-01-01

    Use of antibodies is a cornerstone of biological studies and it is important to identify the recognized protein with certainty. Generally an antibody is considered specific if it labels a single band of the expected size in the tissue of interest, or has a strong affinity for the antigen produced in a heterologous system. The identity of the antibody target protein is rarely confirmed by purification and sequencing, however in many cases this may be necessary. In this study we sought to chara...

  14. Ascidian dermatan sulfates attenuate metastasis, inflammation and thrombosis by inhibition of P-selectin

    OpenAIRE

    Kozlowski, E; M.S.G. Pavão; Borsig, L

    2011-01-01

    Background: Cancer-associated thrombosis and enduring inflammation are strongly associated with cancer progression and metastasis. Heparin is the mostly clinically used anticoagulant/antithrombotic drug, and has recently been shown to exhibit antimetastatic and anti-inflammatory activities that are linked to inhibition of P-selectin and/or L-selectin. P-selectin-mediated platelet–tumor cell and tumor cell–endothelium interactions facilitate the initial steps of metastasis. Objectives and Meth...

  15. Allogeneic Responses between Three Remote Populations of the Cosmopolitan Ascidian Botryllus schlosseri(Immunology)

    OpenAIRE

    Rinkevich, Baruch; Shapira, Michal; Weissman, Irving L.; Saito, Yasunori

    1992-01-01

    Colony allorecognition assays (CAAs) were performed between colonies of the world-wide distributed tunicate Botryllus schlosseri, sampled from the Mediterranean coast of Israel (Is), from Monterey, California (Mon) and from Mutsu Bay, Japan (Ja). While all 48 Is vs Ja CAAs resulted in nonfusion responses, unexpectedly, 4.4% of the 45 Is vs Mon pairs and 12.0% of the 25 Ja vs Mon assays ended in colony fusions. Allogeneic effector mechanisms in all 3 populations were similar, except for the Ja...

  16. Fungicidal compounds from a marine Ascidian-associated fungus Trichoderma harzianum

    Digital Repository Service at National Institute of Oceanography (India)

    PrabhaDevi; Ciavatta, M.L.; Wahidullah, S.; Vuppala, S.; DeSouza, L.

    . Of the five isolated secondary metabolites, compounds 2 and 5 are being reported here for the first time from T. harzianum. Compounds 1 and 4 inhibited the growth of Sclerotium rolfsii causing sclerotium wilt or rot disease in tropical plants. Compound 2 and 5...

  17. Two New Cholic Acid Derivatives from the Marine Ascidian-Associated Bacterium Hasllibacter halocynthiae

    Directory of Open Access Journals (Sweden)

    Sung Hun Kim

    2012-10-01

    Full Text Available The investigation of secondary metabolites in liquid cultures of a recently discovered marine bacterium, Hasllibacter halocynthiae strain KME 002T, led to the isolation of two new cholic acid derivatives. The structures of these compounds were determined to be 3,3,12-trihydroxy-7-ketocholanic acid (1 and 3,3,12-trihydroxy-7-deoxycholanic acid (2 through HRFABMS and NMR data analyses.

  18. Intense predation on ascidians by a trunk fish, Ostracion immaculatus (Temminck et Schlege) (Pisces:Ostracidae)

    Digital Repository Service at National Institute of Oceanography (India)

    Raveendran, T.V.; Harada, E.

    stream_size 9 stream_content_type text/plain stream_name Publ_Seto_Mar_Biol_Lab_37_193.pdf.txt stream_source_info Publ_Seto_Mar_Biol_Lab_37_193.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  19. Data on the ascidians (Chordata, Ascidiacea) of the marine park of Zembra-Zembretta (North Tunisia)

    OpenAIRE

    Mestiri, M.; Espla Alfonso, R.A.; Ben Mustapha, K.; M.S. ROMDHANE

    2005-01-01

    Une étude systématique des ascidies du Parc marin de Zembra-Zembretta a été menée. L’échantillonnage effectué autour de ces îles a été réalisé, pour la majorité des espèces, par scaphandre autonome sur les substrats rocheux et l’herbier à Posidonia oceanica et aussi par dragage sur les fonds meubles (sable et détritique côtier). La profondeur varie selon les stations de 14 à 70m. Au total, une vingtaine d’espèces a été recensée. Elles appartiennent à 6 familles (Polyclinidae, Polycitoridae, D...

  20. Evolutionary mitogenomics of Chordata: the strange case of ascidians and vertebrates

    OpenAIRE

    C Gissi; Griggio, F.; F. Iannelli

    2009-01-01

    The availability of almost one thousand complete mitochondrial genome (mtDNA) sequences of chordates provides an almost unique opportunity to analyse the evolution of this genome in the phylum Chordata, and to identify possible divergent evolutionary trends followed by the three chordate subphyla: Vertebrata, Cephalochordata and Tunicata.Here, we review some genome-level features of mtDNA, such as genetic code, gene content, genome architecture and gene strand asymmetry, mostly focusing on di...

  1. Evolutionary mitogenomics of Chordata: the strange case of ascidians and vertebrates

    Directory of Open Access Journals (Sweden)

    C Gissi

    2009-03-01

    Full Text Available The availability of almost one thousand complete mitochondrial genome (mtDNA sequences of chordates provides an almost unique opportunity to analyse the evolution of this genome in the phylum Chordata, and to identify possible divergent evolutionary trends followed by the three chordate subphyla: Vertebrata, Cephalochordata and Tunicata.Here, we review some genome-level features of mtDNA, such as genetic code, gene content, genome architecture and gene strand asymmetry, mostly focusing on differences existing between tunicates and remaining chordates. Indeed, tunicate mtDNAs show a surprisingly high variability in several genome-level features, even though the current tunicate taxon sampling is absolutely insufficient and is focused mainly on the class Ascidiacea. On the contrary, a stabilization of the mtDNA structural and evolutionary features is observed in both cephalochordates and vertebrates, where genome-level features are almost invariant. Thus, different evolutionary dynamics, probably related to divergent functional constraints, have modelled the overall mtDNA structure and organization of the three chordate subphyla.

  2. The use of food grade oil in the prevention of vase tunicate fouling on mussel aquaculture gear

    Directory of Open Access Journals (Sweden)

    Jiselle A. BAKKER

    2011-01-01

    Full Text Available Current mitigation strategies against invasive tunicates on mussel aquaculture gear in Prince Edward Island concentrate on labour-intensive and costly fouling removal. Instead of removal, this study focused on preventing the settlement of the vase tunicate Ciona intestinalis and other fouling organisms by applying a layer of food grade oil to gear prior to recruitment. Laboratory tests established the adherence and persistence of shortening, a food grade oil with a melting point exceeding ambient water temperatures, to rope and mussels. In situ tests showed that shortening decreased C. intestinalis weight and abundance on buoys, spat collector ropes and collector plates but not on mussel socks. Fouling by algae and other tunicates was significantly reduced on most substrates. There were no detrimental effects of shortening treatment on mussel length and abundance on mussel socks, but total mussel weight was significantly lower on shortening-treated socks. Shortening treatment did not significantly affect mussel spat settlement on spat collector ropes, but further evaluation is required. Overall, shortening application has considerable potential for reducing tunicate and other fouling, particularly on buoys.

  3. Reductive Evolution of the Mitochondrial Processing Peptidases of the Unicellular Parasites Trichomonas vaginalis and Giardia intestinalis

    Czech Academy of Sciences Publication Activity Database

    Šmíd, O.; Matušková, Anna; Harris, S. R.; Kučera, Tomáš; Novotný, M.; Horváthová, L.; Hrdý, I.; Kutejová, E.; Hirt, R. P.; Embley, T. M.; Janata, Jiří; Tachezy, J.

    2008-01-01

    Roč. 4, č. 12 (2008), s. 1-8. ISSN 1553-7366 R&D Projects: GA MŠk LC07032; GA AV ČR IAA501110631 Grant ostatní: CZ(CZ) B-Bio166/2006 (O.S.). S.H., R.P.H. Institutional research plan: CEZ:AV0Z50200510 Keywords : peptidases * mitochondria * human parasites Subject RIV: EE - Microbiology, Virology Impact factor: 9.125, year: 2008

  4. Multiplex Assay Detection of Immunoglobulin G Antibodies That Recognize Giardia intestinalis and Cryptosporidium parvum Antigens ▿

    OpenAIRE

    Priest, Jeffrey W.; Moss, Delynn M.; Visvesvara, Govinda S.; Jones, Cara C.; Li, Anna; Isaac-Renton, Judith L

    2010-01-01

    Giardiasis and cryptosporidiosis are common enteric parasitic diseases that have similar routes of transmission. In this work, we have identified epitopes within the Giardia variant-specific surface protein (VSP) sequences that are recognized by IgG antibodies from 13 of 14 (93%) sera from patients with stool-confirmed giardiasis. The conserved epitopes are shared among VSPs from both of the assemblages that commonly infect humans, and they are likely to be structural, as both sodium dodecyl ...

  5. Detection of Ancient DNA of Encephalitozoon intestinalis (Microsporidia) in Archaeological Material

    Czech Academy of Sciences Publication Activity Database

    Myšková, E.; Ditrich, O.; Sak, Bohumil; Kváč, Martin; Cymbalak, T.

    2014-01-01

    Roč. 100, č. 3 (2014), s. 356-359. ISSN 0022-3395 Institutional support: RVO:60077344 Keywords : parasites * Cryptosporidium * amplification * coprolites * Ascaris * Giardia * world * eggs Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.227, year: 2014

  6. Genome and transcriptome studies of the protozoan parasites Trypanosoma cruzi and Giardia intestinalis

    Science.gov (United States)

    Farran, Alexandra J. E.

    Vocal fold (VF) diseases and disorders are difficult to treat surgically or therapeutically. Tissue engineering offers an alternative strategy for the restoration of functional VF. In this work, we have developed tissue engineering methodologies for the functional reconstruction of VF. As a first step, the structure, composition and mechanical properties of native VF tissues have been investigated. In pigs ranging from fetal to 2+ years old, the VF structure and viscoelastic properties were found to be age-dependent. Adult tissues were more organized, displaying a denser lamina propria, and mature elastin fibers compared to fetal tissues, resulting in higher storage moduli. Secondly, biomimetic scaffolds which recaptured the mechanical properties of the native VF were developed. Chemically-defined collagen-hyaluronic acid (HA) composite hydrogels, and elastin-mimetic hybrid polymers (EMHPs) were successfully used as conducive 3D matrices, and 2D elastic scaffolds respectively, to in vitro static culture of fibroblasts. While the collagen-HA hydrogels allowed for in situ cell encapsulation and supported cell attachment and proliferation in 3D, the integrin-binding domain RGDSP was needed for cell proliferation on EMHPs. To emulate in vitro the mechanical environment of the native VF tissue, a dynamic culture system capable of generating vibratory stimulations at human phonation frequencies was successfully created and characterized. Gene expression analysis of fibroblasts subjected to 1 hour vibrations in 2D revealed that the expression of ECM-related genes was altered in response to changes in vibratory frequency and amplitude. Finally, expanding on our previous studies, the dynamic culture system was modified to accommodate for the long-term dynamic culture of cell-laden hydrogels. Human mesenchymal stem cells (hMSCs) encapsulated in a collagen/HA-based hydrogel, cultured in presence of connective tissue growth factor (CTGF), and subjected to high frequency vibrations were shown to respond to all three type of external factors. In summary, microenvironments such as biomimetic scaffolds, soluble factors, and mechanical stimuli are important modulator of cellular function. The strategic combination of those microenvironments into a biomimicking VF tissue engineering 3D system did not only provide an in vitro platform for the investigation of VF diseases, but also have the potential to offer alternative treatments for VF disorders.

  7. Methylome analysis of C. intestinalis and the origin of tissue specific methylation

    OpenAIRE

    Yokoyama, Takao

    2012-01-01

    報告番号: ; 学位授与年月日: 2012-03-22 ; 学位の種別: 修士 ; 学位の種類: 修士(科学) ; 学位記番号: 修創域第4505号 ; 研究科・専攻: 新領域創成科学研究科情報生命科学専攻

  8. Case Report: Recognizing Pneumatosis Intestinalis: A Case of Bowel Ischemia Presenting as Renal Colic

    OpenAIRE

    Peter D. Corr

    2012-01-01

    The clinical diagnosis of bowel ischemia is often difficult and the diagnosis can easily be missed unless there is a high index of clinical and radiological suspicion. Bowel ischemia and or infarction must be considered in the differential diagnosis in the older patient with pre-existing coronary artery or generalized vascular disease, cardiac failure, or arrhythmias especially atrial fibrillation and hypertension. An elderly patient with caecal infarction is presented wh...

  9. Localization of gamma-tubulin in interphase and mitotic cells of a unicellular eukaryote, Giardia intestinalis

    Czech Academy of Sciences Publication Activity Database

    Nohýnková, E.; Dráber, Pavel; Reisching, J.; Kulda, J.

    2000-01-01

    Roč. 79, č. 6 (2000), s. 438-445. ISSN 0171-9335 R&D Projects: GA MZd IZ3190; GA MŠk VS96142; GA ČR GA204/98/1054 Institutional research plan: CEZ:AV0Z5052915 Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.801, year: 2000

  10. Monitoring of Giardia intestinalis and Cryptosporidium parvum in Czech drinking water sources

    Czech Academy of Sciences Publication Activity Database

    Dolejš, P.; Ditrich, Oleg; Machula, T.; Kalousková, N.; Půžová, G.

    Bad Elster: Conference proceedings Bad Elster, 1998, s. 126-130. [Conference proceeding Bad Elster. Bad Elster (DE), 24.11.1998-28.11.1998] R&D Projects: GA MZe EP0960986669 Subject RIV: FP - Other Medical Disciplines

  11. Sediment Burial Intolerance of Marine Macroinvertebrates.

    Science.gov (United States)

    Hendrick, Vicki J; Hutchison, Zoë L; Last, Kim S

    2016-01-01

    The marine environment contains suspended particulate matter which originates from natural and anthropogenic sources. Settlement of this material can leave benthic organisms susceptible to smothering, especially if burial is sudden i.e. following storms or activities such as dredging. Their survival will depend on their tolerance to, and their ability to escape from burial. Here we present data from a multi-factorial experiment measuring burial responses incorporating duration, sediment fraction and depth. Six macroinvertebrates commonly found in sediment rich environments were selected for their commercial and/or conservation importance. Assessments revealed that the brittle star (Ophiura ophiura), the queen scallop (Aequipecten opercularis) and the sea squirt (Ciona intestinalis) were all highly intolerant to burial whilst the green urchin (Psammichinus miliaris) and the anemone (Sagartiogeton laceratus), showed intermediate and low intolerance respectively, to burial. The least intolerant, with very high survival was the Ross worm (Sabellaria spinulosa). With the exception of C. intestinalis, increasing duration and depth of burial with finer sediment fractions resulted in increased mortality for all species assessed. For C. intestinalis depth of burial and sediment fraction were found to be inconsequential since there was complete mortality of all specimens buried for more than one day. When burial emergence was assessed O. ophiura emerged most frequently, followed by P. miliaris. The former emerged most frequently from the medium and fine sediments whereas P. miliaris emerged more frequently from coarse sediment. Both A. opercularis and S. laceratus showed similar emergence responses over time, with A. opercularis emerging more frequently under coarse sediments. The frequency of emergence of S. laceratus increased with progressively finer sediment and C. intestinalis did not emerge from burial irrespective of sediment fraction or depth. Finally, and perhaps

  12. Sediment Burial Intolerance of Marine Macroinvertebrates.

    Directory of Open Access Journals (Sweden)

    Vicki J Hendrick

    Full Text Available The marine environment contains suspended particulate matter which originates from natural and anthropogenic sources. Settlement of this material can leave benthic organisms susceptible to smothering, especially if burial is sudden i.e. following storms or activities such as dredging. Their survival will depend on their tolerance to, and their ability to escape from burial. Here we present data from a multi-factorial experiment measuring burial responses incorporating duration, sediment fraction and depth. Six macroinvertebrates commonly found in sediment rich environments were selected for their commercial and/or conservation importance. Assessments revealed that the brittle star (Ophiura ophiura, the queen scallop (Aequipecten opercularis and the sea squirt (Ciona intestinalis were all highly intolerant to burial whilst the green urchin (Psammichinus miliaris and the anemone (Sagartiogeton laceratus, showed intermediate and low intolerance respectively, to burial. The least intolerant, with very high survival was the Ross worm (Sabellaria spinulosa. With the exception of C. intestinalis, increasing duration and depth of burial with finer sediment fractions resulted in increased mortality for all species assessed. For C. intestinalis depth of burial and sediment fraction were found to be inconsequential since there was complete mortality of all specimens buried for more than one day. When burial emergence was assessed O. ophiura emerged most frequently, followed by P. miliaris. The former emerged most frequently from the medium and fine sediments whereas P. miliaris emerged more frequently from coarse sediment. Both A. opercularis and S. laceratus showed similar emergence responses over time, with A. opercularis emerging more frequently under coarse sediments. The frequency of emergence of S. laceratus increased with progressively finer sediment and C. intestinalis did not emerge from burial irrespective of sediment fraction or depth. Finally

