
Sample records for ascidian ciona edwardsii

  1. Huntingtin gene evolution in Chordata and its peculiar features in the ascidian Ciona genus


    Cattaneo Elena; Pesole Graziano; Gissi Carmela; Tartari Marzia


    Abstract Background To gain insight into the evolutionary features of the huntingtin (htt) gene in Chordata, we have sequenced and characterized the full-length htt mRNA in the ascidian Ciona intestinalis, a basal chordate emerging as new invertebrate model organism. Moreover, taking advantage of the availability of genomic and EST sequences, the htt gene structure of a number of chordate species, including the cogeneric ascidian Ciona savignyi, and the vertebrates Xenopus and Gallus was reco...

  2. Huntingtin gene evolution in Chordata and its peculiar features in the ascidian Ciona genus

    Directory of Open Access Journals (Sweden)

    Cattaneo Elena


    Full Text Available Abstract Background To gain insight into the evolutionary features of the huntingtin (htt gene in Chordata, we have sequenced and characterized the full-length htt mRNA in the ascidian Ciona intestinalis, a basal chordate emerging as new invertebrate model organism. Moreover, taking advantage of the availability of genomic and EST sequences, the htt gene structure of a number of chordate species, including the cogeneric ascidian Ciona savignyi, and the vertebrates Xenopus and Gallus was reconstructed. Results The C. intestinalis htt transcript exhibits some peculiar features, such as spliced leader trans-splicing in the 98 nt-long 5' untranslated region (UTR, an alternative splicing in the coding region, eight alternative polyadenylation sites, and no similarities of both 5' and 3'UTRs compared to homologs of the cogeneric C. savignyi. The predicted protein is 2946 amino acids long, shorter than its vertebrate homologs, and lacks the polyQ and the polyP stretches found in the the N-terminal regions of mammalian homologs. The exon-intron organization of the htt gene is almost identical among vertebrates, and significantly conserved between Ciona and vertebrates, allowing us to hypothesize an ancestral chordate gene consisting of at least 40 coding exons. Conclusion During chordate diversification, events of gain/loss, sliding, phase changes, and expansion of introns occurred in both vertebrate and ascidian lineages predominantly in the 5'-half of the htt gene, where there is also evidence of lineage-specific evolutionary dynamics in vertebrates. On the contrary, the 3'-half of the gene is highly conserved in all chordates at the level of both gene structure and protein sequence. Between the two Ciona species, a fast evolutionary rate and/or an early divergence time is suggested by the absence of significant similarity between UTRs, protein divergence comparable to that observed between mammals and fishes, and different distribution of repetitive

  3. Spermiotoxicity of nickel nanoparticles in the marine invertebrate Ciona intestinalis (ascidians). (United States)

    Gallo, Alessandra; Boni, Raffaele; Buttino, Isabella; Tosti, Elisabetta


    Nickel nanoparticles (Ni NPs) are increasingly used in modern industries as catalysts, sensors, and in electronic applications. Due to this large use, their inputs into marine environment have significantly increased; however, the potential ecotoxicological effects in marine environment have so far received little attention. In particular, little is known on the impact of NPs on gamete quality of marine organisms and on the consequences on fertility potential. The present study examines, for the first time, the impact of Ni NPs exposure on sperm quality of the marine invertebrate Ciona intestinalis (ascidian). Several parameters related with sperm status such as plasma membrane lipid peroxidation, mitochondrial membrane potential (MMP), intracellular pH, DNA integrity, and fertilizing ability were assessed as toxicity end points after exposure to different Ni NPs concentrations. Ni NPs generate oxidative stress that in turn induces lipid peroxidation and DNA fragmentation, and alters MMP and sperm morphology. Furthermore, sperm exposure to Ni NPs affects their fertilizing ability and causes developmental anomalies in the offspring. All together, these results reveal a spermiotoxicity of Ni NPs in ascidians suggesting that the application of these NPs should be carefully assessed as to their potential toxic effects on the health of marine organisms that, in turn, may influence the ecological system. This study shows that ascidian sperm represent a suitable and sensitive tool for the investigation of the toxicity of NPs entered into marine environment, for defining the mechanisms of toxic action and for the environmental monitoring purpose. PMID:27080039

  4. Local database and the search program for proteomic analysis of sperm proteins in the ascidian Ciona intestinalis

    International Nuclear Information System (INIS)

    Separation of proteins by two-dimensional electrophoresis and following mass spectrometry (MS) is now a conventional technique for proteomic analysis. For proteomic analysis of a certain tissue with a limited information of primary structures of proteins, we have developed an analytical system for peptide mass fingerprinting in gene products in the testis of the ascidian Ciona intestinalis. Ciona sperm proteins were separated by two-dimensional gel electrophoresis and the tryptic fragments were subjected to MALDI-TOF/MS. The mass pattern was searched against on-line databases but resulted in less identification of these proteins. We have constructed a MS database from Ciona testis ESTs and the genome draft sequence, along with a newly devised, perl-based search program PerMS for peptide mass fingerprinting. This system could identify more than 80% of Ciona sperm proteins, suggesting that it could be widely applied for proteomic analysis for a limited tissue with less genomic information

  5. Proteomics of ionomycin-induced ascidian sperm reaction: Released and exposed sperm proteins in the ascidian Ciona intestinalis. (United States)

    Nakazawa, Shiori; Shirae-Kurabayashi, Maki; Otsuka, Kei; Sawada, Hitoshi


    Sperm proteins mediating sperm-egg interaction should be exhibited on the sperm surface, or exposed or released when sperm approach an egg. In ascidians (protochordates), sperm undergo a sperm reaction, characterized by enhanced sperm motility and mitochondrial swelling and shedding on contact with the vitelline coat (VC) or by treatment with Ca(2+) ionophore. Here, proteomic analysis was conducted on sperm exudates and sperm surface proteins using ionomycin-induced sperm reaction and cell-impermeable labeling in Ciona intestinalis type A (C. robusta). In the exudate from sperm treated with ionomycin, membrane proteins including a possible VC receptor CiUrabin were abundant, indicating the release of membranous compartments during sperm reaction. Among the surface proteins XP_009859314.1 (uncharacterized protein exhibiting homology to HrTTSP-1) was most abundant before the sperm reaction, but XP_004227079.1 (unknown Ig superfamily protein) appears to be most abundantly exposed by the sperm reaction. Moreover, proteins containing a notable set of domains, astacin-like metalloprotease domain and thrombospondin type 1 repeat(s), were found in this fraction. Possible roles in fertilization as well as localizations and behaviors of these proteins are discussed. PMID:26223815

  6. Metamorphosis of the invasive ascidian Ciona savignyi: environmental variables and chemical exposure. (United States)

    Cahill, Patrick L; Atalah, Javier; Selwood, Andrew I; Kuhajek, Jeanne M


    In this study, the effects of environmental variables on larval metamorphosis of the solitary ascidian Ciona savignyi were investigated in a laboratory setting. The progression of metamorphic changes were tracked under various temperature, photoperiod, substrate, larval density, and vessel size regimes. Metamorphosis was maximised at 18 °C, 12:12 h subdued light:dark, smooth polystyrene substrate, and 10 larvae mL(-1) in a twelve-well tissue culture plate. Eliminating the air-water interface by filling culture vessels to capacity further increased the proportion of metamorphosed larvae; 87 ± 5% of larvae completed metamorphosis within 5 days compared to 45 ± 5% in control wells. The effects of the reference antifouling compounds polygodial, portimine, oroidin, chlorothalonil, and tolylfluanid on C. savignyi were subsequently determined, highlighting (1) the sensitivity of C. savignyi metamorphosis to chemical exposure and (2) the potential to use C. savignyi larvae to screen for bioactivity in an optimised laboratory setting. The compounds were bioactive in the low ng mL(-1) to high µg mL(-1) range. Polygodial was chosen for additional investigations, where it was shown that mean reductions in the proportions of larvae reaching stage E were highly repeatable both within (repeatability = 14 ± 9%) and between (intermediate precision = 17 ± 3%) independent experiments. An environmental extract had no effect on the larvae but exposing larvae to both the extract and polygodial reduced potency relative to polygodial alone. This change in potency stresses the need for caution when working with complex samples, as is routinely implemented when isolating natural compounds from their biological source. Overall, the outcomes of this study highlight the sensitivity of C. savignyi metamorphosis to environmental variations and chemical exposure. PMID:26966668

  7. Ciona Genetics


    Veeman, Michael T.; Chiba, Shota; Smith, William C.


    Ascidians, such as Ciona, are invertebrate chordates with simple embryonic body plans and small, relatively non-redundant genomes. Ciona genetics is in its infancy compared to many other model systems, but it provides a powerful method for studying this important vertebrate outgroup. Here we give basic methods for genetic analysis of Ciona, including protocols for controlled crosses both by natural spawning and by the surgical isolation of gametes; the identification and propagation of mutant...

  8. Nitric oxide affects ERK signaling through down-regulation of MAP kinase phosphatase levels during larval development of the ascidian Ciona intestinalis.

    Directory of Open Access Journals (Sweden)

    Immacolata Castellano

    Full Text Available In the ascidian Ciona intestinalis larval development and metamorphosis require a complex interplay of events, including nitric oxide (NO production, MAP kinases (ERK, JNK and caspase-3 activation. We have previously shown that NO levels affect the rate of metamorphosis, regulate caspase activity and promote an oxidative stress pathway, resulting in protein nitration. Here, we report that NO down-regulates MAP kinase phosphatases (mkps expression affecting positively ERK signaling. By pharmacological approach, we observed that the reduction of endogenous NO levels caused a decrease of ERK phosphorylation, whereas increasing levels of NO induced ERK activation. We have also identified the ERK gene network affected by NO, including mpk1, mpk3 and some key developmental genes by quantitative gene expression analysis. We demonstrate that NO induces an ERK-independent down-regulation of mkp1 and mkp3, responsible for maintaining the ERK phosphorylation levels necessary for transcription of key metamorphic genes, such as the hormone receptor rev-erb and the van willebrand protein vwa1c. These results add new insights into the role played by NO during larval development and metamorphosis in Ciona, highlighting the cross-talk between different signaling pathways.

  9. A genomewide analysis of genes for the heat shock protein 70 chaperone system in the ascidian Ciona intestinalis


    Wada, Shuichi; Hamada, Mayuko; Satoh, Nori


    Molecular chaperones play crucial roles in various aspects of the biogenesis and maintenance of proteins in the cell. The heat shock protein 70 (HSP70) chaperone system, in which HSP70 proteins act as chaperones, is one of the major molecular chaperone systems conserved among a variety of organisms. To shed light on the evolutionary history of the constituents of the chordate HSP70 chaperone system and to identify all of the components of the HSP70 chaperone system in ascidians, we carried ou...

  10. Characterization and metal-induced gene transcription of two new copper zinc superoxide dismutases in the solitary ascidian Ciona intestinalis

    Energy Technology Data Exchange (ETDEWEB)

    Ferro, Diana [Department of Biology, University of Padova, Padova (Italy); Institute for Evolution and Biodiversity, Westfälische Wilhelms-Universität, Münster (Germany); Franchi, Nicola [Department of Biology, University of Padova, Padova (Italy); Department of Biological, Chemical, Pharmaceutical Science and Technology, University of Palermo, Palermo (Italy); Mangano, Valentina [Department of Biological, Chemical, Pharmaceutical Science and Technology, University of Palermo, Palermo (Italy); Bakiu, Rigers [Department of Crop Production, Agricultural University of Tirana, Tirana (Albania); Cammarata, Matteo; Parrinello, Nicolò [Department of Biological, Chemical, Pharmaceutical Science and Technology, University of Palermo, Palermo (Italy); Santovito, Gianfranco, E-mail: [Department of Biology, University of Padova, Padova (Italy); Ballarin, Loriano [Department of Biology, University of Padova, Padova (Italy)


    Highlights: •Ciona intestinalis express two copper-zinc superoxide dismutases (Cu,Zn SODs), one extracellular (Ci-SODa) and one intracellular isoform (Ci-SODb). •Promoters contain consensus sequences similar to mammalian MRE. •Metal exposure results in a significant increase of gene transcription: ci-soda is induced especially by copper and zinc, the increase of ci-sodb transcription is more evident after cadmium exposure. •Genes are mostly transcribed in circulating hemocytes and in ovarian follicular cells. -- Abstract: Antioxidant enzymes are known to protect living organisms against the oxidative stress risk, also induced by metals. In the present study, we describe the purification and molecular characterization of two Cu,Zn superoxide dismutases (SODs), referred to as Ci-SODa and Ci-SODb, from Ciona intestinalis, a basal chordate widely distributed in temperate shallow seawater. The putative amino acid sequences were compared with Cu,Zn SODs from other metazoans and phylogenetic analyses indicate that the two putative Ci-SODs are more related to invertebrate SODs than vertebrate ones. Both phylogenetic and preliminary homology modeling analyses suggest that Ci-SODa and Ci-SODb are extracellular and intracellular isoform, respectively. The mRNA of the two Cu,Zn SODs was localized in hemocytes and in ovarian follicular cells, as revealed by in situ hybridization. The time course of SOD mRNA levels in the presence of three different metals showed upregulation of ci-soda and inhibition of ci-sodb. Spectrophotometric analysis confirms the presence of SOD activity in Ciona tissues. Our in silico analyses of the ci-soda promoter region revealed putative consensus sequences similar to mammalian metal-responsive elements (MRE), suggesting that the transcription of these genes directly depends on metals. These data emphasize the importance of complex metal regulation of ci-soda and ci-sodb transcription, as components of an efficient detoxification pathway

  11. Characterization and metal-induced gene transcription of two new copper zinc superoxide dismutases in the solitary ascidian Ciona intestinalis

    International Nuclear Information System (INIS)

    Highlights: •Ciona intestinalis express two copper-zinc superoxide dismutases (Cu,Zn SODs), one extracellular (Ci-SODa) and one intracellular isoform (Ci-SODb). •Promoters contain consensus sequences similar to mammalian MRE. •Metal exposure results in a significant increase of gene transcription: ci-soda is induced especially by copper and zinc, the increase of ci-sodb transcription is more evident after cadmium exposure. •Genes are mostly transcribed in circulating hemocytes and in ovarian follicular cells. -- Abstract: Antioxidant enzymes are known to protect living organisms against the oxidative stress risk, also induced by metals. In the present study, we describe the purification and molecular characterization of two Cu,Zn superoxide dismutases (SODs), referred to as Ci-SODa and Ci-SODb, from Ciona intestinalis, a basal chordate widely distributed in temperate shallow seawater. The putative amino acid sequences were compared with Cu,Zn SODs from other metazoans and phylogenetic analyses indicate that the two putative Ci-SODs are more related to invertebrate SODs than vertebrate ones. Both phylogenetic and preliminary homology modeling analyses suggest that Ci-SODa and Ci-SODb are extracellular and intracellular isoform, respectively. The mRNA of the two Cu,Zn SODs was localized in hemocytes and in ovarian follicular cells, as revealed by in situ hybridization. The time course of SOD mRNA levels in the presence of three different metals showed upregulation of ci-soda and inhibition of ci-sodb. Spectrophotometric analysis confirms the presence of SOD activity in Ciona tissues. Our in silico analyses of the ci-soda promoter region revealed putative consensus sequences similar to mammalian metal-responsive elements (MRE), suggesting that the transcription of these genes directly depends on metals. These data emphasize the importance of complex metal regulation of ci-soda and ci-sodb transcription, as components of an efficient detoxification pathway

  12. How Fast Is the Sessile Ciona?


    Giuseppe D'Onofrio; Fernando Alvarez-Valin; Luisa Berná


    Genomewide analyses of distances between orthologous gene pairs from the ascidian species Ciona intestinalis and Ciona savignyi were compared with those of vertebrates. Combining this data with a detailed and careful use of vertebrate fossil records, we estimated the time of divergence between the two ascidians nearly 180 My. This estimation was obtained after correcting for the different substitution rates found comparing several groups of chordates; indeed we determine here that on average ...

  13. How Fast Is the Sessile Ciona?

    Directory of Open Access Journals (Sweden)

    Luisa Berná


    Full Text Available Genomewide analyses of distances between orthologous gene pairs from the ascidian species Ciona intestinalis and Ciona savignyi were compared with those of vertebrates. Combining this data with a detailed and careful use of vertebrate fossil records, we estimated the time of divergence between the two ascidians nearly 180 My. This estimation was obtained after correcting for the different substitution rates found comparing several groups of chordates; indeed we determine here that on average Ciona species evolve 50% faster than vertebrates.

  14. Evolutionary changes in the notochord genetic toolkit: a comparative analysis of notochord genes in the ascidian Ciona and the larvacean Oikopleura

    Directory of Open Access Journals (Sweden)

    Jiang Di


    Full Text Available Abstract Background The notochord is a defining feature of the chordate clade, and invertebrate chordates, such as tunicates, are uniquely suited for studies of this structure. Here we used a well-characterized set of 50 notochord genes known to be targets of the notochord-specific Brachyury transcription factor in one tunicate, Ciona intestinalis (Class Ascidiacea, to begin determining whether the same genetic toolkit is employed to build the notochord in another tunicate, Oikopleura dioica (Class Larvacea. We identified Oikopleura orthologs of the Ciona notochord genes, as well as lineage-specific duplicates for which we determined the phylogenetic relationships with related genes from other chordates, and we analyzed their expression patterns in Oikopleura embryos. Results Of the 50 Ciona notochord genes that were used as a reference, only 26 had clearly identifiable orthologs in Oikopleura. Two of these conserved genes appeared to have undergone Oikopleura- and/or tunicate-specific duplications, and one was present in three copies in Oikopleura, thus bringing the number of genes to test to 30. We were able to clone and test 28 of these genes. Thirteen of the 28 Oikopleura orthologs of Ciona notochord genes showed clear expression in all or in part of the Oikopleura notochord, seven were diffusely expressed throughout the tail, six were expressed in tissues other than the notochord, while two probes did not provide a detectable signal at any of the stages analyzed. One of the notochord genes identified, Oikopleura netrin, was found to be unevenly expressed in notochord cells, in a pattern reminiscent of that previously observed for one of the Oikopleura Hox genes. Conclusions A surprisingly high number of Ciona notochord genes do not have apparent counterparts in Oikopleura, and only a fraction of the evolutionarily conserved genes show clear notochord expression. This suggests that Ciona and Oikopleura, despite the morphological similarities

  15. Ascidian bioresources: common and variant chemical compositions and exploitation strategy - examples of Halocynthia roretzi, Styela plicata, Ascidia sp. and Ciona intestinalis. (United States)

    Zhao, Yadong; Li, Jiebing


    To explore abundant marine ascidian bioresources, four species from two orders have been compared in their chemical compositions. After a universal separation of the animal body into two fractions, all tunics have been found rich in carbohydrate contents, while all inner body tissues are richer in proteins. Cellulose is present almost exclusively in the tunics and more in the order Stolidobranchia, while more sulfated polysaccharides are present in Phlebobranchia species. Almost all proteins are collagens with a high essential amino acid index and high delicious amino acid (DAA) content. All fractions also have high contents of good-quality fatty acids and trace minerals but low toxic element contents, with different sterols and glycosaminoglycans. There are species-specific characteristics observed for vanadium accumulation and sterol structures which are also meaningful for ascidian chemotaxonomy and resource exploitation. It is suggested that in addition to the present utilizations of tunics for cellulose production and of some species' inner body tissues as human food, one should explore all species' inner body tissues as human foods and all tunics as food or animal feed with the contained cellulose as dietary fiber. Collagens, sulfated polysaccharides, glycosaminoglycans, sterols and trace elements could be explored as byproducts for, e.g. pharmaceutical and chemical industries. PMID:27049617

  16. The ascidian prophenoloxidase activating system

    Directory of Open Access Journals (Sweden)

    M Cammarata


    Full Text Available Phenoloxidases/tyrosinases initiate melanin synthesis in almost all organisms, and are involved in different biological activities such as the colour change of human hair and the browning or blackening of fruit skin etc. In many invertebrates, defence reactions are linked to phenoloxidase activity and/or melanization. Contacts with foreign molecules are able to trigger the prophenoloxidase (proPO system that requires serine protease cleavage for activating the zymogen to phenoloxidase (PO. It is generally accepted that the proPO system is fully expressed in arthropods, and, recently, progress in the regulation of crustacean and insect proPO activation steps have been achieved. After cells were stimulated by components of pathogen associated molecular pattern (PAMP, proPO activation takes place via zimogenic serine proteinase in turn activated by PAMPs followed by cascade, spatial and temporal control.The proPO activating system plays a defensive role in arthropods, molluscs, annelids, ascidians and the cephalochordate Branchiostoma belcheri.In the present paper, we report on ascidian proPO system and related molecules, with particular focus on the biochemical, cellular and molecular aspects of the Ciona intestinalis, proPO system of circulating hemocytes from naïve ascidians as well as of body wall following LPS inflammatory challenge.

  17. Genomics and developmental approaches to an ascidian adenohypophysis primordium. (United States)

    Kano, Shungo


    Ascidians, which are the closest phylogenetic relatives to vertebrates, lack a distinct pituitary gland, which is the major endocrine gland in vertebrates. Nevertheless, for the past 130 years, it has been debated that the ascidian neural complex (NC) is homologous to the pituitary. Of the three major components of the NC, the neural gland (NG) has mainly been thought to be the ascidian counterpart of the pituitary. Recently, however, the ciliated funnel, and not the NG, was postulated to be the adenohypophysis (AH) primordium because it is likely derived from oral ectoderm, and because the expression of several placodal genes is comparable to their expression in vertebrates. An extensive in silico survey of the Ciona intestinalis genome sequence revealed that genes encoding pituitary hormones are absent in ascidians. Under the circumstances, this thesis attempts to find a path that shows that the AH primordium is recognizable in the ascidian by revisiting molecular and developmental data from recent public resources on C. intestinalis, and through the use of advanced bio-imaging techniques. A putative Ciona genetic pathway, which was constructed by referring to data from mammals, shows that only a patchwork of the genetic network exists to achieve terminal differentiation of the AH endocrine cells in the Ciona genome. Re-annotation on glycoprotein hormone related proteins, a GPA2/ARP and two GPB5/BRP ones previously reported, reveals that the GPA2 locus contains two splicing variants, and one variant likely formed a three-dimensional conformation similar to that of human GPA2. No clone of the GPB5/BRP1 locus has been isolated, and another candidate, BRP2, is unlikely to be a GPB5. Next, I argued a possibility that endocrine activities of Ciona species could be specialized in association with its short generation time, and I suggest that not only Ciona species but also other ascidians should be studied in order to understand ascidian endocrinology. Confocal images

  18. Development of translationally active mRNA for larval muscle acetylcholinesterase during ascidian embryogenesis.


    Meedel, T H; Whittaker, J R


    Relative quantities of translationally active acetylcholinesterase (acetylcholine acetylhydrolase, EC mRNA present at various developmental stages were compared in embryos of the ascidian Ciona intestinalis. Purified RNA was tested for its translational capacity by microinjection into Xenopus laevis oocytes; the acetylcholinesterase produced was immunoprecipitated with antibody to Ciona acetylcholinesterase and enzyme activity was assayed radiometrically. With this protocol, enzyme s...

  19. An Otx/Nodal Regulatory Signature for Posterior Neural Development in Ascidians


    Agnès Roure; Patrick Lemaire; Sébastien Darras


    In chordates, neural induction is the first step of a complex developmental process through which ectodermal cells acquire a neural identity. In ascidians, FGF-mediated neural induction occurs at the 32-cell stage in two blastomere pairs, precursors respectively of anterior and posterior neural tissue. We combined molecular embryology and cis-regulatory analysis to unveil in the ascidian Ciona intestinalis the remarkably simple proximal genetic network that controls posterior neural fate acqu...

  20. An otx/nodal regulatory signature for posterior neural development in ascidians.

    Directory of Open Access Journals (Sweden)

    Agnès Roure


    Full Text Available In chordates, neural induction is the first step of a complex developmental process through which ectodermal cells acquire a neural identity. In ascidians, FGF-mediated neural induction occurs at the 32-cell stage in two blastomere pairs, precursors respectively of anterior and posterior neural tissue. We combined molecular embryology and cis-regulatory analysis to unveil in the ascidian Ciona intestinalis the remarkably simple proximal genetic network that controls posterior neural fate acquisition downstream of FGF. We report that the combined action of two direct FGF targets, the TGFβ factor Nodal, acting via Smad- and Fox-binding sites, and the transcription factor Otx suffices to trigger ascidian posterior neural tissue formation. Moreover, we found that this strategy is conserved in the distantly related ascidian Phallusia mammillata, in spite of extreme sequence divergence in the cis-regulatory sequences involved. Our results thus highlight that the modes of gene regulatory network evolution differ with the evolutionary scale considered. Within ascidians, developmental regulatory networks are remarkably robust to genome sequence divergence. Between ascidians and vertebrates, major fate determinants, such as Otx and Nodal, can be co-opted into different networks. Comparative developmental studies in ascidians with divergent genomes will thus uncover shared ascidian strategies, and contribute to a better understanding of the diversity of developmental strategies within chordates.

  1. The repertoire of G protein-coupled receptors in the sea squirt Ciona intestinalis

    Directory of Open Access Journals (Sweden)

    Manoj Narayanan


    Full Text Available Abstract Background G protein-coupled receptors (GPCRs constitute a large family of integral transmembrane receptor proteins that play a central role in signal transduction in eukaryotes. The genome of the protochordate Ciona intestinalis has a compact size with an ancestral complement of many diversified gene families of vertebrates and is a good model system for studying protochordate to vertebrate diversification. An analysis of the Ciona repertoire of GPCRs from a comparative genomic perspective provides insight into the evolutionary origins of the GPCR signalling system in vertebrates. Results We have identified 169 gene products in the Ciona genome that code for putative GPCRs. Phylogenetic analyses reveal that Ciona GPCRs have homologous representatives from the five major GRAFS (Glutamate, Rhodopsin, Adhesion, Frizzled and Secretin families concomitant with other vertebrate GPCR repertoires. Nearly 39% of Ciona GPCRs have unambiguous orthologs of vertebrate GPCR families, as defined for the human, mouse, puffer fish and chicken genomes. The Rhodopsin family accounts for ~68% of the Ciona GPCR repertoire wherein the LGR-like subfamily exhibits a lineage specific gene expansion of a group of receptors that possess a novel domain organisation hitherto unobserved in metazoan genomes. Conclusion Comparison of GPCRs in Ciona to that in human reveals a high level of orthology of a protochordate repertoire with that of vertebrate GPCRs. Our studies suggest that the ascidians contain the basic ancestral complement of vertebrate GPCR genes. This is evident at the subfamily level comparisons since Ciona GPCR sequences are significantly analogous to vertebrate GPCR subfamilies even while exhibiting Ciona specific genes. Our analysis provides a framework to perform future experimental and comparative studies to understand the roles of the ancestral chordate versions of GPCRs that predated the divergence of the urochordates and the vertebrates.

  2. Synthesis of fucosyl-containing glycoproteins of the vitelline coat in oocytes of Ciona intestinalis (Ascidia).


    F.Rosati; Cotelli, F.; De Santis, R.; A. Monroy; Pinto, M. R.


    The sperm receptors of the ascidian oocyte are located at the outer surface of the vitelline coat (formerly called the chorion). The fucose residues are the receptor's most important components for sperm recognition and binding. We asked whether the fucosyl-containing glycoproteins of the vitelline coat are a product of the oocyte, the follicle cells, or the test cells. Ovaries of Ciona intestinalis were injected with L-[3H]fucose and the progress of its incorporation was followed by using au...

  3. Transcript Mapping and Genome Annotation of Ascidian mtDNA Using EST Data


    Gissi, Carmela; Pesole, Graziano


    Mitochondrial transcripts of two ascidian species were reconstructed through sequence assembly of publicly available ESTs resembling mitochondrial DNA sequences (mt-ESTs). This strategy allowed us to analyze processing and mapping of the mitochondrial transcripts and to investigate the gene organization of a previously uncharacterized mitochondrial genome (mtDNA). This new strategy would greatly facilitate the sequencing and annotation of mtDNAs. In Ciona intestinalis, the assembled mt-...

  4. Ciona intestinalis as an emerging model organism: its regeneration under controlled conditions and methodology for egg dechorionation*


    Liu, Li-Ping; Xiang, Jian-hai; Dong, Bo; Natarajan, Pavanasam; Yu, Kui-jie; Cai, Nan-er


    The ascidian Ciona intestinalis is a model organism of developmental and evolutionary biology and may provide crucial clues concerning two fundamental matters, namely, how chordates originated from the putative deuterostome ancestor and how advanced chordates originated from the simplest chordates. In this paper, a whole-life-span culture of C. intestinalis was conducted. Fed with the diet combination of dry Spirulina, egg yolk, Dicrateria sp., edible yeast and weaning diet for shrimp, C. int...

  5. Morphological Differences between Larvae of the Ciona intestinalis Species Complex: Hints for a Valid Taxonomic Definition of Distinct Species


    Roberta Pennati; Gentile Francesco Ficetola; Riccardo Brunetti; Federico Caicci; Fabio Gasparini; Francesca Griggio; Atsuko Sato; Thomas Stach; Sabrina Kaul-Strehlow; Carmela Gissi; Lucia Manni


    The cosmopolitan ascidian Ciona intestinalis is the most common model species of Tunicata, the sister-group of Vertebrata, and widely used in developmental biology, genomics and evolutionary studies. Recently, molecular studies suggested the presence of cryptic species hidden within the C. intestinalis species, namely C. intestinalis type A and type B. So far, no substantial morphological differences have been identified between individuals belonging to the two types. Here we present morphome...

  6. Taxonomy Icon Data: Ciona intestinalis (Sea squirt) [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available ttp:// ... Ciona_intestinalis_L.png Ciona_intestinalis_NL.png Ciona_intestinalis_S.png Ciona_intestinalis_NS.png h

  7. Genetic perspectives on the ascidian central nervous system

    Directory of Open Access Journals (Sweden)

    A Locascio


    Full Text Available In 2002, date of publication of the Ciona intestinalis genome, ascidians entered the post-genomic era. This tool had a fundamental role and has become the starting point for a series of new functional and genomic studies. Recently, great efforts have been done to characterize the genetic cascades of genes having a key role in early embryonic development and to draw the regulatory networks in which they are involved. In this review, we focused our attention on the last advances obtained in the attempt to clarify the complex molecular events governing ascidian central nervous system development with a special interest for anterior neural and sensory structures. We discussed the more recent theories on its early induction and late regionalization. In particular, we used some conserved genes fully or partially characterized as examples to compare ascidian and vertebrate central nervous system (CNS.By integrating the various results obtained with microarray, morpholino loss of function and promoter analyses, we showed that many progresses have been done to unravel the gene networks controlling early CNS induction and formation. Unfortunately, fewer advances have been done in the identification of the regulatory cascades controlling late CNS regionalization and sensory organs differentiation. Some results are discussed to point out the importance of fully characterizing also these specific regulatory cascades.

  8. Natural variation of model mutant phenotypes in Ciona intestinalis.

    Directory of Open Access Journals (Sweden)

    Paolo Sordino

    Full Text Available BACKGROUND: The study of ascidians (Chordata, Tunicata has made a considerable contribution to our understanding of the origin and evolution of basal chordates. To provide further information to support forward genetics in Ciona intestinalis, we used a combination of natural variation and neutral population genetics as an approach for the systematic identification of new mutations. In addition to the significance of developmental variation for phenotype-driven studies, this approach can encompass important implications in evolutionary and population biology. METHODOLOGY/PRINCIPAL FINDINGS: Here, we report a preliminary survey for naturally occurring mutations in three geographically interconnected populations of C. intestinalis. The influence of historical, geographical and environmental factors on the distribution of abnormal phenotypes was assessed by means of 12 microsatellites. We identified 37 possible mutant loci with stereotyped defects in embryonic development that segregate in a way typical of recessive alleles. Local populations were found to differ in genetic organization and frequency distribution of phenotypic classes. CONCLUSIONS/SIGNIFICANCE: Natural genetic polymorphism of C. intestinalis constitutes a valuable source of phenotypes for studying embryonic development in ascidians. Correlating genetic structure and the occurrence of abnormal phenotypes is a crucial focus for understanding the selective forces that shape natural finite populations, and may provide insights of great importance into the evolutionary mechanisms that generate animal diversity.

  9. The significance of Ciona intestinalis as a stem organism in integrative studies of functional evolution of the chordate endocrine, neuroendocrine, and nervous systems. (United States)

    Matsubara, Shin; Kawada, Tsuyoshi; Sakai, Tsubasa; Aoyama, Masato; Osugi, Tomohiro; Shiraishi, Akira; Satake, Honoo


    Ascidians are the closest phylogenetic neighbors to vertebrates and are believed to conserve the evolutionary origin in chordates of the endocrine, neuroendocrine, and nervous systems involving neuropeptides and peptide hormones. Ciona intestinalis harbors various homologs or prototypes of vertebrate neuropeptides and peptide hormones including gonadotropin-releasing hormones (GnRHs), tachykinins (TKs), and calcitonin, as well as Ciona-specific neuropeptides such as Ciona vasopressin, LF, and YFV/L peptides. Moreover, molecular and functional studies on Ciona tachykinin (Ci-TK) have revealed the novel molecular mechanism of inducing oocyte growth via up-regulation of vitellogenesis-associated protease activity, which is expected to be conserved in vertebrates. Furthermore, a series of studies on Ciona GnRH receptor paralogs have verified the species-specific regulation of GnRHergic signaling including unique signaling control via heterodimerization among multiple GnRH receptors. These findings confirm the remarkable significance of ascidians in investigations of the evolutionary processes of the peptidergic systems in chordates, leading to the promising advance in the research on Ciona peptides in the next stage based on the recent development of emerging technologies including genome-editing techniques, peptidomics-based multi-color staining, machine-learning prediction, and next-generation sequencing. These technologies and bioinformatic integration of the resultant "multi-omics" data will provide unprecedented insights into the comprehensive understanding of molecular and functional regulatory mechanisms of the Ciona peptides, and will eventually enable the exploration of both conserved and diversified endocrine, neuroendocrine, and nervous systems in the evolutionary lineage of chordates. PMID:26031189

  10. The identification of transcription factors expressed in the notochord of Ciona intestinalis adds new potential players to the Brachyury gene regulatory network


    Diana S José-Edwards; Kerner, Pierre; Kugler, Jamie E.; Deng, Wei; Jiang, Di; Di Gregorio, Anna


    The notochord is the distinctive characteristic of chordates; however, the knowledge of the complement of transcription factors governing the development of this structure is still incomplete. Here we present the expression patterns of seven transcription factor genes detected in the notochord of the ascidian Ciona intestinalis at various stages of embryonic development. Four of these transcription factors, Fos-a, NFAT5, AFF and Klf15, have not been directly associated with the notochord in p...

  11. ANISEED 2015: a digital framework for the comparative developmental biology of ascidians. (United States)

    Brozovic, Matija; Martin, Cyril; Dantec, Christelle; Dauga, Delphine; Mendez, Mickaël; Simion, Paul; Percher, Madeline; Laporte, Baptiste; Scornavacca, Céline; Di Gregorio, Anna; Fujiwara, Shigeki; Gineste, Mathieu; Lowe, Elijah K; Piette, Jacques; Racioppi, Claudia; Ristoratore, Filomena; Sasakura, Yasunori; Takatori, Naohito; Brown, Titus C; Delsuc, Frédéric; Douzery, Emmanuel; Gissi, Carmela; McDougall, Alex; Nishida, Hiroki; Sawada, Hitoshi; Swalla, Billie J; Yasuo, Hitoyoshi; Lemaire, Patrick


    Ascidians belong to the tunicates, the sister group of vertebrates and are recognized model organisms in the field of embryonic development, regeneration and stem cells. ANISEED is the main information system in the field of ascidian developmental biology. This article reports the development of the system since its initial publication in 2010. Over the past five years, we refactored the system from an initial custom schema to an extended version of the Chado schema and redesigned all user and back end interfaces. This new architecture was used to improve and enrich the description of Ciona intestinalis embryonic development, based on an improved genome assembly and gene model set, refined functional gene annotation, and anatomical ontologies, and a new collection of full ORF cDNAs. The genomes of nine ascidian species have been sequenced since the release of the C. intestinalis genome. In ANISEED 2015, all nine new ascidian species can be explored via dedicated genome browsers, and searched by Blast. In addition, ANISEED provides full functional gene annotation, anatomical ontologies and some gene expression data for the six species with highest quality genomes. ANISEED is publicly available at: PMID:26420834

  12. Ordered expression pattern of Hox and ParaHox genes along the alimentary canal in the ascidian juvenile. (United States)

    Nakayama, Satoshi; Satou, Kunihiro; Orito, Wataru; Ogasawara, Michio


    The Hox and ParaHox genes of bilateria share a similar expression pattern along the body axis and are known to be associated with anterior-posterior patterning. In vertebrates, the Hox genes are also expressed in presomitic mesoderm and gut endoderm and the ParaHox genes show a restricted expression pattern in the gut-related derivatives. Regional expression patterns in the embryonic central nervous system of the basal chordates amphioxus and ascidian have been reported; however, little is known about their endodermal expression in the alimentary canal. We focus on the Hox and ParaHox genes in the ascidian Ciona intestinalis and investigate the gene expression patterns in the juvenile, which shows morphological regionality in the alimentary canal. Gene expression analyses by using whole-mount in situ hybridization reveal that all Hox genes have a regional expression pattern along the alimentary canal. Expression of Hox1 to Hox4 is restricted to the posterior region of pharyngeal derivatives. Hox5 to Hox13 show an ordered expression pattern correlated with each Hox gene number along the postpharyngeal digestive tract. This expression pattern along the anterior-posterior axis has also been observed in Ciona ParaHox genes. Our observations suggest that ascidian Hox and ParaHox clusters are dispersed; however, the ordered expression patterns along the alimentary canal appear to be conserved among chordates. PMID:26837224

  13. Inverse correlation of population similarity and introduction date for invasive ascidians.

    Directory of Open Access Journals (Sweden)

    Nathan Silva

    Full Text Available The genomes of many marine invertebrates, including the purple sea urchin and the solitary ascidians Ciona intestinalis and Ciona savignyi, show exceptionally high levels of heterozygosity, implying that these populations are highly polymorphic. Analysis of the C. savignyi genome found little evidence to support an elevated mutation rate, but rather points to a large population size contributing to the polymorphism level. In the present study, the relative genetic polymorphism levels in sampled populations of ten different ascidian species were determined using a similarity index generated by AFLP analysis. The goal was to determine the range of polymorphism within the populations of different species, and to uncover factors that may contribute to the high level of polymorphism. We observe that, surprisingly, the levels of polymorphism within these species show a negative correlation with the reported age of invasive populations, and that closely related species show substantially different levels of genetic polymorphism. These findings show exceptions to the assumptions that invasive species start with a low level of genetic polymorphism that increases over time and that closely related species have similar levels of genetic polymorphism.