  13. Transcription factors ETS2 and MESP1 transdifferentiate human dermal fibroblasts into cardiac progenitors.

    Science.gov (United States)

    Islas, Jose Francisco; Liu, Yu; Weng, Kuo-Chan; Robertson, Matthew J; Zhang, Shuxing; Prejusa, Allan; Harger, John; Tikhomirova, Dariya; Chopra, Mani; Iyer, Dinakar; Mercola, Mark; Oshima, Robert G; Willerson, James T; Potaman, Vladimir N; Schwartz, Robert J

    2012-08-01

    Unique insights for the reprograming of cell lineages have come from embryonic development in the ascidian Ciona, which is dependent upon the transcription factors Ci-ets1/2 and Ci-mesp to generate cardiac progenitors. We tested the idea that mammalian v-ets erythroblastosis virus E26 oncogene homolog 2 (ETS2) and mesoderm posterior (MESP) homolog may be used to convert human dermal fibroblasts into cardiac progenitors. Here we show that murine ETS2 has a critical role in directing cardiac progenitors during cardiopoiesis in embryonic stem cells. We then use lentivirus-mediated forced expression of human ETS2 to convert normal human dermal fibroblasts into replicative cells expressing the cardiac mesoderm marker KDR(+). However, although neither ETS2 nor the purported cardiac master regulator MESP1 can by themselves generate cardiac progenitors de novo from fibroblasts, forced coexpression of ETS2 and MESP1 or cell treatment with purified proteins reprograms fibroblasts into cardiac progenitors, as shown by the de novo appearance of core cardiac transcription factors, Ca(2+) transients, and sarcomeres. Our data indicate that ETS2 and MESP1 play important roles in a genetic network that governs cardiopoiesis. PMID:22826236

  14. Epibiosis of oxygen phototrophs containing chlorophylls a, b, c, and d on the colonial ascidian Cystodytes dellechiajei

    Czech Academy of Sciences Publication Activity Database

    Martínez-García, M.; Koblížek, Michal; López-Legentil, S.; Antón, J.

    2011-01-01

    Roč. 61, č. 1 (2011), s. 13-19. ISSN 0095-3628 Institutional research plan: CEZ:AV0Z50200510 Keywords : D-PRODUCING CYANOBACTERIUM * ACARYOCHLORIS-MARINA * ADAPTATION Subject RIV: EE - Microbiology, Virology Impact factor: 2.912, year: 2011

  15. Increased Inter-Colony Fusion Rates Are Associated with Reduced COI Haplotype Diversity in an Invasive Colonial Ascidian Didemnum vexillum

    OpenAIRE

    Smith, Kirsty F.; Stefaniak, Lauren; Saito, Yasunori; Gemmill, Chrissen E.C.; Cary, S. Craig; Fidler, Andrew E.

    2012-01-01

    Considerable progress in our understanding of the population genetic changes associated with biological invasions has been made over the past decade. Using selectively neutral loci, it has been established that reductions in genetic diversity, reflecting founder effects, have occurred during the establishment of some invasive populations. However, some colonial organisms may actually gain an ecological advantage from reduced genetic diversity because of the associated reduction in inter-colon...

  16. The synapsin gene family in basal chordates: evolutionary perspectives in metazoans

    Directory of Open Access Journals (Sweden)

    De Bernardi Fiorenza

    2010-01-01

    Full Text Available Abstract Background Synapsins are neuronal phosphoproteins involved in several functions correlated with both neurotransmitter release and synaptogenesis. The comprehension of the basal role of the synapsin family is hampered in vertebrates by the existence of multiple synapsin genes. Therefore, studying homologous genes in basal chordates, devoid of genome duplication, could help to achieve a better understanding of the complex functions of these proteins. Results In this study we report the cloning and characterization of the Ciona intestinalis and amphioxus Branchiostoma floridae synapsin transcripts and the definition of their gene structure using available C. intestinalis and B. floridae genomic sequences. We demonstrate the occurrence, in both model organisms, of a single member of the synapsin gene family. Full-length synapsin genes were identified in the recently sequenced genomes of phylogenetically diverse metazoans. Comparative genome analysis reveals extensive conservation of the SYN locus in several metazoans. Moreover, developmental expression studies underline that synapsin is a neuronal-specific marker in basal chordates and is expressed in several cell types of PNS and in many, if not all, CNS neurons. Conclusion Our study demonstrates that synapsin genes are metazoan genes present in a single copy per genome, except for vertebrates. Moreover, we hypothesize that, during the evolution of synapsin proteins, new domains are added at different stages probably to cope up with the increased complexity in the nervous system organization. Finally, we demonstrate that protochordate synapsin is restricted to the post-mitotic phase of CNS development and thereby is a good marker of postmitotic neurons.

  17. Phenotypic rescue of a Drosophila model of mitochondrial ANT1 disease

    Directory of Open Access Journals (Sweden)

    Suvi Vartiainen

    2014-06-01

    Full Text Available A point mutation in the Drosophila gene that codes for the major adult isoform of adenine nuclear translocase (ANT represents a model for human diseases that are associated with ANT insufficiency [stress-sensitive B1 (sesB1]. We characterized the organismal, bioenergetic and molecular phenotype of sesB1 flies then tested strategies to compensate the mutant phenotype. In addition to developmental delay and mechanical-stress-induced seizures, sesB1 flies have an impaired response to sound, defective male courtship, female sterility and curtailed lifespan. These phenotypes, excluding the latter two, are shared with the mitoribosomal protein S12 mutant, tko25t. Mitochondria from sesB1 adults showed a decreased respiratory control ratio and downregulation of cytochrome oxidase. sesB1 adults exhibited ATP depletion, lactate accumulation and changes in gene expression that were consistent with a metabolic shift towards glycolysis, characterized by activation of lactate dehydrogenase and anaplerotic pathways. Females also showed downregulation of many genes that are required for oogenesis, and their eggs, although fertilized, failed to develop to the larval stages. The sesB1 phenotypes of developmental delay and mechanical-stress-induced seizures were alleviated by an altered mitochondrial DNA background. Female sterility was substantially rescued by somatic expression of alternative oxidase (AOX from the sea squirt Ciona intestinalis, whereas AOX did not alleviate developmental delay. Our findings illustrate the potential of different therapeutic strategies for ANT-linked diseases, based on alleviating metabolic stress.

  18. Phenotypic rescue of a Drosophila model of mitochondrial ANT1 disease.

    Science.gov (United States)

    Vartiainen, Suvi; Chen, Shanjun; George, Jack; Tuomela, Tea; Luoto, Kaisa R; O'Dell, Kevin M C; Jacobs, Howard T

    2014-06-01

    A point mutation in the Drosophila gene that codes for the major adult isoform of adenine nuclear translocase (ANT) represents a model for human diseases that are associated with ANT insufficiency [stress-sensitive B(1) (sesB(1))]. We characterized the organismal, bioenergetic and molecular phenotype of sesB(1) flies then tested strategies to compensate the mutant phenotype. In addition to developmental delay and mechanical-stress-induced seizures, sesB(1) flies have an impaired response to sound, defective male courtship, female sterility and curtailed lifespan. These phenotypes, excluding the latter two, are shared with the mitoribosomal protein S12 mutant, tko(25t). Mitochondria from sesB(1) adults showed a decreased respiratory control ratio and downregulation of cytochrome oxidase. sesB(1) adults exhibited ATP depletion, lactate accumulation and changes in gene expression that were consistent with a metabolic shift towards glycolysis, characterized by activation of lactate dehydrogenase and anaplerotic pathways. Females also showed downregulation of many genes that are required for oogenesis, and their eggs, although fertilized, failed to develop to the larval stages. The sesB(1) phenotypes of developmental delay and mechanical-stress-induced seizures were alleviated by an altered mitochondrial DNA background. Female sterility was substantially rescued by somatic expression of alternative oxidase (AOX) from the sea squirt Ciona intestinalis, whereas AOX did not alleviate developmental delay. Our findings illustrate the potential of different therapeutic strategies for ANT-linked diseases, based on alleviating metabolic stress. PMID:24812436

  19. A conserved non-reproductive GnRH system in chordates.

    Directory of Open Access Journals (Sweden)

    Takehiro G Kusakabe

    Full Text Available Gonadotropin-releasing hormone (GnRH is a neuroendocrine peptide that plays a central role in the vertebrate hypothalamo-pituitary axis. The roles of GnRH in the control of vertebrate reproductive functions have been established, while its non-reproductive function has been suggested but less well understood. Here we show that the tunicate Ciona intestinalis has in its non-reproductive larval stage a prominent GnRH system spanning the entire length of the nervous system. Tunicate GnRH receptors are phylogenetically closest to vertebrate GnRH receptors, yet functional analysis of the receptors revealed that these simple chordates have evolved a unique GnRH system with multiple ligands and receptor heterodimerization enabling complex regulation. One of the gnrh genes is conspicuously expressed in the motor ganglion and nerve cord, which are homologous structures to the hindbrain and spinal cord of vertebrates. Correspondingly, GnRH receptor genes were found to be expressed in the tail muscle and notochord of embryos, both of which are phylotypic axial structures along the nerve cord. Our findings suggest a novel non-reproductive role of GnRH in tunicates. Furthermore, we present evidence that GnRH-producing cells are present in the hindbrain and spinal cord of the medaka, Oryzias latipes, thereby suggesting the deep evolutionary origin of a non-reproductive GnRH system in chordates.

  20. Phylogenetic relationships of the Fox (Forkhead) gene family in the Bilateria

    Science.gov (United States)

    Mazet, Francoise; Yu, Jr Kai; Liberles, David A.; Holland, Linda Z.; Shimeld, Sebastian M.

    2003-01-01

    The Forkhead or Fox gene family encodes putative transcription factors. There are at least four Fox genes in yeast, 16 in Drosophila melanogaster (Dm) and 42 in humans. Recently, vertebrate Fox genes have been classified into 17 groups named FoxA to FoxQ. Here, we extend this analysis to invertebrates, using available sequences from D. melanogaster, Anopheles gambiae (Ag), Caenorhabditis elegans (Ce), the sea squirt Ciona intestinalis (Ci) and amphioxus Branchiostoma floridae (Bf), from which we also cloned several Fox genes. Phylogenetic analyses lend support to the previous overall subclassification of vertebrate genes, but suggest that four subclasses (FoxJ, L, N and Q) could be further subdivided to reflect their relationships to invertebrate genes. We were unable to identify orthologs of Fox subclasses E, H, I, J, M and Q1 in D. melanogaster, A. gambiae or C. elegans, suggesting either considerable loss in ecdysozoans or the evolution of these subclasses in the deuterostome lineage. Our analyses suggest that the common ancestor of protostomes and deuterostomes had a minimum complement of 14 Fox genes.

  1. Larval rearing, metamorphosis, growth and reproduction of the eolid nudibranch hermissenda crassicornis (eschscholtz, 1831) (gastropoda: opisthobranchia).

    Science.gov (United States)

    Harrigan, J F; Alkon, D L

    1978-06-01

    1. Hermissenda crassicornis is a subannual nudibranch species that reproduces year-round. 2. There is a significant positive relationship between adult weight, diameter of the egg mass, estimated number of eggs per egg mass, and average number of eggs per capsule. 3. There is a planktonic veliger stage of 34 days minimum at 13 degrees -15 degrees C. 4. Larvae metamorphose on at least three species of hydroids. 5. To develop in reasonable numbers to a state competent to metamorphose veligers require a diet that includes phytoplankton of larger cell size (10-11 microm) than the commonly used Isochrysis and Monochrysis (5 microm). 6. Although Hermissenda feeds on a wide variety of sessile invertebrate species in the ocean, a diet of tunicate alone (Ciona intestinalis) promotes good growth and survival in the laboratory. 7. Egg mass deposition is initiated only after first copulation, except in the last month of life, and continues from about one-month post-metamorphosis to death, at about four months post-metamorphosis. Generation time (egg-to-egg) may be as short as 2.5 months. 8. A laboratory strain of Hermissenda is being established to provide animals of known history for research on the neural correlates of behavior. Animals, at least initially, are being selected for fast growth rate. PMID:20693369

  2. Detection of marine microalgal biotoxins using bioassays based on functional expression of tunicate xenobiotic receptors in yeast.

    Science.gov (United States)

    Richter, Ingrid; Fidler, Andrew E

    2015-03-01

    Marine microalgae can produce biotoxins that cause widespread poisoning in marine ecosystems and may also affect human health. While established microalgal biotoxins are detectable using chemical methods, a need remains for robust, inexpensive bioassays. Ligand-binding domains (LBDs) from a tunicate nuclear receptor, VDR/PXRα, which is orthologous to both the vertebrate pregnane X receptor (PXR) and the vitamin D receptor (VDR), can be activated by microalgal biotoxins when expressed in mammalian cell lines. Building on this observation, we developed a generic recombinant yeast bioassay platform that expresses chimeric proteins containing tunicate VDR/PXRα LBDs which mediate ligand-dependent transcription of a reporter gene (lacZ) encoding an easily assayed enzyme (β-galactosidase). Recombinant yeast strains expressing VDR/PXRα LBDs from two tunicate species, Ciona intestinalis and Botryllus schlosseri, were exposed to both synthetic and natural toxins. Structurally simple synthetic chemicals (n-butyl-p-aminobenzoate, carbamazepine, p-aminobenzoic acid, and bisphenol-A) generated EC50 values in the μM range, while more structurally complex marine biotoxins (okadaic acid, pectenotoxin-11, and portimine) activated the assays in the nM range. Given the large number of tunicate species, we propose that tunicate VDR/PXR LBDs may be used as 'sensor elements' in similar yeast-based high-throughput bioassays for detection of established microalgal biotoxins and uncharacterised marine bioactive compounds. PMID:25549942

  3. Expression of the alternative oxidase mitigates beta-amyloid production and toxicity in model systems.

    Science.gov (United States)

    El-Khoury, Riyad; Kaulio, Eveliina; Lassila, Katariina A; Crowther, Damian C; Jacobs, Howard T; Rustin, Pierre

    2016-07-01

    Mitochondrial dysfunction has been widely associated with the pathology of Alzheimer's disease, but there is no consensus on whether it is a cause or consequence of disease, nor on the precise mechanism(s). We addressed these issues by testing the effects of expressing the alternative oxidase AOX from Ciona intestinalis, in different models of AD pathology. AOX can restore respiratory electron flow when the cytochrome segment of the mitochondrial respiratory chain is inhibited, supporting ATP synthesis, maintaining cellular redox homeostasis and mitigating excess superoxide production at respiratory complexes I and III. In human HEK293-derived cells, AOX expression decreased the production of beta-amyloid peptide resulting from antimycin inhibition of respiratory complex III. Because hydrogen peroxide was neither a direct product nor substrate of AOX, the ability of AOX to mimic antioxidants in this assay must be indirect. In addition, AOX expression was able to partially alleviate the short lifespan of Drosophila models neuronally expressing human beta-amyloid peptides, whilst abrogating the induction of markers of oxidative stress. Our findings support the idea of respiratory chain dysfunction and excess ROS production as both an early step and as a pathologically meaningful target in Alzheimer's disease pathogenesis, supporting the concept of a mitochondrial vicious cycle underlying the disease. PMID:27094492

  4. Metaphylogeny of 82 gene families sheds a new light on chordate evolution

    Directory of Open Access Journals (Sweden)

    2006-04-01

    Full Text Available Achieving a better comprehension of the evolution of species has always been an important matter for evolutionary biologists. The deuterostome phylogeny has been described for many years, and three phyla are distinguishable: Echinodermata (including sea stars, sea urchins, etc…, Hemichordata (including acorn worms and pterobranchs, and Chordata (including urochordates, cephalochordates and extant vertebrates. Inside the Chordata phylum, the position of vertebrate species is quite unanimously accepted. Nonetheless, the position of urochordates in regard with vertebrates is still the subject of debate, and has even been suggested by some authors to be a separate phylum from cephalochordates and vertebrates. It was also the case for agnathans species –myxines and hagfish– for which phylogenetic evidence was recently given for a controversial monophyly. This raises the following question: which one of the cephalochordata or urochordata is the sister group of vertebrates and what are their relationships? In the present work, we analyzed 82 protein families presenting homologs between urochordata and other deuterostomes and focused on two points: 1 testing accurately the position of urochordata and cephalochordata phyla in regard with vertebrates as well as chordates monophyly, 2 performing an estimation of the rate of gene loss in the Ciona intestinalis genome. We showed that the urochordate phyla is the vertebrate sister group and that gene loss played a major role in structuring the urochordate genome.

  5. A SINGLE GENOTYPE OF ENCEPHALITOZOON INTESTINALIS INFECTS FREE-RANGING GORILLAS AND PEOPLE SHARING THEIR HABITATS, UGANDA

    Science.gov (United States)

    Several microsporidia species are recognized etiologic agents of human diseases. Microsporidian spores have been detected by Chromotrope 2R and calcofluor stains in fecal samples of three fre-ranging human-habituated mountain gorillas of Uganda and two people who share gorilla h...

  6. Role of CD4+ and CD8+ T lymphocytes in the protection of mice against Encephalitozoon intestinalis infection

    Czech Academy of Sciences Publication Activity Database

    Salát, Jiří; Braunfuchsová, Pavlína; Kopecký, Jan; Ditrich, Oleg

    2002-01-01

    Roč. 88, č. 7 (2002), s. 603-608. ISSN 0932-0113 R&D Projects: GA AV ČR IAA6022101 Institutional research plan: CEZ:AV0Z6022909 Keywords : immune-response * interferon-gamma * microsporidiosis Subject RIV: EC - Immunology Impact factor: 1.046, year: 2002

  7. Molecular Detection of Giardia intestinalis from Stray Dogs in Animal Shelters of Gyeongsangbuk-do (Province) and Daejeon, Korea

    OpenAIRE

    Shin, Jin-Cheol; Reyes, Alisha Wehdnesday Bernardo; Kim, Sang-Hun; Kim, Suk; Park, Hyung-Jin; Seo, Kyoung-Won; Song, Kun-Ho

    2015-01-01

    Giardia is a major public health concern and considered as reemerging in industrialized countries. The present study investigated the prevalence of giardiosis in 202 sheltered dogs using PCR. The infection rate was 33.2% (67/202); Gyeongsangbuk-do and Daejeon showed 25.7% (39/152, P

  8. Geography and host specificity: Two forces behind the genetic structure of the freshwater fish parasite Ligula intestinalis (Cestoda: Diphyllobothriidae)

    Czech Academy of Sciences Publication Activity Database

    Bouzid, W.; Štefka, Jan; Hypša, Václav; Lek, S.; Scholz, Tomáš; Legal, L.; Ben Hassine, O. K.; Loot, G.

    2008-01-01

    Roč. 38, č. 12 (2008), s. 1465-1479. ISSN 0020-7519 R&D Projects: GA MŠk LC522; GA ČR GA524/04/0342; GA MŠk LC06073 Grant ostatní: GA ČR(CZ) GA206/08/1019 Institutional research plan: CEZ:AV0Z60220518 Keywords : genealogy * coevolution * genetic structure * tapeworms Subject RIV: EG - Zoology Impact factor: 3.752, year: 2008

  9. Invasion of the intestinal tract by sporozoites of Eimeria coecicola and Eimeria intestinalis in naive and immune rabbits

    Czech Academy of Sciences Publication Activity Database

    Pakandl, Michal; Sewald, B.; Drouet-Viard, F.

    2006-01-01

    Roč. 98, č. 4 (2006), s. 310-316. ISSN 0932-0113 R&D Projects: GA ČR GA524/05/2328 Institutional research plan: CEZ:AV0Z60220518 Keywords : rabbit coccidia * sporozoites * intra- and extraintestinal migration Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.140, year: 2006

  10. Interplay of host specificity and biogeography in the population structure of a cosmopolitan endoparasite: microsatellite study of Ligula intestinalis (Cestoda)

    Czech Academy of Sciences Publication Activity Database

    Štefka, Jan; Hypša, Václav; Scholz, Tomáš

    2009-01-01

    Roč. 18, č. 6 (2009), s. 1187-1206. ISSN 0962-1083 R&D Projects: GA MŠk LC06073; GA ČR GA524/08/0885; GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : cryptic speciation * geographical isolation * host specificity * microsatellites * parasite * population structure Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 5.960, year: 2009

  11. Occurence and removal of Cryptosporidium parvum and Giardia intestinalis in sources of drinking water in Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Dolejš, P.; Machula, T.; Kalousková, Nataša; Ditrich, O.; Půžová, G.

    Bad Elster: AAV, 1998. s. 39-39. [International Conference on Water Sanitation and Health: Resolving conflicts between drinking water demands and pressures from society wastes. 15.02.1998-17.02.1998, Bad Elster] Subject RIV: EI - Biotechnology ; Bionics

  12. Endozoicomonas are specific, facultative symbionts of sea squirts

    DEFF Research Database (Denmark)

    Schreiber, Lars; Kjeldsen, Kasper Urup; Funch, Peter;

    2016-01-01

    Ascidians are marine filter feeders and harbor diverse microbiota that can exhibit a high degree of host-specificity. Pharyngeal samples of Scandinavian and Mediterranean ascidians were screened for consistently associated bacteria by culture-dependent and -independent approaches. Representatives...

  13. Evolution and origin of merlin, the product of the Neurofibromatosis type 2 (NF2 tumor-suppressor gene

    Directory of Open Access Journals (Sweden)

    Omelyanchuk Leonid V

    2005-12-01

    Full Text Available Abstract Background Merlin, the product of the Neurofibromatosis type 2 (NF2 tumor suppressor gene, belongs to the ezrin-radixin-moesin (ERM subgroup of the protein 4.1 superfamily, which links cell surface glycoproteins to the actin cytoskeleton. While merlin's functional activity has been examined in mammalian and Drosophila models, little is understood about its evolution, diversity, and overall distribution among different taxa. Results By combining bioinformatic and phylogenetic approaches, we demonstrate that merlin homologs are present across a wide range of metazoan lineages. While the phylogenetic tree shows a monophyletic origin of the ERM family, the origin of the merlin proteins is robustly separated from that of the ERM proteins. The derivation of merlin is thought to be in early metazoa. We have also observed the expansion of the ERM-like proteins within the vertebrate clade, which occurred after its separation from Urochordata (Ciona intestinalis. Amino acid sequence alignment reveals the absence of an actin-binding site in the C-terminal region of all merlin proteins from various species but the presence of a conserved internal binding site in the N-terminal domain of the merlin and ERM proteins. In addition, a more conserved pattern of amino acid residues is found in the region containing the so-called "Blue Box," although some amino acid substitutions in this region exist in the merlin sequences of worms, fish, and Ciona. Examination of sequence variability at functionally significant sites, including the serine-518 residue, the phosphorylation of which modulates merlin's intra-molecular association and function as a tumor suppressor, identifies several potentially important sites that are conserved among all merlin proteins but divergent in the ERM proteins. Secondary structure prediction reveals the presence of a conserved α-helical domain in the central to C-terminal region of the merlin proteins of various species. The

  14. Molecular orbital calculations, experimental and theoretical UV spectra of granulatimides and didemnimides, biologically active polycyclic heteroaromatic alkaloids from the ascidian Didemnum granulatum

    Science.gov (United States)

    Camargo, A. J.; Oliveira, J. H. H. L.; Trsic, M.; Berlinck, R. G. S.

    2001-01-01

    A detailed computational study was performed for compounds granulatimide, isogranulatimide, and didemnimides A, D, and E, using the semiempirical Austin model 1 quantum chemical method. The electronic features and structural parameters were confronted with the inhibition of the G2 cell cycle checkpoint of mammalian cancer cells. All compounds were submitted to a rigorous conformational analysis using the Tripos 5.2 force field implemented in the Spartan 5.01 program. The electronic density in specific regions of the molecules appears to play a pivotal role towards activity. The molecular planarity creates a broad negative electrostatic potential on the two sides of the active compounds (granulatimide and isogralulatimide) and a positive potential in their central core, while the non-planar compounds (didemnimides A, D, and E, which are inactive) present an asymmetric potential scattered over the molecules. These electrostatic potential features are likely to be the modulator of hydrophobicity or lipophilicity of the compounds, which appear correlated with activity. The hydrogen attached to the N atom of the pyrrole moiety of indole is more positive for active compounds than for the inactive molecules. The theoretical electronic spectra were obtained for all compounds using the configuration interaction method, with the AM1 routine. All transitions present π→π ∗ nature. The theoretical results are in good agreement with experimental values.

  15. Vascular Endothelial Growth Factor Receptor Family in Ascidians, Halocynthia roretzi (Sea Squirt). Its High Expression in Circulatory System-Containing Tissues

    OpenAIRE

    Saeed Samarghandian; Masabumi Shibuya

    2013-01-01

    The vascular endothelial growth factor (VEGF)-VEGF Receptor (VEGFR) system is an important pathway for regulation of angiogenesis. However, its evolutionary development, particularly the step from invertebrates to vertebrates, is still largely unknown. Here, we molecularly cloned the VEGFR-like gene from Halocynthia roretzi, a species belonging to the Tunicata, the chordate subphylum recently considered the sister group of vertebrates. The cDNA encoded a homolog of human VEGFR, including the ...

  16. Phylogenetic analysis of the tenascin gene family: evidence of origin early in the chordate lineage

    Directory of Open Access Journals (Sweden)

    Tucker RP

    2006-08-01

    Full Text Available Abstract Background Tenascins are a family of glycoproteins found primarily in the extracellular matrix of embryos where they help to regulate cell proliferation, adhesion and migration. In order to learn more about their origins and relationships to each other, as well as to clarify the nomenclature used to describe them, the tenascin genes of the urochordate Ciona intestinalis, the pufferfish Tetraodon nigroviridis and Takifugu rubripes and the frog Xenopus tropicalis were identified and their gene organization and predicted protein products compared with the previously characterized tenascins of amniotes. Results A single tenascin gene was identified in the genome of C. intestinalis that encodes a polypeptide with domain features common to all vertebrate tenascins. Both pufferfish genomes encode five tenascin genes: two tenascin-C paralogs, a tenascin-R with domain organization identical to mammalian and avian tenascin-R, a small tenascin-X with previously undescribed GK repeats, and a tenascin-W. Four tenascin genes corresponding to tenascin-C, tenascin-R, tenascin-X and tenascin-W were also identified in the X. tropicalis genome. Multiple sequence alignment reveals that differences in the size of tenascin-W from various vertebrate classes can be explained by duplications of specific fibronectin type III domains. The duplicated domains are encoded on single exons and contain putative integrin-binding motifs. A phylogenetic tree based on the predicted amino acid sequences of the fibrinogen-related domains demonstrates that tenascin-C and tenascin-R are the most closely related vertebrate tenascins, with the most conserved repeat and domain organization. Taking all lines of evidence together, the data show that the tenascins referred to as tenascin-Y and tenascin-N are actually members of the tenascin-X and tenascin-W gene families, respectively. Conclusion The presence of a tenascin gene in urochordates but not other invertebrate phyla

  17. Distribution and diversity of tunicates utilizing eelgrass as substrate in the western North Atlantic between 39° and 47° north latitude (New Jersey to Newfoundland)

    Science.gov (United States)

    Carman, M R; Colarusso, Phillip D; Nelson, Eric P; Grunden, David W; Wong, Melisa C; McKenzie, Cynthia; Matheson, Kyle; Davidson, Jeffrey G.; Fox, Sophia; Neckles, Hilary A.; Bayley, Holly; Schott, Stephen; Dijkstra, Jennifer A; Stewart-Clark, Sarah

    2016-01-01

    Seagrass meadows are ecologically important habitats that are declining globally at an accelerating rate due to natural and anthropogenic stressors. Their decline is a serious concern as this habitat provides many ecosystem services. Eelgrass (Zostera marina) is the dominant seagrass species in the western North Atlantic. It has recently been established that invasive tunicate species possibly threaten the health of eelgrass beds. Colonization of eelgrass leaves by tunicates can inhibit eelgrass growth and may cause shoot mortality. To document the distribution and diversity of tunicate species that attach to eelgrass in the western North Atlantic, we surveyed twenty-one eelgrass sites from New Jersey to Newfoundland. Eight species of tunicates were found to be colonizing eelgrass, of which 6 are considered invasive. Botrylloides violaceus and Botryllus schlosseri were most commonly attached to eelgrass, with B. schlosseri having the largest latitudinal range of any species. Tunicate faunas attached to eelgrass were less diverse north of Gloucester, Massachusetts, where individual survey sites exhibited two species at most and only 4 of the 8 species observed in this study. Percent tunicate cover on eelgrass tended to fall within the 1–25 range, with occasional coverage up to >75–100. Density of eelgrass was highly variable among sites, ranging from <1 to 820 shoots/m². The solitary tunicate Ciona intestinalis was only found on eelgrass at the highest latitude sampled, in Newfoundland, where it is a new invader. The tunicates observed in this study, both solitary and colonial, are viable when attached to eelgrass and pose a potential threat to overgrow and weaken seagrass shoots and reduce the sustainability of seagrass meadows.

  18. Diverse forms of RPS9 splicing are part of an evolving autoregulatory circuit.

    Science.gov (United States)

    Plocik, Alex M; Guthrie, Christine

    2012-01-01

    Ribosomal proteins are essential to life. While the functions of ribosomal protein-encoding genes (RPGs) are highly conserved, the evolution of their regulatory mechanisms is remarkably dynamic. In Saccharomyces cerevisiae, RPGs are unusual in that they are commonly present as two highly similar gene copies and in that they are over-represented among intron-containing genes. To investigate the role of introns in the regulation of RPG expression, we constructed 16 S. cerevisiae strains with precise deletions of RPG introns. We found that several yeast introns function to repress rather than to increase steady-state mRNA levels. Among these, the RPS9A and RPS9B introns were required for cross-regulation of the two paralogous gene copies, which is consistent with the duplication of an autoregulatory circuit. To test for similar intron function in animals, we performed an experimental test and comparative analyses for autoregulation among distantly related animal RPS9 orthologs. Overexpression of an exogenous RpS9 copy in Drosophila melanogaster S2 cells induced alternative splicing and degradation of the endogenous copy by nonsense-mediated decay (NMD). Also, analysis of expressed sequence tag data from distantly related animals, including Homo sapiens and Ciona intestinalis, revealed diverse alternatively-spliced RPS9 isoforms predicted to elicit NMD. We propose that multiple forms of splicing regulation among RPS9 orthologs from various eukaryotes operate analogously to translational repression of the alpha operon by S4, the distant prokaryotic ortholog. Thus, RPS9 orthologs appear to have independently evolved variations on a fundamental autoregulatory circuit. PMID:22479208

  19. Diverse forms of RPS9 splicing are part of an evolving autoregulatory circuit.

    Directory of Open Access Journals (Sweden)

    Alex M Plocik

    Full Text Available Ribosomal proteins are essential to life. While the functions of ribosomal protein-encoding genes (RPGs are highly conserved, the evolution of their regulatory mechanisms is remarkably dynamic. In Saccharomyces cerevisiae, RPGs are unusual in that they are commonly present as two highly similar gene copies and in that they are over-represented among intron-containing genes. To investigate the role of introns in the regulation of RPG expression, we constructed 16 S. cerevisiae strains with precise deletions of RPG introns. We found that several yeast introns function to repress rather than to increase steady-state mRNA levels. Among these, the RPS9A and RPS9B introns were required for cross-regulation of the two paralogous gene copies, which is consistent with the duplication of an autoregulatory circuit. To test for similar intron function in animals, we performed an experimental test and comparative analyses for autoregulation among distantly related animal RPS9 orthologs. Overexpression of an exogenous RpS9 copy in Drosophila melanogaster S2 cells induced alternative splicing and degradation of the endogenous copy by nonsense-mediated decay (NMD. Also, analysis of expressed sequence tag data from distantly related animals, including Homo sapiens and Ciona intestinalis, revealed diverse alternatively-spliced RPS9 isoforms predicted to elicit NMD. We propose that multiple forms of splicing regulation among RPS9 orthologs from various eukaryotes operate analogously to translational repression of the alpha operon by S4, the distant prokaryotic ortholog. Thus, RPS9 orthologs appear to have independently evolved variations on a fundamental autoregulatory circuit.