    Piette, Jacques; Lemaire, Patrick


    Most developmental biologists equate tunicates to the sessile ascidians, including Ciona intestinalis, and the pelagic appendicularians, in particular Oikopleura dioica. However, there exists a third group of tunicates with a pelagic lifestyle, the thaliaceans, which include salps, pyrosomes, and doliolids. Although thaliaceans have raised the curiosity offamous zoologists since the 18th century, the difficulty of observing and experimentally manipulating them has led to many controversies and speculations about their life cycles and developmental strategies, the phylogenetic relationship within the group and with other tunicates, and the drivers of speciation in these widely distributed animals living in a seemingly uniform environment. Here, we take a historical perspective to summarize 250 years of work on this intriguing group of animals, and explore how modern genomics and imaging approaches are starting to solve fascinating evolutionary and developmental riddles. Recent molecular analyses support previous morphological evidence that ascidians are not monophyletic and that thaliaceans evolved from a sessile ascidian-like ancestor. In parallel, preliminary live-imaging and gene-expression data offer exciting entry points to understand how the adoption of a pelagic lifestyle led to drastic modifications in the morphology, embryology, and life cycle of these tunicates, compared to their sessile ancestor. PMID:26285352

  15. A novel third complement component C3 gene of Ciona intestinalis expressed in the endoderm at the early developmental stages

    Directory of Open Access Journals (Sweden)

    T Hibino


    Full Text Available The third complement component (C3 in ascidian was reported to function as an opsonin to enhance phagocytosis and as a chemotactic factor for phagocytes, indicating that ascidian C3 works in mesodermal cavity as a humoral factor like vertebrate C3s. In the basal Eumetazoa, Cnidaria lacking mesodermal tissues, C3 was reported to work in an endodermal cavity. Evolution of structure and function of C3 is still to be clarified. Here we report the identification of the third C3 gene, CiC3-3, in the genome of an ascidian, Ciona intestinalis. Phylogenetic analysis using the entire amino acid sequences of Eumetazoan C3s indicated that CiC3-3 possess a closer relationship to vertebrate C3, C4 and C5 than other ascidian C3s. Although CiC3-3 retained the α-β processing site and 6 cysteine residues in the C3a region, it lacked the intra-molecular thioester bond and the catalytic histidine residue. Instead, CiC3-3 had a unique insertion of about 70 residues long Lys/Arg-rich sequence. CiC3-3 was expressed highly in the embryonic stages, but little in the adult in contradistinction to CiC3-1 and CiC3-2. The expression of CiC3-3 in early embryonic stages was restricted to endoderm similar to cnidarian C3s. Thus, the ascidian complement system could represent a unique evolutionary stage sharing a primitive endodermal function with Cnidaria, and newly developed humoral function with vertebrates.

  16. Ascidian gene-expression profiles


    William R Jeffery


    With the advent of gene-expression profiling, a large number of genes can now be investigated simultaneously during critical stages of development. This approach will be particularly informative in studies of ascidians, basal chordates whose genomes and embryology are uniquely suited for mapping developmental gene networks.

  17. 3D-printed microwell arrays for Ciona microinjection and timelapse imaging.

    Directory of Open Access Journals (Sweden)

    Clint Gregory

    Full Text Available Ascidians such as Ciona are close chordate relatives of the vertebrates with small, simple embryonic body plans and small, simple genomes. The tractable size of the embryo offers considerable advantages for in toto imaging and quantitative analysis of morphogenesis. For functional studies, Ciona eggs are considerably more challenging to microinject than the much larger eggs of other model organisms such as zebrafish and Xenopus. One of the key difficulties is in restraining the eggs so that the microinjection needle can be easily introduced and withdrawn. Here we develop and test a device to cast wells in agarose that are each sized to hold a single egg. This injection mold is fabricated by micro-resolution stereolithography with a grid of egg-sized posts that cast corresponding wells in agarose. This 3D printing technology allows the rapid and inexpensive testing of iteratively refined prototypes. In addition to their utility in microinjection, these grids of embryo-sized wells are also valuable for timelapse imaging of multiple embryos.

  18. Ciona intestinalis as a model for cardiac development


    Davidson, Brad


    The primitive chordate Ciona intestinalis has emerged as a significant model system for the study of heart development. The Ciona embryo employs a conserved heart gene network in the context of extremely low cell numbers and reduced genetic redundancy. Here, I review recent studies on the molecular genetics of Ciona cardiogenesis as well as classic work on heart anatomy and physiology. I also discuss the potential of employing Ciona to decipher a comprehensive chordate gene network and to det...

  19. Ciona intestinalis as an emerging model organism: its regeneration under controlled conditions and methodology for egg dechorionation

    Institute of Scientific and Technical Information of China (English)

    LIU Li-ping; XIANG Jian-hai; DONG Bo; NATARAJAN Pavanasam; YU Kui-jie; CAI Nan-er


    The ascidian Ciona intestinalis is a model organism of developmental and evolutionary biology and may provide crucial clues concerning two fundamental matters, namely, how chordates originated from the putative deuterostome ancestor and how advanced chordates originated from the simplest chordates. In this paper, a whole-life-span culture of C. intestinalis was conducted. Fed with the diet combination of dry Spirulina, egg yolk, Dicrateria sp., edible yeast and weaning diet for shrimp, C.intestinalis grew up to average 59 mm and matured after 60 d cultivation. This culture process could be repeated using the artificially cultured mature ascidians as material. When the fertilized eggs were maintained under 10, 15, 20, 25 ℃, they hatched within 30 h, 22 h, 16 h and 12 h 50 min respectively experiencing cleavage, blastulation, gastrulation, neurulation, tailbud stage and tadpole stage. The tadpole larvae were characterized as typical but simplified chordates because of their dorsal nerve cord, notochord and primordial brain. After 8~24 h freely swimming, the tadpole larvae settled on the substrates and metamorphosized within 1~2 d into filter feeding sessile juvenile ascidians. In addition, unfertilized eggs were successfully dechorionated in filtered seawater containing 1% Tripsin, 0.25% EDTA at pH of 10.5 within 40 min. After fertilization, the dechorionated eggs developed well and hatched at normal hatching rate. In conclusion, this paper presented feasible methodology for rearing the tadpole larvae of C. intestinalis into sexual maturity under controlled conditions and detailed observations on the embryogenesis of the laboratory cultured ascidians, which will facilitate developmental and genetic research using this model system.

  20. Intraspecific Variation of Centruroides Edwardsii Venom from Two Regions of Colombia

    Directory of Open Access Journals (Sweden)

    Sebastián Estrada-Gómez


    Full Text Available We report the first description studies, partial characterization, and intraspecific difference of Centruroides edwardsii, Gervais 1843, venom. C. edwardsii from two Colombian regions (Antioquia and Tolima were evaluated. Both venoms showed hemolytic activity, possibly dependent of enzymatic active phospholipases, and neither coagulant nor proteolytic activities were observed. Venom electrophoretic profile showed significant differences between C. edwardsii venom from both regions. A high concentration of proteins with molecular masses between 31 kDa and 97.4 kDa, and an important concentration close or below 14.4 kDa were detected. RP-HPLC retention times between 38.2 min and 42.1 min, showed bands close to 14.4 kDa, which may correspond to phospholipases. RP-HPLC venom profile showed a well conserved region in both venoms between 7 and 17 min, after this, significant differences were detected. From Tolima region venom, 50 well-defined peaks were detected, while in the Antioquia region venom, 55 well-defined peaks were detected. Larvicidal activity was only detected in the C. edwardsii venom from Antioquia. No antimicrobial activity was observed using complete venom or RP-HPLC collected fractions of both venoms. Lethally activity (carried out on female albino swiss mice was detected at doses over 19.2 mg/kg of crude venom. Toxic effects included distress, excitability, eye irritation and secretions, hyperventilation, ataxia, paralysis, and salivation.

  1. Ultrastructural comparative analysis on the adhesive papillae of the swimming larvae of three ascidian species

    Directory of Open Access Journals (Sweden)

    G Dolcemascolo


    Full Text Available This paper presents a preliminary report on the papillae of the swimming larvae of three ascidian species: Ascidia malaca, Phallusia mammillata and Ciona intestinalis. The investigations, carried out at ultrastructural level and at confocal laser microscope, have evidenced, in the adhesive papillae of the three studied species, three different cell-types: axial columnar cells, collocytes, sensory cells respectively. The adhesive papillae of A. malaca and P. mammillata show central axial columnar cells with long microvilli emerging from the apical edge and extending throughout the hyaline cap. Collocytes are elongated secreting cells, lying in middle-lateral side. Sensory cells have a cilium at the apical side and an axon proceeding from the basal side. The adhesive papillae of C. intestinalis present some differences in the ultrastructure of the axial columnar cells, which bear a big digitiform protrusion, extending throughout the hyaline cap and a lot of microtubules along the cell axis. The investigations, carried out at confocal microscopy, have evidentiated a clear fluorescence in the papillae of the three studied species and a network of nervous fibers projecting from the papillar base up to cerebral vesicle of the cephalenteron. The characteristic of simple and coniforme type and the adhesive and sensorial functions of adhesive papillae of three ascidian species examined are confirmed.

  2. Genetic and Genomic Toolbox of the Chordate Ciona intestinalis


    Stolfi, Alberto; Christiaen, Lionel


    The experimental malleability and unique phylogenetic position of the sea squirt Ciona intestinalis as part of the sister group to the vertebrates have helped establish these marine chordates as model organisms for the study of developmental genetics and evolution. Here we summarize the tools, techniques, and resources available to the Ciona geneticist, citing examples of studies that employed such strategies in the elucidation of gene function in Ciona. Genetic screens, germline transgenesis...

  3. Functional Brachyury binding sites establish a temporal read-out of gene expression in the Ciona notochord.

    Directory of Open Access Journals (Sweden)

    Lavanya Katikala


    Full Text Available The appearance of the notochord represented a milestone in Deuterostome evolution. The notochord is necessary for the development of the chordate body plan and for the formation of the vertebral column and numerous organs. It is known that the transcription factor Brachyury is required for notochord formation in all chordates, and that it controls transcription of a large number of target genes. However, studies of the structure of the cis-regulatory modules (CRMs through which this control is exerted are complicated in vertebrates by the genomic complexity and the pan-mesodermal expression territory of Brachyury. We used the ascidian Ciona, in which the single-copy Brachyury is notochord-specific and CRMs are easily identifiable, to carry out a systematic characterization of Brachyury-downstream notochord CRMs. We found that Ciona Brachyury (Ci-Bra controls most of its targets directly, through non-palindromic binding sites that function either synergistically or individually to activate early- and middle-onset genes, respectively, while late-onset target CRMs are controlled indirectly, via transcriptional intermediaries. These results illustrate how a transcriptional regulator can efficiently shape a shallow gene regulatory network into a multi-tiered transcriptional output, and provide insights into the mechanisms that establish temporal read-outs of gene expression in a fast-developing chordate embryo.

  4. Ecology of ascidians in the macrofouling community of New Mangalore Port

    Digital Repository Service at National Institute of Oceanography (India)

    Venkat, K.; Anil, A.C.; Khandeparker, D.C.; Mokashe, S.S.

    Ascidians constitute a major component of macrofouling community at the New Mangalore Port during the premonsoon season (February-May). The presence of ascidians in these waters is being reported for the first time. Ascidian recruitment...

  5. Seeing chordate evolution through the Ciona genome sequence


    Cañestro, Cristian; Bassham, Susan; Postlethwait, John H.


    A draft sequence of the compact genome of the sea squirt Ciona intestinalis, a non-vertebrate chordate that diverged very early from other chordates, including vertebrates, illuminates how chordates originated and how vertebrate developmental innovations evolved.

  6. Reprotoxicity of the Antifoulant Chlorothalonil in Ascidians: An Ecological Risk Assessment (United States)

    Gallo, Alessandra; Tosti, Elisabetta


    Chlorothalonil is a widely used biocide in antifouling paint formulation that replaces tin-based compounds after their definitive ban. Although chlorothalonil inputs into the marine environment have significantly increased in recent years, little is known about its effect on marine animals and in particular on their reproductive processes. In this line, the aim of the present study was to investigate the effects of chlorothalonil exposure on the gamete physiology, fertilization rate and transmissible damage to offspring in the marine invertebrate Ciona intestinalis (ascidians). To identify a possible mechanism of action of chlorothalonil, electrophysiological techniques were used to study the impact on oocyte membrane excitability and on the electrical events occurring at fertilization. The pre-exposure of spermatozoa and oocytes to chlorothalonil did not affect the fertilization rate but caused damage to the offspring by inducing larval malformation. The highest toxicity was observed when fertilization was performed in chlorothalonil solutions with the lowest EC50 value. In particular, it was observed that low chlorothalonil concentrations interfered with embryo development and led to abnormal larvae, whereas high concentrations arrested embryo formation. In mature oocytes, a decrease in the amplitudes of the sodium and fertilization currents was observed, suggesting an involvement of plasma membrane ion currents in the teratogenic mechanism of chlorothalonil action. The risk estimation confirmed that the predicted no-effect concentration (PNEC) exceeded the predicted effect concentration (PEC), thus indicating that chlorothalonil may pose a risk to aquatic species. PMID:25875759

  7. Ascidians from Rocas Atoll, northeast Brazil


    Sandra Vieira Paiva; Ronaldo Ruy Oliveira-Filho; Tito Monteiro Da Cruz Lotufo


    Rocas Atoll is the only one of its kind in the South Atlantic—and the first Brazilian marine biological reserve. This is the first report about the ascidians from Rocas. A total of 12 species were found, 5 of them not hitherto described: Ascidia viridina sp. nov., Didemnum rochai sp. nov., Leptoclinides crocotulus sp. nov., Polysyncraton maurizeliae sp. nov., and Trididemnum rocasensis sp. nov.). One Caribbean species, Didemnum halimedae, was also discovered in the region for the first time. ...

  8. Ascidians from Rocas Atoll, northeast Brazil


    Paiva, Sandra V.; Oliveira Filho, Ronaldo R. de; Lotufo, Tito M. da Cruz


    Rocas Atoll is the only one of its kind in the South Atlantic—and the first Brazilian marine biological reserve. This is the first report about the ascidians from Rocas. A total of 12 species were found, 5 of them not hitherto described: Ascidia viridina sp. nov., Didemnum rochai sp. nov., Leptoclinides crocotulus sp. nov., Polysyncraton maurizeliae sp. nov., and Trididemnum rocasensis sp. nov. One Caribbean species, Didemnum halimedae, was also discovered in the region for the first time. Fu...

  9. CiMT-1, an unusual chordate metallothionein gene in Ciona intestinalis genome: structure and expression studies. (United States)

    Franchi, Nicola; Boldrin, Francesco; Ballarin, Loriano; Piccinni, Ester


    The present article reports on the characterization of the urochordate metallothionein (MT) gene, CiMT-1, from the solitary ascidian Ciona intestinalis. The predicted protein is shorter than other known deuterostome MTs, having only 39 amino acids. The gene has the same tripartite structure as vertebrate MTs, with some features resembling those of echinoderm MTs. The promoter region shows the canonical cis-acting elements recognized by transcription factors that respond to metal, ROS, and cytokines. Unusual sequences, described in fish and echinoderms, are also present. In situ hybridization suggests that only a population of hemocytes involved in immune responses, i.e. granular amebocytes, express CiMT-1 mRNA. These observations support the idea that urochordates perform detoxification through hemocytes, and that MTs may play important roles in inflammatory humoral responses in tunicates. The reported data offer new clues for better understanding the evolution of these multivalent proteins from non-vertebrate to vertebrate chordates and reinforce their functions in detoxification and immunity. PMID:21328559

  10. Amino Alcohols from the Ascidian Pseudodistoma sp.

    Directory of Open Access Journals (Sweden)

    Tae Hyung Won


    Full Text Available Seven new amino alcohol compounds, pseudoaminols A–G (1–7, were isolated from the ascidian Pseudodistoma sp. collected off the coast of Chuja-do, Korea. Structures of these new compounds were determined by analysis of the spectroscopic data and from chemical conversion. The presence of an N-carboxymethyl group in two of the new compounds (6 and 7 is unprecedented among amino alcohols. Several of these compounds exhibited moderate antimicrobial activity and cytotoxicity, as well as weak inhibitory activity toward Na+/K+-ATPase.

  11. In vitro Antibacterial Activity of Combretum edwardsii, Combretum krausii, and Maytenus nemorosa and Their Synergistic Effects in Combination with Antibiotics. (United States)

    Chukwujekwu, Jude C; van Staden, Johannes


    The study investigated the antibacterial activity of crude extracts of C. edwardsii, Combretum krausii, and Maytenus nemorosa as well as their interactions with selected antibiotics against drug resistant bacterial strains. Using the rapid p-iodonitrotetrazolium chloride colorimetric assay, minimum inhibitory concentration values of plant extracts and antibiotics were determined. The interactions of plant extracts and antibiotics were studied using a checkerboard method. The MICs of the plant extracts and antibiotics were in the range of 0.037-6.25 and 0.001-2.5 mg/ml, respectively. The plant fractions tested in the present study displayed varying levels of antibacterial activity depending on the bacterial strains. Generally, Staphylococcus aureus was the most susceptible of the three strains of bacteria while the other two beta-lactamase producing Gram-negative bacteria were the most resistant. The hexane leaf extract of M. nemorosa was the most active (MIC = 37 μg/ml) against S. aureus. Ethyl acetate leaf extract of C. krausii was the most active against Klebsiella pneumoniae and ethyl acetate leaf extract of C. edwardsii was the most active against Escherichia coli. Synergistic interactions were detected in 13% of the combinations against E. coli, 27% of the combinations against K. pneumoniae and 80% of the combinations against S. aureus. The few synergistic interactions observed in the present study suggest that the crude extracts of the leaves of M. nemorosa, C. edwardsii, and C. krausii could be potential sources of broad spectrum antibiotic resistance modifying compounds. PMID:27471466

  12. Changes in gelsolin expression during ascidian metamorphosis. (United States)

    Ohtsuka, Y; Okamura, Y; Obinata, T


    Gelsolin is an actin regulatory protein that is expressed in a wide variety of tissues and is especially abundant in muscle and blood cells. The role of gelsolin during structural reorganization of the body, such as during metamorphosis or regeneration, is poorly understood. We analyzed changes in gelsolin expression during ascidian embryogenesis and metamorphosis using nucleic acid probes and a monoclonal antibody (AS23) specific for ascidian gelsolin; our results indicated that gelsolin is maternally provided and that its de novo gene transcription is initiated during the neurula stage. In the larva, gelsolin was detectable in specific types of nerve cells, i.e. the adhesive papillae, motor neurons and epidermal sensory neurons. During metamorphosis, the expression of gelsolin changes markedly: the expression is suppressed in nerve tissues after tail resorption but is induced in mesodermal tissues. Gelsolin accumulated in mesenchyme cells until the onset of tail resorption, and following tail resorption, these cells migrated to the tunic and differentiated into tunic cells with many fine processes. Migration of the mesenchyme cells into the tunic was completely inhibited by treatment with cytochalasin B. Gelsolin was colocalized with actin in tunic cells, suggesting that it is involved in the rearrangement of actin filaments during cell locomotion or morphogenesis. PMID:11455440

  13. Germ-line transgenesis of the Tc1/mariner superfamily transposon Minos in Ciona intestinalis


    Sasakura, Yasunori; Awazu, Satoko; Chiba, Shota; Satoh, Nori


    The tadpole larva of the basal chordate Ciona intestinalis has the most simplified, basic body-plan of chordates. Because it has a compact genome with a complete draft sequence, a large quantity of EST/cDNA information, and a short generation time, Ciona is a suitable model for future genetics. We establish here a transgenic technique in Ciona that uses the Tc1/mariner superfamily transposon Minos. Minos was integrated efficiently into the genome of germ cells and transmitted stably to ...

  14. The central nervous system of ascidian larvae. (United States)

    Hudson, Clare


    Ascidians are marine invertebrate chordates. Their tadpole larvae contain a dorsal tubular nervous system, resulting from the rolling up of a neural plate. Along the anterior-posterior (A-P) axis, the central nervous system (CNS) is organized into a sensory vesicle, neck, trunk ganglion, and tail nerve cord and consists of approximately only 330 cells, of which around 100 are thought to be neurons. The organization of distinct neuronal cell types and neurotransmitter gene expression within the CNS has been described. The unique developmental mode of ascidians, with a small number of cells and a fixed cell division pattern, allows individual cells to be traced throughout development. This feature has led to the complete documentation of the cell lineages of certain cell types in the CNS. Thus, a step-by-step understanding of nervous system development from the initial stages of neural induction to the neurogenesis of individual neurons is a feasible goal. The genetic control of neural fate induction and early neural plate patterning are now well understood. The molecular mechanisms specifying the cholinergic neurons of the trunk ganglion as well as the pigment cells of the sensory organs are also well elucidated. In addition, studies have begun on the morphogenetic processes of neurulation. Remaining challenges include building an embryonic atlas integrating gene expression patterns, cell lineage, and neuronal cell types as well as developing the gene regulatory networks of cell fate specification and integrating them with the genetic control of morphogenesis. WIREs Dev Biol 2016, 5:538-561. doi: 10.1002/wdev.239 For further resources related to this article, please visit the WIREs website. PMID:27328318

  15. Morphological Differences between Larvae of the Ciona intestinalis Species Complex: Hints for a Valid Taxonomic Definition of Distinct Species.

    Directory of Open Access Journals (Sweden)

    Roberta Pennati

    Full Text Available The cosmopolitan ascidian Ciona intestinalis is the most common model species of Tunicata, the sister-group of Vertebrata, and widely used in developmental biology, genomics and evolutionary studies. Recently, molecular studies suggested the presence of cryptic species hidden within the C. intestinalis species, namely C. intestinalis type A and type B. So far, no substantial morphological differences have been identified between individuals belonging to the two types. Here we present morphometric, immunohistochemical, and histological analyses, as well as 3-D reconstructions, of late larvae obtained by cross-fertilization experiments of molecularly determined type A and type B adults, sampled in different seasons and in four different localities. Our data point to quantitative and qualitative differences in the trunk shape of larvae belonging to the two types. In particular, type B larvae exhibit a longer pre-oral lobe, longer and relatively narrower total body length, and a shorter ocellus-tail distance than type A larvae. All these differences were found to be statistically significant in a Discriminant Analysis. Depending on the number of analyzed parameters, the obtained discriminant function was able to correctly classify > 93% of the larvae, with the remaining misclassified larvae attributable to the existence of intra-type seasonal variability. No larval differences were observed at the level of histology and immunohistochemical localization of peripheral sensory neurons. We conclude that type A and type B are two distinct species that can be distinguished on the basis of larval morphology and molecular data. Since the identified larval differences appear to be valid diagnostic characters, we suggest to raise both types to the rank of species and to assign them distinct names.

  16. Morphological Differences between Larvae of the Ciona intestinalis Species Complex: Hints for a Valid Taxonomic Definition of Distinct Species (United States)

    Pennati, Roberta; Ficetola, Gentile Francesco; Brunetti, Riccardo; Caicci, Federico; Gasparini, Fabio; Griggio, Francesca; Sato, Atsuko; Stach, Thomas; Kaul-Strehlow, Sabrina; Gissi, Carmela; Manni, Lucia


    The cosmopolitan ascidian Ciona intestinalis is the most common model species of Tunicata, the sister-group of Vertebrata, and widely used in developmental biology, genomics and evolutionary studies. Recently, molecular studies suggested the presence of cryptic species hidden within the C. intestinalis species, namely C. intestinalis type A and type B. So far, no substantial morphological differences have been identified between individuals belonging to the two types. Here we present morphometric, immunohistochemical, and histological analyses, as well as 3-D reconstructions, of late larvae obtained by cross-fertilization experiments of molecularly determined type A and type B adults, sampled in different seasons and in four different localities. Our data point to quantitative and qualitative differences in the trunk shape of larvae belonging to the two types. In particular, type B larvae exhibit a longer pre-oral lobe, longer and relatively narrower total body length, and a shorter ocellus-tail distance than type A larvae. All these differences were found to be statistically significant in a Discriminant Analysis. Depending on the number of analyzed parameters, the obtained discriminant function was able to correctly classify > 93% of the larvae, with the remaining misclassified larvae attributable to the existence of intra-type seasonal variability. No larval differences were observed at the level of histology and immunohistochemical localization of peripheral sensory neurons. We conclude that type A and type B are two distinct species that can be distinguished on the basis of larval morphology and molecular data. Since the identified larval differences appear to be valid diagnostic characters, we suggest to raise both types to the rank of species and to assign them distinct names. PMID:25955391

  17. New Bioactive Alkyl Sulfates from Mediterranean Tunicates

    Directory of Open Access Journals (Sweden)

    Marialuisa Menna


    Full Text Available Chemical investigation of two species of marine ascidians, Aplidium elegans and Ciona edwardsii, collected in Mediterranean area, led to isolation of a series of alkyl sulfates (compounds 1–5 including three new molecules 1–3. Structures of the new metabolites have been elucidated by spectroscopic analysis. Based on previously reported cytotoxic activity of these type of molecules, compounds 1–3 have been tested for their effects on the growth of two cell lines, J774A.1 (BALB/c murine macrophages and C6 (rat glioma in vitro. Compounds 1 and 2 induced selective concentration-dependent mortality on J774A.1 cells.

  18. Ascidians and the plasticity of the chordate developmental program


    Lemaire, Patrick; Smith, William C.; Nishida, Hiroki


    Little is known about the ancient chordates that gave rise to the first vertebrates, but the descendants of other invertebrate chordates extant at the time still flourish in the ocean. These invertebrates include the cephalochordates and tunicates, whose larvae share with vertebrate embryos a common body plan with a central notochord and a dorsal nerve cord. Tunicates are now thought to be the sister group of vertebrates. However, research based on several species of ascidians, a diverse and ...

  19. Geographic ranges of ascidians from Antarctica and the southeastern Pacific

    Institute of Scientific and Technical Information of China (English)

    Dirk Schories; Karen Sanamyan; Nadja Sanamyan; Mara Jos Daz; Ignacio Garrido; Thomas Heran; Jorge Holtheuer; Gesche Kohlberg


    Historical and novel data on the geographic and bathymetric distribution of ascidians from Antarctic, Magellan and Chilean waters are compiled, and an inventory of taxa comprising 162 species reported over a 150 year period from the Antarctic region South Polar Province (SPP) compiled. The ascidian fauna from the South Shetland Islands (SSI) is compared with that of the Magellan region, Patagonia and the Chilean coast. We collected 46 ascidian species along the Chilean coast, and during four expeditions to King George Island (SSI) by SCUBA between 2003–2012. About 15% of King George Island (SSI) species are observed to occur also in shallow waters of southern Chile (SCL). Few species known from warm temperate southeastern Pacific (Northern Chile, NCL) waters are absent from the Chilean part of the Magellan Province (SCL). With most data contributed from the Chilean coast coming from the SCL, and with limited sampling having been undertaken at depths exceeding 100 m in the NCL, apparent differences in species richness along the Chilean coast could be attributabed to differential sampling effort. We detail 12 species from our Antarctic and Chilean collections in detail, including one, Diplosoma listerianum, not previously reported from Chilean waters, and the genus Botryllus, previously known from them on the basis of a single record.

  20. ANP (Atrial Natriuretic Peptide presence in the heart of a tunicate, Ciona intestinalis.

    Directory of Open Access Journals (Sweden)

    Aldo Gerbino


    Full Text Available Atrial natriuretic peptide was found in the heart of vertebrates, we studied the ANP presence in the heart of Ciona intestinalis. This is animal is very important because of the its evolutionary position between invertebrates and vertebrates. ANP presence was only revealed in myoepithelial cells of the myocardium. Results suggest the hypothesis that ANP is present not only in the vertebrates but also in the invertebrates and in Ciona heart ANP might play a similar role like in the heart of vertebrates.

  1. SNPs and Hox gene mapping in Ciona intestinalis

    Directory of Open Access Journals (Sweden)

    Biffali Elio


    Full Text Available Abstract Background The tunicate Ciona intestinalis (Enterogona, Ascidiacea, a major model system for evolutionary and developmental genetics of chordates, harbours two cryptic species. To assess the degree of intra- and inter-specific genetic variability, we report the identification and analysis of C. intestinalis SNP (Single Nucleotide Polymorphism markers. A SNP subset was used to determine the genetic distance between Hox-5 and -10 genes. Results DNA fragments were amplified from 12 regions of C. intestinalis sp. A. In total, 128 SNPs and 32 one bp indels have been identified within 8 Kb DNA. SNPs in coding regions cause 4 synonymous and 12 non-synonymous substitutions. The highest SNP frequency was detected in the Hox5 and Hox10 intragenic regions. In C. intestinalis, these two genes have lost their archetypal topology within the cluster, such that Hox10 is located between Hox4 and Hox5. A subset of the above primers was used to perform successful amplification in C. intestinalis sp. B. In this cryptic species, 62 SNPs were identified within 3614 bp: 41 in non-coding and 21 in coding regions. The genetic distance of the Hox-5 and -10 loci, computed combining a classical backcross approach with the application of SNP markers, was found to be 8.4 cM (Haldane's function. Based on the physical distance, 1 cM corresponds to 39.5 Kb. Linkage disequilibrium between the aforementioned loci was calculated in the backcross generation. Conclusion SNPs here described allow analysis and comparisons within and between C. intestinalis cryptic species. We provide the first reliable computation of genetic distance in this important model chordate. This latter result represents an important platform for future studies on Hox genes showing deviations from the archetypal topology.

  2. Antibacterial modified diketopiperazines from two ascidians of the genus Didemnum

    Energy Technology Data Exchange (ETDEWEB)

    Kossuga, Miriam H.; Lira, Simone P.; McHugh, Shayna; Torres, Yohandra R.; Berlinck, Roberto G.S. [Universidade de Sao Paulo (USP), Sao Carlos, SP (Brazil). Inst. de Quimica; Lima, Bruna A.; Goncalves, Reginaldo [Universidade Estadual de Campinas, Piracicaba, SP (Brazil). Faculdade de Odontologia. Dept. de Diagnostico Oral; Veloso, Katyuscya; Ferreira, Antonio G. [Universidade Federal de Sao Carlos, SP (Brazil). Dept. de Quimica; Rocha, Rosana M. [Universidade Federal do Parana (UFPR), Curitiba, PR (Brazil). Centro Politecnico. Setor de Ciencias Biologicas. Dept. de Zoologia


    The chemical investigation of the crude extract of an ascidian of the genus Didemnum led to the isolation of the modified diketopiperazine rodriguesines A (1) and (2) as a mixture of homologues, which could be identified by analysis of spectroscopic data including MS/MS experiments. The investigation of a second Didemnum sp. led to the isolation of N-acetyl-rodriguesine A (3) and N-acetyl-rodriguesine B (4). The absolute configuration of compounds 1 and 2 could be established by hydrolysis and Marfey's analysis and comparison with literature data reported for compound 3, previously obtained as a synthetic product. The mixture of 1 and 2 displayed moderate antibiotic activity against a clinical isolate of Streptococcus mutans and against S. mutans UA159 and Staphylococcus aureus ATCC6538. (author)

  3. An exceptional salt tolerant antimicrobial peptide derived from a novel gene family of hemocytes of the marine invertebrate Ciona intestinalis


    Fedders, Henning; Michalek, Matthias; Grötzinger, Joachim; Leippe, Matthias


    Abstract A novel gene family coding for putative antimicrobial peptides was identified in the EST data base of the sea squirt Ciona intestinalis, and one of these genes was molecularly cloned from the Northern European Ciona subspecies. In situ hybridisation and immunocytochemical analysis revealed that the natural peptide is synthesized and stored in a distinct hemocyte type, the univacuolar non-refractile granulocytes. By semiquantitative RT-PCR analysis it was shown that the exp...

  4. Colony specificity and chemotaxis in the compound ascidian Botryllus schlosseri. (United States)

    Cima, Francesca; Sabbadin, Armando; Zaniolo, Giovanna; Ballarin, Loriano


    We re-investigated the behavior of hemocytes during the non-fusion (rejection) reaction between genetically incompatible colonies of the ascidian Botryllus schlosseri. In the course of the reaction, hemocytes - mainly morula cells - crowd inside the blind ends of marginal vascular vessels (known as ampullae) of the colonial leading edge (LE) facing the foreign colony which suggests the occurrence of chemotactic attraction of circulating hemocytes towards the ampullar lumen. Then, cells migrate, through the ampullar tips, into the partially fused tunics and contribute to the formation of the necrotic spots along the contact borders which characterize the reaction. Studies on histological sections clearly indicate that, although morula cell concentration is always higher in ampullae of the LE than in those of the lateral (L) part of the colony, their frequency significantly increases in LE ampullae of rejecting colonies with respect to LE ampullae of both fusing and isolated colonies. In addition, in vitro chemotaxis experiments demonstrated that blood plasma from incompatible colonies can stimulate morula cell migration through polycarbonate filters and this passage is inhibited by antibodies raised against mammalian pro-inflammatory cytokines. The possible nature and role of molecules recognized by anti-cytokine antibodies in hemocyte migration are discussed. PMID:16962802

  5. Immunobiology of compound ascidians, with particular reference to Botryllus schlosseri: state of art

    Directory of Open Access Journals (Sweden)

    L Ballarin


    Full Text Available The phylogenetic position of invertebrate chordates closely related to vertebrates explains the increasing interest towards tunicate immunobiology. Most of the tunicates are ascidians which, like all other invertebrates, rely only on innate immunity for their defense. Compound ascidians differ from solitary species for the presence of colony specificity, i.e. the ability for intraspecific non-self recognition. The immunobiology of compound ascidians has been particularly studied in Botryllus schlosseri, which is an emerging model organism for this kind of studies. In B. schlosseri and related species, immunocytes are represented by phagocytes and cytotoxic morula cells, the former able to ingest foreign cell and particles, the latter representing the effectors of the inflammatory reaction which follows the contact between genetically incompatible colonies. Activated phagocytes release lectins with opsonic activity and are involved in the clearance of apoptotic cells during the colonial generational change. Morula cells recognize the presence of foreign molecules as well as allogeneic soluble factors diffusing from an alien colony and as a consequence they: i release cytokines in the medium which have chemotactic activity and activate phagocytes; ii degranulate and release phenoloxidase which induces necrotic cell death by oxidative stress. A better knowledge of Botryllus genome will allow a deeper insight into open problems in immunobiology of compound ascidians.

  6. Quinone and Hydroquinone Metabolites from the Ascidians of the Genus Aplidium


    Camila Spereta Bertanha; Ana Helena Januário; Tavane Aparecida Alvarenga; Letícia Pereira Pimenta; Silva, Márcio Luis Andrade e; Wilson Roberto Cunha; Patrícia Mendonça Pauletti


    Ascidians of the genus Aplidium are recognized as an important source of chemical diversity and bioactive natural products. Among the compounds produced by this genus are non-nitrogenous metabolites, mainly prenylated quinones and hydroquinones. This review discusses the isolation, structural elucidation, and biological activities of quinones, hydroquinones, rossinones, longithorones, longithorols, floresolides, scabellones, conicaquinones, aplidinones, thiaplidiaquinones, and conithiaquinone...

  7. Modiolarca lateralis (Pteryomorphia: Mytilidae: bivalve associated to six species of ascidians from Bocas del Toro, Panama

    Directory of Open Access Journals (Sweden)

    Juan I Cañete


    Full Text Available We describe the presence of the bivalve Modiolarca lateralis (Say, 1822 in six tropical ascidians Ascidia curvata, A. sydneiensis, A. panamensis, A. interrupta, Herdmania pallida and Polycarpa spongiabilis collected at depths of 1-3 m on coral reefs, mangrove roots and dock supports in Almirante Bay, Bocas del Toro, Panama (9°18'N, 82°13'W during June-July 2011. Bivalve prevalence varied between 9-30% across species, but was mainly associated with A. panamensis, P. spongiabilis and A. interrupta. Prevalence seems to be influenced by tunic thickness rather than by the ascidian size. Bivalves varied in size (0.6-11 mm shell length, with the smallest individual found in A. sydneiensis. There were only one or two bivalves per ascidians, although a maximum of 18 was found in one A. panamensis. M. lateralis seems to behave similarly to its temperate counterparts: it has a variety of hosts, occurs mainly in the anterior region of the ascidians, and has a variable abundance per host.

  8. A novel third complement component C3 gene of Ciona intestinalis expressed in the endoderm at the early developmental stages


    Hibino, T.; Nonaka, M


    The third complement component (C3) in ascidian was reported to function as an opsonin to enhance phagocytosis and as a chemotactic factor for phagocytes, indicating that ascidian C3 works in mesodermal cavity as a humoral factor like vertebrate C3s. In the basal Eumetazoa, Cnidaria lacking mesodermal tissues, C3 was reported to work in an endodermal cavity. Evolution of structure and function of C3 is still to be clarified. Here we report the identification of the third C3 gene, CiC3-3, in t...

  9. Seismic air gun exposure during early-stage embryonic development does not negatively affect spiny lobster Jasus edwardsii larvae (Decapoda: Palinuridae). (United States)

    Day, Ryan D; McCauley, Robert D; Fitzgibbon, Quinn P; Semmens, Jayson M


    Marine seismic surveys are used to explore for sub-seafloor oil and gas deposits. These surveys are conducted using air guns, which release compressed air to create intense sound impulses, which are repeated around every 8-12 seconds and can travel large distances in the water column. Considering the ubiquitous worldwide distribution of seismic surveys, the potential impact of exposure on marine invertebrates is poorly understood. In this study, egg-bearing female spiny lobsters (Jasus edwardsii) were exposed to signals from three air gun configurations, all of which exceeded sound exposure levels (SEL) of 185 dB re 1 μPa(2) · s. Lobsters were maintained until their eggs hatched and the larvae were then counted for fecundity, assessed for abnormal morphology using measurements of larval length and width, tested for larval competency using an established activity test and measured for energy content. Overall there were no differences in the quantity or quality of hatched larvae, indicating that the condition and development of spiny lobster embryos were not adversely affected by air gun exposure. These results suggest that embryonic spiny lobster are resilient to air gun signals and highlight the caution necessary in extrapolating results from the laboratory to real world scenarios or across life history stages. PMID:26947006

  10. When shape matters: strategies of different Antarctic ascidians morphotypes to deal with sedimentation. (United States)

    Torre, Luciana; Abele, Doris; Lagger, Cristian; Momo, Fernando; Sahade, Ricardo


    Climate change leads to increased melting of tidewater glaciers in the Western Antarctic Peninsula region and sediment bearing glacial melt waters negatively affects filter feeding species as solitary ascidians. In previous work the erect-forms Molgula pedunculata and Cnemidocarpa verrucosa (Order Stolidobranchiata) appeared more sensitive than the flat form Ascidia challengeri (Order Phlebobranchiata). Sedimentation exposure is expected to induce up-regulation of anaerobic metabolism by obstructing the organs of gas exchange (environmental hypoxia) or causes enhanced squirting activity (functional hypoxia). In this study we evaluated the possible relationship between ascidian morphotype and their physiological response to sedimentation. Together with some behavioural observations, we analysed the response of anaerobic metabolic parameters (lactate formation and glycogen consumption) in different tissues of three Antarctic ascidians, exposed to high sediment concentrations (200 mgL(-1)). The results were compared to experimental hypoxia (10% pO2) and exercise (induced muscular contraction) effects, in order to discriminate the effect of sediment on each species and morpho-type (erect vs. flat forms). Our results suggest that the styled (erect) C. verrucosa increases muscular squirting activity in order to expulse excessive material, while the flat-form A. challengeri reacts more passively by down-regulating its aerobic metabolism under sediment exposure. Contrary, the erect ascidian M. pedunculata did not show any measurable response to the treatments, indicating that filtration and ingestion activities were not reduced or altered even under high sedimentation (low energetic material) which could be disadvantageous on the long-term and could explain why M. pedunculata densities decline in the study area. PMID:24986145

  11. Quinone and Hydroquinone Metabolites from the Ascidians of the Genus Aplidium

    Directory of Open Access Journals (Sweden)

    Camila Spereta Bertanha


    Full Text Available Ascidians of the genus Aplidium are recognized as an important source of chemical diversity and bioactive natural products. Among the compounds produced by this genus are non-nitrogenous metabolites, mainly prenylated quinones and hydroquinones. This review discusses the isolation, structural elucidation, and biological activities of quinones, hydroquinones, rossinones, longithorones, longithorols, floresolides, scabellones, conicaquinones, aplidinones, thiaplidiaquinones, and conithiaquinones. A compilation of the 13C-NMR spectral data of these compounds is also presented.