  20. Migratory neuronal progenitors arise from the neural plate borders in tunicates.

    Science.gov (United States)

    Stolfi, Alberto; Ryan, Kerrianne; Meinertzhagen, Ian A; Christiaen, Lionel

    2015-11-19

    The neural crest is an evolutionary novelty that fostered the emergence of vertebrate anatomical innovations such as the cranium and jaws. During embryonic development, multipotent neural crest cells are specified at the lateral borders of the neural plate before delaminating, migrating and differentiating into various cell types. In invertebrate chordates (cephalochordates and tunicates), neural plate border cells express conserved factors such as Msx, Snail and Pax3/7 and generate melanin-containing pigment cells, a derivative of the neural crest in vertebrates. However, invertebrate neural plate border cells have not been shown to generate homologues of other neural crest derivatives. Thus, proposed models of neural crest evolution postulate vertebrate-specific elaborations on an ancestral neural plate border program, through acquisition of migratory capabilities and the potential to generate several cell types. Here we show that a particular neuronal cell type in the tadpole larva of the tunicate Ciona intestinalis, the bipolar tail neuron, shares a set of features with neural-crest-derived spinal ganglia neurons in vertebrates. Bipolar tail neuron precursors derive from caudal neural plate border cells, delaminate and migrate along the paraxial mesoderm on either side of the neural tube, eventually differentiating into afferent neurons that form synaptic contacts with both epidermal sensory cells and motor neurons. We propose that the neural plate borders of the chordate ancestor already produced migratory peripheral neurons and pigment cells, and that the neural crest evolved through the acquisition of a multipotent progenitor regulatory state upstream of multiple, pre-existing neural plate border cell differentiation programs. PMID:26524532

  1. Evolutionary origins of retinoid active short-chain dehydrogenases/reductases of SDR16C family.

    Science.gov (United States)

    Belyaeva, Olga V; Chang, Chenbei; Berlett, Michael C; Kedishvili, Natalia Y

    2015-06-01

    Vertebrate enzymes that belong to the 16C family of short-chain dehydrogenases/reductases (SDR16C) were shown to play an essential role in the control of retinoic acid (RA) levels during development. To trace the evolution of enzymatic function of SDR16C family, and to examine the origins of the pathway for RA biosynthesis from vitamin A, we identified putative SDR16C enzymes through the extensive search of available genome sequencing data in a subset of species representing major metazoan phyla. The phylogenetic analysis revealed that enzymes from protostome, non-chordate deuterostome and invertebrate chordate species are found in three clades of SDR16C family containing retinoid active enzymes, which are retinol dehydrogenase 10 (RDH10), retinol dehydrogenases E2 (RDHE2) and RDHE2-similar, and dehydrogenase reductase (SDR family) member 3 (DHRS3). For the initial functional analysis, we cloned RDH10- and RDHE2-related enzymes from the early developmental stages of a non-chordate deuterostome, green sea urchin Lytechinus variegatus, and an invertebrate chordate, sea squirt Ciona intestinalis. In situ hybridization revealed that these proteins are expressed in a pattern relevant to development, while assays performed on proteins expressed in mammalian cell culture showed that they possess retinol-oxidizing activity as their vertebrate homologs. The existence of invertebrate homologs of DHRS3 was inferred from the analysis of phylogeny and cofactor-binding residues characteristic of preference for NADP(H). The presence of invertebrate homologs in the DHRS3 group of SDR16C is interesting in light of the complex mutually activating interaction, which we have recently described for human RDH10 and DHRS3 enzymes. Further functional analysis of these homologs will establish whether this interaction evolved to control retinoid homeostasis only in vertebrates, or is also conserved in pre-vertebrates. PMID:25451586

  2. Identifying single copy orthologs in Metazoa.

    Directory of Open Access Journals (Sweden)

    Christopher J Creevey

    2011-12-01

    Full Text Available The identification of single copy (1-to-1 orthologs in any group of organisms is important for functional classification and phylogenetic studies. The Metazoa are no exception, but only recently has there been a wide-enough distribution of taxa with sufficiently high quality sequenced genomes to gain confidence in the wide-spread single copy status of a gene.Here, we present a phylogenetic approach for identifying overlooked single copy orthologs from multigene families and apply it to the Metazoa. Using 18 sequenced metazoan genomes of high quality we identified a robust set of 1,126 orthologous groups that have been retained in single copy since the last common ancestor of Metazoa. We found that the use of the phylogenetic procedure increased the number of single copy orthologs found by over a third more than standard taxon-count approaches. The orthologs represented a wide range of functional categories, expression profiles and levels of divergence.To demonstrate the value of our set of single copy orthologs, we used them to assess the completeness of 24 currently published metazoan genomes and 62 EST datasets. We found that the annotated genes in published genomes vary in coverage from 79% (Ciona intestinalis to 99.8% (human with an average of 92%, suggesting a value for the underlying error rate in genome annotation, and a strategy for identifying single copy orthologs in larger datasets. In contrast, the vast majority of EST datasets with no corresponding genome sequence available are largely under-sampled and probably do not accurately represent the actual genomic complement of the organisms from which they are derived.

  3. Early evolution of ionotropic GABA receptors and selective regimes acting on the mammalian-specific theta and epsilon subunits.

    Directory of Open Access Journals (Sweden)

    Christopher J Martyniuk

    Full Text Available BACKGROUND: The amino acid neurotransmitter GABA is abundant in the central nervous system (CNS of both invertebrates and vertebrates. Receptors of this neurotransmitter play a key role in important processes such as learning and memory. Yet, little is known about the mode and tempo of evolution of the receptors of this neurotransmitter. Here, we investigate the phylogenetic relationships of GABA receptor subunits across the chordates and detail their mode of evolution among mammals. PRINCIPAL FINDINGS: Our analyses support two major monophyletic clades: one clade containing GABA(A receptor alpha, gamma, and epsilon subunits, and another one containing GABA(A receptor rho, beta, delta, theta, and pi subunits. The presence of GABA receptor subunits from each of the major clades in the Ciona intestinalis genome suggests that these ancestral duplication events occurred before the divergence of urochordates. However, while gene divergence proceeded at similar rates on most receptor subunits, we show that the mammalian-specific subunits theta and epsilon experienced an episode of positive selection and of relaxed constraints, respectively, after the duplication event. Sites putatively under positive selection are placed on a three-dimensional model obtained by homology-modeling. CONCLUSIONS: Our results suggest an early divergence of the GABA receptor subunits, before the split from urochordates. We show that functional changes occurred in the lineages leading to the mammalian-specific subunit theta, and we identify the amino acid sites putatively responsible for the functional divergence. We discuss potential consequences for the evolution of mammals and of their CNS.

  4. Effetto pro-ossidante e pro-infiammatorio degli ossisteroli in cellule intestinali: attività modulatoria della frazione fenolica del vino

    OpenAIRE

    Cabboi, Barbara, Paola Melis, M.

    2014-01-01

    Because the intestine sits at the interface between the organism and its luminal environment, it represents a critical defense barrier against luminal toxic agents. Thus, in addition to being exposed to luminal nutrients, the intestinal mucosa is constantly challenged by diet-derived oxidants, mutagens, and carcinogens as well as by endogenously generated reactive oxygen species. Among the oxidizing agents cholesterol oxidation products, oxysterols, are particularly relevant; besides being ge...

  5. The prevalence of Giardia intestinalis and Entamoeba histolytica/dispar in Van Regional Training and Research Hospital: A four-year monitoring

    Directory of Open Access Journals (Sweden)

    Yasemin Bayram

    2013-03-01

    Full Text Available Objective: The aim of this retrospective study was to determinethe frequency rates of Giardia and E.histolytica/E.dispar and their distribution by years as well as agegroups and gender distribution during a four-year period.Materials and methods: A total of 9911 stool samplessent to our laboratory between January 2008 and December2011 were tested for parasites. Native-Lugol and formolethyl acetate sedimentation methods were utilized formicroscopic identification of Entamoeba sp. and Giardiatrophozoites and cysts in fresh stool samples. Additionally,trichrome staining was performed in stool sampleswhere the distinctive diagnosis could not be confirmed.Results: From a total of 9911 stool samples analyzedduring the study, 4.7% were positive for Giardia and 6.2%were positive for Entemoeba histolytica/ Entemoeba dispar.Of Giardia-positive patients 57% were male and 43%female. Similarly, 56% of Entemoeba histolytica/ Entemoebadispar positive patients were male and 44% werefemale. Both parasites’ higher frequency rates seen inmale groups were found statistically significant (p<0.01.Conclusion: It is seen that intestinal protozoon infectionsare still present as an important public health problemin our region. In order to prevent this problem, personalhygiene and sanitation rules education for community aswell as infrastructure improvements are necessary.Key words: Giardia, Entemoeba histolytica/ Entemoeba dispar, prevalence

  6. Transport of MS2 phage, Escherichia coli, Clostridium perfringens, Cryptosporidium parvum and Giardia intestinalis in a gravel and a sandy soil : additions and corrections

    NARCIS (Netherlands)

    Hijnen, W.A.M.; Medema, Gerriet Jan; Brouwer-Hanzens, Anke J.; Charles, Katrina J.

    2006-01-01

    To define protection zones around groundwater abstraction wells and safe setback distances for artificial recharge systems in water treatment, quantitative information is needed about the removal of micro-organisms during soil passage. Column experiments were conducted using natural soil and water f

  7. Transport of MS2 phage, Escherichia coli, Clostridium perfringens, Cryptosporidium parvum and Giardia intestinalis in a gravel and a sandy soil

    NARCIS (Netherlands)

    Hijnen, W.A.M.; Medema, Gerriet Jan; Brouwer-Hanzens, Anke J.; Charles, Katrina J.

    2005-01-01

    To define protection zones around groundwater abstraction wells and safe setback distances for artificial recharge systems in water treatment, quantitative information is needed about the removal of micro-organisms during soil passage. Column experiments were conducted using natural soil and water f

  8. Susceptibility of IFN? or IL-12 knock-out and SCID mice to infection with two microsporidian species, Encephalitozoon cuniculi and E. intestinalis

    Czech Academy of Sciences Publication Activity Database

    Salát, Jiří; Sak, Bohumil; Le, T.; Kopecký, Jan

    2004-01-01

    Roč. 51, č. 4 (2004), s. 275-282. ISSN 0015-5683 R&D Projects: GA AV ČR IAA6022101; GA ČR GP524/03/D167 Grant ostatní: Bravo! Program(US) MIRT T37TW00036-01 Institutional research plan: CEZ:AV0Z6022909 Keywords : Microsporidia * Encephalitozoon * mice Subject RIV: EC - Immunology Impact factor: 0.837, year: 2004

  9. Sledování výskytu Giardia Intestinalis a Cryptosporidium parvum ve zdrojích pitných vod

    Czech Academy of Sciences Publication Activity Database

    Dolejš, P.; Ditrich, Oleg; Kalousková, N.; Machula, T.; Půžová, G.

    Praha: Konference Aktuální otázky vodárenské biologie, 1998, s. 121-124. [Aktuální otázky vodárenské biologie. Praha (CZ), 01.01.1998-02.01.1998] R&D Projects: GA MZe EP0960986669 Subject RIV: FP - Other Medical Disciplines

  10. Sledování výskytu Giardia intestinalis a Cryptosporidium parvum ve zdrojích pitných vod

    Czech Academy of Sciences Publication Activity Database

    Dolejš, P.; Ditrich, Oleg; Machula, T.; Kalousková, N.; Půžová, G.

    Spišská Nová Ves: Konference s mezinárodnou účasťou Pitná voda, 1998, s. 83-88. [Konference s mezinárodnou účasťou Pitná voda. Spišská Nová Ves (SK), 01.01.1998-02.01.1998] R&D Projects: GA MZe EP0960986669 Subject RIV: FP - Other Medical Disciplines

  11. Metodi molecolari per la diagnosi di laboratorio e lo studio epidemiologico delle infezioni da Giardia intestinalis, Cryptosporidium spp. e Dientamoeba fragilis

    OpenAIRE

    Montecchini, Sara

    2012-01-01

    Le malattie gastrointestinali sostenute da protozoi patogeni a trasmissione fecale-orale hanno un rilevante impatto in termini di morbilità e mortalità in tutto il mondo, con prevalenza particolarmente elevata nei Paesi in via di sviluppo. Tuttavia, tali infezioni sono diventate un problema non trascurabile per i Paesi industrializzati quali il nostro, in relazione al progressivo e costante aumento di soggetti che per ragioni diverse (turismo, lavoro, opere missionarie, etc.) si recano in are...

  12. Phylogeny of the Aplousobranchia (Tunicata: Ascidiacea Filogenia de Aplousobranchia (Tunicata: Ascidiacea

    Directory of Open Access Journals (Sweden)

    Tatiane R. Moreno

    2008-06-01

    Full Text Available The phylogenetic relationships of genera and families of Aplousobranchia Lahille (Tunicata, Ascidiacea is reconstructed based on morphological characters - the first comprehensive morphology-based phylogenetic analysis for the Aplousobranchia. Monophyly of Aplousobranchia and its families were tested with samples of 14 families. The final character matrix comprised 47 characters and 41 genera as terminal taxa. Nine equally most parsimonious trees (length 161, CI = 0.5031, RI = 0.7922 were found. Characters describing replication, colony system formation, and branchial walls were the more important in phylogenetic reconstruction. These characters were more useful than others more traditionally used in ascidian taxonomy, such as: body division, position of the heart, gonads and epicardium. Characters not frequently used in phylogenetic analysis, such as body wall muscles, muscles associated with transversal blood vessels and arrangement of the larval papillae, also have phylogenetic information. Results supported monophyly of the Aplousobranchia sensu Lahille, 1887 including only Polycitoridae, Polyclinidae, and Didemnidae. On the other hand, Aplousobranchia including also Cionidae and Diazonidae is not monophyletic since Perophora and Ecteinascidia were included as ingroups in the cladogram, Ciona (now closer to Ascidia was no longer included in Aplousobranchia and the position of Rhopalaea and Diazona is not resolved. We propose a revised classification based on this phylogenetic analysis, in which Aplousobranchia, with three new families and an indeterminate taxon, now has 15 families.O relacionamento filogenéticos de gêneros e famílias de de Aplousobranchia Lahille (Tunicata, Ascidiacea foi reconstruída com base em caracteres morfológicos - esta constitui a primeira análise filogenética morfológica abrangente para Aplousobranchia. A monofilia de Aplousobranchia e suas famílias foi testada com espécies de 14 famílias. A matriz final

  13. Giardia: General Information

    Science.gov (United States)

    ... Recommend on Facebook Tweet Share Compartir What is giardiasis? G. intestinalis trophozoites in a Giemsa stained mucosal ... and around the world. How do you get giardiasis and how is it spread? G. intestinalis trophozoites ...

  14. Observations of recruitment and colonization by tunicates and associated invertebrates using giant one-meter2 recruitment plates at Woods Hole, Massachusetts

    Science.gov (United States)

    Valentine, Page C.; Carman, M.R.; Blackwood, Dann S.

    2016-01-01

    Large recruitment plates measuring 1 × 1 m were deployed over an 18-month period from September 2013 to March 2015 for the purpose of documenting recruitment and colonization processes of marine invertebrate species at Woods Hole, Massachusetts. Each side of two plates was subdivided into 16 subareas (25 × 25 cm), and an observational strategy was developed whereby, at approximately two-week intervals, a different subarea was cleaned. Using this approach, we were able to photographically document species recruitment and growth interactions. Water temperature records from the site show that steady warming and cooling between 3 and 20° C changed at a mean rate of 0.2 ° C d-1. However, temperature changes during the coolest and warmest parts of the temperature cycle were highly variable. In 2014, between the first and last occurrence of 0° C, temperatures were ≤0° C 15 percent of the time, but in 2015 temperatures were ≤0° C 93 percent of the time. In 2014, between the first and last occurrence of 21° C, temperatures were ≥21° C 88 percent of the time, and this warm period correlated with the disappearance of the hydroid Ectopleura crocea, the solitary tunicates Ascidiella aspersa and Ciona intestinalis, and the 2013 generation of Botrylloides violaceus. In Woods Hole, large plates provided enough space to accommodate both fast- and slow-colonizing species, resulting in the establishment of a diverse assemblage that was observed over a long time period. The most successful colonizing species had relatively long reproductive and recruitment periods, grew rapidly, repelled settlement onto their surfaces by larvae of any species, defended themselves against overgrowth by any species, overwintered, and lived a long time. Of the three dominant species observed in this study, the colonial tunicates Didemnum vexillum and Botrylloides violaceus had these qualities; the encrusting colonial bryozoan Schizoporella unicornis had all but one, it grew more slowly

  15. FAM20: an evolutionarily conserved family of secreted proteins expressed in hematopoietic cells

    Directory of Open Access Journals (Sweden)

    Cobos Everardo

    2005-01-01

    Full Text Available Abstract Background Hematopoiesis is a complex developmental process controlled by a large number of factors that regulate stem cell renewal, lineage commitment and differentiation. Secreted proteins, including the hematopoietic growth factors, play critical roles in these processes and have important biological and clinical significance. We have employed representational difference analysis to identify genes that are differentially expressed during experimentally induced myeloid differentiation in the murine EML hematopoietic stem cell line. Results One identified clone encoded a previously unidentified protein of 541 amino acids that contains an amino terminal signal sequence but no other characterized domains. This protein is a member of family of related proteins that has been named family with sequence similarity 20 (FAM20 with three members (FAM20A, FAM20B and FAM20C in mammals. Evolutionary comparisons revealed the existence of a single FAM20 gene in the simple vertebrate Ciona intestinalis and the invertebrate worm Caenorhabditis elegans and two genes in two insect species, Drosophila melanogaster and Anopheles gambiae. Six FAM20 family members were identified in the genome of the pufferfish, Fugu rubripes and five members in the zebrafish, Danio rerio. The mouse Fam20a protein was ectopically expressed in a mammalian cell line and found to be a bona fide secreted protein and efficient secretion was dependent on the integrity of the signal sequence. Expression analysis revealed that the Fam20a gene was indeed differentially expressed during hematopoietic differentiation and that the other two family members (Fam20b and Fam20c were also expressed during hematcpoiesis but that their mRNA levels did not vary significantly. Likewise FAM20A was expressed in more limited set of human tissues than the other two family members. Conclusions The FAM20 family represents a new family of secreted proteins with potential functions in regulating

  16. Amphioxus (Branchiostoma floridae has orthologs of vertebrate odorant receptors

    Directory of Open Access Journals (Sweden)

    Taylor John S

    2009-10-01

    Full Text Available Abstract Background A common feature of chemosensory systems is the involvement of G protein-coupled receptors (GPCRs in the detection of environmental stimuli. Several lineages of GPCRs are involved in vertebrate olfaction, including trace amine-associated receptors, type 1 and 2 vomeronasal receptors and odorant receptors (ORs. Gene duplication and gene loss in different vertebrate lineages have lead to an enormous amount of variation in OR gene repertoire among species; some fish have fewer than 100 OR genes, while some mammals possess more than 1000. Fascinating features of the vertebrate olfactory system include allelic exclusion, where each olfactory neuron expresses only a single OR gene, and axonal guidance where neurons expressing the same receptor project axons to common glomerulae. By identifying homologous ORs in vertebrate and in non-vertebrate chordates, we hope to expose ancestral features of the chordate olfactory system that will help us to better understand the evolution of the receptors themselves and of the cellular components of the olfactory system. Results We have identified 50 full-length and 11 partial ORs in Branchiostoma floridae. No ORs were identified in Ciona intestinalis. Phylogenetic analysis places the B. floridae OR genes in a monophyletic clade with the vertebrate ORs. The majority of OR genes in amphioxus are intronless and many are also tandemly arrayed in the genome. By exposing conserved amino acid motifs and testing the ability of those motifs to discriminate between ORs and non-OR GPCRs, we identified three OR-specific amino acid motifs common in cephalochordate, fish and mammalian and ORs. Conclusion Here, we show that amphioxus has orthologs of vertebrate ORs. This conclusion demonstrates that the receptors, and perhaps other components of vertebrate olfaction, evolved at least 550 million years ago. We have also identified highly conserved amino acid motifs that may be important for maintaining

  17. Epitope of titin A-band-specific monoclonal antibody Tit1 5 H1.1 is highly conserved in several Fn3 domains of the titin molecule. Centriole staining in human, mouse and zebrafish cells

    Directory of Open Access Journals (Sweden)

    Mikelsaar Aavo-Valdur

    2012-09-01

    Full Text Available Abstract Background Previously we have reported on the development of a new mouse anti-titin monoclonal antibody, named MAb Titl 5 H1.1, using the synthetic peptide N-AVNKYGIGEPLESDSVVAK-C which corresponds to an amino acid sequence in the A-region of the titin molecule as immunogen. In the human skeletal muscles, MAb Titl 5 H1.1 reacts specifically with titin in the A-band of the sarcomere and in different non-muscle cell types with nucleus and cytoplasm, including centrioles. In this report we have studied the evolutionary aspects of the binding of MAb Tit1 5 H1.1 with its target antigen (titin. Results We have specified the epitope area of MAb Tit1 5 H1.1 by subpeptide mapping to the hexapeptide N-AVNKYG-C. According to protein databases this amino acid sequence is located in the COOH-terminus of several different Fn3 domains of the A-region of titin molecule in many organisms, such as human being, mouse, rabbit, zebrafish (Danio rerio, and even in sea squirt (Ciona intestinalis. Our immunohisto- and cytochemical studies with MAb Tit1 5 H1.1 in human, mouse and zebrafish tissues and cell cultures showed a striated staining pattern in muscle cells and also staining of centrioles, cytoplasm and nuclei in non-muscle cells. Conclusions The data confirm that titin can play, in addition to the known roles in striated muscle cells also an important role in non-muscle cells as a centriole associated protein. This phenomenon is highly conserved in the evolution and is related to Fn3 domains of the titin molecule. Using titin A-band-specific monoclonal antibody MAb Tit1 5 H1.1 it was possible to locate titin in the sarcomeres of skeletal muscle cells and in the centrioles, cytoplasm and nuclei of non-muscle cells in phylogenetically so distant organisms as Homo sapiens, Mus musculus and zebrafish (Danio rerio.

  18. Identification and correction of abnormal, incomplete and mispredicted proteins in public databases

    Directory of Open Access Journals (Sweden)

    Bányai László

    2008-08-01

    Full Text Available Abstract Background Despite significant improvements in computational annotation of genomes, sequences of abnormal, incomplete or incorrectly predicted genes and proteins remain abundant in public databases. Since the majority of incomplete, abnormal or mispredicted entries are not annotated as such, these errors seriously affect the reliability of these databases. Here we describe the MisPred approach that may provide an efficient means for the quality control of databases. The current version of the MisPred approach uses five distinct routines for identifying abnormal, incomplete or mispredicted entries based on the principle that a sequence is likely to be incorrect if some of its features conflict with our current knowledge about protein-coding genes and proteins: (i conflict between the predicted subcellular localization of proteins and the absence of the corresponding sequence signals; (ii presence of extracellular and cytoplasmic domains and the absence of transmembrane segments; (iii co-occurrence of extracellular and nuclear domains; (iv violation of domain integrity; (v chimeras encoded by two or more genes located on different chromosomes. Results Analyses of predicted EnsEMBL protein sequences of nine deuterostome (Homo sapiens, Mus musculus, Rattus norvegicus, Monodelphis domestica, Gallus gallus, Xenopus tropicalis, Fugu rubripes, Danio rerio and Ciona intestinalis and two protostome species (Caenorhabditis elegans and Drosophila melanogaster have revealed that the absence of expected signal peptides and violation of domain integrity account for the majority of mispredictions. Analyses of sequences predicted by NCBI's GNOMON annotation pipeline show that the rates of mispredictions are comparable to those of EnsEMBL. Interestingly, even the manually curated UniProtKB/Swiss-Prot dataset is contaminated with mispredicted or abnormal proteins, although to a much lesser extent than UniProtKB/TrEMBL or the EnsEMBL or GNOMON

  19. Molecular investigation of zoonotic genotypes of Giardia intestinalis isolates in humans, dogs and cats, sheep, goats and cattle in Araçatuba (São Paulo State, Brazil) by the analysis of ß-giardin gene fragments

    OpenAIRE

    Elenir Alves Macedo de Godoy; Juares Elias Santos Junior; Marcus Vinícius Teresa Belloto; Marcus Vinícius Proença de Moraes; Gustavo Capatti Cassiano; Aline Cardoso Caseca Volotão; Maria Cecília Rui Luvizotto; Claudia Márcia Aparecida Carareto; Mônica Cristina de Moraes Silva; Ricardo Luiz Dantas Machado

    2013-01-01

    In the period from July 2009 to October 2010, fecal samples from 61 animals and 154 humans from the municipality of Aracatuba (São Paulo State, Brazil) were studied. Fecal samples from animals were collected in the Municipal Animal Shelter and the Veterinary Hospital of the Universidade Estadual Paulista. Human fecal specimens were collected in playschools in the outskirts of the city by the private network of clinical analysis laboratories of the municipal. Diagnosis was done by optical mic...

  20. 21 CFR 520.1326b - Mebendazole and trichlorfon paste.

    Science.gov (United States)

    2010-04-01

    ... (Gastrophilus intestinalis and G. nasalis), large roundworms (Parascaris equorum), large strongyles (Strongylus edentatus, S. equinus, S. vulgaris), small strongyles, and pinworms (Oxyuris equi). (3) Limitations. Do...

  1. Macrofouling community structure in Kanayama Bay, Kii Peninsula (Japan)

    Digital Repository Service at National Institute of Oceanography (India)

    Raveendran, T.V.; Harada, E.

    of fouling organisms were monitored at monthly intervals. Fortnightly variations in hydrographic parameters were also noted simultaneously. The fouling community at this bay was a complex assemblage of bryozoans, ascidians, polychaetes and barnacles...

  2. Impact of predation by Ostracion immaculatus (Pisces: Ostraciidae) on the macrofouling community structure in Kanayama Bay, Kii Peninsula (Japan)

    Digital Repository Service at National Institute of Oceanography (India)

    Raveendran, T.V.; Harada, E.

    using predator inclusion as well as exclusion treatment confirmed that predation by this fish had significant impact on the structure of fouling community. The importance of predation was manifested mainly through the influence of fish on ascidians...

  3. Larvae of fouling organisms and macrofouling at New Mangalore Port, west coast of India

    Digital Repository Service at National Institute of Oceanography (India)

    Khandeparker, D.C.; Anil, A.C.; Venkat, K.

    Polychaetes, bryozoans, barnacles and ascidians were the dominant groups in the fouling community at New Mangalore Port. Polychaete and cirripede larvae were encountered throughout the year. Even though bivalve were present in the planktonic hauls...

  4. rRNA genes from the lower chordate Herdmania momus: structural similarity with higher eukaryotes.

    OpenAIRE

    Degnan, B M; Yan, J.; Hawkins, C J; Lavin, M F

    1990-01-01

    Ascidians, primitive chordates that have retained features of the likely progenitors to all vertebrates, are a useful model to study the evolutionary relationship of chordates to other animals. We have selected the well characterized ribosomal RNA (rRNA) genes to investigate this relationship, and we describe here the cloning and characterization of an entire ribosomal DNA (rDNA) tandem repeat unit from a lower chordate, the ascidian Herdmania momus. rDNA copy number and considerable sequence...

  5. Ascidia subterranea sp. nov. (Phlebobranchia: Ascidiidae), a new tunicate belonging to the A. sydneiensis Stimpson, 1855 group, found as burrow associate of Axiopsis serratifrons A. Milne-Edwards, 1873 (Decapoda: Axiidae) on Derawan Island, Indonesia.

    Science.gov (United States)

    Kneer, Dominik; Monniot, Francoise; Stach, Thomas; Christianen, Marjolijn J A

    2013-01-01

    A new tunicate, Ascidia subterranea sp. nov., was found in burrows of the axiid crustacean Axiopsis serratifrons on Derawan Island, Indonesia. It differs from other ascidians in its habitat as well as numerous morphological peculiarities which are described in detail. The shrimp Rostronia stylirostris Holthuis, 1952 was found inside A. subterranea sp. nov., and 4 species of bivalves, 3 species of polychaetes, 1 gastropod, 1 polyplacophoran and 1 sponge species were found as burrow associates besides the ascidian. PMID:24758824

  6. Territoriality and Conflict Avoidance Explain Asociality (Solitariness) of the Endosymbiotic Pea Crab Tunicotheres moseri

    OpenAIRE

    Ambrosio, Louis J.; Baeza, J. Antonio

    2016-01-01

    Host monopolization theory predicts symbiotic organisms inhabiting morphologically simple, relatively small and scarce hosts to live solitarily as a result of territorial behaviors. We tested this prediction with Tunicotheres moseri, an endosymbiotic crab dwelling in the atrial chamber of the morphologically simple, small, and relatively scarce ascidian Styela plicata. As predicted, natural populations of T. moseri inhabit ascidian hosts solitarily with greater frequency than expected by chan...

  7. A Microscopic Capacitor Model of Voltage Coupling in Membrane Proteins: Gating Charge Fluctuations in Ci-VSD.

    Science.gov (United States)

    Kim, Ilsoo; Warshel, Arieh

    2016-01-28

    The voltage sensitivity of membrane proteins is reflected in the response of the voltage sensing domains (VSDs) to the changes in membrane potential. This response is implicated in the displacement of positively charged residues, associated with the conformational changes of VSDs. The displaced charges generate nonlinear (i.e., voltage-dependent) capacitance current called the gating current (and its corresponding gating charge), which is a key experimental quantity that characterizes voltage activation in VSMP. However, the relevant theoretical/computational approaches, aimed to correlate the structural information on VSMP to electrophysiological measurements, have been rather limited, posing a broad challenge in computer simulations of VSMP. Concomitant with the development of our coarse-graining (CG) model of voltage coupling, we apply our theoretical framework for the treatments of voltage effects in membrane proteins to modeling the VSMP activation, taking the VSDs (Ci-VSD) derived from the Ciona intestinalis voltage sensitive phosphatase (Ci-VSP) as a model system. Our CG model reproduces the observed gating charge of Ci-VSD activation in several different perspectives. In particular, a new closed-form expression of the gating charge is evaluated in both nonequilibrium and equilibrium ways, while considering the fluctuation-dissipation relation that connects a nonequilibrium measurement of the gating charge to an equilibrium measurement of charge fluctuations (i.e., the voltage-independent linear component of membrane capacitance). In turn, the expression uncovers a novel link that connects an equilibrium measurement of the voltage-independent linear capacitance to a nonequilibrium measurement of the voltage-dependent nonlinear capacitance (whose integral over voltage is equal to the gating charge). In addition, our CG model yields capacitor-like voltage dependent free energy parabolas, resulting in the free energy difference and the free energy barrier for

  8. Isolamento e atividades biológicas de produtos naturais das esponjas monanchora arbuscula, aplysina sp. petromica ciocalyptoides e topsentia ophiraphidites, da ascídia didemnum ligulum e do octocoral carijoa riisei Isolantion and biological activities of secondary metabolites from the sponges monanchora aff. arbuscula, aplysina sp. petromica ciocalyptoides and topsentia ophiraphidies, from the ascidian didemnum ligulum and from the octocoral carijoa riisei

    OpenAIRE

    Miriam H. Kossuga; Simone P. de Lira; Andréa M. Nascimento; Gambardella, Maria Teresa P.; Berlinck, Roberto G. S.; Yohandra R. Torres; Gislene G. F. Nascimento; Eli F. Pimenta; Marcio Silva; Otávio H. Thiemann; Glaucius Oliva; André G. Tempone; Melhem, Márcia S.C.; Ana O. de Souza; Galetti, Fabio C. S.

    2007-01-01

    The investigation of extracts from six species of marine invertebrates yielded one new and several known natural products. Isoptilocaulin from the sponge Monanchora aff. arbuscula displayed antimicrobial activity at 1.3 mg/mL against an oxacillin-resistant strain of Staphylococcus aureus. Five inactive known dibromotyrosine derivatives, 2 6, were isolated from a new species of marine sponge, Aplysina sp. The sponges Petromica ciocalyptoides and Topsentia ophiraphidites yielded the known halis...