  12. Quinone and hydroquinone metabolites from the ascidians of the genus Aplidium. (United States)

    Bertanha, Camila Spereta; Januário, Ana Helena; Alvarenga, Tavane Aparecida; Pimenta, Letícia Pereira; Silva, Márcio Luis Andrade E; Cunha, Wilson Roberto; Pauletti, Patrícia Mendonça


    Ascidians of the genus Aplidium are recognized as an important source of chemical diversity and bioactive natural products. Among the compounds produced by this genus are non-nitrogenous metabolites, mainly prenylated quinones and hydroquinones. This review discusses the isolation, structural elucidation, and biological activities of quinones, hydroquinones, rossinones, longithorones, longithorols, floresolides, scabellones, conicaquinones, aplidinones, thiaplidiaquinones, and conithiaquinones. A compilation of the 13C-NMR spectral data of these compounds is also presented. PMID:24927227

  13. Distribution and Localised Effects of the Invasive Ascidian Didemnum perlucidum (Monniot 1983) in an Urban Estuary. (United States)

    Simpson, Tiffany Schenk; Wernberg, Thomas; McDonald, Justin I


    Didemnid ascidians are notorious marine invaders, fouling infrastructure in many ecosystems globally. However, there have been few reports of direct interactions with native species in their natural environment. The invasive colonial ascidian Didemnum perlucidum was discovered in the Swan River estuary (Western Australia) growing on the native seagrass Halophila ovalis. Given the known effects of other related Didemnum species it was expected that D. perlucidum could adversely affect the seagrass, with possible flow on effects to the rest of the ecosystem. This study aimed to document the distribution and abundance of D. perlucidum in the estuary, and to determine whether this species had a negative impact on H. ovalis or associated flora and fauna. D. perlucidum was largely present near areas of infrastructure, particularly mooring buoys, suggesting these were the source of D. perlucidum recruits on the seagrasses. It showed a clear seasonal pattern in abundance, with highly variable cover and colony size. D. perlucidum had a measurable effect on H. ovalis, with colonies enveloping all plant tissue, likely restricting the photosynthetic ability of individual leaves and total plant biomass. There were also significantly less seagrass-associated mud snails (Batillaria australis) where D. perlucidum cover was high. These results demonstrate the ability of invasive ascidians to colonise and affect native seagrasses and associated biota. Seagrasses are pivotal to the ecological function of many urban estuaries world-wide. Biodiversity in these systems is already vulnerable to multiple stressors from human activities but the potential stress of fouling ascidians may pose an additional and increasing threat in the future. PMID:27144600

  14. Ultrastructures and Classification of Circulating Hemocytes in 9 Botryllid Ascidians (Chordata: Ascidiacea)


    Hirose, Euichi; Shirae, Maki; Saito, Yasunori


    Ultrastructures of circulating hemocytes were studied in 9 botryllid ascidians. The hemocytes are classified into five types: hemoblasts, phagocytes, granulocytes, morula cells, and pigment cells. These five types are always found in the 9 species. They should represent the major hemocyte types of the circulating cells in the blood. Hemoblasts are small hemocytes having a high nucleus/cytoplasm ratio. There are few granular or vacuolar inclusions in the cytoplasm. Phagocytes have phagocytic a...

  15. Solitary ascidians embryos (Chordata, Tunicata) as model organisms for testing coastal pollutant toxicity


    G Zega; R. Pennati; S Candiani; M Pestarino; Bernardi, F


    Marine coastal communities are daily exposed to several chemical compounds commonly used in agriculture and industrial activities. Therefore, toxicological studies evaluating the effects of these compounds on marine organisms are of primary importance for marine environment preservation. Different model organisms are used to perform toxicity tests with potential pollutants, under laboratory conditions. In last decades, solitary ascidians have been selected as valuable model organisms to run b...

  16. A saturation screen for cis-acting regulatory DNA in the Hox genes of Ciona intestinalis

    Energy Technology Data Exchange (ETDEWEB)

    Keys, David N.; Lee, Byung-in; Di Gregorio, Anna; Harafuji, Naoe; Detter, Chris; Wang, Mei; Kahsai, Orsalem; Ahn, Sylvia; Arellano, Andre; Zhang, Quin; Trong, Stephan; Doyle, Sharon A.; Satoh, Noriyuki; Satou, Yutaka; Saiga, Hidetoshi; Christian, Allen; Rokhsar, Dan; Hawkins, Trevor L.; Levine, Mike; Richardson, Paul


    A screen for the systematic identification of cis-regulatory elements within large (>100 kb) genomic domains containing Hox genes was performed by using the basal chordate Ciona intestinalis. Randomly generated DNA fragments from bacterial artificial chromosomes containing two clusters of Hox genes were inserted into a vector upstream of a minimal promoter and lacZ reporter gene. A total of 222 resultant fusion genes were separately electroporated into fertilized eggs, and their regulatory activities were monitored in larvae. In sum, 21 separable cis-regulatory elements were found. These include eight Hox linked domains that drive expression in nested anterior-posterior domains of ectodermally derived tissues. In addition to vertebrate-like CNS regulation, the discovery of cis-regulatory domains that drive epidermal transcription suggests that C. intestinalis has arthropod-like Hox patterning in the epidermis.

  17. Solitary ascidians embryos (Chordata, Tunicata as model organisms for testing coastal pollutant toxicity

    Directory of Open Access Journals (Sweden)

    G Zega


    Full Text Available Marine coastal communities are daily exposed to several chemical compounds commonly used in agriculture and industrial activities. Therefore, toxicological studies evaluating the effects of these compounds on marine organisms are of primary importance for marine environment preservation. Different model organisms are used to perform toxicity tests with potential pollutants, under laboratory conditions. In last decades, solitary ascidians have been selected as valuable model organisms to run bioassays with embryos and larvae. In fact, by in vitro fertilization, it is easy to obtain thousands of embryos, rapidly developing and therefore allowing a fast screen of pollutant toxicity.The aim of this review was to summarize results from toxicity tests, run with heavy metals, organo-metal and organic compounds, on solitary ascidian development and settlement to evidence that these animals offer several advantages as models to perform these kind of studies. First of all, they have a sensitiveness directly comparable to that of other marine model organisms. Moreover, the effects of toxicants on exposed embryos and larvae could be studied using different approaches, from ultrastructure to genetic analysis. Finally, since ascidians are chordates morphological and gene expression analyses could provide data for comparative studies with vertebrates.

  18. The venom gland transcriptome of the Desert Massasauga Rattlesnake (Sistrurus catenatus edwardsii: towards an understanding of venom composition among advanced snakes (Superfamily Colubroidea

    Directory of Open Access Journals (Sweden)

    Mackessy Stephen P


    Full Text Available Abstract Background Snake venoms are complex mixtures of pharmacologically active proteins and peptides which belong to a small number of superfamilies. Global cataloguing of the venom transcriptome facilitates the identification of new families of toxins as well as helps in understanding the evolution of venom proteomes. Results We have constructed a cDNA library of the venom gland of a threatened rattlesnake (a pitviper, Sistrurus catenatus edwardsii (Desert Massasauga, and sequenced 576 ESTs. Our results demonstrate a high abundance of serine proteinase and metalloproteinase transcripts, indicating that the disruption of hemostasis is a principle mechanism of action of the venom. In addition to the transcripts encoding common venom proteins, we detected two varieties of low abundance unique transcripts in the library; these encode for three-finger toxins and a novel toxin possibly generated from the fusion of two genes. We also observed polyadenylated ribosomal RNAs in the venom gland library, an interesting preliminary obsevation of this unusual phenomenon in a reptilian system. Conclusion The three-finger toxins are characteristic of most elapid venoms but are rare in viperid venoms. We detected several ESTs encoding this group of toxins in this study. We also observed the presence of a transcript encoding a fused protein of two well-characterized toxins (Kunitz/BPTI and Waprins, and this is the first report of this kind of fusion in a snake toxin transcriptome. We propose that these new venom proteins may have ancillary functions for envenomation. The presence of a fused toxin indicates that in addition to gene duplication and accelerated evolution, exon shuffling or transcriptional splicing may also contribute to generating the diversity of toxins and toxin isoforms observed among snake venoms. The detection of low abundance toxins, as observed in this and other studies, indicates a greater compositional similarity of venoms (though

  19. Functional Brachyury binding sites establish a temporal read-out of gene expression in the Ciona notochord.


    Lavanya Katikala; Hitoshi Aihara; Passamaneck, Yale J.; Stefan Gazdoiu; José-Edwards, Diana S.; Kugler, Jamie E.; Izumi Oda-Ishii; Janice H Imai; Yutaka Nibu; Anna Di Gregorio


    Author Summary Transcription factors control where and when gene expression is switched on by binding to specific stretches of DNA known as cis-regulatory modules (CRMs). In this study, we investigated the architecture and composition of CRMs that direct gene expression in the notochord—a transient rod-like structure found in all embryos that belong to the phylum chordata, which includes humans. Here we used the sea squirt Ciona, a simple chordate, and analyzed how the transcription factor Br...

  20. Nitric oxide acts as a positive regulator to induce metamorphosis of the ascidian Herdmania momus.

    Directory of Open Access Journals (Sweden)

    Nobuo Ueda

    Full Text Available Marine invertebrates commonly have a biphasic life cycle in which the metamorphic transition from a pelagic larva to a benthic post-larva is mediated by the nitric oxide signalling pathway. Nitric oxide (NO is synthesised by nitric oxide synthase (NOS, which is a client protein of the molecular chaperon heat shock protein 90 (HSP90. It is notable, then, that both NO and HSP90 have been implicated in regulating metamorphosis in marine invertebrates as diverse as urochordates, echinoderms, molluscs, annelids, and crustaceans. Specifically, the suppression of NOS activity by the application of either NOS- or HSP90-inhibiting pharmacological agents has been shown consistently to induce the initiation of metamorphosis, leading to the hypothesis that a negative regulatory role of NO is widely conserved in biphasic life cycles. Further, the induction of metamorphosis by heat-shock has been demonstrated for multiple species. Here, we investigate the regulatory role of NO in induction of metamorphosis of the solitary tropical ascidian, Herdmania momus. By coupling pharmacological treatments with analysis of HmNOS and HmHSP90 gene expression, we present compelling evidence of a positive regulatory role for NO in metamorphosis of this species, in contrast to all existing ascidian data that supports the hypothesis of NO as a conserved negative regulator of metamorphosis. The exposure of competent H. momus larvae to a NOS inhibitor or an NO donor results in an up-regulation of NOS and HSP90 genes. Heat shock of competent larvae induces metamorphosis in a temperature dependent manner, up to a thermal tolerance that approaches 35°C. Both larval/post-larval survival and the appearance of abnormal morphologies in H. momus post-larvae reflect the magnitude of up-regulation of the HSP90 gene in response to heat-shock. The demonstrated role of NO as a positive metamorphic regulator in H. momus suggests the existence of inter-specific adaptations of NO regulation

  1. Complete DNA sequence of the mitochondrial genome of the ascidian Halocynthia roretzi (Chordata, Urochordata).


    Yokobori, S i; Ueda, T.; Feldmaier-Fuchs, G; Pääbo, S; Ueshima, R.; Kondow, A; Nishikawa, K.; Watanabe, K.


    The complete nucleotide sequence of the 14,771-bp-long mitochondrial (mt) DNA of a urochordate (Chordata)-the ascidian Halocynthia roretzi-was determined. All the Halocynthia mt-genes were found to be located on a single strand, which is rich in T and G rather than in A and C. Like nematode and Mytilus edulis mtDNAs, that of Halocynthia encodes no ATP synthetase subunit 8 gene. However, it does encode an additional tRNA gene for glycine (anticodon TCT) that enables Halocynthia mitochondria to...

  2. An endocrine disruptor, bisphenol A, affects development in the protochordate Ciona intestinalis: Hatching rates and swimming behavior alter in a dose-dependent manner

    International Nuclear Information System (INIS)

    Bisphenol A (BPA) is widely used industrially to produce polycarbonate plastics and epoxy resins. Numerous studies document the harmful effects caused by low-dose BPA exposure especially on nervous systems and behavior in experimental animals such as mice and rats. Here, we exposed embryos of a model chordate, Ciona intestinalis, to seawater containing BPA to evaluate adverse effects on embryonic development and on the swimming behavior of subsequent larvae. Ciona is ideal because its larva develops rapidly and has few cells. The rate of larval hatching decreased in a dose-dependent manner with exposures to BPA above 3 μM; swimming behavior was also affected in larvae emerging from embryos exposed to 1 μM BPA. Adverse effects were most severe on fertilized eggs exposed to BPA within 7 h post-fertilization. Ciona shares twelve nuclear receptors with mammals, and BPA is proposed to disturb the physiological functions of one or more of these. - Highlights: ► Embryos of Ciona intestinalis were exposed to BPA to evaluate its developmental effects. ► The rate of larval hatching decreased in a dose-dependent manner. ► Swimming behavior was affected in larvae that emerge from embryos exposed to 1 μM BPA. ► Our findings will support a new strategy to analyze the developmental effects induced by BPA. - Exposure of fertilized Ciona embryos to BPA decreased their hatch rate in a dose-dependent manner and led to abnormal larval swimming behavior.

  3. Expression of the Ciona intestinalis alternative oxidase (AOX) in Drosophila complements defects in mitochondrial oxidative phosphorylation. (United States)

    Fernandez-Ayala, Daniel J M; Sanz, Alberto; Vartiainen, Suvi; Kemppainen, Kia K; Babusiak, Marek; Mustalahti, Eero; Costa, Rodolfo; Tuomela, Tea; Zeviani, Massimo; Chung, Jongkyeong; O'Dell, Kevin M C; Rustin, Pierre; Jacobs, Howard T


    Defects in mitochondrial OXPHOS are associated with diverse and mostly intractable human disorders. The single-subunit alternative oxidase (AOX) found in many eukaryotes, but not in arthropods or vertebrates, offers a potential bypass of the OXPHOS cytochrome chain under conditions of pathological OXPHOS inhibition. We have engineered Ciona intestinalis AOX for conditional expression in Drosophila melanogaster. Ubiquitous AOX expression produced no detrimental phenotype in wild-type flies. However, mitochondrial suspensions from AOX-expressing flies exhibited a significant cyanide-resistant substrate oxidation, and the flies were partially resistant to both cyanide and antimycin. AOX expression was able to complement the semilethality of partial knockdown of both cyclope (COXVIc) and the complex IV assembly factor Surf1. It also rescued the locomotor defect and excess mitochondrial ROS production of flies mutated in dj-1beta, a Drosophila homolog of the human Parkinson's disease gene DJ1. AOX appears to offer promise as a wide-spectrum therapeutic tool in OXPHOS disorders. PMID:19416715

  4. The repertoire of heterotrimeric G proteins and RGS proteins in Ciona intestinalis.

    Directory of Open Access Journals (Sweden)

    R Prasobh

    Full Text Available BACKGROUND: Heterotrimeric G proteins and regulators of G protein signaling (RGS proteins are key downstream interacting partners in the G protein coupled receptor (GPCR signaling pathway. The highly versatile GPCR transmembrane signaling system is a consequence of the coupling of a diverse set of receptors to downstream partners that include multiple subforms of G proteins and regulatory proteins including RGS proteins, among others. While the GPCR repertoire of Ciona intestinalis, representing the basal chordate is known, the repertoire of the heterotrimeric G proteins and RGS proteins is unknown. METHODOLOGY/PRINCIPAL FINDINGS: In the present study, we performed an in-silico genome-wide search of C. intestinalis for its complement of G proteins and RGS proteins. The identification of several one-to-one orthologs of human G proteins at the levels of families, subfamilies and types and of homologs of the human RGS proteins suggests an evolutionarily conserved structure function relationship of the GPCR signaling mechanism in the chordates. CONCLUSIONS: The C. intestinalis genome encodes a highly conserved, albeit, limited repertoire of the heterotrimeric G protein complexes with the size of subunit types comparable with that in lower eukaryotes.

  5. Genomic analyses reveal a conserved glutathione homeostasis pathway in the invertebrate chordate Ciona intestinalis (United States)

    Nava, Gerardo M.; Lee, David Y.; Ospina, Javier H.; Cai, Shi-Ying


    The major thiol redox buffer glutathione (l-γ-glutamyl-l-cysteinylglycine, GSH) is central to cell fate determination, and thus, associated metabolic and regulatory pathways are exquisitely sensitive to a wide range of environmental cues. An imbalance of cellular redox homeostasis has emerged as a pathologic hallmark of a diverse range of human gene-environment disorders. Despite the central importance of GSH in cellular homeostasis, underlying genetic regulatory pathways remain poorly defined. This report describes the annotation and expression analysis of genes contributing to GSH homeostasis in the invertebrate chordate Ciona intestinalis. A core pathway comprising 19 genes contributing to the biosynthesis of GSH and its use as both a redox buffer and a conjugate in phase II detoxification as well as known transcriptional regulators were analyzed. These genes exhibit a high level of sequence conservation with corresponding human, rat, and mouse homologs and were expressed constitutively in tissues of adult animals. The GSH biosynthetic genes Gclc and Gclm were also responsive to the prototypical antioxidant tert-butylhydroquinone. The present evidence of a conserved GSH homeostasis pathway in C. intestinalis together with its phylogenetic position as a basal chordate and lifestyle as a filter feeder constantly exposed to natural marine toxins introduces this species as an important animal model for defining molecular mechanisms that potentially underlie genetic susceptibility to environmentally associated stress. PMID:19470804

  6. DNA barcoding of two solitary ascidians, Herdmania momus Savigny, 1816 and Microcosmus squamiger Michaelsen, 1927 from Thoothukudi coast, India. (United States)

    Jaffar Ali, H Abdul; Ahmed, N Shabeer


    Morphology-based taxonomical studies of ascidians in India are meagre due to lack of ascidian taxonomist and limitations inherent in conventional system-based identification. The use of short fragment of mitochondrial DNA sequence is proving highly useful in identifying species in a situation where, the traditional morphology-based identification is difficult. In the present study, two adult solitary ascidians collected from the Thoothukudi coast were morphologically identified as Herdmania momus Savigny, 1816 and Microcosmus squamiger Michaelsen, 1927. The genomic DNA of these ascidians was isolated, COI gene was amplified, sequenced and submitted to the GenBank under the accession numbers KM058116, KM411616 and KJ944390. Homology search result using BLAST showed that H. momus showed 100% matched with other H. momus, while M. squamiger showed similarity with Pyura herdmani, a member of the same family Pyuridae. The phylogenetic and genetic distance was maximum in interspecies than in intraspecies. These COI sequences will allow the identification of the species through DNA barcoding technique. Here, we report for the first time the COI gene of H. momus, Savigny 1816 from the Indian coast. PMID:26122341

  7. Significant reduction in allergenicity of ovalbumin from chicken egg white following treatment with ascidian viscera N-acetylglucosaminidase. (United States)

    Hwang, Hye Seong; Park, Heajin; Kim, Jihye; Choi, Jai Yeon; Lee, Young Kwang; Park, Ho-Young; Choi, Hee-Don; Kim, Ha Hyung


    Ovalbumin (OA) is the most abundant ingredient of chicken egg-white allergenic proteins. In the present study we investigated the possibility of reducing OA allergenicity by treatment with a natural protein exhibiting N-acetylglucosaminidase (NA) activity. Ascidian is cultivated as a food resource in northeast Asia. The ascidian viscera NA (AVNA) with almost no other exoglycosidases or proteolytic enzymes was isolated by applying size-exclusion chromatography to a protein precipitate of ascidian viscera. Intact OA was mixed with AVNA containing 0.2, 1.0, and 5.0 Units of NA. Anion-exchange chromatography was then used to isolate OA from AVNA-treated OA. The electrophoretic patterns and N-glycans of each isolated OA from AVNA-treated OA (iOA) were analyzed, and the terminal N-acetylglucosamines of iOA were selectively cleaved with no other degradation occurring. A competitive indirect enzyme-linked immunosorbent assay using rabbit anti-OA sera was performed to investigate the allergenicity of iOA, which was found to be significantly reduced depending on the increased NA activity compared to that of intact OA. These results indicate that OA allergenicity was reduced using a simple and mild treatment process with AVNA, and suggest that ascidian NA is an efficient natural protein for reducing the allergenicity of OA without requiring the use of harsh physical treatments or chemical conjugation. PMID:27178210

  8. Characterization and transcription studies of a phytochelatin synthase gene from the solitary tunicate Ciona intestinalis exposed to cadmium

    Energy Technology Data Exchange (ETDEWEB)

    Franchi, Nicola [Department of Biology, University of Padova, Padova (Italy); Department of Biological, Chemical, Pharmaceutical Science and Technology, University of Palermo, Palermo (Italy); Piccinni, Ester [Department of Biology, University of Padova, Padova (Italy); Ferro, Diana [Department of Biology, University of Padova, Padova (Italy); Institute for Evolution and Biodiversity, Westfälische Wilhelms-Universität, Münster (Germany); Basso, Giuseppe [Department of Woman and Child Health, University of Padova, Padova (Italy); Spolaore, Barbara [CRIBI Biotechnology Centre, University of Padova, Padova (Italy); Department of Pharmaceutical and Pharmacological Sciences, University of Padova, Padova (Italy); Santovito, Gianfranco, E-mail: [Department of Biology, University of Padova, Padova (Italy); Ballarin, Loriano [Department of Biology, University of Padova, Padova (Italy)


    Highlights: • Ciona intestinalis have a functional phytochelatin synthase (PCS) gene (cipcs). • CiPCS amino acid sequence is phylogentically related to other metazoan PCSs. • CiPCS catalyze the synthesis of PC2. • cipcs are mostly transcribed in circulating hemocytes, in both tunic and blood lacunae. • Cadmium exposure results in a significant increase of cipcs and cipcna transcription. - Abstract: The major thiol-containing molecules involved in controlling the level of intracellular ROS in eukaryotes, acting as a nonenzymatic detoxification system, are metallothioneins (MTs), glutathione (GSH) and phytochelatins (PCs). Both MTs and GSH are well-known in the animal kingdom. PC was considered a prerogative of the plant kingdom but, in 2001, a phytochelatin synthase (PCS) gene was described in the nematode Caenorhabditis elegans; additional genes encoding this enzyme were later described in the earthworm Eisenia fetida and in the parasitic nematode Schistosoma mansoni but scanty data are available, up to now, for Deuterostomes. Here, we describe the molecular characteristics and transcription pattern, in the presence of Cd, of a PCS gene from the invertebrate chordate Ciona intestinalis, a ubiquitous solitary tunicate and demonstrate the presence of PCs in tissue extracts. We also studied mRNA localization by in situ hybridization. In addition, we analyzed the behavior of hemocytes and tunic cells consequent to Cd exposure as well as the transcription pattern of the Ciona orthologous for proliferating cell nuclear antigen (PCNA), usually considered a proliferation marker, and observed that cell proliferation occurs after 96 h of Cd treatment. This matches the hypothesis of Cd-induced cell proliferation, as already suggested by previous data on the expression of a metallothionein gene in the same animal.

  9. Characterization and transcription studies of a phytochelatin synthase gene from the solitary tunicate Ciona intestinalis exposed to cadmium

    International Nuclear Information System (INIS)

    Highlights: • Ciona intestinalis have a functional phytochelatin synthase (PCS) gene (cipcs). • CiPCS amino acid sequence is phylogentically related to other metazoan PCSs. • CiPCS catalyze the synthesis of PC2. • cipcs are mostly transcribed in circulating hemocytes, in both tunic and blood lacunae. • Cadmium exposure results in a significant increase of cipcs and cipcna transcription. - Abstract: The major thiol-containing molecules involved in controlling the level of intracellular ROS in eukaryotes, acting as a nonenzymatic detoxification system, are metallothioneins (MTs), glutathione (GSH) and phytochelatins (PCs). Both MTs and GSH are well-known in the animal kingdom. PC was considered a prerogative of the plant kingdom but, in 2001, a phytochelatin synthase (PCS) gene was described in the nematode Caenorhabditis elegans; additional genes encoding this enzyme were later described in the earthworm Eisenia fetida and in the parasitic nematode Schistosoma mansoni but scanty data are available, up to now, for Deuterostomes. Here, we describe the molecular characteristics and transcription pattern, in the presence of Cd, of a PCS gene from the invertebrate chordate Ciona intestinalis, a ubiquitous solitary tunicate and demonstrate the presence of PCs in tissue extracts. We also studied mRNA localization by in situ hybridization. In addition, we analyzed the behavior of hemocytes and tunic cells consequent to Cd exposure as well as the transcription pattern of the Ciona orthologous for proliferating cell nuclear antigen (PCNA), usually considered a proliferation marker, and observed that cell proliferation occurs after 96 h of Cd treatment. This matches the hypothesis of Cd-induced cell proliferation, as already suggested by previous data on the expression of a metallothionein gene in the same animal

  10. The Simple Chordate Ciona intestinalis Has a Reduced Complement of Genes Associated with Fanconi Anemia (United States)

    Stanley, Edward C.; Azzinaro, Paul A.; Vierra, David A.; Howlett, Niall G.; Irvine, Steven Q.


    Fanconi anemia (FA) is a human genetic disease characterized by congenital defects, bone marrow failure, and increased cancer risk. FA is associated with mutation in one of 24 genes. The protein products of these genes function cooperatively in the FA pathway to orchestrate the repair of DNA interstrand cross-links. Few model organisms exist for the study of FA. Seeking a model organism with a simpler version of the FA pathway, we searched the genome of the simple chordate Ciona intestinalis for homologs of the human FA-associated proteins. BLAST searches, sequence alignments, hydropathy comparisons, maximum likelihood phylogenetic analysis, and structural modeling were used to infer the likelihood of homology between C. intestinalis and human FA proteins. Our analysis indicates that C. intestinalis indeed has a simpler and potentially functional FA pathway. The C. intestinalis genome was searched for candidates for homology to 24 human FA and FA-associated proteins. Support was found for the existence of homologs for 13 of these 24 human genes in C. intestinalis. Members of each of the three commonly recognized FA gene functional groups were found. In group I, we identified homologs of FANCE, FANCL, FANCM, and UBE2T/FANCT. Both members of group II, FANCD2 and FANCI, have homologs in C. intestinalis. In group III, we found evidence for homologs of FANCJ, FANCO, FANCQ/ERCC4, FANCR/RAD51, and FANCS/BRCA1, as well as the FA-associated proteins ERCC1 and FAN1. Evidence was very weak for the existence of homologs in C. intestinalis for any other recognized FA genes. This work supports the notion that C. intestinalis, as a close relative of vertebrates, but having a much reduced complement of FA genes, offers a means of studying the function of certain FA proteins in a simpler pathway than that of vertebrate cells. PMID:27279728

  11. Two New Tryptamine Derivatives, Leptoclinidamide and (--Leptoclinidamine B, from an Indonesian Ascidian Leptoclinides dubius

    Directory of Open Access Journals (Sweden)

    Michio Namikoshi


    Full Text Available Two new tryptamine-derived alkaloids, named as leptoclinidamide (1 and (--leptoclinidamine B (2, were isolated from an Indonesian ascidian Leptoclinides dubius together with C2-α-D-mannosylpyranosyl-L-tryptophan (3. The structure of 1 was assigned on the basis of spectroscopic data for 1 and its N-acetyl derivative (4. Compound 1 was an amide of tryptamine with two β-alanine units. Although the planar structure of 2 is identical to that of the known compound (+-leptoclinidamine B (5, compound 2 was determined to be the enantiomer of 5 based on amino acid analysis using HPLC methods. Compounds 1 to 4 were evaluated for cytotoxicity against two human cancer cell lines, HCT-15 (colon and Jurkat (T-cell lymphoma cells, but none of the compounds showed activity.

  12. Ciona intestinalis as a Marine Model System to Study Some Key Developmental Genes Targeted by the Diatom-Derived Aldehyde Decadienal (United States)

    Lettieri, Anna; Esposito, Rosaria; Ianora, Adrianna; Spagnuolo, Antonietta


    The anti-proliferative effects of diatoms, described for the first time in copepods, have also been demonstrated in benthic invertebrates such as polychaetes, sea urchins and tunicates. In these organisms PUAs (polyunsaturated aldehydes) induce the disruption of gametogenesis, gamete functionality, fertilization, embryonic mitosis, and larval fitness and competence. These inhibitory effects are due to the PUAs, produced by diatoms in response to physical damage as occurs during copepod grazing. The cell targets of these compounds remain largely unknown. Here we identify some of the genes targeted by the diatom PUA 2-trans-4-trans-decadienal (DD) using the tunicate Ciona intestinalis. The tools, techniques and genomic resources available for Ciona, as well as the suitability of Ciona embryos for medium-to high-throughput strategies, are key to their employment as model organisms in different fields, including the investigation of toxic agents that could interfere with developmental processes. We demonstrate that DD can induce developmental aberrations in Ciona larvae in a dose-dependent manner. Moreover, through a preliminary analysis, DD is shown to affect the expression level of genes involved in stress response and developmental processes. PMID:25789602

  13. Distribution and invasiveness of a colonial ascidian, Didemnum psammathodes, along the southern Indian coastal water

    Directory of Open Access Journals (Sweden)

    H. Abdul Jaffar


    Full Text Available Ascidians are well known worldwide for their rapid invasions and also for the presence of potential biomedical molecules. Members of the family Didemnidae are widely distributed in tropical waters and they are reported to be among the families possessing rich bioactive compounds. Didemnum psammathodes has a cosmopolitan distribution in tropical waters. The growing evidence of multifarious potential and ever increasing invasion of this species accentuated the need for additional research into its diversity and distribution for sustainable utilization and conservation. The present study was intended to focus on distribution and invasiveness of colonial ascidian, D. psammathodes, along the southern Indian peninsular waters. The present data are based on our own observations made during 2012–2014 period and also on the published and unpublished records of the last 20 years. Out of 45 stations surveyed, D. psammathodes was encountered at a maximum of 41 stations and was found to be more abundant in Hare Island (n = 42, North Break Water (n = 38 and Vizhinjam bay (n = 32. This species was absent at four different stations. Catch per unit effort was higher (19.6 in Hare Island followed by NBW (16.0 and Vizhinjam bay (6.8. The highest number of colonies (136 was observed in calcareous stones, followed by embedded rocks (54 and molluscan shells (33. Hydrographical parameters showed no significant differences between the stations (p < 0.005. It is concluded that D. psammathodes has the potential to invade most of the stations and its distribution was not influenced by hydrographical parameters rather than substrates.

  14. Evaluation of antibacterial activity of crude extracts of ascidian Didemnum psammathodes Sluiter, 1895 against isolated human and fish pathogens

    Institute of Scientific and Technical Information of China (English)

    N Sri Kumaran; S Bragadeeswaran; VK Meenakshi


    Objective: To evaluate the antimicrobial activities of ascidian Didemnum psammathodes (D. psammathodes) against human and fish pathogenic organisms. Methods: In this study antimicrobial activities were carried out by standard disc diffusion method. In this experiment 40 human, fish bacterial and fungal pathogens were isolated and assayed against 7 different solvents such as methanol, acetone, ethanol, n-butanol, chloroform, ethyl acetate and dichloromethane. Each solvent were assayed at different concentrations of 25, 50, 75, 100 mg/mL. Results: From this experiment solvent having higher concentrations showed high inhibition activity and the fungi are showed more resistant than the bacterial strains used. Conclusions: These results indicate that the ascidian D. psammathodes is found to have remarkable antimicrobial activities against isolated microbes. Further studies will fulfill for purification and structural elucidation of antimicrobial drugs.

  15. Microenvironmental Ecology of the Chlorophyll b-containing Symbiotic Cyanobacterium Prochloron in the Didemnid Ascidian Lissoclinum patella

    Directory of Open Access Journals (Sweden)

    Michael eKühl


    Full Text Available The discovery of the cyanobacterium Prochloron was the first finding of a bacterial oxyphototroph with chlorophyll (Chl b, in addition to Chl a. It was first described as Prochloron didemni but a number of clades have since been described. Prochloron is a conspicuously large (7-25 µm unicellular cyanobacterium living in a symbiotic relationship, primarily with (sub- tropical didemnid ascidians; it has resisted numerous cultivation attempts and appears truly obligatory symbiotic. Recently, a Prochloron draft genome was published, revealing no lack of metabolic genes that could explain the apparent inability to reproduce and sustain photosynthesis in a free-living stage. Possibly, the unsuccessful cultivation is partly due to a lack of knowledge about the microenvironmental conditions and ecophysiology of Prochloron in its natural habitat. We used microsensors, variable chlorophyll fluorescence imaging and imaging of O2 and pH to obtain a detailed insight to the microenvironmental ecology and photobiology of Prochloron in hospite in the didemnid ascidian Lissoclinum patella. The microenvironment within ascidians is characterized by steep gradients of light and chemical parameters that change rapidly with varying irradiances. The interior zone of the ascidians harboring Prochloron thus became anoxic and acidic within a few min of darkness, while the same zone exhibited O2 super-saturation and strongly alkaline pH after a few min of illumination. Photosynthesis showed lack of photoinhibition even at high irradiances equivalent to full sunlight, and photosynthesis recovered rapidly after periods of anoxia. We discuss these new insights on the ecological niche of Prochloron and possible interactions with its host and other microbes in light of its recently published genome and a recent study of the overall microbial diversity and metagenome of L. patella.

  16. Studies on the seasonal variations in the proximate composition of ascidians from the Palk Bay,Southeast coast of India

    Institute of Scientific and Technical Information of China (English)

    Ananthan; G; Karthikeyan; MM; Selva; Prabhu; A; Raghunathan; C


    Objective:To investigate the seasonal fluctuations of the proximate composition of the ascidians muscle.Methods:The moisture content was estimated by drying 1 g of fresh tissue at a constant temperature at 105(?)for 24 h.The loss of weight was taken as moisture content.The total protein was estimated using the Biuret method.The total carbohydrate in dried sample was estimated spectrophotometrically following the phenol-sulphuric acid method.The lipid in the dried sample tissue was gravimetrically estimated following the chloroform-methanol mixture method.Ash content was determined gravimetrically by incinerating 1 g dried sample in muffle furnace at about 550℃for 6 h and results are expressed in percentage.Results:It was found very difficult to compare the monthly variations,as all the ten species,exhibited wide fluctuations in their proximate compositions.For the sake of convenience,average seasonal values were calculated by summing the monthly values.Conclusions:The proximate composition of the 10 commonly available ascidians showed high nutritive value and hence these groups especially solitary ascidians can be recommended for human consumption in terms of pickles,soup,curry and others after ensuring the safety of consumers.

  17. Studies on the seasonal variations in the proximate composition of ascidians from the Palk Bay, Southeast coast of India

    Institute of Scientific and Technical Information of China (English)

    Ananthan G; Karthikeyan MM; Selva Prabhu A; Raghunathan C


    To investigate the seasonal fluctuations of the proximate composition of the ascidians muscle. Methods: The moisture content was estimated by drying 1 g of fresh tissue at a constant temperature at 105 ℃ for 24 h.The loss of weight was taken as moisture content. The total protein was estimated using the Biuret method. The total carbohydrate in dried sample was estimated spectrophotometrically following the phenol- sulphuric acid method. The lipid in the dried sample tissue was gravimetrically estimated following the chloroform-methanol mixture method. Ash content was determined gravimetrically by incinerating 1 g dried sample in muffle furnace at about 550 ℃ for 6 h and results are expressed in percentage. Results: It was found very difficult to compare the monthly variations, as all the ten species, exhibited wide fluctuations in their proximate compositions. For the sake of convenience, average seasonal values were calculated by summing the monthly values. Conclusions: The proximate composition of the 10 commonly available ascidians showed high nutritive value and hence these groups especially solitary ascidians can be recommended for human consumption in terms of pickles, soup, curry and others after ensuring the safety of consumers.

  18. Evidence that talin alternative splice variants from Ciona intestinalis have different roles in cell adhesion

    Directory of Open Access Journals (Sweden)

    McCann Richard O


    Full Text Available Abstract Background Talins are large, modular cytoskeletal proteins found in animals and amoebozoans such as Dictyostelium discoideum. Since the identification of a second talin gene in vertebrates, it has become increasingly clear that vertebrate Talin1 and Talin2 have non-redundant roles as essential links between integrins and the actin cytoskeleton in distinct plasma membrane-associated adhesion complexes. The conserved C-terminal I/LWEQ module is important for talin function. This structural element mediates the interaction of talins with F-actin. The I/LWEQ module also targets mammalian Talin1 to focal adhesion complexes, which are dynamic multicomponent assemblies required for cell adhesion and cell motility. Although Talin1 is essential for focal adhesion function, Talin2 is not targeted to focal adhesions. The nonvertebrate chordate Ciona intestinalis has only one talin gene, but alternative splicing of the talin mRNA produces two proteins with different C-terminal I/LWEQ modules. Thus, C. intestinalis contains two talins, Talin-a and Talin-b, with potentially different activities, despite having only one talin gene. Results We show here that, based on their distribution in cDNA libraries, Talin-a and Talin-b are differentially expressed during C. intestinalis development. The I/LWEQ modules of the two proteins also have different affinities for F-actin. Consistent with the hypothesis that Talin-a and Talin-b have different roles in cell adhesion, the distinct I/LWEQ modules of Talin-a and Talin-b possess different subcellular targeting determinants. The I/LWEQ module of Talin-a is targeted to focal adhesions, where it most likely serves as the link between integrin and the actin cytoskeleton. The Talin-b I/LWEQ module is not targeted to focal adhesions, but instead preferentially labels F-actin stress fibers. These different properties of C. intestinalis the Talin-a and Talin-b I/LWEQ modules mimic the differences between mammalian

  19. Ecological observations on the colonial ascidian Didemnum sp. in a New England tide pool habitat (United States)

    Valentine, P.C.; Carman, M.R.; Blackwood, D.S.; Heffron, E.J.