  9. A Case of Refractory Giardiasis Treated with Nitazoxsanide

    Directory of Open Access Journals (Sweden)

    Omer Coskun

    2012-06-01

    Full Text Available Giardia intestinalis is the cause of both epidemic and endemic diarrhea and upset of the gastrointestinal system. There are a number of drugs whose efficacies are well studied and that have been accepted for the treatment of patients with this infection. However, some individuals experience treatment failure, despite having received successive courses of treatment that have been documented to result in a cure for most patients. Nitazoxanide has been reported to be effective against a broad range of parasites, including G. intestinalis. In this case, we present a case of drug resistance G. intestinalis treated with nitazoxanide. [TAF Prev Med Bull 2012; 11(3.000: 369-372

  10. Strategy for simultaneous molecular detection of the protozoan parasites Toxoplasma, Cryptosporidium and Giardia in food matrices and persistence on leaves of vegetables during storage at 4°C

    Science.gov (United States)

    Toxoplasma gondii, Cryptosporidium spp. and Giardia intestinalis are emerging pathogen parasites in the food domain. However, without standardized method for their detection in food matrices, parasitic foodborne outbreaks remain neglected. In this study, a new immunomagnetic separation assay (IMS To...

  11. Parasites and Foodborne Illness

    Science.gov (United States)

    ... Web Content Viewer (JSR 286) Actions ${title} Loading... Parasites and Foodborne Illness Introduction Giardia duodenalis or intestinalis ... gondii Trichinella spiralis Taenia saginata/Taenia solium (Tapeworms) Parasites may be present in food or in water ...

  12. Giardia Infections

    Science.gov (United States)

    ... is an illness caused by a parasite called Giardia intestinalis. It lives in soil, food, and water. ... poop) through sexual contact. The risk of getting giardia is higher for travelers to countries where it ...

  13. Identification of microsporidia in stool specimens by using PCR and restriction endonucleases.

    OpenAIRE

    Fedorko, D. P.; Nelson, N.A.; Cartwright, C P

    1995-01-01

    We report the development of a PCR-based assay for the detection of microsporidia in clinical specimens. A single primer pair complementary to conserved sequences of the small-subunit rRNA enabled amplification of DNA from the four major microsporidian pathogens of humans: Encephalitozoon cuniculi, Encephalitozoon hellem, Enterocytozoon bieneusi, and Septata intestinalis. The extraction method allowed PCR amplification of E. bieneusi and S. intestinalis DNA from sodium hypochlorite-treated st...

  14. Evaluation of the BD Max Enteric Parasite Panel for Clinical Diagnostics.

    Science.gov (United States)

    Mölling, Paula; Nilsson, Peter; Ennefors, Theresa; Ögren, Jessica; Florén, Kerstin; Thulin Hedberg, Sara; Sundqvist, Martin

    2016-02-01

    We compared the performance of the BD Max enteric parasite panel to routine microscopy and an in-house PCR for the detection of Giardia intestinalis, Entamoeba histolytica, and Cryptosporidium spp. The enteric parasite panel showed good specificity for all targets and good sensitivity for E. histolytica and Cryptosporidium spp. Sensitivity for G. intestinalis with the BD Max enteric parasite panel was equivalent to that with microscopy. PMID:26582832

  15. Giardiasis in Leon, Nicaragua : Prevalence and protection

    OpenAIRE

    Téllez Sierra, Aleyda

    2006-01-01

    Giardia intestinalis is endemic in Nicaragua and affects children early in their lives. Infected individuals may be asymptomatic or suffer from acute or chronic diarrhea, malabsorption and weight loss. The prevalence of Giardia intestinalis infection in the population of León-Nicaragua was investigated. The presence of Giardia specific secretory antibodies was correlated with protection against disease. Parasite proteins as powerful immunogens were evaluated. By microsco...

  16. Multilocus genotyping of human Giardia isolates suggests limited zoonotic transmission and association between assemblage B and flatulence in children

    OpenAIRE

    Lebbad, M.; Petersson, I.; Karlsson, L.; Botero-Kleiven, S; Andersson, JO; Svenungsson, B; Svärd, SG

    2011-01-01

    BACKGROUND: Giardia intestinalis is one of the most common diarrhea-related parasites in humans, where infection ranges from asymptomatic to acute or chronic disease. G. intestinalis consists of eight genetically distinct genotypes or assemblages, designated A-H, and assemblages A and B can infect humans. Giardiasis has been classified as a possible zoonotic disease but the role of animals in human disease transmission still needs to be proven. We tried to link different assemblages and sub-a...

  17. Antioxidant system responses in two co-occurring green-tide algae under stress conditions

    Science.gov (United States)

    Wang, Ying; Zhao, Xinyu; Tang, Xuexi

    2016-01-01

    Green tides have occurred every year from 2007 to 2014 in the Yellow Sea. Ulva prolifera (Müller) J. Agardh has been identified as the bloom-forming alga, co-occurring with U. intestinalis. We observed distinct strategies for both algal species during green tides. U. prolifera exhibited a high abundance initially and then decreased dramatically, while U. intestinalis persisted throughout. The antioxidant system responses of these two macroalgae were compared in the late phase of a green tide (in-situ) and after laboratory acclimation. Lipid peroxidation and antioxidant system responses differed significantly between the two. Malondialdehyde and hydrogen peroxide contents increased significantly in-situ in U. prolifera, but not in U. intestinalis. In U. prolifera, we observed a significant decrease in total antioxidant ability (T-AOC), antioxidant enzymes (SOD and Apx), and non-enzyme antioxidants (GSH and AsA) in-situ. U. intestinalis showed the same pattern of T-AOC and SOD, but its Gpx, Apx, and GSH responses did not differ significantly. The results suggest that U. prolifera was more susceptible than U. intestinalis to the harsh environmental changes during the late phase of a Yellow Sea green tide. The boom and bust strategy exhibited by U. prolifera and the persistence of U. intestinalis can be explained by differences in enzyme activity and antioxidant systems.

  18. Isolation of C11 Cyclopentenones from Two Didemnid Species, Lissoclinum sp. and Diplosoma sp.

    Directory of Open Access Journals (Sweden)

    Katsuhiro Ueda

    2009-12-01

    Full Text Available A series of new C11 cyclopentenones 1-7 was isolated, together with four known metabolites 9/10, 12 and 13, from the extract of the didemnid ascidian Lissoclinum sp. The other didemnid ascidian Diplosoma sp. contained didemnenones 1, 2 and 5, and five known metabolites 8-12. The structures of 1-7 were elucidated by spectroscopic analyses. Cytotoxicity of the isolated compounds was evaluated against three human cancer cell lines (HCT116, A431 and A549.

  19. Dicty_cDB: Contig-U13126-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 63 1 ( BW518158 ) Ciona savignyi cDNA, clone:csga014m04, 5'end, sin... 50 0.063 1 ( AY689436 ) Deer...pox virus W-848-83, complete genome. 40 0.066 5 ( AY689437 ) Deerpox virus W-1170-84, comp

  20. Particle-capture mechanisms in suspension-feeding invertebrates

    DEFF Research Database (Denmark)

    Riisgård, Hans Ulrik; Larsen, Poul Scheel

    2010-01-01

    A large number of suspension-feeding animals (e.g. bivalves, polychaetes, ascidians, bryozoans, crustaceans, sponges, echinoderms, cnidarians) have specialized in grazing on not only the 2 to 200 µm phytoplankton but frequently also the 0.5 to 2 µm free-living bacteria in the aquatic environment,...

  1. How the sea squirt nucleus tells mesoderm Not to be endoderm

    OpenAIRE

    Parton, Richard M.; Davis, Ilan

    2010-01-01

    Sea squirts are simple invertebrate chordates. In this issue, Takatori et al show nuclear migration within ascidian mesendodermal cells enables polarized localization of Not mRNA, which encodes a homeobox protein that distinguishes mesoderm from endoderm fates. The link between nuclear migration and mRNA localization suggests exciting parallels with protostomes.

  2. The cyclopoid copepod Pseudomyicola spinosus (Raffaele & Monticelli) from marine pelecypods, chiefly in Bermuda and the West Indies

    NARCIS (Netherlands)

    Humes, Arthur G.

    1968-01-01

    The myicolid copepod Pseudomyicola spinosus is reported from 22 new hosts (pelecypods) in Bermuda and the West Indies, from 1 new host (a pelecypod) in Madagascar, and from an ascidian (Pyuridae) in Curaçao (probably an accidental association). P. spinosus is redescribed, based on specimens from Iso

  3. Proximate composition of marine invertebrates from tropical coastal waters, with emphasis on the relationship between nitrogen and protein contents

    OpenAIRE

    Graciela S Diniz; Elisabete Barbarino; João Oiano-Neto; Sidney Pacheco; Sergio O. Lourenço

    2014-01-01

    The chemical profiles of Desmapsamma anchorata, Hymeniacidon heliophila (Porifera), Bunodosoma caissarum, Renilla muelleri (Cnidaria), Aplysia brasiliana, Eledone massyae, Isognomon bicolor (Mollusca), Echinaster brasiliensis, Echinometra lucunter, Holothuria grisea, Lytechinus variegatus (Echinodermata), and Phallusia nigra (Chordata) were determined. Hydrosoluble protein was the most abundant class of substances for all species, except for the ascidian Phallusia nigra, in which the carbohyd...

  4. The mitochondrial genome of Phallusia mammillata and Phallusia fumigata (Tunicata, Ascidiacea: high genome plasticity at intra-genus level

    Directory of Open Access Journals (Sweden)

    Pesole Graziano

    2007-08-01

    Full Text Available Abstract Background Within Chordata, the subphyla Vertebrata and Cephalochordata (lancelets are characterized by a remarkable stability of the mitochondrial (mt genome, with constancy of gene content and almost invariant gene order, whereas the limited mitochondrial data on the subphylum Tunicata suggest frequent and extensive gene rearrangements, observed also within ascidians of the same genus. Results To confirm this evolutionary trend and to better understand the evolutionary dynamics of the mitochondrial genome in Tunicata Ascidiacea, we have sequenced and characterized the complete mt genome of two congeneric ascidian species, Phallusia mammillata and Phallusia fumigata (Phlebobranchiata, Ascidiidae. The two mtDNAs are surprisingly rearranged, both with respect to one another and relative to those of other tunicates and chordates, with gene rearrangements affecting both protein-coding and tRNA genes. The new data highlight the extraordinary variability of ascidian mt genome in base composition, tRNA secondary structure, tRNA gene content, and non-coding regions (number, size, sequence and location. Indeed, both Phallusia genomes lack the trnD gene, show loss/acquisition of DHU-arm in two tRNAs, and have a G+C content two-fold higher than other ascidians. Moreover, the mt genome of P. fumigata presents two identical copies of trnI, an extra tRNA gene with uncertain amino acid specificity, and four almost identical sequence regions. In addition, a truncated cytochrome b, lacking a C-terminal tail that commonly protrudes into the mt matrix, has been identified as a new mt feature probably shared by all tunicates. Conclusion The frequent occurrence of major gene order rearrangements in ascidians both at high taxonomic level and within the same genus makes this taxon an excellent model to study the mechanisms of gene rearrangement, and renders the mt genome an invaluable phylogenetic marker to investigate molecular biodiversity and speciation

  5. Calbindin-D in peripheral cells is vitamin D and calcium dependent

    International Nuclear Information System (INIS)

    The vitamin D-induced calcium-binding protein calbindin-D (CaBP) was localized immunohistochemically in some but not all of the cell bodies and axons within the intestinalis nerve of the chicken. Unlike other nerve tissue thus far examined, the CaBP content of the intestinalis nerve was decreased in vitamin D deficiency and increased in chicken adapted to a calcium-deficient diet. These changes are qualitatively similar to the pattern of response of enterocytes. The inclusion of calcium-containing solutions within the duodenal lumen caused, directly or indirectly, a decrease in the amount of CaBP in this nerve in a dose-dependent manner. The exact role of CaBP in intestinalis nerve cells is unknown but may be in the regulation of intracellular ionic Ca2+ concentrations during excitation, although other functions of CaBP cannot be excluded. CaBP was measured by radioimmunoassay

  6. ПЕРЕКИСНОЕ ОКИСЛЕНИЕ ЛИПИДОВ В ПАРАЗИТО-ХОЗЯИННОЙ СИСТЕМЕ НА ПРИМЕРЕ LIGULA INTESTINALIS (CESTODA, PSEUDOPHYLLIDEA) ABRAMIS BRAMA (L.)

    OpenAIRE

    Силкина, Н.; Микряков, Д.; Карасев, Ф.

    2007-01-01

    Анализ полученных результатов свидетельствует, что с ростом гельминта в его организме происходит изменение зоны равновесия окислительного гомеостаза. У длинноразмерных паразитов, по сравнению с более короткими, отмечается достоверное изменение исследованных показателей. Благодаря высокой перекисеобразовательной способности паразита, а также его эффективной антиокислительной защите обеспечиваются благоприятные условия для питания, роста и развития лигулид в организме хозяина....

  7. Dicty_cDB: Contig-U11836-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ) CHORI51418E04TR BAC library from the primary brea... 36 2.1 2 ( AM850132 ) Chelonus inanitus bracovirus se...NA Library ... 48 0.70 1 ( AL499603 ) Human DNA sequence *** SEQUENCING CANCELLED *** f... 44 1.0 7 ( BW448452 ) Ciona intestina...ino Acid sequence (All Frames) Frame A: qiktmvlikmkn*snlveflenhqfimiyirlhfyhqiyfkxvklywyqdqevvslmqks mkhqiqifvimiqqfiim...60 Query: 361 cattaacccctccaaatgagagcttttcaatcattggtcaaaaagcatcggtaaganatt 420 |||||||||||||||||||||||||||||...||||||||||||||||||||||||||||||| Sbjct: 361 cattaacccctccaaatgagagcttttcaatcattggtcaaaaagcatcggtaagana

  8. Dicty_cDB: Contig-U09330-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ylem planings - daytime a... 60 1e-04 1 ( EX331539 ) GQ02903.B7_A06 GQ029 - Xylem scrapings - AT NITE ... 60... 1e-04 1 ( EX323057 ) GQ02819.SP6_M07 GQ028 - Cambium / phloem scrappin... 60 1e-04 1 ( EX322713 ) GQ02819.B...7_M07 GQ028 - Cambium / phloem scrapping... 60 1e-04 1 ( AV999726 ) Ciona intesti

  9. T-type Calcium Channel Regulation of Neural Tube Closure and EphrinA/EPHA Expression

    Directory of Open Access Journals (Sweden)

    Sarah Abdul-Wajid

    2015-10-01

    Full Text Available A major class of human birth defects arise from aberrations during neural tube closure (NTC. We report on a NTC signaling pathway requiring T-type calcium channels (TTCCs that is conserved between primitive chordates (Ciona and Xenopus. With loss of TTCCs, there is a failure to seal the anterior neural folds. Accompanying loss of TTCCs is an upregulation of EphrinA effectors. Ephrin signaling is known to be important in NTC, and ephrins can affect both cell adhesion and repulsion. In Ciona, ephrinA-d expression is downregulated at the end of neurulation, whereas, with loss of TTCC, ephrinA-d remains elevated. Accordingly, overexpression of ephrinA-d phenocopied TTCC loss of function, while overexpression of a dominant-negative Ephrin receptor was able to rescue NTC in a Ciona TTCC mutant. We hypothesize that signaling through TTCCs is necessary for proper anterior NTC through downregulation of ephrins, and possibly elimination of a repulsive signal.

  10. Structure and function of vanadium compounds in living organisms.

    Science.gov (United States)

    Rehder, D

    1992-01-01

    Vanadium has been recognized as a metal of biological importance only recently. In this mini-review, its main functions uncovered during the past few years are addressed. These encompass (i) the regulation of phosphate metabolizing enzymes (which is exemplified for the inhibition of ribonucleases by vanadate), (ii) the halogenation of organic compounds by vanadate-dependent non-heme peroxidases from seaweeds, (iii) the reductive protonation of nitrogen (nitrogen fixation) by alternative, i.e. vanadium-containing, nitrogenases from N2-fixing bacteria, (iv) vanadium sequestering by sea squirts (ascidians), and (v) amavadine, a low molecular weight complex of V(IV) accumulated in the fly agaric and related toadstools. The function of vanadium, while still illusive in ascidians and toadstools, begins to be understood in vanadium-enzyme interaction. Investigations into the structure and function of model compounds play an increasingly important role in elucidating the biological significance of vanadium. PMID:1392470

  11. Effects of simulated eutrophication and overfishing on algae and invertebrate settlement in a coral reef of Koh Phangan, Gulf of Thailand.