    The colonial ascidian Didemnum sp. has colonized northwestern Atlantic coastal habitats from southern Long Island, New York, to Eastport, Maine. It is also present in offshore habitats of the Georges Bank fishing grounds. It threatens to alter fisheries habitats and shellfish aquacultures. Observations in a tide pool at Sandwich, MA from December 2003 to February 2006 show that Didemnum sp. tolerates water temperatures ranging from ≤ 1 to > 24 °C, with daily changes of up to 11 °C. It attaches to pebbles, cobbles, and boulders, and it overgrows other tunicates, seaweeds, sponges, and bivalves. From May to mid July, colonies appear as small patches on the bottoms of rocks. Colonies grow rapidly from July to September, with some growth into December, and they range in color from pink to pale yellow to pale orange. Colony health declines from October through April, presumably in response to changes in water temperatures, and this degenerative process is manifested by color changes, by the appearance of small dark brown spots that represent clumps of fecal pellets in the colony, by scavenging by periwinkles, and by a peeling-away of colonies from the sides of cobbles and boulders. At Sandwich, colonies died that were exposed to air at low tide. The species does not exhibit this seasonal cycle of growth and decline in subtidal habitats (40–65 m) on the Georges Bank fishing grounds where the daily climate is relatively stable and annual water temperatures range from 4 to 15 °C. Experiments in the tide pool with small colony fragments (5 to 9 cm2) show they re-attach and grow rapidly by asexual budding, increasing in size 6- to 11-fold in the first 15 days. Didemnum sp. at Sandwich has no known predators except for common periwinkles (Littorina littorea) that graze on degenerating colonies in the October to April time period and whenever colonies are stressed by desiccation. The tendencies of the ascidian (1) to attach to firm substrates, (2) to rapidly overgrow

  20. A Maternal System Initiating the Zygotic Developmental Program through Combinatorial Repression in the Ascidian Embryo (United States)

    Oda-Ishii, Izumi; Kubo, Atsushi; Kari, Willi; Suzuki, Nobuhiro; Rothbächer, Ute


    Maternal factors initiate the zygotic developmental program in animal embryos. In embryos of the chordate, Ciona intestinalis, three maternal factors—Gata.a, β-catenin, and Zic-r.a—are required to establish three domains of gene expression at the 16-cell stage; the animal hemisphere, vegetal hemisphere, and posterior vegetal domains. Here, we show how the maternal factors establish these domains. First, only β-catenin and its effector transcription factor, Tcf7, are required to establish the vegetal hemisphere domain. Second, genes specifically expressed in the posterior vegetal domain have additional repressive cis-elements that antagonize the activity of β-catenin/Tcf7. This antagonizing activity is suppressed by Zic-r.a, which is specifically localized in the posterior vegetal domain and binds to DNA indirectly through the interaction with Tcf7. Third, Gata.a directs specific gene expression in the animal hemisphere domain, because β-catenin/Tcf7 weakens the Gata.a-binding activity for target sites through a physical interaction in the vegetal cells. Thus, repressive regulation through protein-protein interactions among the maternal transcription factors is essential to establish the first distinct domains of gene expression in the chordate embryo. PMID:27152625

  1. Recurrent phagocytosis-induced apoptosis in the cyclical generation change of the compound ascidian Botryllus schlosseri. (United States)

    Franchi, Nicola; Ballin, Francesca; Manni, Lucia; Schiavon, Filippo; Basso, Giuseppe; Ballarin, Loriano


    Colonies of the marine, filter-feeding ascidian Botryllus schlosseri undergo cyclical generation changes or takeovers. These events are characterised by the progressive resorption of adult zooids and their replacement by their buds that grow to adult size, open their siphons and start filtering. During the take-over, tissues of adult zooids undergo extensive apoptosis; circulating, spreading phagocytes enter the effete tissues, ingest dying cells acquiring a giant size and a round morphology. Then, phagocytes re-enter the circulation where they represent a considerable fraction (more than 20%) of circulating haemocytes. In this study, we evidence that most of these circulating phagocytes show morphological and biochemical signs of apoptosis. Accordingly, these phagocytes express transcripts of orthologues of the apoptosis-related genes Bax, AIF1 and PARP1. Electron microscopy shows that giant phagocytes contain apoptotic phagocytes inside their own phagocytic vacuole. The transcript of the orthologues of the anti-apoptotic gene IAP7 was detected only in spreading phagocytes, mostly abundant in phases far from the take-over. Therefore, the presented data suggest that, at take-over, phagocytes undergo phagocytosis-induced apoptosis (PIA). In mammals, PIA is assumed to be a process assuring the killing and the complete elimination of microbes, by promoting the disposal of terminally differentiated phagocytes and the resolution of infection. In B. schlosseri, PIA assumes a so far undescribed role, being required for the control of asexual development and colony homeostasis. PMID:27106705

  2. Antimicrobial Activity of the Crude Extracts of Compound Ascidians, Didemnum candidum and Didemnum psammathodes (Tunicata: Didemnidae from Mandapam (South East Coast of India

    Directory of Open Access Journals (Sweden)

    S. Mohamed Hussain


    Full Text Available Many cytotoxic compounds of therapeutic interest have been isolated from marine organisms. In thepresent study two species of compound ascidians Didemnum psammathodes and Didemnum candidum wereassayed for their antimicrobial activity against eight bacterial and four fungal pathogens. The antimicrobialactivity of the crude extract of ascidian shows inhibitory activity against almost all the eight strains. However,D. psammathodes shows prominent antibacterial activity than that of Didemnum candidum. Whereas noremarkable antifungal activity was noticed against the ascidian crude extract. The maximum inhibition zone(15 mm was observed against Salmonella typhi in the crude methanol extract of D. psammathodes and theminimum inhibition zone (1 mm was noticed against Vibrio cholera and Staphylococcus aureas in the crudeacetone extract of Didemnum candidum. In D. psammathodes the crude methanol extract the range of inhibitionof the bacteria varied from 2–15 mm with an average of 4.3 mm. According to fungi only Aspergillus niger andPenicillium sp. were showed the trace activity against few crude extract and remaining two fungal pathogensshows negative result. In the present result two way analysis of variance was showing that there was asignificant difference between the extracts as well as the strains (p<0.05.

  3. Identification of Eusynstyelamide B as a Potent Cell Cycle Inhibitor Following the Generation and Screening of an Ascidian-Derived Extract Library Using a Real Time Cell Analyzer

    Directory of Open Access Journals (Sweden)

    Michelle S. Liberio


    Full Text Available Ascidians are marine invertebrates that have been a source of numerous cytotoxic compounds. Of the first six marine-derived drugs that made anticancer clinical trials, three originated from ascidian specimens. In order to identify new anti-neoplastic compounds, an ascidian extract library (143 samples was generated and screened in MDA-MB-231 breast cancer cells using a real-time cell analyzer (RTCA. This resulted in 143 time-dependent cell response profiles (TCRP, which are read-outs of changes to the growth rate, morphology, and adhesive characteristics of the cell culture. Twenty-one extracts affected the TCRP of MDA-MB-231 cells and were further investigated regarding toxicity and specificity, as well as their effects on cell morphology and cell cycle. The results of these studies were used to prioritize extracts for bioassay-guided fractionation, which led to the isolation of the previously identified marine natural product, eusynstyelamide B (1. This bis-indole alkaloid was shown to display an IC50 of 5 µM in MDA-MB-231 cells. Moreover, 1 caused a strong cell cycle arrest in G2/M and induced apoptosis after 72 h treatment, making this molecule an attractive candidate for further mechanism of action studies.

  4. Cytotoxicity of actinomycetes associated with the ascidian Eudistoma vannamei (Millar, 1977, endemic of northeastern coast of Brazil

    Directory of Open Access Journals (Sweden)

    Paula C Jimenez


    Full Text Available Previous studies demonstrated that the crude extract of the ascidian Eudistoma vannamei, endemic from northeasttern Brazil, strongly hinders growth of tumor cells in vitro by inducing apoptosis due to tryptophan derivatives, which are commonly found in bacteria. This study presents a bioactivity-guided screening among actinomycetes, associated with E. vannamei, aiming at recognizing active principles with biological relevance. Twenty strains of actinomycetes, designated as EVA 0101 through 0120, were isolated from colonies of E. vannamei among which 11 were selected for cytotoxicity evaluation. The extracts from EVA 0102, 0103, 0106, 0109 and 0113 were the most active, and were further studied for IC50 determination and chemical analysis by ¹H NMR. IC50 values obtained ranged from 3.62 µg mL-1 (for EVA 0109 in leukemia cells to 84.65 µg/mL (for EVA 0106 in melanoma cells. All active extracts exhibited the same TLC and spectroscopic profiles, suggesting the presence of quinones and other related secondary metabolites. Furthermore, these strains were identified and compared based on their respective 16S rRNA sequences. The results herein identified the five strains as Micromonospora spp. while phylogenetic analysis suggests that they are possibly two different Micromonospora species producing the cytotoxic compounds.

  5. Msxb is a core component of the genetic circuitry specifying the dorsal and ventral neurogenic midlines in the ascidian embryo. (United States)

    Roure, Agnès; Darras, Sébastien


    The tail ascidian larval peripheral nervous system is made up of epidermal sensory neurons distributed more or less regularly in ventral and dorsal midlines. Their formation occurs in two-steps: the ventral and dorsal midlines are induced as neurogenic territories by Fgf9/16/20 and Admp respectively. The Delta2/Notch interaction then controls the number of neurons that form. The genetic machinery acting between the inductive processes taking place before gastrulation and neuron specification at tailbud stages are largely unknown. The analysis of seven transcription factors expressed in the forming midlines revealed an unexpected complexity and dynamic of gene expression. Their systematic overexpression confirmed that these genes do not interact following a linear cascade of activation. However, the integration of our data revealed the distinct key roles of the two upstream factors Msxb and Nkx-C that are the earliest expressed genes and the only ones able to induce neurogenic midline and ESN formation. Our data suggest that Msxb would be the primary midline gene integrating inputs from the ventral and dorsal inducers and launching a pan-midline transcriptional program. Nkx-C would be involved in tail tip specification, in maintenance of the pan-midline network and in a posterior to anterior wave controlling differentiation. PMID:26592100

  6. Two mannose-binding lectin homologues and an MBL-associated serine protease are expressed in the gut epithelia of the urochordate species Ciona intestinalis

    DEFF Research Database (Denmark)

    Skjødt, Mikkel-Ole; Palarasah, Yaseelan; Rasmussen, Karina Juhl;


    The lectin complement pathway has important functions in vertebrate host defence and accumulating evidence of primordial complement components trace its emergence to invertebrate phyla. We introduce two putative mannose-binding lectin homologues (CioMBLs) from the urochordate species Ciona intest...... protease in the epithelia cells lining the stomach and intestine. In conclusion we present two urochordate MBLs and identify an associated serine protease, which support the concept of an evolutionary ancient origin of the lectin complement pathway....

  7. Photoresponse and Learning Behavior of Ascidian Larvae, a Primitive Chordate, to Repeated Stimuli of Step-Up and Step-Down of Light


    Kawakami, I.; Shiraishi, S; Tsuda, M


    Ascidians are lower chordates and their simple tadpole-like larvae share a basic body plan with vertebrates. Newly hatched larvae show no response to a stimulus of light. 4 h after hatching, the larvae were induced to swim upon a step-down of light and stop swimming upon a step-up of light. At weaker intensity of light, the larvae show the same response to a stimulus after presentation of repeated stimuli. When intensity of actinic light was increased, the larvae show sensitization and habitu...

  8. NK4 antagonizes Tbx1/10 to promote cardiac versus pharyngeal muscle fate in the ascidian second heart field.

    Directory of Open Access Journals (Sweden)

    Wei Wang


    Full Text Available The heart and head muscles share common developmental origins and genetic underpinnings in vertebrates, including humans. Parts of the heart and cranio-facial musculature derive from common mesodermal progenitors that express NKX2-5, ISL1, and TBX1. This ontogenetic kinship is dramatically reflected in the DiGeorge/Cardio-Velo-Facial syndrome (DGS/CVFS, where mutations of TBX1 cause malformations in the pharyngeal apparatus and cardiac outflow tract. Cardiac progenitors of the first heart field (FHF do not require TBX1 and segregate precociously from common progenitors of the second heart field (SHF and pharyngeal muscles. However, the cellular and molecular mechanisms that govern heart versus pharyngeal muscle specification within this lineage remain elusive. Here, we harness the simplicity of the ascidian larva to show that, following asymmetric cell division of common progenitors, NK4/NKX2-5 promotes GATAa/GATA4/5/6 expression and cardiac specification in the second heart precursors by antagonizing Tbx1/10-mediated inhibition of GATAa and activation of Collier/Olf/EBF (COE, the determinant of atrial siphon muscle (ASM specification. Our results uncover essential regulatory connections between the conserved cardio-pharyngeal factor Tbx1/10 and muscle determinant COE, as well as a mutual antagonism between NK4 and Tbx1/10 activities upstream of GATAa and COE. The latter cross-antagonism underlies a fundamental heart versus pharyngeal muscle fate choice that occurs in a conserved lineage of cardio-pharyngeal progenitors. We propose that this basic ontogenetic motif underlies cardiac and pharyngeal muscle development and evolution in chordates.

  9. Stochasticity in space, persistence in time: genetic heterogeneity in harbour populations of the introduced ascidian Styela plicata. (United States)

    Pineda, Mari-Carmen; Lorente, Beatriz; López-Legentil, Susanna; Palacín, Creu; Turon, Xavier


    Spatio-temporal changes in genetic structure among populations provide crucial information on the dynamics of secondary spread for introduced marine species. However, temporal components have rarely been taken into consideration when studying the population genetics of non-indigenous species. This study analysed the genetic structure of Styela plicata, a solitary ascidian introduced in harbours and marinas of tropical and temperate waters, across spatial and temporal scales. A fragment of the mitochondrial gene Cytochrome Oxidase subunit I (COI) was sequenced from 395 individuals collected at 9 harbours along the NW Mediterranean coast and adjacent Atlantic waters (> 1,200 km range) at two time points 5 years apart (2009 and 2014). The levels of gene diversity were relatively low for all 9 locations in both years. Analyses of genetic differentiation and distribution of molecular variance revealed strong genetic structure, with significant differences among many populations, but no significant differences among years. A weak and marginally significant correlation between geographic distance and gene differentiation was found. Our results revealed spatial structure and temporal genetic homogeneity in S. plicata, suggesting a limited role of recurrent, vessel-mediated transport of organisms among small to medium-size harbours. Our study area is representative of many highly urbanized coasts with dense harbours. In these environments, the episodic chance arrival of colonisers appears to determine the genetic structure of harbour populations and the genetic composition of these early colonising individuals persists in the respective harbours, at least over moderate time frames (five years) that encompass ca. 20 generations of S. plicata. PMID:27366653

  10. Bigger is not always better: offspring size does not predict growth or survival for seven ascidian species. (United States)

    Jacobs, Molly W; Sherrard, Kristin M


    The presumed trade-off between offspring size and quality predicted by life history theory is often invoked to explain the wide range of propagule sizes observed in animals and plants. This trade-off is broadly supported by intraspecific studies but has been difficult to test in an interspecific context, particularly in animals. We tested the fitness consequences of offspring size both intra- and interspecifically for seven species of ascidians (sessile, suspension-feeding, marine invertebrates) whose offspring volumes varied over three orders of magnitude. We measured two major components of fitness, juvenile growth rates and survival, in laboratory and field experiments encompassing several food conditions. Contrary to the predictions of life history theory, larger offspring size did not result in higher rates of growth or survival, and large offspring did not perform better under nutritional stress, either intraspecifically or interspecifically. In fact, two of the four species with small offspring grew rapidly enough to catch up in size to the species with large offspring in as little as eight weeks, under wild-type food conditions. Trade-offs between growth potential and defense may overwhelm and obscure any trade-offs between offspring size and survival or growth rate. While large initial size may still confer a competitive advantage, we failed to detect any consequences of interspecific variation in initial size. This implies that larger offspring in these species, far from being inherently superior in growth or survival, require compensation in other aspects of life history if reproductive effort is to be efficient. Our results suggest that the importance of initial offspring size is context dependent and often overestimated relative to other life history traits. PMID:21302831

  11. Characterization of the teneurin C-terminal associated peptide (TCAP) in the vase tunicate, Ciona intestinalis: A novel peptide system associated with energy metabolism and reproduction. (United States)

    Colacci, Michael; De Almeida, Reuben; Chand, Dhan; Lovejoy, Sabine R; Sephton, Dawn; Vercaemer, Benedikte; Lovejoy, David A


    The vase tunicate, Ciona intestinalis, is a protochordate and is considered a sister lineage to the chordates. The recent sequencing of its genome has made this species a particularly important model to understand the genetic basis of vertebrate evolution. However, C. intestinalis is also a highly invasive species along the Atlantic coast of North America and other regions of the world which have caused considerable economic stress due to its biofouling actions and, in particular, negative impacts on the mussel- and oyster-based aquaculture industry. Despite this background, little is known about C. intestinalis physiology. The teneurin C-terminal associated peptides (TCAP) are a family of highly conserved peptide hormones found in most metazoans. Moreover, these peptides have been implicated in the inhibition of stress and stimulation of feeding-based metabolism. We have, therefore, identified this peptide using an in silico approach and characterized its immunological expression in tissues using a mouse polyclonal antiserum. These data indicate that its primary structure is more similar to invertebrate TCAPs relative to vertebrate TCAPs. Immunological expression indicates that it is highly expressed in the digestive tract and gonads consistent with findings in vertebrates. Synthetic mouse TCAP-1 administered into the brachial basket significantly increases the incidence of non-stress contractile behaviors. These findings support the hypothesis that TCAP is a bioactive peptide in C. intestinalis. Thus, C. intestinalis and tunicates in general may offer a simple model to investigate peptide interaction while providing information on how to control this invasive species. PMID:25687741

  12. CS5931, a Novel Polypeptide in Ciona savignyi, Represses Angiogenesis via Inhibiting Vascular Endothelial Growth Factor (VEGF and Matrix Metalloproteinases (MMPs

    Directory of Open Access Journals (Sweden)

    Ge Liu


    Full Text Available CS5931 is a novel polypeptide from Ciona savignyi with anticancer activities. Previous study in our laboratory has shown that CS5931 can induce cell death via mitochondrial apoptotic pathway. In the present study, we found that the polypeptide could inhibit angiogenesis both in vitro and in vivo. CS5931 inhibited the proliferation, migration and formation of capillary-like structures of HUVECs (Human Umbilical Vein Endothelial Cell in a dose-dependent manner. Additionally, CS5931 repressed spontaneous angiogenesis of the zebrafish vessels. Further studies showed that CS5931 also blocked vascular endothelial growth factor (VEGF production but without any effect on its mRNA expression. Moreover, CS5931 reduced the expression of matrix metalloproteinases (MMP-2 and MMP-9 both on protein and mRNA levels in HUVEC cells. We demonstrated that CS5931 possessed strong anti-angiogenic activity both in vitro and in vivo, possible via VEGF and MMPs. This study indicates that CS5931 has the potential to be developed as a novel therapeutic agent as an inhibitor of angiogenesis for the treatment of cancer.

  13. Suppression of cell-spreading and phagocytic activity on nano-pillared surface: in vitro experiment using hemocytes of the colonial ascidian Botryllus schlosseri

    Directory of Open Access Journals (Sweden)

    L Ballarin


    Full Text Available Nano-scale nipple array on the body surface has been described from various invertebrates including endoparasitic and mesoparasitic copepods, but the functions of the nipple array is not well understood. Using the hydrophilized nanopillar sheets made of polystyrene as a mimetic material of the nipple arrays on the parasites’ body surface, we assayed the cell spreading and phagocytosis of the hemocytes of the colonial ascidian Botryllus schlosseri. On the pillared surface, the number of spreading amebocytes and the number of phagocytizing hemocytes per unit area were always smaller than those on the flat surface (Mann-Whitney test, p < 0.05 - 0.001, probably because the effective area for the cell attachment on the pillared surface is much smaller than the area on the flat sheet. The present results supports the idea that the nipple array on the parasites' body surface reduces the innate immune reaction from the host hemocytes.

  14. An ultraviolet-sensitive maternal mRNA encoding a cytoskeletal protein may be involved in axis formation in the ascidian embryo

    International Nuclear Information System (INIS)

    Ultraviolet (uv) irradiation of the vegetal hemisphere of fertilized eggs during ooplasmic segregation inhibits subsequent gastrulation and axis formation in ascidian embryos. The molecular basis of this phenomenon was investigated in by comparing in vivo protein synthesis and in vitro mRNA translation in normal and uv-irradiated embryos of the ascidian Styela clava. Analysis of protein synthesis by [35S]methionine incorporation, two-dimensional (2D) gel electrophoresis, and autoradiography showed that only 21 of 433 labeled polypeptides were missing or decreased in labeling intensity in uv-irradiated embryos. The most prominent of these was a 30,000 molecular weight (pI 6.0) polypeptide (p30). Extraction of gastrulae with the nonionic detergent Triton X-100 showed that p30 is retained in the detergent insoluble residue, suggesting that it is associated with the cytoskeleton. Several lines of evidence suggest that p30 may be involved in axis formation. First, p30 labeling peaks during gastrulation, when the embryonic axis is being established. Second, axis formation and p30 labeling are abolished by the same threshold uv dose, which is distinct from that required to inactivate muscle cell development. Third, the uv sensitivity period for abolishing p30 labeling and axis formation are both restricted to ooplasmic segregation. In vitro translation of egg RNA followed by 2D gel electrophoresis and autoradiography of the protein products showed that p30 is encoded by a maternal mRNA. The translation of p30 mRNA was abolished by uv irradiation of fertilized eggs during ooplasmic segregation suggesting that this message is a uv-sensitive target. The results are consistent with the hypothesis that uv irradiation blocks gastrulation and axis formation by inhibiting the translation of maternal mRNA localized in the vegetal hemisphere of the fertilized egg

  15. Natural products from the ascidian Botrylloides giganteum, from the sponges Verongula gigantea, Ircinia felix, Cliona delitrix and from the nudibranch Tambja eliora, from the Brazilian coastline

    International Nuclear Information System (INIS)

    Two new marine metabolites, 3Z, 6Z, 9Z-dodecatrien-1-ol (1) from the ascidian Botrylloides giganteum and 4H-pyran-2ol acetate from the sponge Ircinia felix (4) are herein reported. The known bromotyrosine compounds, 2-(3,5-dibromo-4-methoxyphenyl)-N,N,Ndimethylethanammonium (2) and 2,6-dibromo-4-(2-(trimethylammonium)ethyl)phenol (3), have been isolated from the sponge Verongula gigantea. Serotonin (5) is reported for the first time from the sponge Cliona delitrix, and tambjamines A (15) and D (16) isolated as their respective salts from the nudibranch Tambja eliora. Only tambjamine D presented cytotoxicity against CEM (IC5)0 12.2 μg/mL) and HL60 (IC50 13.2 μg/mL) human leukemia cells, MCF-7 breast cancer cells (IC50 13.2 μg/mL), colon HCT-8 cancer cells (IC50 10.1 μg/mL) and murine melanoma B16 cancer cells (IC50 6.7 μg/mL). (author)

  16. First in situ observations of the deep-sea carnivorous ascidian Dicopia antirrhinum Monniot C., 1972 in the Western Mediterranean Sea (United States)

    Mecho, A.; Aguzzi, J.; Company, J. B.; Canals, M.; Lastras, G.; Turon, X.


    Dicopia antirrhinum C. Monniot, 1972 is a rare species of deep-sea ascidian belonging to the Family Octacnemidae, reported at depths of 1000-2500 m in European Atlantic waters. Adult individuals have never been reported before in the Mediterranean Sea, where only seven juvenile specimens were found in 1975 at 500 m water depth in the Central basin (Malta). The affinities of these specimens with D. antirrhinum were noted, but lack of some typical characters of the species in juveniles prevented a definite taxonomical identification. No other member of the Octacnemidae has ever been found in the Mediterranean. In this study we describe the sampling of an adult specimen of D. antirrhinum at around 1100 m water depth on the flank of the La Fonera (Palamós) canyon, Northwestern Mediterranean, confirming their presence in the Mediterranean Sea. We also observed 5 individuals of this species on their natural habitat with a Remotely Operated Vehicle (ROV). Our results highlight the potential occurrence of Octacnemidae, the presence of which has been largely overlooked, in several deep-sea canyon areas within the Western Mediterranean basin. These observations are important because they indicate the need for increased sampling effort with new technologies, such as ROVs, in ecologically relevant habitats such as canyons, in order to obtain a more accurate picture of deep-sea biodiversity in the Mediterranean Sea.

  17. The colonial ascidian Didemnum sp. A: current distribution, basic biology and potential threat to marine communities of the northeast and west coasts of North America (United States)

    Bullard, S.G.; Lambert, G.; Carman, M.R.; Byrnes, J.; Whitlatch, R.B.; Ruiz, G.; Miller, R.J.; Harris, L.; Valentine, P.C.; Collie, J.S.; Pederson, J.; McNaught, D.C.; Cohen, A.N.; Asch, R.G.; Dijkstra, J.; Heinonen, K.


    Didemnum sp. A is a colonial ascidian with rapidly expanding populations on the east and west coasts of North America. The origin of Didemum sp. A is unknown. Populations were first observed on the northeast coast of the U.S. in the late 1980s and on the west coast during the 1990s. It is currently undergoing a massive population explosion and is now a dominant member of many subtidal communities on both coasts. To determine Didemnum sp. A's current distribution, we conducted surveys from Maine to Virginia on the east coast and from British Columbia to southern California on the west coast of the U.S. between 1998 and 2005. In nearshore locations Didemnum sp. A currently ranges from Eastport, Maine to Shinnecock Bay, New York on the east coast. On the west coast it has been recorded from Humboldt Bay to Port San Luis in California, several sites in Puget Sound, Washington, including a heavily fouled mussel culture facility, and several sites in southwestern British Columbia on and adjacent to oyster and mussel farms. The species also occurs at deeper subtidal sites (up to 81 m) off New England, including Georges, Stellwagen and Tillies Banks. On Georges Bank numerous sites within a 230 km2 area are 50–90% covered by Didemnum sp. A; large colonies cement the pebble gravel into nearly solid mats that may smother infaunal organisms. These observations suggest that Didemnum sp. A has the potential to alter marine communities and affect economically important activities such as fishing and aquaculture.

  18. Signaling pathways in ascidian oocyte maturation: the roles of cAMP/Epac, intracellular calcium levels, and calmodulin kinase in regulating GVBD. (United States)

    Lambert, Charles C


    Most mature ascidian oocytes undergo germinal vesicle breakdown (GVBD) when released by the ovary into sea water (SW). Acidic SW blocks this but they can be stimulated by raising the pH, increasing intracellular cAMP levels by cell permeant forms, inhibiting its breakdown or causing synthesis. Boltenia villosa oocytes undergo GVBD in response to these drugs. However, the cAMP receptor protein kinase A (PKA) does not appear to be involved, as oocytes are not affected by the kinase inhibitor H-89. Also, the PKA independent Epac agonist 8CPT-2Me-cAMP stimulates GVBD in acidic SW. GVBD is inhibited in calcium free sea water (CaFSW). The intracellular calcium chelator BAPTA-AM blocks GVBD at 10 µM. GVBD is also inhibited when the ryanodine receptors (RYR) are blocked by tetracaine or ruthenium red but not by the IP(3) inhibitor D-609. However, dimethylbenzanthracene (DMBA), a protein kinase activator, stimulates GVBD in BAPTA, tetracaine or ruthenium red blocked oocytes. The calmodulin kinase inhibitor KN-93 blocks GVBD at 10 µM. This and preceding papers support the hypothesis that the maturation inducing substance (MIS) produced by the follicle cells in response to increased pH causes activation of a G protein which triggers cAMP synthesis. The cAMP then activates an Epac molecule, which causes an increase in intracellular calcium from the endoplasmic reticulum ryanodine receptor. The increased intracellular calcium subsequently activates calmodulin kinase, which causes an increase in cdc25 phosphatase activity, activating MPF and the progression of the oocyte into meiosis. PMID:21774024

  19. Conservation of Notochord Gene Expression Across Chordates: Insights From the Leprecan Gene Family


    Capellini, Terence D.; Dunn, Matthew P.; Yale J Passamaneck; Selleri, Licia; Di Gregorio, Anna


    The notochord is a defining character of the chordates, and the T-box transcription factor Brachyury has been shown to be required for notochord development in all chordates examined. In the ascidian Ciona intestinalis, at least 44 notochord genes have been identified as bona fide transcriptional targets of Brachyury. We examined the embryonic expression of a subset of murine orthologs of Ciona Brachyury target genes in the notochord to assess its conservation throughout chordate evolution. W...

  20. Early embryonic expression of a LIM-homeobox gene Cs-lhx3 is downstream of beta-catenin and responsible for the endoderm differentiation in Ciona savignyi embryos. (United States)

    Satou, Y; Imai, K S; Satoh, N


    In early Ciona embryos, nuclear accumulation of beta-catenin is most probably the first step of endodermal cell specification. If beta-catenin is mis- and/or overexpressed, presumptive notochord cells and epidermal cells change their fates into endodermal cells, whereas if beta-catenin nuclear localization is downregulated by the overexpression of cadherin, the endoderm differentiation is suppressed, accompanied with the differentiation of extra epidermal cells ( Imai, K., Takada, N., Satoh, N. and Satou, Y. (2000) Development 127, 3009-3020). Subtractive hybridization screens of mRNAs between beta-catenin overexpressed embryos and cadherin overexpressed embryos were conducted to identify potential beta-catenin target genes that are responsible for endoderm differentiation in Ciona savignyi embryos. We found that a LIM-homeobox gene (Cs-lhx3), an otx homolog (Cs-otx) and an NK-2 class gene (Cs-ttf1) were among beta-catenin downstream genes. In situ hybridization signals for early zygotic expression of Cs-lhx3 were evident only in the presumptive endodermal cells as early as the 32-cell stage, those of Cs-otx in the mesoendodermal cells at the 32-cell stage and those of Cs-ttf1 in the endodermal cells at the 64-cell stage. Later, Cs-lhx3 was expressed again in a set of neuronal cells in the tailbud embryo, while Cs-otx was expressed in the anterior nervous system of the embryo. Expression of all three genes was upregulated in beta-catenin overexpressed embryos and downregulated in cadherin overexpressed embryos. Injection of morpholino oligonucleotides against Cs-otx did not affect the embryonic endoderm differentiation, although the formation of the central nervous system was suppressed. Injection of Cs-ttf1 morpholino oligonucleotides also failed to suppress the endoderm differentiation, although injection of its synthetic mRNAs resulted in ectopic development of endoderm differentiation marker alkaline phosphatase. By contrast, injection of Cs-lhx3 morpholino

  1. Isolation and biological activities of secondary metabolites from the sponges monanchora aff. arbuscula, aplysina sp. petromica ciocalyptoides and topsentia ophiraphidies, from the ascidian didemnum ligulum and from the octocoral carijoa riisei

    International Nuclear Information System (INIS)

    The investigation of extracts from six species of marine invertebrates yielded one new and several known natural products. Isoptilocaulin from the sponge Monanchora aff. arbuscula displayed antimicrobial activity at 1.3 mg/mL against an oxacillin-resistant strain of Staphylococcus aureus. Five inactive known dibromotyrosine derivatives, 2 6, were isolated from a new species of marine sponge, Aplysina sp. The sponges Petromica ciocalyptoides and Topsentia ophiraphidites yielded the known halistanol sulfate A (7) as an inhibitor of the antileishmanial target adenosine phosphoribosyl transferase. The ascidian Didemnum ligulum yielded asterubin (10) and the new N,N-dimethyl-O-methylethanolamine (11). The octocoral Carijoa riisei yielded the known 18-acetoxypregna-1,4,20-trien-3-one (12), which displayed cytotoxic activity against the cancer cell lines SF295, MDA-MB435, HCT8 and HL60. (author)

  2. Biophysical characterization of the fluorescent protein voltage probe VSFP2.3 based on the voltage-sensing domain of Ci-VSP

    DEFF Research Database (Denmark)

    Lundby, Alicia; Akemann, Walther; Knöpfel, Thomas


    A voltage sensitive phosphatase was discovered in the ascidian Ciona intestinalis. The phosphatase, Ci-VSP, contains a voltage-sensing domain homologous to those known from voltage-gated ion channels, but unlike ion channels, the voltage-sensing domain of Ci-VSP can reside in the cell membrane as...

  3. Biomixing generated by benthic filterfeeders: A diffusion model for near-bottom phytoplankton depletion

    DEFF Research Database (Denmark)

    Scheel Larsen, Poul; Riisgård, H.U.


    polychaete Nereis diversicolor and the ascidian Ciona intestinalis, respectively. The model is based on sinks located at inhalant openings and Fick's law with an effective diffusivity that decreases with distance above the bottom due to the biomixing generated by exhalant and inhalant feeding currents. For N...

  4. Ascídias (Tunicata, Ascidiacea da Reserva Biológica Marinha do Arvoredo, Santa Catarina, Brasil Ascidians (Tunicata, Ascidiacea from the Arvoredo Marine Biological Reserve, Santa Catarina, Brazil

    Directory of Open Access Journals (Sweden)

    Rosana M. da Rocha


    Full Text Available A Reserva Biológica Marinha de Arvoredo compreende uma extensa área (17.800 ha, onde se elevam as ilhas do Arvoredo, Galé, Deserta e calhau de São Pedro. O levantamento de espécies de ascídias foi realizado por meio de mergulho autônomo m águas rasas (5-17 m de profundidade. Vinte e seis espécies são aqui registradas, entre as quais Lissoclinum perforatum (Giard, 1872, L. verrilli (Van Name, 1902 e Leptoclinides latus Monniot, 1983 representam novos registros para o Brasil, e outras 19 espécies representam novos registros para o Estado de Santa Catarina. Com este resultado, 34 espécies de ascídias já foram registradas em Santa Catarina, das quais 22 são marcadamente tropicais. Este cenário não representa a diversidade total da Reserva, uma vez que três espécies novas serão descritas em outra publicação e os locais mais expostos e profundos das ilhas não foram amostrados.The Arvoredo Marine Biological Reserve covers an extensive area including the islands Arvoredo, Galés and Deserta and a small rocky outcrop called São Pedro. The survey of ascidians was accomplished with scuba dive, only in shallow water (5-17 m deep. Twenty-six species are here registered, among which Lissoclinum perforatum (Giard, 1872, L. verrilli (Van Name, 1902 and Leptoclinides latus Monniot, 1983 represent new reports to Brazil, and other 19 species represent new reports to the State of Santa Catarina. Together with the results of the present work, 34 ascidian species have already been reported from Santa Catarina, of the which 22 are remarkably tropical. This scenery doesn't represent the total diversity of the Reserve, since three new species will be described in another publication and the most exposed and deep places of the islands were not sampled.

  5. Endozoicomonas Are Specific, Facultative Symbionts of Sea Squirts (United States)

    Schreiber, Lars; Kjeldsen, Kasper U.; Funch, Peter; Jensen, Jeppe; Obst, Matthias; López-Legentil, Susanna; Schramm, Andreas


    Ascidians are marine filter feeders and harbor diverse microbiota that can exhibit a high degree of host-specificity. Pharyngeal samples of Scandinavian and Mediterranean ascidians were screened for consistently associated bacteria by culture-dependent and -independent approaches. Representatives of the Endozoicomonas (Gammaproteobacteria, Hahellaceae) clade were detected in the ascidian species Ascidiella aspersa, Ascidiella scabra, Botryllus schlosseri, Ciona intestinalis, Styela clava, and multiple Ascidia/Ascidiella spp. In total, Endozoicomonas was detected in more than half of all specimens screened, and in 25–100% of the specimens for each species. The retrieved Endozoicomonas 16S rRNA gene sequences formed an ascidian-specific subclade, whose members were detected by fluorescence in situ hybridization (FISH) as extracellular microcolonies in the pharynx. Two strains of the ascidian-specific Endozoicomonas subclade were isolated in pure culture and characterized. Both strains are chemoorganoheterotrophs and grow on mucin (a mucus glycoprotein). The strains tested negative for cytotoxic or antibacterial activity. Based on these observations, we propose ascidian-associated Endozoicomonas to be commensals, living off the mucus continuously secreted into the pharynx. Members of the ascidian-specific Endozoicomonas subclade were also detected in seawater from the Scandinavian sampling site, which suggests acquisition of the symbionts by horizontal transmission. The combined results indicate a host-specific, yet facultative symbiosis between ascidians and Endozoicomonas. PMID:27462299

  6. Ascídias (Tunicata, Ascidiacea introduzidas no Arquipélago de Alcatrazes, São Paulo Introduced ascidians (Tunicata, Ascidiacea in the Arquipélago de Alcatrazes, State of São Paulo, Brazil

    Directory of Open Access Journals (Sweden)

    Rosana M. da Rocha


    Full Text Available O Arquipélago de Alcatrazes (24º06'S, 45º42'W localiza-se a 36 km da costa e constitui uma Estação Ecológica desde 1987. Estando próximo à região portuária de São Sebastião, São Paulo, está sujeito à introdução de espécies exóticas. Com o objetivo de detectar se está ocorrendo ou não introdução de espécies, foram coletados 40 exemplares de ascídias da principal ilha do arquipélago, a Ilha de Alcatrazes, sendo 15 amostras da Baía do Oratório e 25 do Saco do Funil. Foram encontradas 24 espécies em sete famílias. Dentre estas, apenas cinco espécies podem ser consideradas como nativas para o Atlântico; quatro são atlânticas, mas criptogênicas na região devido à distribuição disjunta; cinco são classificadas como criptogênicas de ampla distribuição mundial; e uma pode ser considerada como um caso certo de introdução, Ciona intestinalis (Linnaeus, 1767. Há ainda nove espécies que não puderam ser identificadas, podendo algumas se tratar de espécies novas. A presença de uma espécie exótica e a grande quantidade de espécies criptogênicas com forte evidência de introdução são indícios de que as ilhas estão sendo ameaçadas por uma fauna não nativa. A conservação do Arquipélago deve levar em consideração a presença do porto como fonte de estresse e o controle das espécies introduzidas como parte do plano de manejo da Unidade de Conservação.Arquipélago de Alcatrazes (24º06'S, 45º42'W is 36 km off the coast and it is an Ecological Station since 1987. It is also located near the port region of São Sebastião, São Paulo, hence subjected to introduction of exotic species. Forty samples were taken in the principal island of the archipelago to detect possible introductions. Fifteen samples were from Baía do Oratório and 25 from Saco do Funil. Twenty four species distributed in seven families were found. Only five of them were classified as native, four are Atlantic but cryptogenic in the

  7. Tubular Heart Pumping Mechanisms in Ciona Intestinalis (United States)

    Battista, Nicholas; Miller, Laura


    In vertebrate embryogenesis, the first organ to form is the heart, beginning as a primitive heart tube. However, many invertebrates have tubular hearts from infancy through adulthood. Heart tubes have been described as peristaltic and impedance pumps. Impedance pumping assumes a single actuation point of contraction, while traditional peristalsis assumes a traveling wave of actuation. In addition to differences in flow, this inherently implies differences in the conduction system. It is possible to transition from pumping mechanism to the other with a change in the diffusivity of the action potential. In this work we consider the coupling between the fluid dynamics and electrophysiology of both mechanisms, within a basal chordate, the tunicate. Using CFD with a neuro-mechanical model of tubular pumping, we discuss implications of the both mechanisms. Furthermore, we discuss the implications of the pumping mechanism on evolution and development.

  8. Isolation and biological activities of secondary metabolites from the sponges monanchora aff. arbuscula, aplysina sp. petromica ciocalyptoides and topsentia ophiraphidies, from the ascidian didemnum ligulum and from the octocoral carijoa riisei; Isolamento e atividades biologicas de produtos naturais das esponjas monanchora arbuscula, aplysina sp., petromica ciocalyptoides e topsentia ophiraphidites, da ascidia didemnum ligulum e do octocoral carijoa riisei

    Energy Technology Data Exchange (ETDEWEB)

    Kossuga, Miriam H.; Lira, Simone P. de; Nascimento, Andrea M.; Gambardella, Maria Teresa P.; Berlinck, Roberto G.S. [Universidade de Sao Paulo (USP), Sao Carlos, SP (Brazil). Inst. de Quimica]. E-mail:; Torres, Yohandra R. [Universidade Estadual do Centro-Oeste, Guarapuava, PR (Brazil). Dept. de Quimica; Nascimento, Gislene G.F. [Universidade Metodista de Piracicaba (UNIMEP), SP (Brazil). Faculdade de Ciencias da Saude; Pimenta, Eli F.; Silva, Marcio; Thiemann, Otavio H.; Oliva, Glaucius [Universidade de Sao Paulo (USP), Sao Carlos, SP (Brazil). Inst. de Fisica; Tempone, Andre G.; Melhem, Marcia S.C. [Instituto Adolfo Lutz, Sao Paulo, SP (Brazil). Div. de Biologia Medica; Souza, Ana O. de; Galetti, Fabio C.S.; Silva, Celio L. [Universidade de Sao Paulo (USP), Ribeirao Preto, SP (Brazil). Faculdade de Medicina. Dept. de Bioquimica e Imunologia; Cavalcanti, Bruno; Pessoa, Claudia O.; Moraes, Manoel O. [Universidade Federal do Ceara (UFC), Fortaleza, CE (Brazil). Faculdade de Medicina. Dept. de Fisiologia e Farmacologia; Hajdu, Eduardo [Universidade Federal do Rio de Janeiro (UFRJ), RJ (Brazil). Museu Nacional; Peixinho, Solange [Universidade Federal da Bahia (UFBA), Salvador, BA (Brazil). Dept. de Biologia; Rocha, Rosana M. [Universidade Federal do Parana (UFPR), Curitiba, PR (Brazil). Setor de Ciencias Biologicas. Dept. de Zoologia


    The investigation of extracts from six species of marine invertebrates yielded one new and several known natural products. Isoptilocaulin from the sponge Monanchora aff. arbuscula displayed antimicrobial activity at 1.3 mg/mL against an oxacillin-resistant strain of Staphylococcus aureus. Five inactive known dibromotyrosine derivatives, 2 6, were isolated from a new species of marine sponge, Aplysina sp. The sponges Petromica ciocalyptoides and Topsentia ophiraphidites yielded the known halistanol sulfate A (7) as an inhibitor of the antileishmanial target adenosine phosphoribosyl transferase. The ascidian Didemnum ligulum yielded asterubin (10) and the new N,N-dimethyl-O-methylethanolamine (11). The octocoral Carijoa riisei yielded the known 18-acetoxypregna-1,4,20-trien-3-one (12), which displayed cytotoxic activity against the cancer cell lines SF295, MDA-MB435, HCT8 and HL60. (author)

  9. Isolamento e atividades biológicas de produtos naturais das esponjas monanchora arbuscula, aplysina sp. petromica ciocalyptoides e topsentia ophiraphidites, da ascídia didemnum ligulum e do octocoral carijoa riisei Isolantion and biological activities of secondary metabolites from the sponges monanchora aff. arbuscula, aplysina sp. petromica ciocalyptoides and topsentia ophiraphidies, from the ascidian didemnum ligulum and from the octocoral carijoa riisei

    Directory of Open Access Journals (Sweden)

    Miriam H. Kossuga


    Full Text Available The investigation of extracts from six species of marine invertebrates yielded one new and several known natural products. Isoptilocaulin from the sponge Monanchora aff. arbuscula displayed antimicrobial activity at 1.3 mg/mL against an oxacillin-resistant strain of Staphylococcus aureus. Five inactive known dibromotyrosine derivatives, 2 6, were isolated from a new species of marine sponge, Aplysina sp. The sponges Petromica ciocalyptoides and Topsentia ophiraphidites yielded the known halistanol sulfate A (7 as an inhibitor of the antileishmanial target adenosine phosphoribosyl transferase. The ascidian Didemnum ligulum yielded asterubin (10 and the new N,N-dimethyl-O-methylethanolamine (11. The octocoral Carijoa riisei yielded the known 18-acetoxypregna-1,4,20-trien-3-one (12, which displayed cytotoxic activity against the cancer cell lines SF295, MDA-MB435, HCT8 and HL60.

  10. Produtos naturais da ascídia Botrylloides giganteum, das esponjas Verongula gigantea, Ircinia felix, Cliona delitrix e do nudibrânquio Tambja eliora, da costa do Brasil Natural products from the ascidian Botrylloides giganteum, from the sponges Verongula gigantea, Ircinia felix, Cliona delitrix and from the nudibranch Tambja eliora, from the Brazilian coastline

    Directory of Open Access Journals (Sweden)

    Ana Claudia Granato


    Full Text Available Two new marine metabolites, 3Z, 6Z, 9Z-dodecatrien-1-ol (1 from the ascidian Botrylloides giganteum and 4H-pyran-2ol acetate from the sponge Ircinia felix (4 are herein reported. The known bromotyrosine compounds, 2-(3,5-dibromo-4-methoxyphenyl-N,N,N-dimethylethanammonium (2 and 2,6-dibromo-4-(2-(trimethylammoniumethylphenol (3, have been isolated from the sponge Verongula gigantea. Serotonin (5 is reported for the first time from the sponge Cliona delitrix, and tambjamines A (15 and D (16 isolated as their respective salts from the nudibranch Tambja eliora. Only tambjamine D presented cytotoxicity against CEM (IC50 12.2 µg/mL and HL60 (IC50 13.2 µg/mL human leukemya cells, MCF-7 breast cancer cells (IC50 13.2 µg/mL, colon HCT-8 cancer cells (IC50 10.1 µg/mL and murine melanoma B16 cancer cells (IC50 6.7 µg/mL.

  11. Recruitment and colonization of colonial ascidians (Tunicata: Ascidiacea on intertidal rocks in Northeastern Brazil Recrutamento e colonização de ascídias coloniais (Tunicata: Ascidiacea em rochas de entre-marés no nordeste do Brasil

    Directory of Open Access Journals (Sweden)

    Petrônio Bezerra Gama


    Full Text Available Recruitment and colonization of colonial ascidians, starting on natural scraped substratum, was observed throughout one year, in quadrats marked on sea- and continental-rock faces in the sublittoral fringe of an exposed beach in the Northeast of Brazil. The species of the Didemnidae, Didemnum duplicatum Monniot, 1983, D. psammathodes Sluiter, 1895, and Polysyncraton amethysteum Van Name, 1902, and an unidentified species of Polycitoridae, Eudistoma sp. 1, were recruited. Presenting continuous recruitment of all species, the density of living and dead recruits and colonies was similar on both faces of the rocks. The highest rainfall during winter, affected significantly the recruits density of D. duplicatum and D. psammathodes. Different permanence periods were observed for colonies of each species. The longest permanence periods were assigned to the colonies of P. amethysteum and D. psammathodes, extending up to four and five months, respectively.A partir de substrato natural raspado, o recrutamento e a colonização de ascídias coloniais foi observado ao longo de um ano, em unidades amostrais delimitadas sobre as faces mar e continente de rochas situadas na franja do infralitoral de uma praia exposta no nordeste do Brasil. Foram recrutadas as espécies de Didemnidae, Didemnum duplicatum Monniot, 1983, D. psammathodes Sluiter, 1895 e Polysyncraton amethysteum Van Name, 1902 e uma espécie não-identificada de Polycitoridae, Eudistoma sp. 1. Apresentando recrutamento contínuo de todas as espécies, a densidade de colônias e de recrutas vivos e mortos foi similar nas duas faces das rochas. Durante o inverno, a densidade de recrutas de D. duplicatum e de D. psammathodes foi significativamente afetada pela intensa pluviosidade. As colônias de cada espécie apresentaram diferentes períodos de permanência sobre as rochas. Com duração de quatro e cinco meses, os maiores períodos de permanência foram assinalados para as colônias de P

  12. mRNA 5′-leader trans-splicing in the chordates


    Vandenberghe, Amanda E.; Meedel, Thomas H.; Hastings, Kenneth E.M.


    We report the discovery of mRNA 5′-leader trans-splicing (SL trans-splicing) in the chordates. In the ascidian protochordate Ciona intestinalis, the mRNAs of at least seven genes undergo trans-splicing of a 16-nucleotide 5′-leader apparently derived from a 46-nucleotide RNA that shares features with previously characterized splice donor SL RNAs. SL trans-splicing was known previously to occur in several protist and metazoan phyla, however, this is the first report of SL trans-splicing within ...

  13. Bioadhesion in ascidians: a developmental and functional genomics perspective


    Pennati, Roberta; Rothbächer, Ute


    The development of bioadhesives inspired from marine animals is a promising approach to generate new tissue-compatible medical components. A number of marine species, through their adhesive properties, also represent significant foulers that become increasingly problematic to aquaculture, shipping or local biodiversity. In order to develop more sophisticated man-made glues and/or efficient fouling resistant surfaces, it is important to understand the mechanical, structural and molecular prope...

  14. Evolution of anterior Hox regulatory elements among chordates

    Directory of Open Access Journals (Sweden)

    Natale Alfonso


    Full Text Available Abstract Background The Hox family of transcription factors has a fundamental role in segmentation pathways and axial patterning of embryonic development and their clustered organization is linked with the regulatory mechanisms governing their coordinated expression along embryonic axes. Among chordates, of particular interest are the Hox paralogous genes in groups 1-4 since their expression is coupled to the control of regional identity in the anterior nervous system, where the highest structural diversity is observed. Results To investigate the degree of conservation in cis-regulatory components that form the basis of Hox expression in the anterior nervous system, we have used assays for transcriptional activity in ascidians and vertebrates to compare and contrast regulatory potential. We identified four regulatory sequences located near the CiHox1, CiHox2 and CiHox4 genes of the ascidian Ciona intestinalis which direct neural specific domains of expression. Using functional assays in Ciona and vertebrate embryos in combination with sequence analyses of enhancer fragments located in similar positions adjacent to Hox paralogy group genes, we compared the activity of these four Ciona cis-elements with a series of neural specific enhancers from the amphioxus Hox1-3 genes and from mouse Hox paralogous groups 1-4. Conclusions This analysis revealed that Kreisler and Krox20 dependent enhancers critical in segmental regulation of the hindbrain appear to be specific for the vertebrate lineage. In contrast, neural enhancers that function as Hox response elements through the action of Hox/Pbx binding motifs have been conserved during chordate evolution. The functional assays reveal that these Hox response cis-elements are recognized by the regulatory components of different and extant species. Together, our results indicate that during chordate evolution, cis-elements dependent upon Hox/Pbx regulatory complexes, are responsible for key aspects of

  15. Ciliary and mucus-net filter feeding, with special reference to fluid mechanical characteristics

    DEFF Research Database (Denmark)

    Jørgensen, C.B.; Kiørboe, Thomas; Møhlenberg, F.;


    Filter characteristics were determined and compared in ciliary and mucus-net filter feeders. The ciliary feeders include the polychaete Sabella penicillus, the brachiopod Terebratulina retusa, the marine bivalves Monia squama, Cardium glaucum, and Petricola pholadiformis, and the freshwater...... bivalves Dreissena polymorpha, Unio pictorum and Anodonta cygnea. The mucus-net feeders are the polychaete Chaetopterus variopedatus, the gastropod Crepidula fornicata and the ascidians Styela clava, Ciona intestinalis, Ascidia virginea, A. obliqua and A. mentula. Efficiencies of particle retention as a...... function of particle size was determined by counting of particles in samples of inhalant and exhalant water. The lower threshold for efficient particle retention varied from .apprx. 6 .mu.m in T. retuso to .apprx. 1 .mu.m in D. polymorpha. Mucus nets efficiently retained particles down to 1-2 .mu.m. Filter...

  16. β-catenin-driven binary cell fate decisions in animal development. (United States)

    Bertrand, Vincent


    The Wnt/β-catenin pathway plays key roles during animal development. In several species, β-catenin is used in a reiterative manner to regulate cell fate diversification between daughter cells following division. This binary cell fate specification mechanism has been observed in animals that belong to very diverse phyla: the nematode Caenorhabditis elegans, the annelid Platynereis, and the ascidian Ciona. It may also play a role in the regulation of several stem cell lineages in vertebrates. While the molecular mechanism behind this binary cell fate switch is not fully understood, it appears that both secreted Wnt ligands and asymmetric cortical factors contribute to the generation of the difference in nuclear β-catenin levels between daughter cells. β-Catenin then cooperates with lineage specific transcription factors to induce the expression of novel sets of transcription factors at each round of divisions, thereby diversifying cell fate. For further resources related to this article, please visit the WIREs website. PMID:26952169

  17. Arsenic (+3 oxidation state) methyltransferase and the methylation of arsenicals in the invertebrate chordate Ciona intestinalis (United States)

    Biotransformation of inorganic arsenic (iAs) involves methylation catalyzed by arsenic (+3 oxidation state) methyltransferase (As3mt), yielding mono- , di- , and trimethylated arsenicals. To investigate the evolution of molecular mechanisms that mediate arsenic biotransformation,...

  18. Characterization of an individual neural crest-like cell lineage in the invertebrate chordate Ciona intestinalis


    Cone, Angela C.


    During embryogenesis, all chordate embryos undergo neurulation to form a dorsal, hollow nerve cord. Neural crest cells (NCC), considered a vertebrate innovation, arise during neurulation and later differentiate into a multitude of tissues that account for much of the structural complexity that distinguishes craniates from invertebrate chordates [1, 2]. NCCs are induced and specified at the border of the neural and non-neural ectoderm by a complex network of inductive signals and transcription...

  19. Toll-like receptors of deuterostome invertebrates

    Directory of Open Access Journals (Sweden)

    Honoo eSatake


    Full Text Available Defensive systems against pathogens are responsible not only for survival or lifetime of an individual but also for the evolution of a species. Innate immunity is expected to be more important for invertebrates than mammals, given that adaptive immunity has not been acquired in the former. Toll-like receptors (TLRs have been shown to play a crucial role in host defense of pathogenic microbes in innate immunity of mammals. Recent genome-wide analyses have suggested that TLR or their related genes are conserved in invertebrates. In particular, numerous TLR-related gene candidates were detected in deuterostome invertebrates including a sea urchin (222 TLR-related gene candidates and amphioxus (72 TLR-related gene candidates. Molecular phylogenetic analysis verified that most of sea urchin or amphioxus TLR candidates are paralogous, suggesting that these organisms expanded TLR-related genes in a species-specific manner. In contrast, another deuterostome invertebrate, an ascidian, Ciona intestinalis, was found to possess only two TLR genes. Moreover, Ciona TLRs, Ci-TLR1 and -2, were shown to possess hybrid functionality of mammalian TLRs. Such functionality of Ci-TLRs could not be predicted by sequence comparison with vertebrate TLRs, indicating the confounding evolutionary lineages of deuterostome invertebrate TLRs or their candidates. In this review article, we present recent advances in studies of TLRs or their candidates of deuterostome invertebrates, and provide insight into an evolutionary process of TLRs.

  20. Purification of Mitochondrial Proteins HSP60 and ATP Synthase from Ascidian Eggs: Implications for Antibody Specificity


    Chenevert, Janet; Pruliere, Gerard; Ishii, Hirokazu; Sardet, Christian; Nishikata, Takahito


    Use of antibodies is a cornerstone of biological studies and it is important to identify the recognized protein with certainty. Generally an antibody is considered specific if it labels a single band of the expected size in the tissue of interest, or has a strong affinity for the antigen produced in a heterologous system. The identity of the antibody target protein is rarely confirmed by purification and sequencing, however in many cases this may be necessary. In this study we sought to chara...

  1. Ascidian dermatan sulfates attenuate metastasis, inflammation and thrombosis by inhibition of P-selectin


    Kozlowski, E; M.S.G. Pavão; Borsig, L


    Background: Cancer-associated thrombosis and enduring inflammation are strongly associated with cancer progression and metastasis. Heparin is the mostly clinically used anticoagulant/antithrombotic drug, and has recently been shown to exhibit antimetastatic and anti-inflammatory activities that are linked to inhibition of P-selectin and/or L-selectin. P-selectin-mediated platelet–tumor cell and tumor cell–endothelium interactions facilitate the initial steps of metastasis. Objectives and Meth...

  2. Allogeneic Responses between Three Remote Populations of the Cosmopolitan Ascidian Botryllus schlosseri(Immunology)


    Rinkevich, Baruch; Shapira, Michal; Weissman, Irving L.; Saito, Yasunori


    Colony allorecognition assays (CAAs) were performed between colonies of the world-wide distributed tunicate Botryllus schlosseri, sampled from the Mediterranean coast of Israel (Is), from Monterey, California (Mon) and from Mutsu Bay, Japan (Ja). While all 48 Is vs Ja CAAs resulted in nonfusion responses, unexpectedly, 4.4% of the 45 Is vs Mon pairs and 12.0% of the 25 Ja vs Mon assays ended in colony fusions. Allogeneic effector mechanisms in all 3 populations were similar, except for the Ja...

  3. Fungicidal compounds from a marine Ascidian-associated fungus Trichoderma harzianum

    Digital Repository Service at National Institute of Oceanography (India)

    PrabhaDevi; Ciavatta, M.L.; Wahidullah, S.; Vuppala, S.; DeSouza, L.

    . Of the five isolated secondary metabolites, compounds 2 and 5 are being reported here for the first time from T. harzianum. Compounds 1 and 4 inhibited the growth of Sclerotium rolfsii causing sclerotium wilt or rot disease in tropical plants. Compound 2 and 5...

  4. Two New Cholic Acid Derivatives from the Marine Ascidian-Associated Bacterium Hasllibacter halocynthiae

    Directory of Open Access Journals (Sweden)

    Sung Hun Kim


    Full Text Available The investigation of secondary metabolites in liquid cultures of a recently discovered marine bacterium, Hasllibacter halocynthiae strain KME 002T, led to the isolation of two new cholic acid derivatives. The structures of these compounds were determined to be 3,3,12-trihydroxy-7-ketocholanic acid (1 and 3,3,12-trihydroxy-7-deoxycholanic acid (2 through HRFABMS and NMR data analyses.

  5. Intense predation on ascidians by a trunk fish, Ostracion immaculatus (Temminck et Schlege) (Pisces:Ostracidae)

    Digital Repository Service at National Institute of Oceanography (India)

    Raveendran, T.V.; Harada, E.

    stream_size 9 stream_content_type text/plain stream_name Publ_Seto_Mar_Biol_Lab_37_193.pdf.txt stream_source_info Publ_Seto_Mar_Biol_Lab_37_193.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  6. Data on the ascidians (Chordata, Ascidiacea) of the marine park of Zembra-Zembretta (North Tunisia)


    Mestiri, M.; Espla Alfonso, R.A.; Ben Mustapha, K.; M.S. ROMDHANE


    Une étude systématique des ascidies du Parc marin de Zembra-Zembretta a été menée. L’échantillonnage effectué autour de ces îles a été réalisé, pour la majorité des espèces, par scaphandre autonome sur les substrats rocheux et l’herbier à Posidonia oceanica et aussi par dragage sur les fonds meubles (sable et détritique côtier). La profondeur varie selon les stations de 14 à 70m. Au total, une vingtaine d’espèces a été recensée. Elles appartiennent à 6 familles (Polyclinidae, Polycitoridae, D...

  7. Evolutionary mitogenomics of Chordata: the strange case of ascidians and vertebrates


    C Gissi; Griggio, F.; F. Iannelli


    The availability of almost one thousand complete mitochondrial genome (mtDNA) sequences of chordates provides an almost unique opportunity to analyse the evolution of this genome in the phylum Chordata, and to identify possible divergent evolutionary trends followed by the three chordate subphyla: Vertebrata, Cephalochordata and Tunicata.Here, we review some genome-level features of mtDNA, such as genetic code, gene content, genome architecture and gene strand asymmetry, mostly focusing on di...

  8. Evolutionary mitogenomics of Chordata: the strange case of ascidians and vertebrates

    Directory of Open Access Journals (Sweden)

    C Gissi


    Full Text Available The availability of almost one thousand complete mitochondrial genome (mtDNA sequences of chordates provides an almost unique opportunity to analyse the evolution of this genome in the phylum Chordata, and to identify possible divergent evolutionary trends followed by the three chordate subphyla: Vertebrata, Cephalochordata and Tunicata.Here, we review some genome-level features of mtDNA, such as genetic code, gene content, genome architecture and gene strand asymmetry, mostly focusing on differences existing between tunicates and remaining chordates. Indeed, tunicate mtDNAs show a surprisingly high variability in several genome-level features, even though the current tunicate taxon sampling is absolutely insufficient and is focused mainly on the class Ascidiacea. On the contrary, a stabilization of the mtDNA structural and evolutionary features is observed in both cephalochordates and vertebrates, where genome-level features are almost invariant. Thus, different evolutionary dynamics, probably related to divergent functional constraints, have modelled the overall mtDNA structure and organization of the three chordate subphyla.

  9. Dermatan sulfate in tunicate phylogeny: Order-specific sulfation pattern and the effect of [→4IdoA(2-Sulfateβ-1→3GalNAc(4-Sulfateβ-1→] motifs in dermatan sulfate on heparin cofactor II activity

    Directory of Open Access Journals (Sweden)

    Sugahara Kazuyuki


    Full Text Available Abstract Background Previously, we have reported the presence of highly sulfated dermatans in solitary ascidians from the orders Phlebobranchia (Phallusia nigra and Stolidobranchia (Halocynthia pyriformis and Styela plicata. Despite the identical disaccharide backbone, consisting of [→4IdoA(2Sβ-1→3GalNAcβ-1→], those polymers differ in the position of sulfation on the N-Acetyl galactosamine, which can occur at carbon 4 or 6. We have shown that position rather than degree of sulfation is important for heparin cofactor II activity. As a consequence, 2,4- and 2,6-sulfated dermatans have high and low heparin cofactor II activities, respectively. In the present study we extended the disaccharide analysis of ascidian dermatan sulfates to additional species of the orders Stolidobranchia (Herdmania pallida, Halocynthia roretzi and Phlebobranchia (Ciona intestinalis, aiming to investigate how sulfation evolved within Tunicata. In addition, we analysed how heparin cofactor II activity responds to dermatan sulfates containing different proportions of 2,6- or 2,4-disulfated units. Results Disaccharide analyses indicated a high content of disulfated disaccharide units in the dermatan sulfates from both orders. However, the degree of sulfation decreased from Stolidobranchia to Phlebobranchia. While 76% of the disaccharide units in dermatan sulfates from stolidobranch ascidians are disulfated, 53% of disulfated disaccharides are found in dermatan sulfates from phlebobranch ascidians. Besides this notable difference in the sulfation degree, dermatan sulfates from phlebobranch ascidians contain mainly 2,6-sulfated disaccharides whereas dermatan sulfate from the stolidobranch ascidians contain mostly 2,4-sulfated disaccharides, suggesting that the biosynthesis of dermatan sulfates might be differently regulated during tunicates evolution. Changes in the position of sulfation on N-acetylgalactosamine in the disaccharide [→4IdoA(2-Sulfateβ-1→3GalNAcβ-1

  10. Effetti dei biocidi rilasciati dalle vernici antivegetative (Tributil stagno e Diuron) sui meccanismi riproduttivi dell’invertebrato marino Ciona Intestinalis


    Gallo, Alessandra


    La riproduzione è il processo biologico con cui un organismo vivente dà origine ad uno o più discendenti garantendo la conservazione della specie. Negli organismi marini a fecondazione esterna gli spermatozoi, gli ovociti e gli embrioni possono essere esposti ad inquinanti ambientali provenienti da attività antropiche che ne possono alterare le funzioni fisiologiche con conseguente riduzione del successo riproduttivo. La membrana plasmatica delle cellule è caratterizzata da proprietà elet...

  11. A glycine receptor is involved in the organization of swimming movements in an invertebrate chordate

    Directory of Open Access Journals (Sweden)

    Okamura Yasushi


    Full Text Available Abstract Background Rhythmic motor patterns for locomotion in vertebrates are generated in spinal cord neural networks known as spinal Central Pattern Generators (CPGs. A key element in pattern generation is the role of glycinergic synaptic transmission by interneurons that cross the cord midline and inhibit contralaterally-located excitatory neurons. The glycinergic inhibitory drive permits alternating and precisely timed motor output during locomotion such as walking or swimming. To understand better the evolution of this system we examined the physiology of the neural network controlling swimming in an invertebrate chordate relative of vertebrates, the ascidian larva Ciona intestinalis. Results A reduced preparation of the larva consisting of nerve cord and motor ganglion generates alternating swimming movements. Pharmacological and genetic manipulation of glycine receptors shows that they are implicated in the control of these locomotory movements. Morphological molecular techniques and heterologous expression experiments revealed that glycine receptors are inhibitory and are present on both motoneurones and locomotory muscle while putative glycinergic interneurons were identified in the nerve cord by labeling with an anti-glycine antibody. Conclusions In Ciona intestinalis, glycine receptors, glycinergic transmission and putative glycinergic interneurons, have a key role in coordinating swimming movements through a simple CPG that is present in the motor ganglion and nerve cord. Thus, the strong association between glycine receptors and vertebrate locomotory networks may now be extended to include the phylum chordata. The results suggest that the basic network for 'spinal-like' locomotion is likely to have existed in the common ancestor of extant chordates some 650 M years ago.

  12. Voltage sensitive phosphatases: emerging kinship to protein tyrosine phosphatases from structure-function research

    Directory of Open Access Journals (Sweden)

    Kirstin eHobiger


    Full Text Available The transmembrane protein Ci-VSP from the ascidian Ciona intestinalis was described as first member of a fascinating family of enzymes, the voltage sensitive phosphatases (VSPs. Ci-VSP and its voltage-activated homologs from other species are stimulated by positive membrane potentials and dephosphorylate the head groups of negatively charged phosphoinositide phosphates (PIPs. In doing so, VSPs act as control centers at the cytosolic membrane surface, because they intervene in signaling cascades that are mediated by PIP lipids. The characteristic motif CX5RT/S in the active site classifies VSPs as members of the huge family of cysteine-based protein tyrosine phosphatases (PTPs. Although PTPs have already been well characterized regarding both, structure and function, their relationship to VSPs has drawn only limited attention so far. Therefore, the intention of this review is to give a short overview about the extensive knowledge about PTPs in relation to the facts known about VSPs. Here, we concentrate on the structural features of the catalytic domain which are similar between both classes of phosphatases and their consequences for the enzymatic function. By discussing results obtained from crystal structures, molecular dynamics simulations, and mutagenesis studies, a possible mechanism for the catalytic cycle of VSPs is presented based on that one proposed for PTPs. In this way, we want to link the knowledge about the catalytic activity of VSPs and PTPs.

  13. Cadmium effects in food chain experiments with marine plankton algae (dinophyta) and benthic filter feeders(Tunicata) (United States)

    Kayser, H.

    The dinoflagellate Scrippsiella faeroense was grown in continuous flow-through cultures (10 1 turbidostat), the outflow leading into vessels containing tunicates of the species Ciona intestinalis, Ascidiella aspersa, Molgula manhattensi and Botryllus schlosseri. The culture medium consisted of natural sea water enriched only with N and P components. CdCl 2 was added to the system at sublethal concentrations. Algal growth wass affected at a Cd ++ concentration of 10 μg·1 -1; sublethal toxicity thresholds of the tunicates ranged from 5 to 10 μg·1 -1. Cadmium accumulation was much higer in the algae than in the tunicates; in spite of the continuous supply of relatively highly Cd contaminated algae, the Cd content of algae-fed tunicates increased insignificantly by comparison with unfed specimens. Only a small percentage of the Cd offered via the food algae was actually assimilated by the ascidians during the first 3 weeks of the experiment. Cd content of the tunicates remained almost constant for the next 2 weeks of the experiment, indicating that ingestion and excretion of the metal was at equilibrium. The concentration factor of Cd decreased through the trophic chain.

  14. Transcription factors ETS2 and MESP1 transdifferentiate human dermal fibroblasts into cardiac progenitors. (United States)

    Islas, Jose Francisco; Liu, Yu; Weng, Kuo-Chan; Robertson, Matthew J; Zhang, Shuxing; Prejusa, Allan; Harger, John; Tikhomirova, Dariya; Chopra, Mani; Iyer, Dinakar; Mercola, Mark; Oshima, Robert G; Willerson, James T; Potaman, Vladimir N; Schwartz, Robert J


    Unique insights for the reprograming of cell lineages have come from embryonic development in the ascidian Ciona, which is dependent upon the transcription factors Ci-ets1/2 and Ci-mesp to generate cardiac progenitors. We tested the idea that mammalian v-ets erythroblastosis virus E26 oncogene homolog 2 (ETS2) and mesoderm posterior (MESP) homolog may be used to convert human dermal fibroblasts into cardiac progenitors. Here we show that murine ETS2 has a critical role in directing cardiac progenitors during cardiopoiesis in embryonic stem cells. We then use lentivirus-mediated forced expression of human ETS2 to convert normal human dermal fibroblasts into replicative cells expressing the cardiac mesoderm marker KDR(+). However, although neither ETS2 nor the purported cardiac master regulator MESP1 can by themselves generate cardiac progenitors de novo from fibroblasts, forced coexpression of ETS2 and MESP1 or cell treatment with purified proteins reprograms fibroblasts into cardiac progenitors, as shown by the de novo appearance of core cardiac transcription factors, Ca(2+) transients, and sarcomeres. Our data indicate that ETS2 and MESP1 play important roles in a genetic network that governs cardiopoiesis. PMID:22826236

  15. Epibiosis of oxygen phototrophs containing chlorophylls a, b, c, and d on the colonial ascidian Cystodytes dellechiajei

    Czech Academy of Sciences Publication Activity Database

    Martínez-García, M.; Koblížek, Michal; López-Legentil, S.; Antón, J.


    Roč. 61, č. 1 (2011), s. 13-19. ISSN 0095-3628 Institutional research plan: CEZ:AV0Z50200510 Keywords : D-PRODUCING CYANOBACTERIUM * ACARYOCHLORIS-MARINA * ADAPTATION Subject RIV: EE - Microbiology, Virology Impact factor: 2.912, year: 2011

  16. Increased Inter-Colony Fusion Rates Are Associated with Reduced COI Haplotype Diversity in an Invasive Colonial Ascidian Didemnum vexillum


    Smith, Kirsty F.; Stefaniak, Lauren; Saito, Yasunori; Gemmill, Chrissen E.C.; Cary, S. Craig; Fidler, Andrew E.


    Considerable progress in our understanding of the population genetic changes associated with biological invasions has been made over the past decade. Using selectively neutral loci, it has been established that reductions in genetic diversity, reflecting founder effects, have occurred during the establishment of some invasive populations. However, some colonial organisms may actually gain an ecological advantage from reduced genetic diversity because of the associated reduction in inter-colon...

  17. Biomixing generated by benthic filter feeders: a diffusion model for near-bottom phytoplankton depletion (United States)

    Larsena, Poul S.; Riisgård, Hans Ulrik


    Transient concentration distributions of flagellate cells ( Rhodomonas sp.) previously measured by Riisgård and co-workers in laboratory experiments have been examined to develop a diffusion model for the process of phytoplankton depletion in stagnant seawater above populations of benthic filter feeders, the polychaete Nereis diversicolor and the ascidian Ciona intestinalis, respectively. The model is based on sinks located at inhalant openings and Fick's law with an effective diffusivity that decreases with distance above the bottom due to the biomixing generated by exhalant and inhalant feeding currents. For N. diversicolor, having inhalant and exhalant openings flush with the sediment surface and a moderate exhalant jet velocity of ˜0.01 m s -1, concentration boundary layer growth is retarded and limited by the low values of diffusivity prevailing at heights greater >˜0.05 m above the bottom. For C. intestinalis, having inhalant and exhalant openings situated ˜0.05-0.1 m above the bottom and a higher and inclined exhalant jet velocity of ˜0.1-0.2 m s -1, the concentration distributions show a nearly uniform depletion over a layer reaching a thickness of 0.2-0.3 m above the bottom due to high biomixing in this layer. Numerical predictions of concentration distributions reproduce essential features of experiments, and suggest near-bottom values of effective diffusivity of 0.3 x 10 -6 and 150 x 10 -6 m 2 s -1, for N. diversicolor and C. intestinalis, respectively. It is suggested that the latter value is so large that the induced mixing should be accounted for in modelling benthic concentration boundary layers under flow conditions.

  18. Endozoicomonas are specific, facultative symbionts of sea squirts

    DEFF Research Database (Denmark)

    Schreiber, Lars; Kjeldsen, Kasper Urup; Funch, Peter;


    Ascidians are marine filter feeders and harbor diverse microbiota that can exhibit a high degree of host-specificity. Pharyngeal samples of Scandinavian and Mediterranean ascidians were screened for consistently associated bacteria by culture-dependent and -independent approaches. Representatives...

  19. Molecular orbital calculations, experimental and theoretical UV spectra of granulatimides and didemnimides, biologically active polycyclic heteroaromatic alkaloids from the ascidian Didemnum granulatum (United States)

    Camargo, A. J.; Oliveira, J. H. H. L.; Trsic, M.; Berlinck, R. G. S.


    A detailed computational study was performed for compounds granulatimide, isogranulatimide, and didemnimides A, D, and E, using the semiempirical Austin model 1 quantum chemical method. The electronic features and structural parameters were confronted with the inhibition of the G2 cell cycle checkpoint of mammalian cancer cells. All compounds were submitted to a rigorous conformational analysis using the Tripos 5.2 force field implemented in the Spartan 5.01 program. The electronic density in specific regions of the molecules appears to play a pivotal role towards activity. The molecular planarity creates a broad negative electrostatic potential on the two sides of the active compounds (granulatimide and isogralulatimide) and a positive potential in their central core, while the non-planar compounds (didemnimides A, D, and E, which are inactive) present an asymmetric potential scattered over the molecules. These electrostatic potential features are likely to be the modulator of hydrophobicity or lipophilicity of the compounds, which appear correlated with activity. The hydrogen attached to the N atom of the pyrrole moiety of indole is more positive for active compounds than for the inactive molecules. The theoretical electronic spectra were obtained for all compounds using the configuration interaction method, with the AM1 routine. All transitions present π→π ∗ nature. The theoretical results are in good agreement with experimental values.

  20. Vascular Endothelial Growth Factor Receptor Family in Ascidians, Halocynthia roretzi (Sea Squirt). Its High Expression in Circulatory System-Containing Tissues


    Saeed Samarghandian; Masabumi Shibuya


    The vascular endothelial growth factor (VEGF)-VEGF Receptor (VEGFR) system is an important pathway for regulation of angiogenesis. However, its evolutionary development, particularly the step from invertebrates to vertebrates, is still largely unknown. Here, we molecularly cloned the VEGFR-like gene from Halocynthia roretzi, a species belonging to the Tunicata, the chordate subphylum recently considered the sister group of vertebrates. The cDNA encoded a homolog of human VEGFR, including the ...

  1. Phylogeny of the Aplousobranchia (Tunicata: Ascidiacea Filogenia de Aplousobranchia (Tunicata: Ascidiacea

    Directory of Open Access Journals (Sweden)

    Tatiane R. Moreno


    Full Text Available The phylogenetic relationships of genera and families of Aplousobranchia Lahille (Tunicata, Ascidiacea is reconstructed based on morphological characters - the first comprehensive morphology-based phylogenetic analysis for the Aplousobranchia. Monophyly of Aplousobranchia and its families were tested with samples of 14 families. The final character matrix comprised 47 characters and 41 genera as terminal taxa. Nine equally most parsimonious trees (length 161, CI = 0.5031, RI = 0.7922 were found. Characters describing replication, colony system formation, and branchial walls were the more important in phylogenetic reconstruction. These characters were more useful than others more traditionally used in ascidian taxonomy, such as: body division, position of the heart, gonads and epicardium. Characters not frequently used in phylogenetic analysis, such as body wall muscles, muscles associated with transversal blood vessels and arrangement of the larval papillae, also have phylogenetic information. Results supported monophyly of the Aplousobranchia sensu Lahille, 1887 including only Polycitoridae, Polyclinidae, and Didemnidae. On the other hand, Aplousobranchia including also Cionidae and Diazonidae is not monophyletic since Perophora and Ecteinascidia were included as ingroups in the cladogram, Ciona (now closer to Ascidia was no longer included in Aplousobranchia and the position of Rhopalaea and Diazona is not resolved. We propose a revised classification based on this phylogenetic analysis, in which Aplousobranchia, with three new families and an indeterminate taxon, now has 15 families.O relacionamento filogenéticos de gêneros e famílias de de Aplousobranchia Lahille (Tunicata, Ascidiacea foi reconstruída com base em caracteres morfológicos - esta constitui a primeira análise filogenética morfológica abrangente para Aplousobranchia. A monofilia de Aplousobranchia e suas famílias foi testada com espécies de 14 famílias. A matriz final

  2. Reproductive protein evolution in two cryptic species of marine chordate

    Directory of Open Access Journals (Sweden)

    Harrison Richard G


    Full Text Available Abstract Background Reproductive character displacement (RCD is a common and taxonomically widespread pattern. In marine broadcast spawning organisms, behavioral and mechanical isolation are absent and prezygotic barriers between species often operate only during the fertilization process. Such barriers are usually a consequence of differences in the way in which sperm and egg proteins interact, so RCD can be manifest as faster evolution of these proteins between species in sympatry than allopatry. Rapid evolution of these proteins often appears to be a consequence of positive (directional selection. Here, we identify a set of candidate gamete recognition proteins (GRPs in the ascidian Ciona intestinalis and showed that these GRPs evolve more rapidly than control proteins (those not involved in gamete recognition. Choosing a subset of these gamete recognition proteins that show evidence of positive selection (CIPRO37.40.1, CIPRO60.5.1, CIPRO100.7.1, we then directly test the RCD hypothesis by comparing divergence (omega and polymorphism (McDonald-Kreitman, Tajima's D, Fu and Li's D and F, Fay and Wu's H statistics in sympatric and allopatric populations of two distinct forms of C. intestinalis (Types A and B between which there are strong post-zygotic barriers. Results Candidate gamete recognition proteins from two lineages of C. intestinalis (Type A and B are evolving more rapidly than control proteins, consistent with patterns seen in insects and mammals. However, ω (dN/dS is not significantly different between the sympatric and allopatric populations, and none of the polymorphism statistics show significant differences between sympatric and allopatric populations. Conclusions Enhanced prezygotic isolation in sympatry has become a well-known feature of gamete recognition proteins in marine broadcast spawners. But in most cases the evolutionary process or processes responsible for this pattern have not been identified. Although gamete

  3. Adaptive behaviour of fishers to external perturbations: simulation of the Tasmanian rock lobster fishery

    NARCIS (Netherlands)

    Hamon, K.G.; Frusher, S.D.; Little, L.R.; Thebaud, O.; Punt, A.E.


    The rock lobster, Jasus edwardsii, lies on a global "hotspot" for climate change in the southeastern Australian state of Tasmania. The short-term effects of climate change are predicted to lead to an increasing exploitable biomass in the south and declining biomass in the north of the state. The fut

  4. Protein: FBA5 [TP Atlas

    Lifescience Database Archive (English)

    Full Text Available FBA5 VSOP(voltage sensor -only protein1) HVCN1 VSOP, VSX1 Voltage-gated hydrogen channel 1 Hydrog ... en voltage-gated channel 1, Voltage sensor ... domain-only protein 7719 Ciona intestinalis 778897 ...

  5. Dicty_cDB: Contig-U11773-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e mRN... 30 0.30 AY895050_1( AY895050 |pid:none) Ciona intestinalis isolate 16 clon... 32 0.30 A45517( A45517 ;S27818) coccidiosis...n-1; AltName: Full=F-spondin; Flags... 31 0.023 AY895052_1( AY895052 |pid:none) Ciona intestinalis...58889_1( BC158889 |pid:none) Rattus norvegicus complement facto... 35 0.83 AY895051_1( AY895051 |pid:none) Ciona intestinalis isol...or UNC5B; AltName: Full=Prot... 29 1.3 AY899287_1( AY899287 |pid:none) Ciona intestinalis isolate 13 clon......bits) Value N ( U82516 ) Dictyostelium discoideum random slug cDNA22 protein... 761 0.0 4 ( BJ384324 ) Dictyostelium dis

  6. Macrofouling community structure in Kanayama Bay, Kii Peninsula (Japan)

    Digital Repository Service at National Institute of Oceanography (India)

    Raveendran, T.V.; Harada, E.

    of fouling organisms were monitored at monthly intervals. Fortnightly variations in hydrographic parameters were also noted simultaneously. The fouling community at this bay was a complex assemblage of bryozoans, ascidians, polychaetes and barnacles...

  7. Impact of predation by Ostracion immaculatus (Pisces: Ostraciidae) on the macrofouling community structure in Kanayama Bay, Kii Peninsula (Japan)

    Digital Repository Service at National Institute of Oceanography (India)

    Raveendran, T.V.; Harada, E.

    using predator inclusion as well as exclusion treatment confirmed that predation by this fish had significant impact on the structure of fouling community. The importance of predation was manifested mainly through the influence of fish on ascidians...

  8. Larvae of fouling organisms and macrofouling at New Mangalore Port, west coast of India

    Digital Repository Service at National Institute of Oceanography (India)

    Khandeparker, D.C.; Anil, A.C.; Venkat, K.

    Polychaetes, bryozoans, barnacles and ascidians were the dominant groups in the fouling community at New Mangalore Port. Polychaete and cirripede larvae were encountered throughout the year. Even though bivalve were present in the planktonic hauls...