    Science.gov (United States)

    Stuhldreier, Ines; Bastian, Pepe; Schönig, Eike; Wild, Christian

    2015-03-15

    Coral reefs in the Gulf of Thailand are highly under-investigated regarding responses to anthropogenic stressors. Thus, this study simulated overfishing and eutrophication using herbivore exclosure cages and slow-release fertilizer to study the in-situ effects on benthic algae and invertebrate settlement in a coral reef of Koh Phangan, Thailand. Settlement of organisms and the development of organic matter on light-exposed and shaded tiles were quantified weekly/biweekly over a study period of 12 weeks. Simulated eutrophication did not significantly influence response parameters, while simulated overfishing positively affected dry mass, turf algae height and fleshy macroalgae occurrence on light-exposed tiles. On shaded tiles, settlement of crustose coralline algae decreased, while abundances of ascidians increased compared to controls. An interactive effect of both stressors was not observed. These results hint to herbivory as actual key controlling factor on the benthic community, and fleshy macroalgae together with ascidians as potential bioindicators for local overfishing. PMID:25649838

  12. Cyanobacterial Diversity and a New Acaryochloris-Like Symbiont from Bahamian Sea-Squirts

    OpenAIRE

    Susanna López-Legentil; Bongkeun Song; Manel Bosch; Joseph R Pawlik; Xavier Turon

    2011-01-01

    Symbiotic interactions between ascidians (sea-squirts) and microbes are poorly understood. Here we characterized the cyanobacteria in the tissues of 8 distinct didemnid taxa from shallow-water marine habitats in the Bahamas Islands by sequencing a fragment of the cyanobacterial 16S rRNA gene and the entire 16S-23S rRNA internal transcribed spacer region (ITS) and by examining symbiont morphology with transmission electron (TEM) and confocal microscopy (CM). As described previously for other s...

  13. Diversity of Nonribosomal Peptide Synthetase Genes in the Microbial Metagenomes of Marine Sponges

    OpenAIRE

    Ute Hentschel; Sheila Marie Pimentel-Elardo; Sebastian Proksch; Lubomir Grozdanov

    2012-01-01

    Genomic mining revealed one major nonribosomal peptide synthetase (NRPS) phylogenetic cluster in 12 marine sponge species, one ascidian, an actinobacterial isolate and seawater. Phylogenetic analysis predicts its taxonomic affiliation to the actinomycetes and hydroxy-phenyl-glycine as a likely substrate. Additionally, a phylogenetically distinct NRPS gene cluster was discovered in the microbial metagenome of the sponge Aplysina aerophoba, which shows ...

  14. Investigation of the potential anticancer and antifungal active secondary metabolites from marine natural products

    OpenAIRE

    Boonlarppradab, Chollaratt

    2007-01-01

    The oceans are a unique resource that has contributed greatly to the field of natural products chemistry. Secondary metabolites from natural sources still play an important role in drug discovery and development by providing pharmaceutical candidates with novel structures that are valuable for synthetic modification. Of the marine organisms described to date, the vast majority of marine natural products derive from invertebrates such as sponges, ascidians, bryozoans, and tunicates. Recently, ...

  15. Antimicrobial natural products from Arctic and sub-Arcticmarine invertebrates

    OpenAIRE

    Tadesse, Margey

    2010-01-01

    Infectious diseases are a leading cause of death world-wide and there is a growing need for new anti-infective agents to combat multi-resistant strains of bacteria and fungi. Marine natural products are promising sources of novel antimicrobial compounds. In the present thesis, an investigation into the antimicrobial metabolites of Arctic and sub-Arctic marine invertebrate species is presented. Extracts of seven ascidian species, six sponge species, a soft-alcyonid coral and a bryozoan species...

  16. Antibiotic, cytotoxic and enzyme inhibitory activity of crude extracts from Brazilian marine invertebrates Atividade antibiótica, citotóxica e de inibição enzimática de extratos brutos de invertebrados marinhos do Brasil

    OpenAIRE

    Mirna H.R. Seleghim; Simone P. Lira; Miriam H. Kossuga; Tatiana Batista; Roberto G. S. Berlinck; Eduardo Hajdu; Guilherme Muricy; Rosana M. da Rocha; Gislene G. F. do Nascimento; Marcio Silva; Eli F. Pimenta; Thiemann, Otávio H.; Glaucius Oliva; Bruno C. Cavalcanti; Claudia Pessoa

    2007-01-01

    Herein we present the results of a screening with 349 crude extracts of Brazilian marine sponges, ascidians, bryozoans and octocorals, against 16 strains of susceptible and antibiotic-resistant bacteria, one yeast (Candida albicans), Mycobacterium tuberculosis H37Rv, three cancer cell lines MCF-7 (breast), B16 (murine melanoma ) and HCT8 (colon), and Leishmania tarentolae adenine phosphoribosyl transferase (L-APRT) enzyme. Less than 15% of marine sponge crude extracts displayed antibacterial ...

  17. Cryptic speciation or global spread? The case of a cosmopolitan marine invertebrate with limited dispersal capabilities

    OpenAIRE

    Pérez-Portela, R.; Arranz, V.; Rius, Marc; Turon, Xavier

    2013-01-01

    The existence of globally-distributed species with low dispersal capabilities is a paradox that has been explained as a result of human-mediated transport and by hidden diversity in the form of unrecognized cryptic species. Both factors are not mutually exclusive, but relatively few studies have demonstrated the presence of both. Here we analyse the genetic patterns of the colonial ascidian Diplosoma listerianum, a species nowadays distributed globally. The study of a fragment of ...

  18. Ecología química en el bentos marino de la Antártida: productos naturales y defensa química en esponjas hexactinélidas, corales blandos y ascidias coloniales

    OpenAIRE

    Núñez Pons, Laura

    2012-01-01

    The inhabitants of marine benthos must combat the ecological pressure caused by predation, competition and fouling through a series of mechanisms, one of which is chemical defense. This type of protection is particularly extended among sessile and/or sluggish organisms, such as sponges, soft corals or ascidians. The strategies to prevent predation are related to bad taste rather than to toxicity. Moreover, they must be considered along with nutritional quality, since the more nutritious the p...

  19. Tunicates: exploring the sea shores and roaming the open ocean. A tribute to Thomas Huxley

    OpenAIRE

    Lemaire, Patrick; Piette, Jacques

    2015-01-01

    This review is a tribute to the remarkable contributions of Thomas Huxley to the biology of tunicates, the likely sister group of vertebrates. In 1851, the great biologist and philosopher published two landmark papers on pelagic tunicates in the Philosophical Transactions of the Royal Society. They were dedicated to the description of the adult anatomy and life cycle of thaliaceans and appendicularians, the pelagic relatives of ascidians. In the first part of this review, we discuss the novel...

  20. Wnt affects symmetry and morphogenesis during post-embryonic development in colonial chordates

    OpenAIRE

    Di Maio, Alessandro; Setar, Leah; Tiozzo, Stefano; De Tomaso, Anthony W

    2015-01-01

    Background Wnt signaling is one of the earliest and most highly conserved regulatory pathways for the establishment of the body axes during regeneration and early development. In regeneration, body axes determination occurs independently of tissue rearrangement and early developmental cues. Modulation of the Wnt signaling in either process has shown to result in unusual body axis phenotypes. Botryllus schlosseri is a colonial ascidian that can regenerate its entire body through asexual buddin...

  1. Prospective protochordate homologs of vertebrate midbrain and MHB, with some thoughts on MHB origins

    Directory of Open Access Journals (Sweden)

    Thurston C. Lacalli

    2006-01-01

    Full Text Available The MHB (midbrain-hindbrain boundary is a key organizing center in the vertebrate brain characterized by highly conserved patterns of gene expression. The evidence for an MHB homolog in protochordates is equivocal, the "neck" region immediately caudal to the sensory vesicle in ascidian larvae being the best accepted candidate. It is argued here that similarities in expression patterns between the MHB and the ascidian neck region are more likely due to the latter being the principal source of neurons in the adult brain, and hence where all the genes involved in patterning the latter will necessarily be expressed. The contrast with amphioxus is exemplified by pax2/5/8, expressed in the neck region in ascidian larvae, but more caudally, along much of the nerve cord in amphioxus. The zone of expression in each case corresponds with that part of the nerve cord ultimately responsible for innervating the adult body, which suggests the spatially restricted MHB-like expression pattern in ascidians is secondarily reduced from a condition more like that in amphioxus. Patterns resembling those of the vertebrate MHB are nevertheless found elsewhere among metazoans. This suggests that, irrespective of its modern function, the MHB marks the site of an organizing center of considerable antiquity. Any explanation for how such a center became incorporated into the chordate brain must take account of the dorsoventral inversion chordates have experienced relative to other metazoans. Especially relevant here is a concept developed by Claus Nielsen, in which the brain is derived from a neural center located behind the ancestral mouth. While this is somewhat counterintuitive, it accords well with emerging molecular data.

  2. New genes in the evolution of the neural crest differentiation program

    OpenAIRE

    Martínez-Morales, Juan Ramón; Henrich, Thorsten; Ramialison, Mirana; Wittbrodt, Joachim

    2007-01-01

    BACKGROUND: Development of the vertebrate head depends on the multipotency and migratory behavior of neural crest derivatives. This cell population is considered a vertebrate innovation and, accordingly, chordate ancestors lacked neural crest counterparts. The identification of neural crest specification genes expressed in the neural plate of basal chordates, in addition to the discovery of pigmented migratory cells in ascidians, has challenged this hypothesis. These new findings revive th...

  3. Taxonomy, phylogeny, historical biogeography, and historical ecology of the genus Pontonia (Crustacea: Decapoda: Caridea: Palaemonidae)

    OpenAIRE

    Fransen, C.H.J.M.

    2002-01-01

    Species of the genus Pontonia Latreille, 1829, are distributed in tropical and subtropical waters around the world, living in association with either molluscan or ascidian hosts. In the present taxonomic revision, Pontonia sensu lato is divided into six genera: Pontonia sensu stricto; Ascidonia gen. nov., Rostronia gen. nov., Dactylonia gen. nov., Odontonia gen. nov., and Bruceonia gen. nov. A total of 29 species is described and figured, four of which are new to science: Pontonia pilosa spec...

  4. Phallusiasterol C, A New Disulfated Steroid from the Mediterranean Tunicate Phallusia fumigata

    Directory of Open Access Journals (Sweden)

    Concetta Imperatore

    2016-06-01

    Full Text Available A new sulfated sterol, phallusiasterol C (1, has been isolated from the Mediterranean ascidian Phallusia fumigata and its structure has been determined on the basis of extensive spectroscopic (mainly 2D NMR analysis. The possible role in regulating the pregnane X receptor (PXR activity of phallusiasterol C has been investigated; although the new sterol resulted inactive, this study adds more items to the knowledge of the structure-PXR regulating activity relationships in the case of sulfated steroids.

  5. Polycheria josephensis, a new species of symbiotic amphipod (Crustacea, Amphipoda, Dexaminidae) from the Northern Gulf of Mexico, with notes on its ecology

    OpenAIRE

    Foster, John; Thoma, Brent

    2016-01-01

    Polycheria josephensis sp. n. (Dexaminidae), an ascidian symbiont, is described from St. Joseph Bay, Florida and other locations in the Gulf of Mexico and the nearshore Atlantic Ocean from South Carolina to northern Florida. Observations on its ecology, behavior, and distribution are provided. Polycheria josephensis sp. n. is morphologically most similar to Polycheria osborni Calman, 1898 from the Pacific coast of North America. Polycheria josephensis sp. n. differs from P. osborni in the num...

  6. Cross-phylum functional equivalence of Otx genes and the origin of brain patterning

    OpenAIRE

    Adachi, Yoshitsugu

    2004-01-01

    Molecular mechanisms of cephalic development is an intriguing question in evolutionary and developmental biology. Otx gene plays important roles in animal brain and head development and Otx genes are found in all major animal groups: cnidarians, lophotrochozoans, ecdysozoans, anddeuterostomes. Ascidians, positioned near the origin of the phylum Chordata, share a conserved set of anteroposterior patterning genes withthat of vertebrates. Here I report the cross-phylum regulatory potential of th...

  7. In vivo antithrombotic properties of a heparin from the oocyte test cells of the sea squirt Styela plicata(Chordata-Tunicata)

    OpenAIRE

    L. Cardilo-Reis; M.C.M. Cavalcante; C.B.M. Silveira; M.S.G. Pavão

    2006-01-01

    In the ascidian Styela plicata, the oocytes are surrounded by two types of accessory cells named follicle cells and test cells. A heparin-like substance with an anticoagulant activity equivalent to 10% of mammalian heparin and about 5% as potent as the mammalian counterpart for the inhibition of thrombin by antithrombin was isolated from the oocyte test cells. In the present study, we compared the antithrombotic and hemorrhagic effects of sea squirt oocyte test cell heparin with those of porc...

  8. Water-borne sperm trigger vitellogenic egg growth in two sessile marine invertebrates.

    OpenAIRE

    Bishop, J D; Manríquez, P H; Hughes, R. N.

    2000-01-01

    A diverse array of sessile marine invertebrates mate by passive dispersal of sperm which fertilize the brooded eggs of neighbours. In two such species, a sea-mat (phylum Bryozoa) and an ascidian (phylum Chordata), vitellogenic egg growth is absent in reproductively isolated specimens, but is triggered by a water-borne factor released by conspecifics. In both of these colonial, hermaphroditic species, the active factor can be removed from water by filtration. The effect involves self-/non-self...

  9. Dicty_cDB: CHN839 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available intestinalis sphingomyelin p... 110 9e-23 X59960_1( X59960 |pid:none) H.sapiens mRNA for sphingomyelinase...ne) Homo sapiens cDNA FLJ77600 complet... 110 1e-22 M81780_2( M81780 |pid:none) Homo sapiens acid sphingomyelinase

  10. An unusual case of nonocclusive mesenteric ischemia in a young girl

    OpenAIRE

    Tanmoy Ghatak; Ratender K Singh; Baronia, Arvind K

    2012-01-01

    Nonocclusive mesenteric ischemia is a type of acute mesenteric ischemia with high mortality seen mostly in elderly cardiac patients. We present a 21-year-old healthy student with nonocclusive mesenteric ischemia along with radiological evidence of hepatic portal venous gas and pneumatosis intestinalis, with subsequent fatality. Its significance and its possible etiology are discussed.

  11. Quantitative Assessment of Contamination of Fresh Food Produce of Various Retail Types by Human-Virulent Microsporidian Spores▿

    OpenAIRE

    Jedrzejewski, Szymon; Graczyk, Thaddeus K.; Slodkowicz-Kowalska, Anna; Tamang, Leena; Majewska, Anna C.

    2007-01-01

    This study demonstrated that fresh food produce, such as berries, sprouts, and green-leafed vegetables, sold at the retail level can contain potentially viable microsporidian spores of human-virulent species, such as Enterocytozoon bieneusi, Encephalitozoon intestinalis, and Encephalitozoon cuniculi, at quantities representing a threat of food-borne infection.

  12. Disease: H01336 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available smallest known nuclear genome from the microsporidian Encephalitozoon intestinalis. Nat Commun 1:77 (2010) ... ...H01336 Encephalitozoon infection The genus Encephalitozoon are spore-forming obligate intracellular microspo...ridian parasites that infect a wide range of organisms, including protists, inverte

  13. Prevalence, incidence, and risk factors of intestinal parasites in Danish primary care patients with irritable bowel syndrome

    DEFF Research Database (Denmark)

    Engsbro, Anne Line; Stensvold, Christen Rune; Nielsen, Henrik Vedel;

    2014-01-01

    and 78/116 patients returning 1 y later, submitted faecal samples that were examined by microscopy, culture for Blastocystis, and real-time PCR for Dientamoeba fragilis, Entamoeba (dispar and histolytica), Cryptosporidium spp., and Giardia intestinalis. Overall, 42-45% of patients harboured intestinal...

  14. Genotyping of Giardia in Dutch patients and animals: a phylogenetic analysis of human and animal isolates.

    NARCIS (Netherlands)

    Giessen, J W B van der; Vries, A de; Roos, M; Wielinga, Peter; Kortbeek, L M; Mank, T G

    2006-01-01

    Giardia duodenalis (syn. Giardia lamblia, Giardia intestinalis) is a protozoan organism that can infect the intestinal tract of many animal species including mammals. Genetic heterogeneity of G. duodenalis is well described but the zoonotic potential is still not clear. In this study, we analysed 10

  15. Regulation of carbohydrate metabolism during Giardia encystment

    NARCIS (Netherlands)

    Vliegenthart, J.F.G.; Jarroll, E.L.; Macechko, P.T.; Steimle, P.A.; Bulik, D.; Karr, C.D.; Keulen, Harry van; Paget, P.A.