  9. rRNA genes from the lower chordate Herdmania momus: structural similarity with higher eukaryotes.


    Degnan, B M; Yan, J.; Hawkins, C J; Lavin, M F


    Ascidians, primitive chordates that have retained features of the likely progenitors to all vertebrates, are a useful model to study the evolutionary relationship of chordates to other animals. We have selected the well characterized ribosomal RNA (rRNA) genes to investigate this relationship, and we describe here the cloning and characterization of an entire ribosomal DNA (rDNA) tandem repeat unit from a lower chordate, the ascidian Herdmania momus. rDNA copy number and considerable sequence...

  10. Ascidia subterranea sp. nov. (Phlebobranchia: Ascidiidae), a new tunicate belonging to the A. sydneiensis Stimpson, 1855 group, found as burrow associate of Axiopsis serratifrons A. Milne-Edwards, 1873 (Decapoda: Axiidae) on Derawan Island, Indonesia. (United States)

    Kneer, Dominik; Monniot, Francoise; Stach, Thomas; Christianen, Marjolijn J A


    A new tunicate, Ascidia subterranea sp. nov., was found in burrows of the axiid crustacean Axiopsis serratifrons on Derawan Island, Indonesia. It differs from other ascidians in its habitat as well as numerous morphological peculiarities which are described in detail. The shrimp Rostronia stylirostris Holthuis, 1952 was found inside A. subterranea sp. nov., and 4 species of bivalves, 3 species of polychaetes, 1 gastropod, 1 polyplacophoran and 1 sponge species were found as burrow associates besides the ascidian. PMID:24758824

  11. Territoriality and Conflict Avoidance Explain Asociality (Solitariness) of the Endosymbiotic Pea Crab Tunicotheres moseri


    Ambrosio, Louis J.; Baeza, J. Antonio


    Host monopolization theory predicts symbiotic organisms inhabiting morphologically simple, relatively small and scarce hosts to live solitarily as a result of territorial behaviors. We tested this prediction with Tunicotheres moseri, an endosymbiotic crab dwelling in the atrial chamber of the morphologically simple, small, and relatively scarce ascidian Styela plicata. As predicted, natural populations of T. moseri inhabit ascidian hosts solitarily with greater frequency than expected by chan...

  12. Isolamento e atividades biológicas de produtos naturais das esponjas monanchora arbuscula, aplysina sp. petromica ciocalyptoides e topsentia ophiraphidites, da ascídia didemnum ligulum e do octocoral carijoa riisei Isolantion and biological activities of secondary metabolites from the sponges monanchora aff. arbuscula, aplysina sp. petromica ciocalyptoides and topsentia ophiraphidies, from the ascidian didemnum ligulum and from the octocoral carijoa riisei


    Miriam H. Kossuga; Simone P. de Lira; Andréa M. Nascimento; Gambardella, Maria Teresa P.; Berlinck, Roberto G. S.; Yohandra R. Torres; Gislene G. F. Nascimento; Eli F. Pimenta; Marcio Silva; Otávio H. Thiemann; Glaucius Oliva; André G. Tempone; Melhem, Márcia S.C.; Ana O. de Souza; Galetti, Fabio C. S.


    The investigation of extracts from six species of marine invertebrates yielded one new and several known natural products. Isoptilocaulin from the sponge Monanchora aff. arbuscula displayed antimicrobial activity at 1.3 mg/mL against an oxacillin-resistant strain of Staphylococcus aureus. Five inactive known dibromotyrosine derivatives, 2 6, were isolated from a new species of marine sponge, Aplysina sp. The sponges Petromica ciocalyptoides and Topsentia ophiraphidites yielded the known halis...

  13. Dicty_cDB: Contig-U16391-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 3895 |pid:none) Podospora anserina genomic DNA c... 204 7e-51 AY830393_1( AY830393 |pid:none) Mus musculus myosin.... 48 1e-13 5 ( BW212344 ) Ciona intestinalis cDNA, clone:cieg070c01, 5' end... 48 1e-13 5 ( BW654420 ) Glycin...d,... 70 2e-13 2 ( AV992378 ) Ciona intestinalis cDNA, clone:cicl58n12, 5' end,... 48 ...T80381.fwd Gateway compatible cien cDNA librar... 48 2e-13 5 ( BW212062 ) Ciona intestinalis cDNA, clone:cieg069d24, 5' en...testinalis cDNA, clone:cilv01m24, 5' end,... 48 3e-11 4 ( DR984111 ) JGI_AOKF1594.rev AOKF Acropora

  14. Dicty_cDB: Contig-U12751-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ) RAE00012771 Reclinomonas americana Home made, nor... 48 0.46 1 ( AM830211 ) Nicotiana tabacum EST, clone n...t006087030. 48 0.46 1 ( BW501508 ) Ciona intestinalis cDNA, clone:cima056p22, 3'end,... 48 0.46 1 ( BW500413 ) Ciona intestina...lis cDNA, clone:cima053a12, 3'end,... 48 0.46 1 ( BW456831 ) Ciona intestina...09_1( AK229409 |pid:none) Arabidopsis thaliana mRNA for puta... 37 0.62 (Q9S775) RecName: Full=CHD3-type chroma...pshtfqevlfqhglkkmirvy*lvsinm vmenilkfsliln*iysqm*revnqilfhqiqlvimikiiiiiiiiaiktiliiliviav iiiiktlqlinnnsnsnl

  15. Dicty_cDB: Contig-U05349-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available A, clone: LEFL1016BE03, H... 44 3e-09 4 ( CN612803 ) CssgEST00526 Culicoides sonorensis female salivar... 38...9) RecName: Full=Iron sulfur cluster assembly protein 1, m... 169 1e-40 CP000488_523( CP000488 |pid:none) Candidatus Ruthia mag... H 1.37 0.711 1.31 Gapped Lambda K H 1.37 0.711 1.31 Matrix: blastn matrix:1 -3 Gap Penalties: Existence: 5, Extensi...e-08 3 ( BW336233 ) Ciona intestinalis cDNA, clone:ciem802f24, 5'end,... 46 2e-08... 3 ( BW338300 ) Ciona intestinalis cDNA, clone:ciem808k18, 5'end,... 46 2e-08 3 ( BW198676 ) Ciona intestina

  16. Dicty_cDB: Contig-U11573-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available vf-532-153... 47 0.002 AF072520_1( AF072520 |pid:none) Nicotiana tabacum centrin (CEN2) m... 47 0.002 ( P41041 ) Rec... ( FF956263 ) CBWU84390.b1 Yutaka Satou unpublished cDNA librar... 40 2.3 3 ( BW301102 ) Ciona intestinalis ...clone:cigd021p07, 5' end... 40 2.5 3 ( FG000324 ) CBWU115949.b1 Yutaka Satou unpublished cDNA libra... 40 2....5 3 ( FF937715 ) CBWU72908.b1 Yutaka Satou unpublished cDNA librar... 40 2.5 3 ( BW215316 ) Ciona intestinalis... 2.6 3 ( BW488095 ) Ciona intestinalis cDNA, clone:cima018a12, 3'end,... 40 2.6 3 ( FF858106 ) CBWU6786.b1 Yutaka Satou unpublis

  17. Dicty_cDB: Contig-U10806-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available gton's Disease gene homolo... 72 6e-11 ( P42859 ) RecName: Full=Huntingtin; AltName: Full=Huntington...671_5( AL954671 |pid:none) Zebrafish DNA sequence from clone ... 75 5e-12 ( P51112 ) RecName: Full=Huntingtin; AltName: Full=Huntingt...M162277 |pid:none) Ciona intestinalis mRNA for huntin... 72 4e-11 L28827_1( L28827 |pid:none) Mouse Huntin...on dise... 74 9e-12 AM238514_1( AM238514 |pid:none) Ciona intestinalis mRNA for hun

  18. Isolation of C11 Cyclopentenones from Two Didemnid Species, Lissoclinum sp. and Diplosoma sp.

    Directory of Open Access Journals (Sweden)

    Katsuhiro Ueda


    Full Text Available A series of new C11 cyclopentenones 1-7 was isolated, together with four known metabolites 9/10, 12 and 13, from the extract of the didemnid ascidian Lissoclinum sp. The other didemnid ascidian Diplosoma sp. contained didemnenones 1, 2 and 5, and five known metabolites 8-12. The structures of 1-7 were elucidated by spectroscopic analyses. Cytotoxicity of the isolated compounds was evaluated against three human cancer cell lines (HCT116, A431 and A549.

  19. Dicty_cDB: Contig-U13126-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 63 1 ( BW518158 ) Ciona savignyi cDNA, clone:csga014m04, 5'end, sin... 50 0.063 1 ( AY689436 ) Deer...pox virus W-848-83, complete genome. 40 0.066 5 ( AY689437 ) Deerpox virus W-1170-84, comp

  20. Gene : CBRC-CINT-01-0226 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CINT-01-0226 Novel UN D UNKNOWN CLCN2_MOUSE 0.0 56% gb|AAC06344.1| chloride channel 2 [Ratt ... ori Satoh unpublished cDNA library, juvenile whole animal ... Ciona intestinalis cDNA clone cijv408o05 5', mRNA ...

  1. Gene : CBRC-CINT-01-0007 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CINT-01-0007 Novel UN A UNKNOWN SSR2_HUMAN 9e-33 29% gb|AAP91736.1| kappa opioid receptor-l ... 0894 BW180279 Nori Satoh unpublished cDNA library, heart ... Ciona intestinalis cDNA clone rciht018k05 3', mRNA ...

  2. Gene : CBRC-CINT-01-0071 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CINT-01-0071 Novel UN A UNKNOWN SSR5_MOUSE 2e-31 30% gb|AAP91736.1| kappa opioid receptor-l ... 0894 BW180279 Nori Satoh unpublished cDNA library, heart ... Ciona intestinalis cDNA clone rciht018k05 3', mRNA ...

  3. Gene : CBRC-CINT-01-0121 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CINT-01-0121 Novel UN C UNKNOWN DSBD_CAMJR 1.2 21% gb|AAR24077.1| AMO [Drosophila melanogas ... 4677 BW184062 Nori Satoh unpublished cDNA library, heart ... Ciona intestinalis cDNA clone rciht029c01 3', mRNA ...

  4. Gene : CBRC-CINT-01-0018 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CINT-01-0018 Novel UN D UNKNOWN VGLX_EHV1V 2.1 22% dbj|BAC87602.1| unnamed protein product ... 3747 BW310187 Nori Satoh unpublished cDNA library, heart ... Ciona intestinalis cDNA clone ciht006l24 5', mRNA ...

  5. Particle-capture mechanisms in suspension-feeding invertebrates

    DEFF Research Database (Denmark)

    Riisgård, Hans Ulrik; Larsen, Poul Scheel


    A large number of suspension-feeding animals (e.g. bivalves, polychaetes, ascidians, bryozoans, crustaceans, sponges, echinoderms, cnidarians) have specialized in grazing on not only the 2 to 200 µm phytoplankton but frequently also the 0.5 to 2 µm free-living bacteria in the aquatic environment,...

  6. How the sea squirt nucleus tells mesoderm Not to be endoderm


    Parton, Richard M.; Davis, Ilan


    Sea squirts are simple invertebrate chordates. In this issue, Takatori et al show nuclear migration within ascidian mesendodermal cells enables polarized localization of Not mRNA, which encodes a homeobox protein that distinguishes mesoderm from endoderm fates. The link between nuclear migration and mRNA localization suggests exciting parallels with protostomes.

  7. The cyclopoid copepod Pseudomyicola spinosus (Raffaele & Monticelli) from marine pelecypods, chiefly in Bermuda and the West Indies

    NARCIS (Netherlands)

    Humes, Arthur G.


    The myicolid copepod Pseudomyicola spinosus is reported from 22 new hosts (pelecypods) in Bermuda and the West Indies, from 1 new host (a pelecypod) in Madagascar, and from an ascidian (Pyuridae) in Curaçao (probably an accidental association). P. spinosus is redescribed, based on specimens from Iso

  8. Proximate composition of marine invertebrates from tropical coastal waters, with emphasis on the relationship between nitrogen and protein contents


    Graciela S Diniz; Elisabete Barbarino; João Oiano-Neto; Sidney Pacheco; Sergio O. Lourenço


    The chemical profiles of Desmapsamma anchorata, Hymeniacidon heliophila (Porifera), Bunodosoma caissarum, Renilla muelleri (Cnidaria), Aplysia brasiliana, Eledone massyae, Isognomon bicolor (Mollusca), Echinaster brasiliensis, Echinometra lucunter, Holothuria grisea, Lytechinus variegatus (Echinodermata), and Phallusia nigra (Chordata) were determined. Hydrosoluble protein was the most abundant class of substances for all species, except for the ascidian Phallusia nigra, in which the carbohyd...

  9. The mitochondrial genome of Phallusia mammillata and Phallusia fumigata (Tunicata, Ascidiacea: high genome plasticity at intra-genus level

    Directory of Open Access Journals (Sweden)

    Pesole Graziano


    Full Text Available Abstract Background Within Chordata, the subphyla Vertebrata and Cephalochordata (lancelets are characterized by a remarkable stability of the mitochondrial (mt genome, with constancy of gene content and almost invariant gene order, whereas the limited mitochondrial data on the subphylum Tunicata suggest frequent and extensive gene rearrangements, observed also within ascidians of the same genus. Results To confirm this evolutionary trend and to better understand the evolutionary dynamics of the mitochondrial genome in Tunicata Ascidiacea, we have sequenced and characterized the complete mt genome of two congeneric ascidian species, Phallusia mammillata and Phallusia fumigata (Phlebobranchiata, Ascidiidae. The two mtDNAs are surprisingly rearranged, both with respect to one another and relative to those of other tunicates and chordates, with gene rearrangements affecting both protein-coding and tRNA genes. The new data highlight the extraordinary variability of ascidian mt genome in base composition, tRNA secondary structure, tRNA gene content, and non-coding regions (number, size, sequence and location. Indeed, both Phallusia genomes lack the trnD gene, show loss/acquisition of DHU-arm in two tRNAs, and have a G+C content two-fold higher than other ascidians. Moreover, the mt genome of P. fumigata presents two identical copies of trnI, an extra tRNA gene with uncertain amino acid specificity, and four almost identical sequence regions. In addition, a truncated cytochrome b, lacking a C-terminal tail that commonly protrudes into the mt matrix, has been identified as a new mt feature probably shared by all tunicates. Conclusion The frequent occurrence of major gene order rearrangements in ascidians both at high taxonomic level and within the same genus makes this taxon an excellent model to study the mechanisms of gene rearrangement, and renders the mt genome an invaluable phylogenetic marker to investigate molecular biodiversity and speciation

  10. Dicty_cDB: Contig-U14087-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available total letters Score E Sequences producing significant alignments: (bits) Value Contig-U14087-1 (Contig-U14087-1Q) /CSM_Contig/ S-transferase Y-b subu... 55 2e-06 (Q9JHF7) RecName: Full=Glutathione-requiring prostaglandin D Bordetella petrii strain DSM 12... 54 6e-06 ( O73888 ) RecName: Full=Glutathione-requiring prostaglandin...( AX886166 |pid:none) Sequence 2029 from Patent EP1033401. 49 3e-04 DQ789057_1( DQ789057 |pid:none) Ciona intestinalis prostaglandin... WO20080... 46 0.002 DQ789056_1( DQ789056 |pid:none) Ciona intestinalis prostaglandin D... 46 0

  11. Dicty_cDB: Contig-U09318-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number...en... 58 7e-04 2 ( EL565943 ) Physarum12351 Physarum polycephalum starvation st... 40 0.001 2 ( BR000263 ) TPA_inf: Ciona intesti...590765_1( AY590765 |pid:none) Cucumis sativus ferric reductase m... 70 6e-19 DQ144235_1( DQ144235 |pid:none) Porphyra yezoensis...rum polycephalum starvation st... 40 2e-06 3 ( BW185868 ) Ciona intestinalis cDNA, clone:rciht034e15, 3' Existence: 5, Extension: 2 Number of Hits to DB: 34,261 Number of Sequences: 6905 Number of extension

  12. Dicty_cDB: Contig-U06776-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 68135_1238( CU468135 |pid:none) Erwinia tasmaniensis strain ET1... 38 0.27 AP008971_1217( AP008971 |pid:none) Finegoldia mag...1 ( AA509039 ) MBAFCX6E07T3 Brugia malayi adult female cDNA (SAW... 48 0.38 1 ( AE009951 ) Fusobacterium nuc...n cDNA librar... 40 2.5 2 ( BW347533 ) Ciona intestinalis cDNA, clone:ciem836m11, 5'end,... 40 2....b1 Yutaka Satou unpublished cDNA librar... 40 2.7 2 ( BW396303 ) Ciona intestinalis cDNA, clone:ciem...51( CP000964 |pid:none) Klebsiella pneumoniae 342, comp... 84 2e-15 CP000647_1821

  13. Dicty_cDB: Contig-U16377-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CP001124 |pid:none) Geobacter bemidjiensis Bem, comp... 38 1.2 D00619_3( D00619 |pid:none) Bacillus subtilis genes for ribosoma....37 0.711 1.31 Matrix: blastn matrix:1 -3 Gap Penalties: Existence: 5, Extension: 2 Number of Hits to DB: 24...ipes adult whol... 74 6e-27 5 ( FC647651 ) CAXU9199.fwd CAXU Lottia gigantea from female gon... 103 1e-25 2 ..., 3'end,... 86 3e-24 2 ( BW402016 ) Ciona intestinalis cDNA, clone:ciem838d02, 3'end,... 86 3e-24 2 ( AV9962... clone:rcitb099d04, 3' en... 84 1e-23 2 ( BW396187 ) Ciona intestinalis cDNA, clone:ciem820g08, 3'end,... 84

  14. Dicty_cDB: Contig-U13737-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4905 ) Ciona intestinalis cDNA, clone:ciem816h13, 3'end,... 48 0.016 2 ( FF709347 ) XABT29982.rev Gateway compatible cie...n cDNA librar... 48 0.016 2 ( BW394585 ) Ciona intestinalis cDNA, clone:ciem815h13, 3'end,... 48.... 192 6e-48 AE017226_2247( AE017226 |pid:none) Treponema denticola ATCC 35405,... 192 6e-48 AE017180_2248( A... AP007255_4090( AP007255 |pid:none) Magnetospirillum magneticum AMB... 189 8e-47 CP000927_4520( CP000927 |pi...,... 186 4e-46 AM494969_338( AM494969 |pid:none) Leishmania braziliensis chromoso

  15. Dicty_cDB: Contig-U15431-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ( EV200506 ) 0101659 Brassica napus Cold acclimation - light B... 44 4.1 1 ( EV091132 ) 0187352 Brassica napus Apical...Matrix: blastn matrix:1 -3 Gap Penalties: Existence: 5, Extension: 2 Number of Hits to DB: 6962 Number of Se...7454 ) XABT209348.b1 Gateway compatible cien cDNA librar... 34 2.7 2 ( BP007860 ) Ciona intestinal...2 ) XABT129983.b1 Gateway compatible cien cDNA librar... 34 2.8 2 ( BW357775 ) Ciona intestinalis cDNA, clon...4 4.1 1 ( AC189231 ) Brassica rapa subsp. pekinensis clone KBrB013M01,... 44 4.1 1 ( U10401 ) Caenorhabditis

  16. Dicty_cDB: Contig-U11836-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ) CHORI51418E04TR BAC library from the primary brea... 36 2.1 2 ( AM850132 ) Chelonus inanitus bracovirus se...NA Library ... 48 0.70 1 ( AL499603 ) Human DNA sequence *** SEQUENCING CANCELLED *** f... 44 1.0 7 ( BW448452 ) Ciona intestina...ino Acid sequence (All Frames) Frame A: qiktmvlikmkn*snlveflenhqfimiyirlhfyhqiyfkxvklywyqdqevvslmqks mkhqiqifvimiqqfiim...60 Query: 361 cattaacccctccaaatgagagcttttcaatcattggtcaaaaagcatcggtaaganatt 420 |||||||||||||||||||||||||||||...||||||||||||||||||||||||||||||| Sbjct: 361 cattaacccctccaaatgagagcttttcaatcattggtcaaaaagcatcggtaagana

  17. Dicty_cDB: Contig-U09330-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ylem planings - daytime a... 60 1e-04 1 ( EX331539 ) GQ02903.B7_A06 GQ029 - Xylem scrapings - AT NITE ... 60... 1e-04 1 ( EX323057 ) GQ02819.SP6_M07 GQ028 - Cambium / phloem scrappin... 60 1e-04 1 ( EX322713 ) GQ02819.B...7_M07 GQ028 - Cambium / phloem scrapping... 60 1e-04 1 ( AV999726 ) Ciona intesti

  18. In silico identification of the sea squirt selenoproteome

    Directory of Open Access Journals (Sweden)

    Jiang Liang


    Full Text Available Abstract Background Computational methods for identifying selenoproteins have been developed rapidly in recent years. However, it is still difficult to identify the open reading frame (ORF of eukaryotic selenoprotein gene, because the TGA codon for a selenocysteine (Sec residue in the active centre of selenoprotein is traditionally a terminal signal of protein translation. Although the identification of selenoproteins from genomes through bioinformatics methods has been conducted in bacteria, unicellular eukaryotes, insects and several vertebrates, only a few results have been reported on the ancient chordate selenoproteins. Results A gene assembly algorithm SelGenAmic has been constructed and presented in this study for identifying selenoprotein genes from eukaryotic genomes. A method based on this algorithm was developed to build an optimal TGA-containing-ORF for each TGA in a genome, followed by protein similarity analysis through conserved sequence alignments to screen out selenoprotein genes form these ORFs. This method improved the sensitivity of detecting selenoproteins from a genome due to the design that all TGAs in the genome were investigated for its possibility of decoding as a Sec residue. Using this method, eighteen selenoprotein genes were identified from the genome of Ciona intestinalis, leading to its member of selenoproteome up to 19. Among them a selenoprotein W gene was found to have two SECIS elements in the 3'-untranslated region. Additionally, the disulfide bond formation protein A (DsbA was firstly identified as a selenoprotein in the ancient chordates of Ciona intestinalis, Ciona savignyi and Branchiostoma floridae, while selenoprotein DsbAs had only been found in bacteria and green algae before. Conclusion The method based on SelGenAmic algorithm is capable of identifying eukaryotic selenoprotein genes from their genomes. Application of this method to Ciona intestinalis proves its successes in finding Sec-decoding TGA

  19. Predation Risk within Fishing Gear and Implications for South Australian Rock Lobster Fisheries. (United States)

    Briceño, Felipe; Linnane, Adrian Joseph; Quiroz, Juan Carlos; Gardner, Caleb; Pecl, Gretta Tatyana


    Depredation of southern rock lobster (Jasus edwardsii) within fishing gear by the Maori octopus (Pinnoctopus cordiformis) has economic and ecological impacts on valuable fisheries in South Australia. In addition, depredation rates can be highly variable resulting in uncertainties for the fishery. We examined how in-pot lobster predation was influenced by factors such as lobster size and sex, season, fishing zone, and catch rate. Using mixed modelling techniques, we found that in-pot predation risk increased with lobster size and was higher for male lobsters. In addition, the effect of catch rate of lobsters on predation risk by octopus differed among fishing zones. There was both a seasonal and a spatial component to octopus predation, with an increased risk within discrete fishing grounds in South Australia at certain times of the year. Information about predation within lobster gear can assist fishery management decision-making, potentially leading to significant reduction in economic losses to the fishery. PMID:26489035

  20. Predation Risk within Fishing Gear and Implications for South Australian Rock Lobster Fisheries.

    Directory of Open Access Journals (Sweden)

    Felipe Briceño

    Full Text Available Depredation of southern rock lobster (Jasus edwardsii within fishing gear by the Maori octopus (Pinnoctopus cordiformis has economic and ecological impacts on valuable fisheries in South Australia. In addition, depredation rates can be highly variable resulting in uncertainties for the fishery. We examined how in-pot lobster predation was influenced by factors such as lobster size and sex, season, fishing zone, and catch rate. Using mixed modelling techniques, we found that in-pot predation risk increased with lobster size and was higher for male lobsters. In addition, the effect of catch rate of lobsters on predation risk by octopus differed among fishing zones. There was both a seasonal and a spatial component to octopus predation, with an increased risk within discrete fishing grounds in South Australia at certain times of the year. Information about predation within lobster gear can assist fishery management decision-making, potentially leading to significant reduction in economic losses to the fishery.

  1. T-type Calcium Channel Regulation of Neural Tube Closure and EphrinA/EPHA Expression

    Directory of Open Access Journals (Sweden)

    Sarah Abdul-Wajid


    Full Text Available A major class of human birth defects arise from aberrations during neural tube closure (NTC. We report on a NTC signaling pathway requiring T-type calcium channels (TTCCs that is conserved between primitive chordates (Ciona and Xenopus. With loss of TTCCs, there is a failure to seal the anterior neural folds. Accompanying loss of TTCCs is an upregulation of EphrinA effectors. Ephrin signaling is known to be important in NTC, and ephrins can affect both cell adhesion and repulsion. In Ciona, ephrinA-d expression is downregulated at the end of neurulation, whereas, with loss of TTCC, ephrinA-d remains elevated. Accordingly, overexpression of ephrinA-d phenocopied TTCC loss of function, while overexpression of a dominant-negative Ephrin receptor was able to rescue NTC in a Ciona TTCC mutant. We hypothesize that signaling through TTCCs is necessary for proper anterior NTC through downregulation of ephrins, and possibly elimination of a repulsive signal.

  2. Geographically conserved microbiomes of four temperate water tunicates. (United States)

    Cahill, Patrick L; Fidler, Andrew E; Hopkins, Grant A; Wood, Susanna A


    Tunicates are useful models for exploring microbiomes because they have an innate immune system resembling that of chordates. Automated ribosomal RNA intergenic spacer analysis and High-Throughput Sequencing were used to compare the tunic microbiomes of Ciona robusta (formerly Ciona intestinalis type A), Ciona savignyi, Botrylloides leachi and Botryllus schlosseri sampled from three distinct locations with limited genetic connectivity. Bacterial phylotype profiles were conserved within each species, and there were no detectable differences between tunic and tunic + cuticle subsamples from an individual. Bacterial operational taxonomic unit (OTU) diversity was lowest for C. savignyi (320 ± 190 OTUs) and highest for B. schlosseri (1260 ± 190 OTUs). Each species had a distinct set of bacterial OTUs (pseudo-F = 3.0, p > 0.001), with the exception of B. leachi and B. schlosseri from one sampling location (t = 1.2, p = 0.09). Of note were OTUs assigned to Alphaproteobacteria from C. robusta plus Phyllobacteriaceae and Endozoicomonas from C. savignyi. These OTUs contributed 51, 22 and 10% of sequence reads, respectively, and are related to known bacterial symbionts. The within-species conservation of core OTUs across three distinct and co-occurring populations of tunicates provides compelling evidence that these tunicates foster defined microbiomes. PMID:26929150

  3. Structure and function of vanadium compounds in living organisms. (United States)

    Rehder, D


    Vanadium has been recognized as a metal of biological importance only recently. In this mini-review, its main functions uncovered during the past few years are addressed. These encompass (i) the regulation of phosphate metabolizing enzymes (which is exemplified for the inhibition of ribonucleases by vanadate), (ii) the halogenation of organic compounds by vanadate-dependent non-heme peroxidases from seaweeds, (iii) the reductive protonation of nitrogen (nitrogen fixation) by alternative, i.e. vanadium-containing, nitrogenases from N2-fixing bacteria, (iv) vanadium sequestering by sea squirts (ascidians), and (v) amavadine, a low molecular weight complex of V(IV) accumulated in the fly agaric and related toadstools. The function of vanadium, while still illusive in ascidians and toadstools, begins to be understood in vanadium-enzyme interaction. Investigations into the structure and function of model compounds play an increasingly important role in elucidating the biological significance of vanadium. PMID:1392470

  4. Effects of simulated eutrophication and overfishing on algae and invertebrate settlement in a coral reef of Koh Phangan, Gulf of Thailand. (United States)

    Stuhldreier, Ines; Bastian, Pepe; Schönig, Eike; Wild, Christian


    Coral reefs in the Gulf of Thailand are highly under-investigated regarding responses to anthropogenic stressors. Thus, this study simulated overfishing and eutrophication using herbivore exclosure cages and slow-release fertilizer to study the in-situ effects on benthic algae and invertebrate settlement in a coral reef of Koh Phangan, Thailand. Settlement of organisms and the development of organic matter on light-exposed and shaded tiles were quantified weekly/biweekly over a study period of 12 weeks. Simulated eutrophication did not significantly influence response parameters, while simulated overfishing positively affected dry mass, turf algae height and fleshy macroalgae occurrence on light-exposed tiles. On shaded tiles, settlement of crustose coralline algae decreased, while abundances of ascidians increased compared to controls. An interactive effect of both stressors was not observed. These results hint to herbivory as actual key controlling factor on the benthic community, and fleshy macroalgae together with ascidians as potential bioindicators for local overfishing. PMID:25649838

  5. Cyanobacterial Diversity and a New Acaryochloris-Like Symbiont from Bahamian Sea-Squirts


    Susanna López-Legentil; Bongkeun Song; Manel Bosch; Joseph R Pawlik; Xavier Turon


    Symbiotic interactions between ascidians (sea-squirts) and microbes are poorly understood. Here we characterized the cyanobacteria in the tissues of 8 distinct didemnid taxa from shallow-water marine habitats in the Bahamas Islands by sequencing a fragment of the cyanobacterial 16S rRNA gene and the entire 16S-23S rRNA internal transcribed spacer region (ITS) and by examining symbiont morphology with transmission electron (TEM) and confocal microscopy (CM). As described previously for other s...

  6. Diversity of Nonribosomal Peptide Synthetase Genes in the Microbial Metagenomes of Marine Sponges


    Ute Hentschel; Sheila Marie Pimentel-Elardo; Sebastian Proksch; Lubomir Grozdanov


    Genomic mining revealed one major nonribosomal peptide synthetase (NRPS) phylogenetic cluster in 12 marine sponge species, one ascidian, an actinobacterial isolate and seawater. Phylogenetic analysis predicts its taxonomic affiliation to the actinomycetes and hydroxy-phenyl-glycine as a likely substrate. Additionally, a phylogenetically distinct NRPS gene cluster was discovered in the microbial metagenome of the sponge Aplysina aerophoba, which shows ...

  7. Investigation of the potential anticancer and antifungal active secondary metabolites from marine natural products


    Boonlarppradab, Chollaratt


    The oceans are a unique resource that has contributed greatly to the field of natural products chemistry. Secondary metabolites from natural sources still play an important role in drug discovery and development by providing pharmaceutical candidates with novel structures that are valuable for synthetic modification. Of the marine organisms described to date, the vast majority of marine natural products derive from invertebrates such as sponges, ascidians, bryozoans, and tunicates. Recently, ...

  8. Antimicrobial natural products from Arctic and sub-Arcticmarine invertebrates


    Tadesse, Margey


    Infectious diseases are a leading cause of death world-wide and there is a growing need for new anti-infective agents to combat multi-resistant strains of bacteria and fungi. Marine natural products are promising sources of novel antimicrobial compounds. In the present thesis, an investigation into the antimicrobial metabolites of Arctic and sub-Arctic marine invertebrate species is presented. Extracts of seven ascidian species, six sponge species, a soft-alcyonid coral and a bryozoan species...

  9. Antibiotic, cytotoxic and enzyme inhibitory activity of crude extracts from Brazilian marine invertebrates Atividade antibiótica, citotóxica e de inibição enzimática de extratos brutos de invertebrados marinhos do Brasil


    Mirna H.R. Seleghim; Simone P. Lira; Miriam H. Kossuga; Tatiana Batista; Roberto G. S. Berlinck; Eduardo Hajdu; Guilherme Muricy; Rosana M. da Rocha; Gislene G. F. do Nascimento; Marcio Silva; Eli F. Pimenta; Thiemann, Otávio H.; Glaucius Oliva; Bruno C. Cavalcanti; Claudia Pessoa


    Herein we present the results of a screening with 349 crude extracts of Brazilian marine sponges, ascidians, bryozoans and octocorals, against 16 strains of susceptible and antibiotic-resistant bacteria, one yeast (Candida albicans), Mycobacterium tuberculosis H37Rv, three cancer cell lines MCF-7 (breast), B16 (murine melanoma ) and HCT8 (colon), and Leishmania tarentolae adenine phosphoribosyl transferase (L-APRT) enzyme. Less than 15% of marine sponge crude extracts displayed antibacterial ...

  10. Cryptic speciation or global spread? The case of a cosmopolitan marine invertebrate with limited dispersal capabilities


    Pérez-Portela, R.; Arranz, V.; Rius, Marc; Turon, Xavier


    The existence of globally-distributed species with low dispersal capabilities is a paradox that has been explained as a result of human-mediated transport and by hidden diversity in the form of unrecognized cryptic species. Both factors are not mutually exclusive, but relatively few studies have demonstrated the presence of both. Here we analyse the genetic patterns of the colonial ascidian Diplosoma listerianum, a species nowadays distributed globally. The study of a fragment of ...

  11. Ecología química en el bentos marino de la Antártida: productos naturales y defensa química en esponjas hexactinélidas, corales blandos y ascidias coloniales


    Núñez Pons, Laura


    The inhabitants of marine benthos must combat the ecological pressure caused by predation, competition and fouling through a series of mechanisms, one of which is chemical defense. This type of protection is particularly extended among sessile and/or sluggish organisms, such as sponges, soft corals or ascidians. The strategies to prevent predation are related to bad taste rather than to toxicity. Moreover, they must be considered along with nutritional quality, since the more nutritious the p...

  12. Tunicates: exploring the sea shores and roaming the open ocean. A tribute to Thomas Huxley


    Lemaire, Patrick; Piette, Jacques


    This review is a tribute to the remarkable contributions of Thomas Huxley to the biology of tunicates, the likely sister group of vertebrates. In 1851, the great biologist and philosopher published two landmark papers on pelagic tunicates in the Philosophical Transactions of the Royal Society. They were dedicated to the description of the adult anatomy and life cycle of thaliaceans and appendicularians, the pelagic relatives of ascidians. In the first part of this review, we discuss the novel...

  13. Wnt affects symmetry and morphogenesis during post-embryonic development in colonial chordates


    Di Maio, Alessandro; Setar, Leah; Tiozzo, Stefano; De Tomaso, Anthony W


    Background Wnt signaling is one of the earliest and most highly conserved regulatory pathways for the establishment of the body axes during regeneration and early development. In regeneration, body axes determination occurs independently of tissue rearrangement and early developmental cues. Modulation of the Wnt signaling in either process has shown to result in unusual body axis phenotypes. Botryllus schlosseri is a colonial ascidian that can regenerate its entire body through asexual buddin...

  14. Prospective protochordate homologs of vertebrate midbrain and MHB, with some thoughts on MHB origins

    Directory of Open Access Journals (Sweden)

    Thurston C. Lacalli


    Full Text Available The MHB (midbrain-hindbrain boundary is a key organizing center in the vertebrate brain characterized by highly conserved patterns of gene expression. The evidence for an MHB homolog in protochordates is equivocal, the "neck" region immediately caudal to the sensory vesicle in ascidian larvae being the best accepted candidate. It is argued here that similarities in expression patterns between the MHB and the ascidian neck region are more likely due to the latter being the principal source of neurons in the adult brain, and hence where all the genes involved in patterning the latter will necessarily be expressed. The contrast with amphioxus is exemplified by pax2/5/8, expressed in the neck region in ascidian larvae, but more caudally, along much of the nerve cord in amphioxus. The zone of expression in each case corresponds with that part of the nerve cord ultimately responsible for innervating the adult body, which suggests the spatially restricted MHB-like expression pattern in ascidians is secondarily reduced from a condition more like that in amphioxus. Patterns resembling those of the vertebrate MHB are nevertheless found elsewhere among metazoans. This suggests that, irrespective of its modern function, the MHB marks the site of an organizing center of considerable antiquity. Any explanation for how such a center became incorporated into the chordate brain must take account of the dorsoventral inversion chordates have experienced relative to other metazoans. Especially relevant here is a concept developed by Claus Nielsen, in which the brain is derived from a neural center located behind the ancestral mouth. While this is somewhat counterintuitive, it accords well with emerging molecular data.

  15. New genes in the evolution of the neural crest differentiation program


    Martínez-Morales, Juan Ramón; Henrich, Thorsten; Ramialison, Mirana; Wittbrodt, Joachim


    BACKGROUND: Development of the vertebrate head depends on the multipotency and migratory behavior of neural crest derivatives. This cell population is considered a vertebrate innovation and, accordingly, chordate ancestors lacked neural crest counterparts. The identification of neural crest specification genes expressed in the neural plate of basal chordates, in addition to the discovery of pigmented migratory cells in ascidians, has challenged this hypothesis. These new findings revive th...

  16. Taxonomy, phylogeny, historical biogeography, and historical ecology of the genus Pontonia (Crustacea: Decapoda: Caridea: Palaemonidae)


    Fransen, C.H.J.M.


    Species of the genus Pontonia Latreille, 1829, are distributed in tropical and subtropical waters around the world, living in association with either molluscan or ascidian hosts. In the present taxonomic revision, Pontonia sensu lato is divided into six genera: Pontonia sensu stricto; Ascidonia gen. nov., Rostronia gen. nov., Dactylonia gen. nov., Odontonia gen. nov., and Bruceonia gen. nov. A total of 29 species is described and figured, four of which are new to science: Pontonia pilosa spec...

  17. Phallusiasterol C, A New Disulfated Steroid from the Mediterranean Tunicate Phallusia fumigata

    Directory of Open Access Journals (Sweden)

    Concetta Imperatore


    Full Text Available A new sulfated sterol, phallusiasterol C (1, has been isolated from the Mediterranean ascidian Phallusia fumigata and its structure has been determined on the basis of extensive spectroscopic (mainly 2D NMR analysis. The possible role in regulating the pregnane X receptor (PXR activity of phallusiasterol C has been investigated; although the new sterol resulted inactive, this study adds more items to the knowledge of the structure-PXR regulating activity relationships in the case of sulfated steroids.

  18. Polycheria josephensis, a new species of symbiotic amphipod (Crustacea, Amphipoda, Dexaminidae) from the Northern Gulf of Mexico, with notes on its ecology


    Foster, John; Thoma, Brent


    Polycheria josephensis sp. n. (Dexaminidae), an ascidian symbiont, is described from St. Joseph Bay, Florida and other locations in the Gulf of Mexico and the nearshore Atlantic Ocean from South Carolina to northern Florida. Observations on its ecology, behavior, and distribution are provided. Polycheria josephensis sp. n. is morphologically most similar to Polycheria osborni Calman, 1898 from the Pacific coast of North America. Polycheria josephensis sp. n. differs from P. osborni in the num...

  19. Cross-phylum functional equivalence of Otx genes and the origin of brain patterning


    Adachi, Yoshitsugu


    Molecular mechanisms of cephalic development is an intriguing question in evolutionary and developmental biology. Otx gene plays important roles in animal brain and head development and Otx genes are found in all major animal groups: cnidarians, lophotrochozoans, ecdysozoans, anddeuterostomes. Ascidians, positioned near the origin of the phylum Chordata, share a conserved set of anteroposterior patterning genes withthat of vertebrates. Here I report the cross-phylum regulatory potential of th...

  20. In vivo antithrombotic properties of a heparin from the oocyte test cells of the sea squirt Styela plicata(Chordata-Tunicata)


    L. Cardilo-Reis; M.C.M. Cavalcante; C.B.M. Silveira; M.S.G. Pavão


    In the ascidian Styela plicata, the oocytes are surrounded by two types of accessory cells named follicle cells and test cells. A heparin-like substance with an anticoagulant activity equivalent to 10% of mammalian heparin and about 5% as potent as the mammalian counterpart for the inhibition of thrombin by antithrombin was isolated from the oocyte test cells. In the present study, we compared the antithrombotic and hemorrhagic effects of sea squirt oocyte test cell heparin with those of porc...

  1. Water-borne sperm trigger vitellogenic egg growth in two sessile marine invertebrates.


    Bishop, J D; Manríquez, P H; Hughes, R. N.


    A diverse array of sessile marine invertebrates mate by passive dispersal of sperm which fertilize the brooded eggs of neighbours. In two such species, a sea-mat (phylum Bryozoa) and an ascidian (phylum Chordata), vitellogenic egg growth is absent in reproductively isolated specimens, but is triggered by a water-borne factor released by conspecifics. In both of these colonial, hermaphroditic species, the active factor can be removed from water by filtration. The effect involves self-/non-self...

  2. Territoriality and Conflict Avoidance Explain Asociality (Solitariness) of the Endosymbiotic Pea Crab Tunicotheres moseri. (United States)

    Ambrosio, Louis J; Baeza, J Antonio


    Host monopolization theory predicts symbiotic organisms inhabiting morphologically simple, relatively small and scarce hosts to live solitarily as a result of territorial behaviors. We tested this prediction with Tunicotheres moseri, an endosymbiotic crab dwelling in the atrial chamber of the morphologically simple, small, and relatively scarce ascidian Styela plicata. As predicted, natural populations of T. moseri inhabit ascidian hosts solitarily with greater frequency than expected by chance alone. Furthermore, laboratory experiments demonstrated that intruder crabs take significantly longer to colonize previously infected compared to uninfected hosts, indicating as expected, that resident crabs exhibit monopolization behaviors. While territoriality does occur, agonistic behaviors employed by T. moseri do not mirror the overt behaviors commonly reported for other territorial crustaceans. Documented double and triple cohabitations in the field coupled with laboratory observations demonstrating the almost invariable success of intruder crabs colonizing occupied hosts, suggest that territoriality is ineffective in completely explaining the solitary social habit of this species. Additional experiments showed that T. moseri juveniles and adults, when searching for ascidians use chemical cues to avoid hosts occupied by conspecifics. This conspecific avoidance behavior reported herein is a novel strategy most likely employed to preemptively resolve costly territorial conflicts. In general, this study supports predictions central to host monopolization theory, but also implies that alternative behavioral strategies (i.e., conflict avoidance) may be more important than originally thought in explaining the host use pattern of symbiotic organisms. PMID:26910474

  3. The hemocytes of Polyandrocarpa mysakiensis: morphology and immune-related activities

    Directory of Open Access Journals (Sweden)

    L Ballarin


    Full Text Available A preliminary study of the hemocytes of developing buds of the compound ascidian Polyandrocarpa misakiensis was carried out at the light microscope level for a better understanding of their biological role. Similarly to other ascidians, P. misakiensis immunocytes are represented by phagocytes and morula cells. Phagocytes include hyaline amoebocytes and round, giant phagocytes, the former the probable precursors of the latter. Hyaline amoebocytes showed high macropinocytotic activity in the presence of bacteria, whereas yeast cells were ingested by phagocytosis. Morula cells contain the enzyme phenoloxidase inside their vacuoles, probably stored as pro-enzyme, which is released upon the recognition of non-self. Together with macrogranular leukocytes, morula cells were the most abundant hemocyte-types which stresses the importance of these cells in Polyandrocarpa biology. Macrogranular leukocytes are frequently found inside the vacuoles of phagocytes and were recognized by a polyclonal antibody raised against an opsonin purified from the colonial ascidian Botryllus schlosseri, which suggests that a similar lectin can be involved in the interaction between these cells and phagocytes.

  4. Origin and evolution of retinoid isomerization machinery in vertebrate visual cycle: hint from jawless vertebrates.

    Directory of Open Access Journals (Sweden)

    Eugenia Poliakov

    Full Text Available In order to maintain visual sensitivity at all light levels, the vertebrate eye possesses a mechanism to regenerate the visual pigment chromophore 11-cis retinal in the dark enzymatically, unlike in all other taxa, which rely on photoisomerization. This mechanism is termed the visual cycle and is localized to the retinal pigment epithelium (RPE, a support layer of the neural retina. Speculation has long revolved around whether more primitive chordates, such as tunicates and cephalochordates, anticipated this feature. The two key enzymes of the visual cycle are RPE65, the visual cycle all-trans retinyl ester isomerohydrolase, and lecithin:retinol acyltransferase (LRAT, which generates RPE65's substrate. We hypothesized that the origin of the vertebrate visual cycle is directly connected to an ancestral carotenoid oxygenase acquiring a new retinyl ester isomerohydrolase function. Our phylogenetic analyses of the RPE65/BCMO and N1pC/P60 (LRAT superfamilies show that neither RPE65 nor LRAT orthologs occur in tunicates (Ciona or cephalochordates (Branchiostoma, but occur in Petromyzon marinus (Sea Lamprey, a jawless vertebrate. The closest homologs to RPE65 in Ciona and Branchiostoma lacked predicted functionally diverged residues found in all authentic RPE65s, but lamprey RPE65 contained all of them. We cloned RPE65 and LRATb cDNAs from lamprey RPE and demonstrated appropriate enzymatic activities. We show that Ciona ß-carotene monooxygenase a (BCMOa (previously annotated as an RPE65 has carotenoid oxygenase cleavage activity but not RPE65 activity. We verified the presence of RPE65 in lamprey RPE by immunofluorescence microscopy, immunoblot and mass spectrometry. On the basis of these data we conclude that the crucial transition from the typical carotenoid double bond cleavage functionality (BCMO to the isomerohydrolase functionality (RPE65, coupled with the origin of LRAT, occurred subsequent to divergence of the more primitive chordates

  5. Dicty_cDB: SSA652 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lvnkrnykfnktnngyknn*lvnkkn*nfnkrn*nvn krliinvv*nlnknwrnlkkiklkemqeikkrnkkekqenkkrnkrekkkrnkk...gitnstkptmvtrtinsstrrietstrgiktst rd*sstsfri*trigei*krss*krckrskretrkrskrtkretrerrkretrkggegk- -- ---kinkdki... /CSM/SL/SLF2-D/SLF288Q.Seq.d/ 46 8e-04 own update 2004.12.25 Homology vs DNA Score E Sequences producing si...68 1 BW029366 |BW029366.1 Ciona intestinalis cDNA, clone:cibd012e01, 5' end, single read. 38 0.70 2 AC129853...gion, partial cds. 44 2.7 1 dna update 2003. 7.30 Homology vs Protein Score E Sequences producing sign

  6. Dicty_cDB: SHC678 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s FZB42... 157 1e-37 AP009256_516( AP009256 |pid:none) Bifidobacterium adolescentis ATC......plnlnn*fvvfvvclwvqsi slnv Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits...ogy vs Protein Score E Sequences producing significant alignments: (bits) Value AM05006... 7.6 2 BW151201 |BW151201.1 Ciona intestinalis cDNA, clone:rcigd014m23, 3' end, single read. 30 7.7 2 dna update 2006. 1.20 Homol... producing significant alignments: (bits) Value N BG04340

  7. Dicty_cDB: Contig-U16200-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available pt livqerdsklklmpsllklmlnkkprinkskktrrskpnsknternsanqkrprpknssl sknskqitreprkkllmnnnnvlllktisvntsvkshyskmplisynviti...cluded Contig length 3455 Chromosome number (1..6, M) 4 Chromosome length 5430582 Start point 4454867 End point...' ... 34 1.8 4 ( EX476109 ) EST_lsal_evj_796653 lsalevj mixed_tissue_mixed_st... 46 1.9 2 ( BW284033 ) Ciona intestin...... 99 7e-35 D89990_1( D89990 |pid:none) Cyprinus carpio mRNA for myosin heavy ... 102 7e-35...-9; AltName: Full=Myosin heavy chai... 132 4e-29 D89991_1( D89991 |pid:none) Cyprinus carpio mRNA for myosin

  8. Dicty_cDB: Contig-U11539-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available iiisrffnfiwimaeyssnfhfsfnnnicnshfsvksfyfqkg*i kvvgidyyckiififnsiniidf**flytfnyfnsnclfnyllf...Contig-U11539-1 gap included 1277 - - - - 1 2 U11539 0 0 0 1 0 0 0 0 0 0 0 0 0 0 Sh...ATTTTAATTATTATCTCAACCTTTGAT TGCAGTAAAAAAAAATAAAACATTTAGNCTTTAATTA Gap gap included Contig length 1277 Chromo...B31, complete genome. 36 8.3 16 ( AV890473 ) Ciona intestinalis cDNA, clone:rcicl28k07, 3' end... 34 8.3 2 (...f*n*nfkf*t riifktfnykfilpk*lynckwyfyi*ciqtrvkyvlfgik*iegyrlsi*r*yyqysng krfqynvsifkffkfnti*ff*filnflfykgfnaiywmqf*pnsn

  9. Dicty_cDB: CHS244 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available d:none) Homo sapiens mRNA for mannosidase,... 121 4e-26 AY099704_1( AY099704 |pid:none) Arabidopsis thaliana alpha-man... sequence. 74 9e-13 2 BW354577 |BW354577.1 Ciona intestinalis cDNA, clone:cima804e24, 5'end, single read. 66...dqicqlhlqvfnilwiqplpvywqiqkeslfmlklhfskdggmnkvqqckill rvwlkvvnwn--- ---hhgi*pwfnqpvvim...M82822.1 Dictyostelium discoideum alpha-mannosidase (manA) gene, complete cds. 1302 0.0 1 CK149800 |CK149800...( P34098 ) RecName: Full=Lysosomal alpha-mannosidase; Sho... 387 e-106 M82822_1(

  10. Dicty_cDB: VSC519 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ivfrhnakangywnwsfenq*fsnhlqinlqc***ckl*fh*nftitrcthfsl *nqferesrenq*ifrkd*rslg**ldl**...gfgnsmvvi*syhsnqfvilvim qisilklsfkineknk Homology vs CSM-cDNA Score E Sequences producing significant alignment....12.25 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N AV869558 |AV869558.1 Ciona BONKJ18, DNA sequence. 40 1.7 2 dna update 2003. 8.20 Homology vs Protein Score E Sequences producing significant alignment...QSSYWVWKFDGGNLVVSFKSICNTSDN ANFNFEALL*n**kk* Translated Amino Acid sequence (All Frames) Frame A: ---nak

  11. Dicty_cDB: Contig-U15458-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ntestinalis cDNA, clone:ciem809f22, 5'end,... 72 1e-19 3 ( BW364920 ) Ciona intestinalis cDNA, clone:cima834...1 Hydra EST UCI 5 ALP Hydra magnipapill... 64 6e-19 3 ( FF733140 ) XABT47017.fwd Gateway compatible cie... 212 1e-53 AF049901_1( AF049901 |pid:none) Trypanosoma brucei rhodesiense pro... ... 0.45 CP000826_1147( CP000826 |pid:none) Serratia proteamaculans 568, co... 38 0.45 AP006725_403( AP006725 |pid:none) Klebsie...ylidllv*rikfimkvlillfhglnvlkfmmlelnhvvfhh*lvvkifkwlilqsef yqnqklvnfqpsiehwvkimmkeyyhql*mkf*rvllhnsmhln*slkenkcqd*slkd* livlkisi

  12. Dicty_cDB: Contig-U16106-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available taktyl ecmgknivhcgdvgtgqvakvcnnlvlgismiavseamnlgvkqgmdpkklagifntssa rcwtselynpcpgvietspasrgytggfgsalmtkdlglavdsaksi....31 Gapped Lambda K H 1.37 0.711 1.31 Matrix: blastn matrix:1 -3 Gap Penalties: Existence: 5, Extensi... 2 ( FD461602 ) LARVM85TR Haematobia irritans 1st Instar Larvae H... 30 0.11 4 ( FC697910 ) CAXX6401.fwd CAX...fwd CAXU Lottia gigantea from female gon... 46 0.14 2 ( FC644415 ) CAXU7159.fwd CAXU Lottia gigantea from fema...9 2 ( BW352889 ) Ciona intestinalis cDNA, clone:ciem852o16, 5'end,... 38 0.39 2 (

  13. Dicty_cDB: Contig-U02820-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ces; 5,674,871 total letters Score E Sequences producing significant alignments: (bits) Value Contig-U02820-1 (Cont...ces producing significant alignments: (bits) Value N ( BJ344428 ) Dictyostelium discoideum cDNA clon...e Score E Sequences producing significant alignments: (bits) Value BC081036_1( BC081036 |pid:none) Xen...ce 28 from Patent WO0246454. 36 1.6 4 ( AE014849 ) Plasmodium falciparum 3D7 chromosome 12, section... 44 6.2 1 ( BW404170 ) Ciona intestinalis cDNA, clone:ciem844j10, 3'end,... 44 6.2 1 ( BW106515 ) Cion

  14. TCF/Lef regulates the Gsx ParaHox gene in central nervous system development in chordates


    Garstang, Myles Grant; Osborne, Peter; Ferrier, David Ellard Keith


    Background The ParaHox genes play an integral role in the anterior-posterior (A-P) patterning of the nervous system and gut of most animals. The ParaHox cluster is an ideal system in which to study the evolution and regulation of developmental genes and gene clusters, as it displays similar regulatory phenomena to its sister cluster, the Hox cluster, but offers a much simpler system with only three genes. Results Using Ciona intestinalis transgenics, we isolated a regulatory element upstream ...

  15. A Conserved Non-Reproductive GnRH System in Chordates


    Kusakabe, Takehiro G.; Tsubasa Sakai; Masato Aoyama; Yuka Kitajima; Yuki Miyamoto; Toru Takigawa; Yutaka Daido; Kentaro Fujiwara; Yasuko Terashima; Yoko Sugiuchi; Giorgio Matassi; Hitoshi Yagisawa; Min Kyun Park; Honoo Satake; Motoyuki Tsuda


    Gonadotropin-releasing hormone (GnRH) is a neuroendocrine peptide that plays a central role in the vertebrate hypothalamo-pituitary axis. The roles of GnRH in the control of vertebrate reproductive functions have been established, while its non-reproductive function has been suggested but less well understood. Here we show that the tunicate Ciona intestinalis has in its non-reproductive larval stage a prominent GnRH system spanning the entire length of the nervous system. Tunicate GnRH recept...

  16. Dicty_cDB: Contig-U10384-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 37 |pid:none) Chloroflexus aggregans DSM 9485... 110 1e-22 ( Q00659 ) RecName: Full=Sulfur metabolite repression control...ella nidulans sulfur metabolite ... 108 4e-22 AB076893_1( AB076893 |pid:none) Ciona intestinali... DNA Library Caenorhab... 36 2.4 2 ( CP000728 ) Clostridium botulinum F str. Langeland, co...01097 |pid:none) Chlorobium limicola DSM 245, co... 125 3e-27 AP009552_5466( AP009552 |pid:none) Microcystis aeruginos...tyon phaeoclathratiforme ... 117 9e-25 AC007259_17( AC007259 |pid:none) Arabidopsis thaliana chromos

  17. Sobre la pizza. Identificación y apropiación alimenticias en el mundo contemporáneo


    Duhart, Fréderic; Meinhardt Haid, Oliver; Tellström, Richard


    Proponemos una reflex ión ant ropológica sobre la pizza en el mundo contemporáneo. Insistimos en la utilización de la pizza en procesos de ide nt ifi cación y de apropiación alimenticia. Según los contex tos, 1a pizza fun ciona como un espejo en el cual un grupo revela los elementos de su cu ltura al imenticia que le parecen esenciales o como una pantalla en la cual se proyectan imágenes de la coci na del Otro.

  18. Dicty_cDB: SHA718 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 00020 |CP000020.1 Vibrio fischeri ES114 chromosome I, complete sequence. 46 0.69 1 BG521055 |BG521055.1 ps05c09.y3 Trichinella... spiralis ML CMVsport jasmer Trichinella spiralis cDNA 5' simil...50920.1 Ciona intestinalis cDNA, clone:cicl05g22, 5' end, single read. 42 0.81 2 BG519938 |BG519938.1 ps05c09.y2 Trichinella... spiralis ML CMVsport jasmer Trichinella spiralis cDNA 5' similar

  19. Dicty_cDB: SLD285 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available cl*tcqsfh*klncqrsrstsycq tms**plalw**sinwfcc*splsfr*kdeei**pkkrwsifk*lnliiiiikkkk...modulin-... 153 8e-36 ( Q63450 ) RecName: Full=Calcium/calmodulin-dependent protein 152 1e-35 ( Q14012 ) RecName: Full=Calcium/calmodulin-dependent protein kina... 152 1e-35 PDBF( 1A06 )...) Dictyostelium discoideum chromoso... 163 6e-39 AB076903_1( AB076903 |pid:none) Ciona intestinalis Ci-CaM-K...SL (Link to library) SLD285 (Link to dictyBase) - - - Contig-U11996-1 SLD285P (Link to Original

  20. Dicty_cDB: VSF267 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available cqsfh*klncqrsrstsycqtms**plalw**sinwfxc*splsfr*xmkkykt Translated Amino Acid sequ...AP EVLXGGSYDNAVDMWXIGVITYILLCGFPPFLCFISKLII*knfxr*l*fprtrmdscl* tcqsfh*klncqrsrstsycqtms**plalw**sinwfxc*spl...BC074183 |pid:none) Xenopus laevis MGC82022 protein, m... 118 1e-38 (Q8IU85) RecName: Full=Calcium/cal...modulin-dependent protein kina... 120 2e-38 (Q8BW96) RecName: Full=Calcium/calmodulin-d...G0... 132 2e-42 AB076903_1( AB076903 |pid:none) Ciona intestinalis Ci-CaM-K mRNA f... 118 4e-39 BC074183_1(

  1. Dicty_cDB: SSJ513 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available l*tcqsfh*klncqrsrsts ycqtms**plalw**sinwfcc*splsfr*kdeei**pkkrwsifk*lnliiii Homology vs CSM-cDNA Score E Seq...41721 |pid:none) Xenopus laevis calcium/calmodulin-... 153 3e-36 ( Q63450 ) RecName: Full=Calcium/calmodulin...-dependent protein kina... 152 4e-36 ( Q14012 ) RecName: Full=Calcium/calmodulin-dependent protein kina... 1...yostelium discoideum chromoso... 168 6e-41 AB076903_1( AB076903 |pid:none) Ciona intestinalis Ci-Ca...SS (Link to library) SSJ513 (Link to dictyBase) - - - Contig-U11996-1 SSJ513Z (Link to Original

  2. Dicty_cDB: SLF532 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nvilpnnvlm tfgslvvinqlvlllistlislkr*rnimtkeevvnlqiikfnnnnn Frame B: ---tilcfisklii*knfnr*l*fprtrmdscl*tcqsfh...evis MGC82022 protein, m... 74 1e-12 ( Q63450 ) RecName: Full=Calcium/calmodulin-dependent protein kina... 7...4 2e-12 ( Q14012 ) RecName: Full=Calcium/calmodulin-dependent protein kina... 74 ...B076903 |pid:none) Ciona intestinalis Ci-CaM-K mRNA f... 81 1e-14 BC074183_1( BC074183 |pid:none) Xenopus la...SL (Link to library) SLF532 (Link to dictyBase) - - - Contig-U11996-1 SLF532Z (Link to Original

  3. Dicty_cDB: SSH378 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available wfpti lcfisklii*knfnr*l*fprtrmdscl*tcqsfh*klncqrsrstsycqtms**plalw **sinwfcc*splsfr*kdeei**pkkrwsifk*lnliiii...M-K mRNA f... 142 5e-33 ( Q63450 ) RecName: Full=Calcium/calmodulin-dep...endent protein kina... 136 2e-31 ( Q14012 ) RecName: Full=Calcium/calmodulin-dependent protein kina... 136 2...982 |pid:none) Dictyostelium discoideum chromoso... 147 2e-34 AB076903_1( AB076903 |pid:none) Ciona intestinalis Ci-Ca...SS (Link to library) SSH378 (Link to dictyBase) - - - Contig-U11996-1 SSH378Z (Link to Original

  4. Dicty_cDB: SLF872 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available qinvilpnnvlmtfgslvvinqlvlllistli slkr*rnimtkeevvnlqiikfnnnnn Frame C: ---fprtrmdscl*tcqsfh*klncqrsrstsycqtms**plalw...m... 53 3e-06 AE014135_86( AE014135 |pid:none) Drosophila melanogaster chromosom... 53 3e-06 ( Q63450 ) RecName: Full=Calcium/cal...modulin-dependent protein kina... 51 1e-05 ( Q14012 ) RecName: Full=Calcium/calmodulin-...modulin-dependent ser... 166 3e-40 AB076903_1( AB076903 |pid:none) Ciona intestinalis Ci-CaM-K mRN...SL (Link to library) SLF872 (Link to dictyBase) - - - Contig-U11996-1 SLF872Z (Link to Original

  5. Dicty_cDB: SLH770 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ilcfisklii*knfnr*l*fprtrmdscl*tcqsfh*klncqrsrstsycqtm s**plalw**sinwfcc*splsfr*kd...74183 |pid:none) Xenopus laevis MGC82022 protein, m... 81 1e-14 ( Q63450 ) RecName: Full=Calcium/calmodulin-...dependent protein kina... 80 2e-14 ( Q14012 ) RecName: Full=Calcium/calmodulin-de...... 209 2e-53 AB076903_1( AB076903 |pid:none) Ciona intestinalis Ci-CaM-K mRNA f... 87 2e-16 BC074183_1( BC0...SL (Link to library) SLH770 (Link to dictyBase) - - - Contig-U11996-1 SLH770Z (Link to Original

  6. Dicty_cDB: SFJ553 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available assxplii*knfnr*l*fprtrmdscl*tcqsfhxklncqrsrxtsycqxms**psalw* *sinwfcc*spxsxx*kdxxi* Homology vs CSM-cDNA Sco...cium/calmodulin-... 144 2e-41 (Q8IU85) RecName: Full=Calcium/calmodulin-dependent pr...otein kina... 142 2e-41 (Q8BW96) RecName: Full=Calcium/calmodulin-dependent protein kina... 142 2e-41 protei...GC82022 protein, m... 141 3e-42 AB076903_1( AB076903 |pid:none) Ciona intestinalis Ci-Ca...SF (Link to library) SFJ553 (Link to dictyBase) - - - Contig-U11996-1 SFJ553Z (Link to Original

  7. Dicty_cDB: SLC252 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available i*knfnr*l* fprtrmdscl*tcqsfh*klncqrsrstsycqtms**plalw**sinwfcc*splsfr*k deei**pkkrwsifk*lnliiii Homology vs ...Mus musculus 13 days embryo lung c... 176 5e-43 (Q8IU85) RecName: Full=Calcium/calmodulin-dependent protein ...kina... 176 5e-43 (Q8BW96) RecName: Full=Calcium/calmodulin-dependent protein kin...none) Dictyostelium discoideum chromoso... 192 6e-48 AB076903_1( AB076903 |pid:none) Ciona intestinalis Ci-Ca...SL (Link to library) SLC252 (Link to dictyBase) - - - Contig-U11996-1 SLC252Z (Link to Original

  8. Dicty_cDB: Contig-U15674-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 9807 ) Ciona intestinalis cDNA, clone:rcibd066d24, 3' en... 113 2e-20 2 ( EE005021 ) ROE00010379 Rhizopus oryzae Company...-20 4 ( EE006561 ) ROE00006529 Rhizopus oryzae Company Rhizopus oryz... 86 2e-20 3 ( EE007078 ) ROE00002595 Rhizopus oryzae Company... Rhizopus oryz... 86 2e-20 3 ( EE007685 ) ROE00004444 Rhizopus oryzae Company Rhizopu... ) ROE00003177 Rhizopus oryzae Company Rhizopus oryz... 86 3e-20 3 ( EE009077 ) R...OE00000022 Rhizopus oryzae Company Rhizopus oryz... 86 3e-20 3 ( CB891330 ) EST648299 KV3 Medicago truncatul

  9. Dermatan sulfate in tunicate phylogeny: Order-specific sulfation pattern and the effect of [→4IdoA(2-Sulfate)β-1→3GalNAc(4-Sulfate)β-1→] motifs in dermatan sulfate on heparin cofactor II activity


    Sugahara Kazuyuki; Bao Xingfeng; Vicente Cristina P; Lotufo Tito; Lima Paula C; Kozlowski Eliene O; Pavão Mauro SG


    Abstract Background Previously, we have reported the presence of highly sulfated dermatans in solitary ascidians from the orders Phlebobranchia (Phallusia nigra) and Stolidobranchia (Halocynthia pyriformis and Styela plicata). Despite the identical disaccharide backbone, consisting of [→4IdoA(2S)β-1→3GalNAcβ-1→], those polymers differ in the position of sulfation on the N-Acetyl galactosamine, which can occur at carbon 4 or 6. We have shown that position rather than degree of sulfation is imp...

  10. Ecology: a niche for cyanobacteria containing chlorophyll d

    DEFF Research Database (Denmark)

    Kühl, Michael; Chen, Min; Ralph, Peter J;


    The cyanobacterium known as Acaryochloris marina is a unique phototroph that uses chlorophyll d as its principal light-harvesting pigment instead of chlorophyll a, the form commonly found in plants, algae and other cyanobacteria; this means that it depends on far-red light for photosynthesis. Here...... we demonstrate photosynthetic activity in Acaryochloris-like phototrophs that live underneath minute coral-reef invertebrates (didemnid ascidians) in a shaded niche enriched in near-infrared light. This discovery clarifies how these cyanobacteria are able to thrive as free-living organisms...

  11. Recruitment Variability of Coral Reef Sessile Communities of the Far North Great Barrier Reef (United States)

    Luter, Heidi M.; Duckworth, Alan R.; Wolff, Carsten W.; Evans-Illidge, Elizabeth; Whalan, Steve


    One of the key components in assessing marine sessile organism demography is determining recruitment patterns to benthic habitats. An analysis of serially deployed recruitment tiles across depth (6 and 12 m), seasons (summer and winter) and space (meters to kilometres) was used to quantify recruitment assemblage structure (abundance and percent cover) of corals, sponges, ascidians, algae and other sessile organisms from the northern sector of the Great Barrier Reef (GBR). Polychaetes were most abundant on recruitment titles, reaching almost 50% of total recruitment, yet covered Coral recruitment was very low, with coral reefs. PMID:27049650

  12. Evolution of developmental roles of Pax2/5/8 paralogs after independent duplication in urochordate and vertebrate lineages

    Directory of Open Access Journals (Sweden)

    Cañestro Cristian


    Full Text Available Abstract Background Gene duplication provides opportunities for lineage diversification and evolution of developmental novelties. Duplicated genes generally either disappear by accumulation of mutations (nonfunctionalization, or are preserved either by the origin of positively selected functions in one or both duplicates (neofunctionalization, or by the partitioning of original gene subfunctions between the duplicates (subfunctionalization. The Pax2/5/8 family of important developmental regulators has undergone parallel expansion among chordate groups. After the divergence of urochordate and vertebrate lineages, two rounds of independent gene duplications resulted in the Pax2, Pax5, and Pax8 genes of most vertebrates (the sister group of the urochordates, and an additional duplication provided the pax2a and pax2b duplicates in teleost fish. Separate from the vertebrate genome expansions, a duplication also created two Pax2/5/8 genes in the common ancestor of ascidian and larvacean urochordates. Results To better understand mechanisms underlying the evolution of duplicated genes, we investigated, in the larvacean urochordate Oikopleura dioica, the embryonic gene expression patterns of Pax2/5/8 paralogs. We compared the larvacean and ascidian expression patterns to infer modular subfunctions present in the single pre-duplication Pax2/5/8 gene of stem urochordates, and we compared vertebrate and urochordate expression to infer the suite of Pax2/5/8 gene subfunctions in the common ancestor of olfactores (vertebrates + urochordates. Expression pattern differences of larvacean and ascidian Pax2/5/8 orthologs in the endostyle, pharynx and hindgut suggest that some ancestral gene functions have been partitioned differently to the duplicates in the two urochordate lineages. Novel expression in the larvacean heart may have resulted from the neofunctionalization of a Pax2/5/8 gene in the urochordates. Expression of larvacean Pax2/5/8 in the endostyle, in

  13. DDBJ in the stream of various biological data


    Miyazaki, S; Sugawara, H.; Ikeo, K.; Gojobori, T; Tateno, Y.


    In the past year we at DDBJ ( have made a steady increase in the number of data submissions with a 50.6% increment in the number of bases or 46.5% increment in the number of entries. Among them the genome data of man, ascidian and rice hold the top three. Our activity has extended to providing a tool that enables sequence retrieval using regular expressions, and to launching our SOAP server and web services to facilitate the acquisition of proper data and tools from ...

  14. Chemotactic behavior of the sperm of chitons (Mollusca: Polyplacophora). (United States)

    Miller, R L


    Observations of sperm behavior in the vicinity of gradients of egg-water or alcohol extracts of whole freshly-spawned eggs of several chitons reveal what appear to be directed movements of sperm up the gradient, resulting in the aggregation of motile sperm at the gradient source. Plots of the tracks of the sperm approaching the gradient source show that the cells increase the time during which they move toward the source and decrease the time spent moving away. Although this resembles the kinesis behavior shown by bacteria in a gradient, the path directions are markedly non-random. The reorientation behavior of thigmotactic sperm involves enlargement of the normal circular path diameter in the direction of the source and an alternation of tight loops and wide circular arcs, with the latter made in the direction of the source. The form of the path of attracted chiton sperm is like that observed during chemotaxis of the sperm of the hydroid Tubularia and the tunicate Ciona and resembles the behavior of Ciona sperm in that there is no increase in velocity as the cells move up the gradient. However, unlike the cnidarian and urochordate cases, the attracting substances extracted from chiton eggs do not act species-specifically. PMID:925668

  15. The truth about mouse, human, worms and yeast

    Directory of Open Access Journals (Sweden)

    Nelson David R


    Full Text Available Abstract Genome comparisons are behind the powerful new annotation methods being developed to find all human genes, as well as genes from other genomes. Genomes are now frequently being studied in pairs to provide cross-comparison datasets. This 'Noah's Ark' approach often reveals unsuspected genes and may support the deletion of false-positive predictions. Joining mouse and human as the cross-comparison dataset for the first two mammals are: two Drosophila species, D. melanogaster and D. pseudoobscura; two sea squirts, Ciona intestinalis and Ciona savignyi; four yeast (Saccharomyces species; two nematodes, Caenorhabditis elegans and Caenorhabditis briggsae; and two pufferfish (Takefugu rubripes and Tetraodon nigroviridis. Even genomes like yeast and C. elegans, which have been known for more than five years, are now being significantly improved. Methods developed for yeast or nematodes will now be applied to mouse and human, and soon to additional mammals such as rat and dog, to identify all the mammalian protein-coding genes. Current large disparities between human Unigene predictions (127,835 genes and gene-scanning methods (45,000 genes still need to be resolved. This will be the challenge during the next few years.

  16. mlRho – a program for estimating the population mutation and recombination rates from shotgun-sequenced diploid genomes (United States)



    Improvements in sequencing technology over the past 5 years are leading to routine application of shotgun sequencing in the fields of ecology and evolution. However, the theory to estimate evolutionary parameters from these data is still being worked out. Here we present an extension and implementation of part of this theory, mlRho. This program can efficiently compute the following three maximum likelihood estimators based on shotgun sequence data obtained from single diploid individuals: the population mutation rate (4Neμ), the sequencing error rate, and the population recombination rate (4Nec). We demonstrate the accuracy of mlRho by applying it to simulated data sets. In addition, we analyse the genomes of the sea squirt Ciona intestinalis and the water flea Daphnia pulex. Ciona intestinalis is an obligate outcrosser, while D. pulex is a cyclic parthenogen, and we discuss how these contrasting life histories are reflected in our parameter estimates. The program mlRho is freely available from PMID:20331786

  17. Lack of host-dependent genetic structure in ectoparasites of Calonectris shearwaters. (United States)

    Gómez-Díaz, E; González-Solís, J; Peinado, M A; Page, R D M


    We compared patterns of mitochondrial DNA (mtDNA) differentiation in three host-specific lice (Halipeurus abnormis, Austromenopon echinatum and Saemundssonia peusi) and one generalist flea (Xenopsylla gratiosa), parasitizing 22 colonies of Cory's and Cape Verde shearwater (Calonectris). The shearwater hosts show distinct phylogeographic structure corresponding to the three taxa Calonectris d. diomedea, C. d. borealis, and C. edwardsii. The host-specific lice appeared undifferentiated among the three Calonectris taxa, whereas the more generalist flea displayed significant levels of population differentiation. Neither genetic distances among host populations, nor their spatial distribution explained the patterns of genetic variability observed in the ectoparasites. The lack of differentiation among lice is unexpected, given that previous work has found evidence of cospeciation between procellariiform seabirds and their lice, and lice typically have an elevated rate of mtDNA evolution with respect to their hosts. Our results suggest that either rates of evolution in seabird lice are not always as high as previously thought, or that the magnitude of movement of lice between seabird hosts has been substantially underestimated. PMID:18028307

  18. Spatial variation in the environmental control of crab larval settlement in a micro-tidal austral estuary (United States)

    Pardo, Luis Miguel; Cardyn, Carlos Simón; Garcés-Vargas, José


    Settlement of benthic marine invertebrates is determined by the interaction between physical factors and biological processes, in which the tide, wind, and predation can play key roles, especially for species that recruit within estuaries. This complexity promotes high variability in recruitment and limited predictability of the size of annual cohorts. This study describes the settlement patterns of megalopae of the commercially important crab Cancer edwardsii at three locations (one in the center and two at the mouth of the estuary) within the Valdivia River estuary (~39.9°S), over three consecutive years (2006-2008). At each location, 12 passive benthic collectors with a natural substratum were deployed for 48 h at 7-day intervals, over a lunar cycle. Half of the collectors were covered with mesh to exclude predators. The main findings were as follows: (1) circulation changes due to upwelling relaxation or onshore winds controlled crab settlement at sites within the mouth of the estuary, (2) at the internal estuarine site, settlement was dominated by tidal effects, and (3) the effect of predation on settlement was negligible at all scales. The results show that the predominant physical factor controlling the return of competent crab larvae to estuarine environments varies spatially within the estuary. The lack of tidal influence on settlement at the mouth of the estuary can be explained by the overwhelming influence of the intense upwelling fronts and the micro-tidal regime in the study area.

  19. Crustacean fishery with bottom traps in an area of the southern Tyrrhenian Sea: species composition, abundance and biomass

    Directory of Open Access Journals (Sweden)



    Full Text Available The north-eastern coast of Sicily is characterized by deep, steep bottoms, not easily exploitable by trawl fishery. In this area few fishermen use bottom traps to catch shrimps and Norway lobsters. Our studies were aimed at identifying the species’ composition, abundance and biomass of crustaceans exploitable by bottom traps in this area. Monthly samples over one year were obtained from two lines of 30 baited traps each, at depths between 100 and 500 m. One line was placed in an area usually exploited by this fishery; the other line was used in the unexploited deepest bottoms. Trapped specimens were counted and weighed. ANOVA test, post hoc multiple comparisons and Student’s t test were applied on abundance and biomass data, for testing differences between areas, among seasons and species. During 22 fishing days, 23 species characteristic of the bathyal mud assemblage were caught, 8 of which were not considered commercial. Plesionika edwardsii was the most important species, recorded in the whole bathymetric range investigated; Nephrops norvegicus was significantly higher in terms of biomass in the unexploited area. The discard, of slight importance, was mostly represented by the crab Liocarcinus depurator. Spring season yielded the best catches in both areas, showing the highest values for both abundance and biomass

  20. Phylogeography of the Calonectris shearwaters using molecular and morphometric data. (United States)

    Gómez-Díaz, E; González-Solís, J; Peinado, M A; Page, R D M


    We investigated phylogenetic relationships and the biogeographic history of the Calonectris species complex, using both molecular and biometric data from one population of the Cape Verde shearwater Calonectris edwardsii (Cape Verde Islands), one from the streaked shearwater C. leucomelas (western Pacific Ocean) and 26 from Cory's shearwater populations distributed across the Atlantic (C. d. borealis) and the Mediterranean (C. d. diomedea). The streaked shearwater appeared as the most basal and distant clades, whereas the genetic divergences among the three main clades within the Palearctic were similar. Clock calibrations match the first speciation event within Calonectris to the Panama Isthmus formation, suggesting a vicariant scenario for the divergence of the Pacific and the Palearctic clades. The separation between the Atlantic and Mediterranean clades would have occurred in allopatry by range contraction followed by local adaptation during the major biogeographic events of the Pleistocene. The endemic form from Cape Verde probably evolved as a result of ecological divergence from the Mediterranean subspecies. Finally, one Mediterranean population (Almeria) was unexpectedly grouped into the Atlantic subspecies clade, both by genetic and by morphometric analyses, pointing out the Almeria-Oran oceanographic front (AOOF) as the actual divide between the two Cory's shearwater subspecies. Our results highlight the importance of oceanographic boundaries as potentially effective barriers shaping population and species phylogeographical structure in pelagic seabirds. PMID:16814569

  1. Asentamiento diario de megalopas de jaibas del género Cancer en un estuario micromareal Daily settlement of Cancer crab megalopae in a microtidal estuary

    Directory of Open Access Journals (Sweden)

    Luis Miguel Pardo


    Full Text Available El asentamiento de crustáceos decápodos en ambientes estuarinos, es la última etapa de un complejo proceso en que las especies meroplanctónicas cierran la fase de vida pelágica. Este proceso tiene etapas sucesivas, que comienza con la formación de parches larvales frente a la costa, su transporte hacia las zonas de crianza, exploración de sustrato en busca de un lugar adecuado para el asentamiento y la metamorfosis a juvenil. Las interacciones entre los factores físicos y el comportamiento de las larvas competentes regulan las diversas etapas de este proceso, determinando finalmente las tasas de asentamiento locales. En este estudio se analiza la importancia relativa de las forzantes físicas que actúan a meso-escala (i.e. estrés del viento, nivel del mar y caudal del río y micro-escala (condiciones locales de temperatura, salinidad y tipo de sustrato sobre el asentamiento de megalopas de los braquiuros Cancer edwardsii y C. coronatus, principales jaibas comerciales en la pesca artesanal chilena. Para esto se instalaron colectores larvales pasivos de fondo por 73 días consecutivos en el periodo de máximo reclutamiento (i.e. abundancia de juvenil I, en la desembocadura del estuario del río Valdivia y se dispuso de arena gruesa y un símil de tapiz algal como sustrato. Los resultados mostraron que: a el asentamiento está caracterizado por extensos periodos de escasos asentados alternados por pulsos de máximos, que no necesariamente coinciden entre las especies estudiadas, b el asentamiento de C. edwardsii mostró estar relacionado con múltiples forzantes que generan la advección de aguas cálidas hacia la costa, c el asentamiento de C. coronatus tuvo relación con las forzantes que generan la surgencia costera, d las larvas de ambas especies no difieren en el asentamiento sobre sustratos heterogéneos. Este estudio mostró que los patrones de asentamiento larval son especie específicos, incluso en especies simpátricas y

  2. Small carnivores of Biligiri Rangaswamy Temple Tiger Reserve, Karnataka, India

    Directory of Open Access Journals (Sweden)

    Honnavalli N. Kumara


    Full Text Available During the present study in Biligiri Rangaswamy Temple Tiger Reserve (BRT, nine species of small carnivores viz., Jungle Cat Felis chaus, Rusty-spotted Cat Prionalilurus rubiginosus, Leopard Cat Prionailurus bengalensis, Small Indian Civet Viverricula indica, Asian Palm Civet Paradoxurus hermaphroditus, Striped-necked Mongoose Herpestes vitticollis, Ruddy Mongoose Herpestes smithii, Common Mongoose Herpestes edwardsii and Smooth-coated Otter Lutrogale perspicillata, were recorded using camera-trapping technique, transect walks, and night surveys. Vegetation type strongly influences the presence and abundance of each species. The most sightings of small carnivores occurred in dry deciduous forests. Among all the species, the Asian Palm Civet was the most abundant and was followed by the small Indian Civet. Compared to many other forests or regions in India, the sight records of the Rusty-spotted Cat were relatively higher in BRT. Although we were unable to use statistical methods to search for higher levels of interdependencies between forest types and small carnivore abundance, our study sheds light on patterns of small carnivore distribution in this unique habitat which bridges the Western Ghats and the Eastern Ghats.