    2001-01-01

    Giardia intestinalis trophozoites encyst when they are exposed to bile. During encystment, events related to the inducible synthesis of a novel N-acetyl-d-galactosamine (GalNAc) homopolymer, occur. Within the first 6 h of encystment, mRNA for glucosamine 6-P isomerase (GPI), the first inducible enzy

  16. Cryptosporidium and Giardia: new challenges to the water industry

    NARCIS (Netherlands)

    Medema, Gerriet Jan

    2001-01-01

    The protozoan parasites Cryptosporidium parvum and Giardia intestinalis have emerged as significant waterborne pathogens over the past decades. Many outbreaks of waterborne cryptosporidiosis and giardiasis have been recorded,primarily in the United States and the United Kingdom.Chapter 1 gives an ov

  17. Assessment of the levels of nitric oxide (NO and cytokines (IL-5, IL-6, IL-13, TNF, IFN-gamma in giardiosis

    Directory of Open Access Journals (Sweden)

    Halina Kemona

    2011-07-01

    Full Text Available The current study aims to determine the involvement of cellular responses in combating Giardia intestinalis invasion. The study group consisted of 44 women and 18 men, aged 18–72 years, infected with G. intestinalis. The diagnosis was established based on laboratory investigations (examination of stool, choloscopy, GSA-65. Blood for analysis was collected before antiparasitic treatment and two weeks after treatment termination. The control group consisted of 22 women and 18 men aged 20–45 years. The serum concentrations of IL-5, IL-6, IL-13, TNF, IFN-γ were assayed using a set of Quantikine human. The concentrations of NO in the serum were determined using a set of Total Nitric Oxide Assay. Patients infected with G. intestinalis showed a statistically significant increase in the levels of NO, IFN-g and IL-13. Even the antiparasitic treatment applied did not reduce the levels of these parameters and only caused a rise in IL-6. Our study showed a lack of acute inflammatory state in the course of G. intestinalis infection. (Folia Histochemica et Cytobiologica 2011; Vol. 49, No. 2, pp. 280–284

  18. Dicty_cDB: Contig-U15756-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 02.B7_I13 GQ029 - Xylem scrapings - AT NITE ... 50 4e-08 3 ( FL709002 ) CCGA12403.b1 CCGA Panicum virgatum a...iona intestinalis cDNA, clone:rcibd026n10, 3' en... 54 3e-08 2 ( EX331040 ) GQ029

  19. Unigene BLAST: CBRC-CINT-01-0070 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CI NT-01-0070 gnl|UG|Ci n#S25792327 Ci ona intestinalis Ci -PUR-alpha/beta/gamma mRNA, complete ... cds, clone: ci dg851p03 /cds=p(73,993) /gb=AB210658 /gi=70571015 / ... ug=Ci n.5070 /len=1907 1.8 30% ...

  20. Unigene BLAST: CBRC-CINT-01-0224 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CI NT-01-0224 gnl|UG|Ci n#S34879952 Ci ona intestinalis transcription factor (ci -htf-1), mRNA ... cds=p(140,4756) /gb=NM_001047991 /gi=114145436 /ug=Ci n.19374 /len=5017 9.0 52% ...

  1. Unigene BLAST: CBRC-CINT-01-0025 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CI NT-01-0025 gnl|UG|Ci n#S25792271 Ci ona intestinalis Ci -SWI/SNF mRNA, complete cds, clone: ... 7k16 /cds=p(25,3036) /gb=AB210714 /gi=70571305 /ug=Ci n.19382 /len=3541 2.2 31% ...

  2. Unigene BLAST: CBRC-CINT-01-0118 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CI NT-01-0118 gnl|UG|Ci n#S25792666 Ci ona intestinalis Ci -BarH mRNA for transcription factor ... al cds /cds=p(1,450) /gb=AB210319 /gi=70568956 /ug=Ci n.18152 /len=599 0.12 34% ...

  3. Unigene BLAST: CBRC-CINT-01-0046 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CI NT-01-0046 gnl|UG|Ci n#S25792491 Ci ona intestinalis Ci -Hox2 mRNA for transcription factor ... al cds /cds=p(1,344) /gb=AB210494 /gi=70569901 /ug=Ci n.18207 /len=344 1.4 41% ...

  4. Unigene BLAST: CBRC-CINT-01-0223 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CI NT-01-0223 gnl|UG|Ci n#S34879952 Ci ona intestinalis transcription factor (ci -htf-1), mRNA ... cds=p(140,4756) /gb=NM_001047991 /gi=114145436 /ug=Ci n.19374 /len=5017 2.0 33% ...

  5. Unigene BLAST: CBRC-CINT-01-0103 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CI NT-01-0103 gnl|UG|Ci n#S25792518 Ci ona intestinalis Ci -GATA-b mRNA for transcription facto ... l cds /cds=p(1,1664) /gb=AB210467 /gi=70569759 /ug=Ci n.9192 /len=1859 1.4 29% ...

  6. Unigene BLAST: CBRC-CINT-01-0239 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CI NT-01-0239 gnl|UG|Ci n#S14562339 Ci ona intestinalis Ci -IQGAP mRNA for IQ motif containing ... cds /cds=p(82,1731) /gb=AB076897 /gi=28556882 /ug=Ci n.19508 /len=2752 6.0 25% ...

  7. Unigene BLAST: CBRC-CINT-01-0198 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CI NT-01-0198 gnl|UG|Ci n#S14562339 Ci ona intestinalis Ci -IQGAP mRNA for IQ motif containing ... cds /cds=p(82,1731) /gb=AB076897 /gi=28556882 /ug=Ci n.19508 /len=2752 6.4 22% ...

  8. Unigene BLAST: CBRC-CINT-01-0158 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CI NT-01-0158 gnl|UG|Ci n#S37590127 Ci ona intestinalis Ci -TGFbeta-NA3 mRNA for transforming g ... 2 /cds=p(1341,2327) /gb=AB299371 /gi=134254372 /ug=Ci n.16040 /len=2463 0.49 37% ...

  9. Unigene BLAST: CBRC-CINT-01-0094 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CI NT-01-0094 gnl|UG|Ci n#S25792271 Ci ona intestinalis Ci -SWI/SNF mRNA, complete cds, clone: ... 7k16 /cds=p(25,3036) /gb=AB210714 /gi=70571305 /ug=Ci n.19382 /len=3541 1.4 32% ...

  10. Unigene BLAST: CBRC-CINT-01-0212 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CI NT-01-0212 gnl|UG|Ci n#S25792664 Ci ona intestinalis Ci -BarX-B mRNA for transcription facto ... l cds /cds=p(17,849) /gb=AB210321 /gi=70568967 /ug=Ci n.18154 /len=849 0.22 36% ...

  11. Unigene BLAST: CBRC-CINT-01-0078 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CI NT-01-0078 gnl|UG|Ci n#S37590127 Ci ona intestinalis Ci -TGFbeta-NA3 mRNA for transforming g ... 2 /cds=p(1341,2327) /gb=AB299371 /gi=134254372 /ug=Ci n.16040 /len=2463 2e-05 37% ...

  12. Unigene BLAST: CBRC-CINT-01-0024 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CI NT-01-0024 gnl|UG|Ci n#S25792271 Ci ona intestinalis Ci -SWI/SNF mRNA, complete cds, clone: ... 7k16 /cds=p(25,3036) /gb=AB210714 /gi=70571305 /ug=Ci n.19382 /len=3541 2.2 31% ...

  13. Unigene BLAST: CBRC-CINT-01-0031 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CI NT-01-0031 gnl|UG|Ci n#S34879952 Ci ona intestinalis transcription factor (ci -htf-1), mRNA ... cds=p(140,4756) /gb=NM_001047991 /gi=114145436 /ug=Ci n.19374 /len=5017 3.5 34% ...

  14. Unigene BLAST: CBRC-CINT-01-0249 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CI NT-01-0249 gnl|UG|Ci n#S14562339 Ci ona intestinalis Ci -IQGAP mRNA for IQ motif containing ... cds /cds=p(82,1731) /gb=AB076897 /gi=28556882 /ug=Ci n.19508 /len=2752 4.8 28% ...

  15. Unigene BLAST: CBRC-CINT-01-0005 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CI NT-01-0005 gnl|UG|Ci n#S25792518 Ci ona intestinalis Ci -GATA-b mRNA for transcription facto ... l cds /cds=p(1,1664) /gb=AB210467 /gi=70569759 /ug=Ci n.9192 /len=1859 9.1 22% ...

  16. Gastric pneumatosis associated with duodenal stenosis and malrotation

    Energy Technology Data Exchange (ETDEWEB)

    Kawano, Shoji [Dept. of Paediatrics, Kawasaki Medical School, Okayama (Japan); Dept. of Paediatrics, Shimonoseki Municipal Hospital, Yamaguchi (Japan); Tanaka, Hiroyuki; Daimon, Yusuke; Niizuma, Takahiro; Terada, Kihei; Kataoka, Naoki [Dept. of Paediatrics, Kawasaki Medical School, Okayama (Japan); Iwamura, Yoshinobu; Aoyama, Kohji [Department of Paediatric Surgery, Kawasaki Medical School, Okayama (Japan)

    2001-09-01

    Pneumatosis intestinalis, which is linear or cystic gas within the bowel wall, is usually found in premature babies in association with necrotizing enterocolitis. Gastric pneumatosis defined as intramural gas of the stomach is a rare sign during infancy. We report an infant with Down's syndrome and a duodenal web with obvious gastric pneumatosis. (orig.)

  17. Territoriality and Conflict Avoidance Explain Asociality (Solitariness) of the Endosymbiotic Pea Crab Tunicotheres moseri.

    Science.gov (United States)

    Ambrosio, Louis J; Baeza, J Antonio

    2016-01-01

    Host monopolization theory predicts symbiotic organisms inhabiting morphologically simple, relatively small and scarce hosts to live solitarily as a result of territorial behaviors. We tested this prediction with Tunicotheres moseri, an endosymbiotic crab dwelling in the atrial chamber of the morphologically simple, small, and relatively scarce ascidian Styela plicata. As predicted, natural populations of T. moseri inhabit ascidian hosts solitarily with greater frequency than expected by chance alone. Furthermore, laboratory experiments demonstrated that intruder crabs take significantly longer to colonize previously infected compared to uninfected hosts, indicating as expected, that resident crabs exhibit monopolization behaviors. While territoriality does occur, agonistic behaviors employed by T. moseri do not mirror the overt behaviors commonly reported for other territorial crustaceans. Documented double and triple cohabitations in the field coupled with laboratory observations demonstrating the almost invariable success of intruder crabs colonizing occupied hosts, suggest that territoriality is ineffective in completely explaining the solitary social habit of this species. Additional experiments showed that T. moseri juveniles and adults, when searching for ascidians use chemical cues to avoid hosts occupied by conspecifics. This conspecific avoidance behavior reported herein is a novel strategy most likely employed to preemptively resolve costly territorial conflicts. In general, this study supports predictions central to host monopolization theory, but also implies that alternative behavioral strategies (i.e., conflict avoidance) may be more important than originally thought in explaining the host use pattern of symbiotic organisms. PMID:26910474

  18. The hemocytes of Polyandrocarpa mysakiensis: morphology and immune-related activities

    Directory of Open Access Journals (Sweden)

    L Ballarin

    2009-11-01

    Full Text Available A preliminary study of the hemocytes of developing buds of the compound ascidian Polyandrocarpa misakiensis was carried out at the light microscope level for a better understanding of their biological role. Similarly to other ascidians, P. misakiensis immunocytes are represented by phagocytes and morula cells. Phagocytes include hyaline amoebocytes and round, giant phagocytes, the former the probable precursors of the latter. Hyaline amoebocytes showed high macropinocytotic activity in the presence of bacteria, whereas yeast cells were ingested by phagocytosis. Morula cells contain the enzyme phenoloxidase inside their vacuoles, probably stored as pro-enzyme, which is released upon the recognition of non-self. Together with macrogranular leukocytes, morula cells were the most abundant hemocyte-types which stresses the importance of these cells in Polyandrocarpa biology. Macrogranular leukocytes are frequently found inside the vacuoles of phagocytes and were recognized by a polyclonal antibody raised against an opsonin purified from the colonial ascidian Botryllus schlosseri, which suggests that a similar lectin can be involved in the interaction between these cells and phagocytes.

  19. Comparative biochemistry of Giardia, Hexamita and Spironucleus: Enigmatic diplomonads.

    Science.gov (United States)

    Lloyd, David; Williams, Catrin F

    2014-10-01

    The diplomonad genera are here represented by three highly diverse species, both free-living (Hexamita inflata), and parasitic (Spironucleus vortens and Giardia intestinalis). All three are moderately aerotolerant flagellates, inhabiting environments where O2 tensions are low and fluctuating. Many diplomonads are opportunistic pathogens of avian, terrestrial and aquatic animals. Hexamitids inhabit deep waters and sediments of lakes and marine basins, S. vortens commonly infects the intestinal tract of ornamental fish, particularly of cichlids and cyprinids, and G. intestinalis, the upper intestinal tracts of humans as well as domestic and farm animals. Despite these very different habitats, their known physiological and biochemical characteristics are similar, but they do differ in significant respects as their lifestyles and life cycles demand. They have efficient O2 scavenging systems, and are highly effective at countering rapid O2 fluctuations, or clustering away from its source (except for G. intestinalis when attached to the jejunal villi). Their core metabolic pathways (glycolysis using pyrophosphate), incomplete tricarboxylic acid cycle (lacking α-ketoglutarate dehydrogenase), and amino acid metabolism (with an alternative energy-generating arginine dihydrolase pathway as a possibility in some cases), largely conform to those of other protists inhabiting low-O2 environments. Mitochondrial evolutionary reduction to give hydrogenosomes as seen in Spironucleus spp. has proceeded further to its minimal state in the mitosomes of G. intestinalis. Understanding of essential redox reactions and the maintentence of redox state, especially in the infective encysted stage of G. intestinalis provide increasing possibilities for parasite control. To this aim a plethora of new synthetic chemicals and natural products (especially those from garlic, Allium sativum) show promise as replacements for the highly effective (but potentially toxic to higher organisms) 5

  20. Origin and evolution of retinoid isomerization machinery in vertebrate visual cycle: hint from jawless vertebrates.

    Directory of Open Access Journals (Sweden)

    Eugenia Poliakov

    Full Text Available In order to maintain visual sensitivity at all light levels, the vertebrate eye possesses a mechanism to regenerate the visual pigment chromophore 11-cis retinal in the dark enzymatically, unlike in all other taxa, which rely on photoisomerization. This mechanism is termed the visual cycle and is localized to the retinal pigment epithelium (RPE, a support layer of the neural retina. Speculation has long revolved around whether more primitive chordates, such as tunicates and cephalochordates, anticipated this feature. The two key enzymes of the visual cycle are RPE65, the visual cycle all-trans retinyl ester isomerohydrolase, and lecithin:retinol acyltransferase (LRAT, which generates RPE65's substrate. We hypothesized that the origin of the vertebrate visual cycle is directly connected to an ancestral carotenoid oxygenase acquiring a new retinyl ester isomerohydrolase function. Our phylogenetic analyses of the RPE65/BCMO and N1pC/P60 (LRAT superfamilies show that neither RPE65 nor LRAT orthologs occur in tunicates (Ciona or cephalochordates (Branchiostoma, but occur in Petromyzon marinus (Sea Lamprey, a jawless vertebrate. The closest homologs to RPE65 in Ciona and Branchiostoma lacked predicted functionally diverged residues found in all authentic RPE65s, but lamprey RPE65 contained all of them. We cloned RPE65 and LRATb cDNAs from lamprey RPE and demonstrated appropriate enzymatic activities. We show that Ciona ß-carotene monooxygenase a (BCMOa (previously annotated as an RPE65 has carotenoid oxygenase cleavage activity but not RPE65 activity. We verified the presence of RPE65 in lamprey RPE by immunofluorescence microscopy, immunoblot and mass spectrometry. On the basis of these data we conclude that the crucial transition from the typical carotenoid double bond cleavage functionality (BCMO to the isomerohydrolase functionality (RPE65, coupled with the origin of LRAT, occurred subsequent to divergence of the more primitive chordates