  3. Cyanobacterial diversity and a new acaryochloris-like symbiont from Bahamian sea-squirts.

    Directory of Open Access Journals (Sweden)

    Susanna López-Legentil

    Full Text Available Symbiotic interactions between ascidians (sea-squirts and microbes are poorly understood. Here we characterized the cyanobacteria in the tissues of 8 distinct didemnid taxa from shallow-water marine habitats in the Bahamas Islands by sequencing a fragment of the cyanobacterial 16S rRNA gene and the entire 16S-23S rRNA internal transcribed spacer region (ITS and by examining symbiont morphology with transmission electron (TEM and confocal microscopy (CM. As described previously for other species, Trididemnum spp. mostly contained symbionts associated with the Prochloron-Synechocystis group. However, sequence analysis of the symbionts in Lissoclinum revealed two unique clades. The first contained a novel cyanobacterial clade, while the second clade was closely associated with Acaryochloris marina. CM revealed the presence of chlorophyll d (chl d and phycobiliproteins (PBPs within these symbiont cells, as is characteristic of Acaryochloris species. The presence of symbionts was also observed by TEM inside the tunic of both the adult and larvae of L. fragile, indicating vertical transmission to progeny. Based on molecular phylogenetic and microscopic analyses, Candidatus Acaryochloris bahamiensis nov. sp. is proposed for this symbiotic cyanobacterium. Our results support the hypothesis that photosymbiont communities in ascidians are structured by host phylogeny, but in some cases, also by sampling location.

  4. Structure and anticoagulant properties of sulfated glycosaminoglycans from primitive Chordates

    Directory of Open Access Journals (Sweden)



    Full Text Available Dermatan sulfates and heparin, similar to the mammalian glycosaminoglycans, but with differences in the degree and position of sulfation were previously isolated from the body of the ascidian Styela plicata and Ascidia nigra. These differences produce profound effects on their anticoagulant properties. S. plicata dermatan sulfate composed by 2-O-sulfatedalpha-L-iduronic acid and 4-O-sulfated N-acetyl-beta-D-galactosamine residues is a potent anticoagulant due to a high heparin cofactor II activity. Surprisingly, it has a lower potency to prevent thrombus formation on an experimental model and a lower bleeding effect in rats than the mammalian dermatan sulfate. In contrast, A. nigra dermatan sulfate, also enriched in 2-O-sulfated alpha-L-iduronic acid, but in this case sulfated at O-6 of the N-acetyl-beta-D-galactosamine units, has no in vitro or in vivo anticoagulant activity, does not prevent thrombus formation but shows a bleeding effect similar to the mammalian glycosaminoglycan. Ascidian heparin, composed by 2-O-sulfated alpha-L-iduronic acid, N- and 6-O-sulfated glucosamine (75% and alpha-L-iduronic acid, N- and 6-O-sulfated glucosamine (25% disaccharide units has an anticoagulant activity 10 times lower than the mammalian heparin, is about 20 times less potent in the inhibition of thrombin by antithrombin, but has the same heparin cofactor II activity as mammalian heparin.

  5. Colony specificity in Botrylloides leachi. I. Morphological aspects

    Directory of Open Access Journals (Sweden)

    G Zaniolo


    Full Text Available We studied colony specificity in the colonial ascidian Botrylloides leachi which, as in other botryllid ascidians, leads to either fusion or non-fusion between contacting colonies. Fusion requires the prior disappearance of contacting tunic cuticles and contact between facing ampullar epithelia. The epithelial cells of the ampullar tip show “pad regions” rich in ribosomes, which contribute to the synthesis of new tunic and cuticle. Blood cells, mainly phagocytes and pigment cells, increase their concentrations inside the ampullar lumen and phagocytes can cross the ampullar epithelium and enter the tunic, where they can contribute to the digestion of tunic cuticles and cells of the ampullar epithelium in order to establish a common circulation. Non-fusion reaction, as studied in the colony allorecognition assay, resembles the subcuticular rejection described in Japanese Botrylloides, characterised by limited tunic fusion, hemocyte leakage, and necrotic spots. Conversely, in the cut surface assay, a more intense cytotoxic reaction is observed along the contact border. In this case, morula cells crowd massively inside the facing ampullae, enter the tunic, and release their vacuolar contents which are probably required for the formation of necrotic spots.

  6. Dicty_cDB: Contig-U15013-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available es promelas Whole (... 46 3.6 1 ( CK324443 ) ACA_CNS_N-9-D12.G Aplysia californica cDNA ampl...if... 46 3.6 1 ( FF075622 ) G1045P325RJ4.T0 Aplysia californica Pooled Normal... 46 3.6 1 ( AY394...817_257( CP000817 |pid:none) Lysinibacillus sphaericus C3-41,... 44 0.014 CP000712_1756( CP000712 |pid:none) Pseudomona...ibacter turnerae T7901, ... 38 0.77 CP000817_3160( CP000817 |pid:none) Lysinibacillus s...4 2.4 2 ( AC020698 ) Homo sapiens BAC clone RP11-45F23 from 4, complet... 36 2.9 5 ( BW158625 ) Ciona in

  7. Dicty_cDB: FC-AC19 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available (... 297 1e-79 AY961548_1( AY961548 |pid:none) Lysiphlebus testaceipes ribosomal ... 297 2e-79 AY120723_1( A...FC-AC19Z (Link to Original site) Representative DNA sequence >FC-AC19 (FC-AC19Q) /CSM/FC/FC-AC/FC-AC19Q.Seq....AU013664 |AU013664.1 Schizosaccharomyces pombe cDNA, clone spc08473. 105 3e-27 3 BW049012 |BW049012.1 Ciona intes...n Score E Sequences producing significant alignments: (bits) Value ( P27685 ) RecName: Full=40S ribosomal protei...nk to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15674-1 Original site URL http:/

  8. Dicty_cDB: Contig-U11489-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 9e-18 AJ508667_1( AJ508667 |pid:none) Ciona intestinalis mRNA for Rac1 p... 94 9e-18 ( O14426 ) RecName: Full=Cell division cont...ozoa sp. H2 cell division cont... 74 1e-11 AY168614_1( AY168614 |pid:none) Brassica napus putative ROP fami...i... 88 5e-16 ( Q01112 ) RecName: Full=Cell division control protein 42 homolog;... 88 5e-16 CR382128_622( CR382128 |pid:non...e: Full=Cell division control protein 42; AltName... 86 3e-...e: Full=Transforming protein RhoA; AltName: Full=... 78 5e-13 AY059622_1( AY059622 |pid:none) Entam

  9. Dicty_cDB: Contig-U10050-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 44 0.011 BC115342_1( BC115342 |pid:none) Danio rerio suppression of tumorig... 44 0.011 BC128654_1( BC12865...4 |pid:none) Danio rerio suppression of tumorig... 44 0.011 AY173045_1( AY173045 |pid:none) Morone Giardia intestinalis isolate WB cl... 42 0.042 (Q9Y5Y6) RecName: Full=Suppressor of tumorigenicity prote...: Full=Disintegrin and metalloproteinase domain-... 40 0.16 (Q0IIH7) RecName: Full=Suppressor of rerio suppression of tumorig... 38 0.79 AB041857_1( AB041857 |pid:none) Ciona intestinalis mRNA for Ci-ME

  10. Dicty_cDB: Contig-U10482-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4_327( CP000594 |pid:none) Ostreococcus lucimarinus CCE9901... 76 5e-13 CT005263_33( CT005263 |pid:none) Leishmania ma...FN357490_14( FN357490 |pid:none) Schistosoma mansoni genome sequen... 44 0.003 CP000584_115( CP000584 |pid:none) Ostreococcus lucima... troglodytes DNA, clone: RP43-047H13.T7. 44 5.4 1 ( BW361512 ) Ciona intestinalis cDNA, clone:cima8... y*kkixlkwkii*i*liixiiiiiixik*knhyqhylyfvaimv*mklvimvvhqiqkll lywf**vly Frame C: xxxc**fq*sttkgg*hsisnetik*invi...sferase 2;... 157 1e-37 AC006592_5( AC006592 |pid:none) Arabidopsis thaliana chromosome 2 ..

  11. Dicty_cDB: Contig-U14928-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s) Database: CSM 8402 sequences; 8,075,542 total letters Score E Sequences producing significant alignments: (bits) Value Cont.............done Score E Sequences producing significant alignments: (bits) Value N ( AC116979 ) Dictyostelium...CHEL7308.b1_G03.ab1 CHE(LMS) serpentine sunflower... 54 0.030 1 ( BW196083 ) Ciona intestinalis cDNA, clone:cicl038e23, 5' en...ig-U14928-1Q) /CSM_Contig/Contig-U14928-1Q.Seq.d (2817 letters) Database: nrp_B 3,236,559 sequences; 1,051,180,864 total letter...01_4992( CP000001 |pid:none) Bacillus cereus E33L, complete ... 80 5e-13 AY973240_1( AY973240 |pid:none) Equus caball

  12. Dicty_cDB: Contig-U11914-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available (cDN... 83 3e-14 AX399977_1( AX399977 |pid:none) Sequence 148 from Patent WO0218424. 83 3e-14 T46488( T46488 )hypothetical prote...........................................done Score E Sequences producing significant alignments: (bits) Valu....94 1 ( CQ578219 ) Sequence 5977 from Patent WO0171042. 48 0.94 1 ( AE014134 ) Drosophila melanogaster chromosome 2L, complete...s mRNA for latent trans... 106 2e-21 DQ900937_1( DQ900937 |pid:none) Ciona intestinalis gamma-ca...1914-1Q.Seq.d (1451 letters) Database: CSM 6905 sequences; 5,674,871 total letters Score E Sequence

  13. Dicty_cDB: Contig-U02608-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s) Database: CSM 6905 sequences; 5,674,871 total letters Score E Sequences producing significant alignments: (bits) Value Cont.................done Score E Sequences producing significant alignments: (bits) Value N ( BJ340160 ) Dictyoste...... 70 2e-10 3 ( BX732541 ) Xenopus tropicalis EST, clone TTpA073e13 5'. 56 2e-10...d. 46 4e-04 2 ( BW366463 ) Ciona intestinalis cDNA, clone:cima838j20, 5'end,... 56 4e-04 2 ( BC166312 ) Xenopus tropical...7303_1( AY627303 |pid:none) Haloferax volcanii DS2 proteasome-... 148 6e-34 BC122550_1( BC122550 |pid:none) Homo sapiens val

  14. Dicty_cDB: Contig-U05543-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1 ( FF475952 ) G613P6146RA1.T0 Acorn worm blastula/gastrula pCMV... 44 4.5 1 ( DQ366714 ) Uncultured Prochlorococcu...G22, WORKING DRAFT SEQU... 48 0.29 1 ( CV869127 ) PDUts1063D08 Porcine testis cDNA library I Sus sc... 48 0..... 32 0.36 3 ( AV873260 ) Ciona intestinalis cDNA, clone:rcicl43a22, 3' end... 32 0.50 3 ( EF173130 ) Entosthodon serratu...s voucher Bowers 13109 CONN RN... 32 0.55 3 ( EF173135 ) Physcomitrella patens voucher Culture f...133954 ) XABT170247.g1 Gateway compatible cien cDNA librar... 40 5.3 2 ( AC120599 ) Rattus norvegicu

  15. Dicty_cDB: Contig-U15999-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available DQ120986 ) Hucho taimen clone ZB-41 microsatellite sequence. 42 0.38 2 ( FE260308 ) CAZN834.fwd CAZN Naegleria gruberi Flagellat... 0.711 1.31 Gapped Lambda K H 1.37 0.711 1.31 Matrix: blastn matrix:1 -3 Gap Penalties: Existence: 5, Extension: 2 cds. 40 0.025 2 ( EG551347 ) MM01C22_XP Sugar Beet germination cDNA library Be... 40 0.025 2 ( DH506983 ) Monosiga ovat...e MegEu13 microsatellite ... 40 1.9 2 ( BP024203 ) Ciona intestinalis cDNA, clon...ent US 7314974. 34 4.6 2 ( FE268718 ) CAZO773.fwd CAZO Naegleria gruberi Flagellate Sta... 40 4.6 2 ( DY

  16. Dicty_cDB: Contig-U09041-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ) Dictyostelium discoideum retrotran... 546 e-154 Z36534_1( Z36534 |pid:none) D.discoideum (Ax3-K) ponA gene...V78X000824.... 37 1.8 AJ970254_1( AJ970254 |pid:none) Anopheles stephensi retroposon 1 A... 37 1.8 ( Q35905 ... AJ970256_1( AJ970256 |pid:none) Anopheles stephensi retroposon 1 A... 37 1.8 AM4...m discoideum TipC (tipC) gene, comple... 325 3e-84 1 ( U63600 ) Dictyostelium discoideum Tdd-4 transposable elemen...ium discoideum retrotran... 95 6e-18 AB097146_1( AB097146 |pid:none) Ciona intestinalis retrotr

  17. Dicty_cDB: Contig-U14953-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 7 BA000031_483( BA000031 |pid:none) Vibrio parahaemolyticus RIMD 221... 61 1e-07 AP007255_522( AP007255 |pid:none) Mag...53 |pid:none) Alkaliphilus oremlandii OhILAs, c... 59 6e-07 CP000488_783( CP000488 |pid:none) Candidatus Ruthia mag... 0.711 1.31 Matrix: blastn matrix:1 -3 Gap Penalties: Existence: 5, Extension: 2 Number of Hits to DB: 40,21...019h19, 5'end,... 52 0.065 1 ( BW347955 ) Ciona intestinalis cDNA, clone:ciem838a16, 5'end,... 52 0.06... Dictyostelium discoideum chromosome 2 map 2567470... 32 0.13 15 ( CP000488 ) Candidatus Ruthia magnifica st

  18. Dicty_cDB: Contig-U16314-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rk rkenypflaseilcmdiqplieavyrddlylqqlyeflnkpnfnlglaaytskvainflg rktidtmayikkqdnivekfikhldkspvvdillkiisieeyqggag... ( DR118372 ) RTMG1_12_H03.g1_A029 Roots minus magnesium Pinus ... 48 0.004 3 ( DX570665 ) MUGQ_CH252P048N23...rom chromoso... 44 0.004 2 ( DR118290 ) RTMG1_12_H03.b1_A029 Roots minus magnesiu...) G1146P36FN17.T0 Anolis carolinensis pooled normal... 46 1e-04 3 ( BX641037 ) Homo sapiens mRNA; cDNA DKFZp...e-04 2 ( BW391073 ) Ciona intestinalis cDNA, clone:ciem804i14, 3'end,... 34 7e-04 4 ( CX472410 ) JGI_XZG5544

  19. Dicty_cDB: Contig-U15833-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s cDNA, clone:cits039i02, full i... 64 2e-05 1 ( DY673534 ) STRCT29JX cold-stressed Fragaria vesca seedling...3333( CP000970 |pid:none) Escherichia coli SMS-3-5, compl... 43 0.026 CP000961_3531( CP000961 |pid:none) Shewanella woo...P000020_471( CP000020 |pid:none) Vibrio fischeri ES114 chromosome... 42 0.057 (Q9X719) RecName: Full=Hollida.... 60 1e-05 2 ( CP000496 ) Pichia stipitis CBS 6054 chromosome 2, complete s... 64 2e-05 1 ( AK116608 ) Ciona intestinali...13 |pid:none) Neurospora crassa intermembrane sp... 43 0.026 (Q1PDW5) RecName: Full=Cell division protease ftsH homolog 6, ch

  20. Dicty_cDB: Contig-U14789-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 72732 ) Ciona savignyi cDNA, clone:csef010p06, 5'end, sin... 42 1e-05 3 ( DN299396 ) PL04015B2F05 cDNA from sexually...S-HH0 Euprymna scolo... 54 0.004 1 ( DN308204 ) PL05016A1B10 cDNA from sexually m...ature hermaphodi... 54 0.004 1 ( DN301348 ) PL04022A2C06 cDNA from sexually mature hermaphodi... 54 0.004 1 ...( DN300514 ) PL04019B1D03 cDNA from sexually mature hermaphodi... 54 0.004 1 ( BQ095991 ) kk04c08.y1 Ascaris

  1. Dicty_cDB: Contig-U16029-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 301514 ) PL04022B2D04 cDNA from sexually mature hermaphodi... 60 2e-21 4 ( DN298105 ) PL04011B1H03 cDNA from sexually... mature hermaphodi... 60 2e-21 4 ( DN298246 ) PL04012A1G09 cDNA from sexually mature hermaphodi... ...60 2e-21 4 ( DN301632 ) PL04023A1G12 cDNA from sexually mature hermaphodi... 60, 5' end... 60 7e-20 4 ( DN294541 ) PL030017A20E10 cDNA from sexually...60 1e-19 4 ( BW213634 ) Ciona intestinalis cDNA, clone:cieg074c18, 5' end... 60 1e-19 4 ( DN307194 ) PL05013A2D05 cDNA from sexually

  2. Dicty_cDB: Contig-U08919-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e) Tetrahymena tropicalis copper-indu... 42 0.044 (Q6L8H2) RecName: Full=Keratin-associated protein...... 44 0.009 DQ482581_1( DQ482581 |pid:none) Galleria mellonella lipophorin rec... 44 0.009 AK066765_1( AK066765 |pid:none) Oryza... musculus FEX2 mRNA, complete c... 44 0.011 AF033584_1( AF033584 |pid:none) Giardia intestinalis varia...4 0.011 AB210518_1( AB210518 |pid:none) Ciona intestinalis mRNA for jagged... 44 0.015 EU152252_1( EU152252 |pid:none) Hydra vulgari... d... 43 0.026 AY142135_1( AY142135 |pid:none) Giardia intestinalis isolate WB cl... 43 0.026 ( P60331 ) RecName: Full=Keratin

  3. La influencia de la convivencia escolar en el nivel de inclusión educativa, en estudiantes de bachiller

    Directory of Open Access Journals (Sweden)

    MSc. Rolando Medina Peña


    Full Text Available La inclusión educativa muchas veces no es bien entendida y se interpreta de diversas formas en el mundo. Desde el campo educativo se connota, a la manera en que la ins­titución educacional da respuesta a la diversidad y, tiene relación directa con el término necesidades educativas es­peciales (NEE. La investigación examina la influencia del código de convivencia escolar en el nivel de inclusión edu­cativa, a partir de la asunción de las necesidades educati­vas especiales de algunos de sus estudiantes. Se perfec­ciona la comprensión de las NEE, de inclusión educativa y los recursos educativos que se ajustan a las peculiaridades del desarrollo humano.

  4. Dicty_cDB: FC-BF21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available yfngiryftnryirygyaiirrcqin*n*sic* sr*rfilccpkiiwyvnlcrsrcslylewfiw*sssfriw*llfncftiilcryycyafg *tftkriwywiryfiiycnqyl*dhcmedi... 4.0 %: nuclear 4.0 %: extracellular, including cell wall >> prediction for FC-BF21 is end 5' end seq. ID FC...FC (Link to library) FC-BF21 (Link to dictyBase) - - - Contig-U16377-1 FC-BF21P (Link to Origina...k to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16377-1 Original site URL http://di...nts: (bits) Value N AL668163 |AL668163.1 Ciona intestinalis; larval mRNA; EST 5PRIM end of clone 030ZH11 of library directiona

  5. Dicty_cDB: Contig-U13406-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 5O16, p... 236 8e-61 AY542969_1( AY542969 |pid:none) Bigelowiella natans guanine nucleo... 236 1e-60 BC08554...Score = 2010 bits (1014), Expect = 0.0 Identities = 1014/1014 (100%) Strand = Plus / Plus Query: 1 aaaaagaaacataatgaagttaaattattatta...ons: 2029 Number of sequences better than 10.0: 277 length of query: 1064 length of data...6 3e-09 2 ( BW255618 ) Ciona intestinalis cDNA, clone:citb081g04, 5' end... 48 3e-09 3 ( FF935005 ) CBWU71199.b1 Yutaka Sat...ou unpublished cDNA librar... 48 4e-09 3 ( FF915066 ) CBWU58117.b1 Yutaka Sat

  6. Dicty_cDB: Contig-U04737-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available entities = 187/187 (100%) Strand = Plus / Plus Query: 385 tcattatgtattaataaattacctattttaacatcagaatttttta...Y-7H8, genomic surve... 48 0.37 1 ( AG625810 ) Macaca fuscata fuscata DNA, clone: MSB2-022E04_F,... 48 0.37 1 ( BX211439 ) Dan... 46 1.5 1 ( BP027525 ) Ciona intestinalis cDNA, clone:cits48i20, 5' end,... 46 1.5 1 ( FD450202 ) EGGA388TR Haematobia irritan...s eggs Haematobia irr... 46 1.5 1 ( FD450201 ) EGGA388TF Haematobia irritans eggs Haematob... BJ419392 ) Dictyostelium discoideum cDNA clone:ddv35p23, 5' ... 36 7.9 2 ( FF860568 ) CBWU8167.g1 Yutaka Sat

  7. Dicty_cDB: Contig-U16263-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2 bits (18), Expect = 0.15 Identities = 21/22 (95%) Strand = Plus / Minus Query: 649 taataatgttttaattgata...GI_CAAJ23360.fwd NIH_XGC_tropBrn2 Xenopus (Silur... 50 0.002 3 ( FD452129 ) EGGAF61TR Haematobia irritan...uts... 54 0.015 1 ( BW039245 ) Ciona intestinalis cDNA, clone:cibd040a11, 5' end... 54 0.015 1 ( FF985828 ) CBWU98429.b1 Yutaka Sat...ou unpublished cDNA librar... 54 0.015 1 ( FF935628 ) CBWU71588.b1 Yutaka Satou unpub...lished cDNA librar... 54 0.015 1 ( FF912191 ) CBWU56358.b1 Yutaka Satou unpublish

  8. Dicty_cDB: Contig-U04312-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lone:cicl034i21, 5' end... 48 0.005 2 ( FF994286 ) CBWU111142.b1 Yutaka Satou unpublished cDNA libra... 48 0...CHPZ3010.b1_D10.ab1 CHP(XYZ) plains sunflower Hel... 38 0.005 2 ( FG001241 ) CBWU116604.b1 Yutaka Satou unpu...0.006 2 ( BW264810 ) Ciona intestinalis cDNA, clone:cign039g20, 5' end... 48 0.006 2 ( FG000620 ) CBWU116165.b1 Yutaka Sat...ou unpublished cDNA libra... 48 0.006 2 ( FF930402 ) CBWU67979.g1 Yutaka Satou unpublished cDN...A librar... 48 0.006 2 ( FF930401 ) CBWU67979.b1 Yutaka Satou unpublished cDNA li

  9. Dicty_cDB: Contig-U01943-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s... 38 0.64 AB196473_1( AB196473 |pid:none) Ciona intestinalis p47phox mRNA fo... 38 0.64 (Q17QS1) RecName: Full=Sor...0.020 BC077503_1( BC077503 |pid:none) Xenopus laevis sorting nexin assoc... 43 40 0.099 EU002077_1( EU002077 |pid:none) Coryphaenoides rupestris isolate... 0.13 EF033000_1( EF033000 |pid:none) Amia calva SH3 and PX domain-conta... 40 0.13 EU002089_1( EU002089 |pid:none) Monopte...rus albus isolate R40 SH3 a... 40 0.13 EU002090_1( EU002090 |pid:none) Sebastes ruberri

  10. Exploration of genetically encoded voltage indicators based on a chimeric voltage sensing domain

    Directory of Open Access Journals (Sweden)

    Yukiko Mishina


    We recently introduced a new VSFP design in which the voltage-sensing domain (VSD is sandwiched between a FRET pair of fluorescent proteins (termed VSFP-Butterflies and also demonstrated a series of chimeric VSD in which portions of the VSD of Ciona intestinalis voltage-sensitive phosphatase (Ci-VSP are substituted by homologous portions of a voltage-gated potassium channel subunit. These chimeric VSD had faster sensing kinetics than that of the native Ci-VSD. Here, we describe a new set of VSFPs that combine chimeric VSD with the Butterfly structure. We show that these chimeric VSFP-Butterflies can report membrane voltage oscillations of up to 200 Hz in cultured cells and report sensory evoked cortical population responses in living mice. This class of GEVIs may be suitable for imaging of brain rhythms in behaving mammalians.

  11. AcEST: DK950528 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 528 Tissue type prothallia Developmental stage gametophyte Contig ID CL2801Contig1 Sequen..........................done Score E Sequences producing significant alignments: (bits) Value sp|Q1EHT7|C3H4_ORYSJ Zinc, ring finger protein, 1 variant (... 49 3e-04 tr|Q256Y7|Q256Y7_HUMAN Makorin-1 OS=Homo sapien... protein, 2 (Fragment... 48 4e-04 tr|B7Q4B2|B7Q4B2_IXOSC Makorin, putative (Fragment... >tr|Q1RLH2|Q1RLH2_CIOIN Zinc finger protein OS=Ciona intestinalis GN=Ci-ZF(C3H/RING)-1 PE=2 SV=1 Length = 447 Score

  12. AcEST: DK947564 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 564 Tissue type young leaves Developmental stage sporophyte Contig ID CL4109Contig1 Sequen... E Sequences producing significant alignments: (bits) Value sp|Q0JP11|C3H3_ORYSJ Zinc finger CCCH domain-conta... CCCH domain-containing protein... 37 0.058 sp|Q9H000|MKRN2_HUMAN Makorin-2 OS=Homo sapiens G...gth = 468 Score = 40.0 bits (92), Expect = 0.009 Identities = 20/51 (39%), Positives = 25/51 (49%) Frame = +2 Quer...3|Q1RPY3_CIOIN Zinc finger protein OS=Ciona intestinalis... 74 8e-12 tr|Q207M5|Q207M5_ICTPU Zinc finger matrin type 5 (Fragment

  13. Dicty_cDB: Contig-U15446-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available dary xyle... 46 5e-05 2 ( CO212619 ) WS00922.B21_J02 IS-B-N-A-10 Picea engelmannii x P... 46 5e-05 2 ( ES874...lone:ddv19l07, 3' ... 66 1e-08 3 ( EC821477 ) SME00009933 esmbsro2 Sawyeria marylandensis cDNA,... 58 1e-08 ...55.b1 Gateway compatible cien cDNA librar... 40 1e-06 3 ( FK055965 ) XABT121425.b1 Gateway compatib... EST from clone SA0AA... 40 3e-06 3 ( EC824003 ) SME00002535 esmbsro2 Sawyeria marylandensis cDNA,... 66 3e-06 1 ( EC820055 ) SME0000... 4e-06 3 ( BW051244 ) Ciona intestinalis cDNA, clone:cibd071p09, 5' end... 40 4e-06 3 ( FK214509 ) XABT21

  14. Dicty_cDB: Contig-U12053-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e) 43 0.030 AF345905_1( AF345905 |pid:none) Homo sapiens LIM mineralization pr... 43 0.030 AB209531_1( AB209531 |pid:non... 48 0.88 1 ( AC177181 ) Strongylocentrotus purpuratus clone R3-4018C22, W... 48 0.88 1 ( ER286475 ) 1092343573088 Global...e CH251-682B11, ... 38 0.79 6 ( ER415983 ) 1092452150498 Global-Ocean-Sampling_GS-35-01-01-1... Phytoplasma mali strain AT complete ch... 36 0.72 17 ( AC192970 ) Pan troglodytes chromosome X clon...vegicus protein tyrosine... 91 1e-16 AB183035_1( AB183035 |pid:none) Ciona intestinalis Ci-VSP mRNA for... 8

  15. Dicty_cDB: Contig-U14888-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e) Paramecium aurelia immobilization anti... 41 0.048 AF448145_3( AF448145 |pid:none) My...Y426751_1( AY426751 |pid:none) Nicotiana attenuata putative 6 rep... 39 0.24 DQ900937_1( DQ900937 |pid:none) Ciona intestinali...s Ci-VWFL1 mRNA f... 39 0.24 (Q8VIK5) RecName: Full=Platelet endothelial aggregation receptor... 39 0...6 1.9 1 ( EJ660326 ) 1092955021308 Global-Ocean-Sampling_GS-30-02-01-1... 46 1.9 1 ( EJ225210 ) 1092351409512 Global-Ocean-Sampli...6 1 ( EJ625288 ) 1092963148730 Global-Ocean-Sampling_GS-29-01-01-1... 44 7.6 1 ( EJ623254 ) 1092963107162 Global-Ocean-Sampli

  16. Dicty_cDB: SSC643 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nwwfi**csryvvnwchylyfimwfptilcfisklii*knfnr *l*fprtrmdscl*tcqsfh*klncqrsrstsycqtms**plalw...AK052401 |pid:none) Mus musculus 13 days embryo lung c... 191 1e-47 (Q8IU85) RecName: Full=Calcium/calmoduli...91 1e-47 (Q8BW96) RecName: Full=Calcium/calmodulin-dependent protein kina... 191 1e-47 BC041721_1( BC041721 ...oso... 212 5e-54 AB076903_1( AB076903 |pid:none) Ciona intestinalis Ci-CaM-K mRNA f... 196 3e-49 BC074183_1(...SS (Link to library) SSC643 (Link to dictyBase) - - - Contig-U11996-1 SSC643Z (Link to Original

  17. Dicty_cDB: SLI715 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available cctrsfnwwfi**csryvvnwchylyfimwfptilcfis klii*knfnr*l*fprtrmdscl*tcqsfh*klncqrsrstsycqtms**plalw...c... 137 2e-31 (Q8IU85) RecName: Full=Calcium/calmodulin-dependent protein kina...... 137 2e-31 (Q8BW96) RecName: Full=Calcium/calmodulin-dependent protein kina... 137 2e-31 BC041721_1( BC0417...romoso... 148 5e-35 AB076903_1( AB076903 |pid:none) Ciona intestinalis Ci-CaM-K mRNA f... 142 4e-33 BC074183...SL (Link to library) SLI715 (Link to dictyBase) - - - Contig-U11996-1 SLI715Z (Link to Original

  18. Dicty_cDB: SSD853 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available cfisklii*knfnr*l*fprtrmdscl*t cqsfh*klncqrsr*rsycqtms**pwalw**singfcc*splsfr*kdeei**pkkrws ifk*lnliiiiikkkkk...vis MGC82022 protein, m... 101 7e-21 ( Q63450 ) RecName: Full=Calcium/calmodulin-dependent protein kina... 1...00 1e-20 ( Q14012 ) RecName: Full=Calcium/calmodulin-dependent protein kina... 100 1e-20 PDBF( 1A06 ) MOL_ID...76903 |pid:none) Ciona intestinalis Ci-CaM-K mRNA f... 103 2e-21 BC074183_1( BC074183 |pid:none) Xenopus lae...SS (Link to library) SSD853 (Link to dictyBase) - - - Contig-U11996-1 SSD853Z (Link to Original

  19. Dicty_cDB: SSD777 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ytrlcctrsfnwwfi**csryvvnwchnlyfimwfptilcfisklii*kn fnr*l*fprtrmdscl*tcqsfh*klncqrsrstsycqtmf**plalw...7e-30 ( Q63450 ) RecName: Full=Calcium/calmodulin-dependent protein kina... 132 9e-30 ( Q14012 ) RecName: Full=Calcium/cal...6982 |pid:none) Dictyostelium discoideum chromoso... 141 1e-32 AB076903_1( AB076903 |pid:none) Ciona intestinalis Ci-Ca...SS (Link to library) SSD777 (Link to dictyBase) - - - Contig-U11996-1 SSD777Z (Link to Original... dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11996-1 Original site URL http://dict

  20. Dicty_cDB: SSJ377 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available fptil csisklii*knfnr*l*fprtrmdscl*tcqsfh*klncqrsrstsycqtms**plalw* *sinwfcc*splsfr*kdeei**pkkrwsifk*lnliiii .... 145 1e-33 ( Q63450 ) RecName: Full=Calcium/calmodulin-dependent protein kina... 144 2e-33 ( Q14012 ) RecName: Full=Calcium/cal...oso... 160 1e-38 AB076903_1( AB076903 |pid:none) Ciona intestinalis Ci-CaM-K mRNA f... 151 1e-35 BC074183_1(...SS (Link to library) SSJ377 (Link to dictyBase) - - - Contig-U11996-1 SSJ377Z (Link to Original... dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11996-1 Original site URL http://dict

  1. Dicty_cDB: VFB154 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available fxwwfi**csryvvnwchylyfimwfptilcfisklii*knfnr*l*fprtrmdscl*tc qsfh*klncqrsrstsycqtms**plalw**sinwfxcxspls Hom... 3e-43 AK052401_1( AK052401 |pid:none) Mus musculus 13 days embryo lung c... 175 6e-43 (Q8IU85) RecName: Full=Calcium/cal... Homo sapiens C... 175 6e-43 (Q8BW96) RecName: Full=Calcium/calmodulin-dependent chain kinase DDB_G0... 191 6e-48 AB076903_1( AB076903 |pid:none) Ciona intestinalis Ci-CaM-K mRNA f... 17...VF (Link to library) VFB154 (Link to dictyBase) - - - Contig-U11996-1 VFB154Z (Link to Original

  2. Dicty_cDB: AFL836 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available hcxqvvvhqimlhqkf*xvvhmimqsicg qlvslpifyyvvshhsyasslplii*knfxr*l*fprtrmdscl*tcqsfh*klncqrsr stsycqxms**plalw*... BC110966_1( BC110966 |pid:none) Xenopus laevis calcium/calmodulin-... 162 4e-50 (Q8IU85) RecName: Full=Calcium/cal...modulin-dependent protein kina... 160 1e-49 (Q8BW96) RecName: Full=Calcium/cal...1( AB076903 |pid:none) Ciona intestinalis Ci-CaM-K mRNA f... 159 3e-49 protein update 2009. 4. 4 PSORT psg: 0.00 gvh: 0.00 al...AF (Link to library) AFL836 (Link to dictyBase) - - - - AFL836P (Link to Original s

  3. Dicty_cDB: VFG381 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available *knfn r*l*fprtrmdscl*tcqsfh*klncqrsrstsycqtms**plalw**sinwfcc*spls fr*kekkyktkeegsifk*lnlii Frame C: diklqtf...n, m... 191 2e-47 AK052401_1( AK052401 |pid:none) Mus musculus 13 days embryo lung c... 190 5e-47 (Q8IU85) RecName: Full=Calcium/cal...modulin-dependent protein kina... 190 5e-47 (Q8BW96) RecName: Full=Calcium/calmoduli... myosin light chain kinase DDB_G0... 213 4e-54 AB076903_1( AB076903 |pid:none) Ciona intestinalis Ci-Ca...VF (Link to library) VFG381 (Link to dictyBase) - G03036 DDB0216307 Contig-U11996-1

  4. Dicty_cDB: SFH150 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lcctrsfxwwfi**csryvvnwchylyfimwfptilcfisklii* knfxr*l*fprtrmdscl*tcqsfh*klncqrsrstsycqtms**plalw**sinwfxc* s...ulus 13 days embryo lung c... 195 1e-48 (Q8IU85) RecName: Full=Calcium/calmodulin-dependent protein kina... ...195 1e-48 AY335686_1( AY335686 |pid:none) Synthetic construct Homo sapiens C... 195 1e-48 (Q8BW96) RecName: Full=Calcium/cal... AB076903 |pid:none) Ciona intestinalis Ci-CaM-K mRNA f... 197 2e-49 BC074183_1( BC074183 |pid:none) Xenopus...SF (Link to library) SFH150 (Link to dictyBase) - - - Contig-U11996-1 SFH150P (Link to Original

  5. Dicty_cDB: SSK695 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available fnr*l*fprtrmdscl*tcqsf h*klncqrsrstsycqtms**plalw**sinwfcc*splsfr*kdeei**pkkrwsifk* lnliiiiikkkkkikkkkviiikk... 108 4e-23 ( Q63450 ) RecName: Full=Calcium/calmodulin-dependent protein kina... 108 8e-23 ( Q14012 ) RecName: Full=Calcium/cal... AB076903 |pid:none) Ciona intestinalis Ci-CaM-K mRNA f... 114 1e-24 (Q86AD7) RecName: Full=Probable myosin ...SS (Link to library) SSK695 (Link to dictyBase) - - - Contig-U11996-1 SSK695E (Link to Original... dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11996-1 Original site URL http://dict

  6. Dicty_cDB: AFL780 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available qsfh*klncqrsrst sycqtms**plalw**sinwfccdlhshfakreei*dqrrgvnlqkln Homology vs CSM-cDNA Score E Sequences producing significant al...8 (Q8IU85) RecName: Full=Calcium/calmodulin-dependent protein kina... 228 2e-58 AY335686_1( AY335686 | Synthetic construct Homo sapiens C... 228 2e-58 (Q8BW96) RecName: Full=Calcium/cal...modulin-dependent protein kina... 228 2e-58 AB076903_1( AB076903 |pid:none) Ciona intestinalis Ci-CaM-K...AF (Link to library) AFL780 (Link to dictyBase) - - - - AFL780P (Link to Original s

  7. Dicty_cDB: SSB277 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ence (All Frames) Frame A: vvnwchylyfimwfptilcfisklii*knfnr*l*fprtrmdscl*tcqsfh*klncqrs rstsycqtms**plalw...0 AK052401_1( AK052401 |pid:none) Mus musculus 13 days embryo lung c... 98 1e-19 (Q8IU85) RecName: Full=Calcium/cal... Synthetic construct Homo sapiens C... 98 1e-19 (Q8BW96) RecName: Full=Calcium/calmodulin-dependent protein ...kina... 98 1e-19 ( Q63450 ) RecName: Full=Calcium/calmodulin-dependent protein kina... 97 3e-19 ( Q14012 ) RecName: Full=Calcium/cal...C82022 protein, m... 100 2e-20 AB076903_1( AB076903 |pid:none) Ciona intestinalis Ci-CaM-K mRNA f... 99 8e-2

  8. Dicty_cDB: VFG501 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available *fprtrmdscl*tcqsfh*klncqrsrstsycqtms**plalw**sinwfcc*splsfrx kmkkyktkeegsifkn*iniix Homology vs CSM-cDNA Sco...M-K mRNA f... 190 2e-47 AK052401_1( AK052401 |pid:none) Mus musculus 13 days embryo lung c... 190 3e-47 (Q8IU85) RecName: Full=Cal... Synthetic construct Homo sapiens C... 190 3e-47 (Q8BW96) RecName: Full=Calcium/cal...022 protein, m... 191 1e-47 AB076903_1( AB076903 |pid:none) Ciona intestinalis Ci-Ca...VF (Link to library) VFG501 (Link to dictyBase) - - - Contig-U11996-1 VFG501Z (Link to Original

  9. Dicty_cDB: AFB623 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available tilcfisklii*knfnr*l*fprtrmdscl*tcqsxh*klxcqrxrst syxqtms**plalw**six Frame B: rykitdi*q*i*KYQYIYLQPYLIVGIVNN...8 1e-55 (Q8IU85) RecName: Full=Calcium/calmodulin-dependent protein kina... 218 1e-55 AY335686_1( AY335686 | Synthetic construct Homo sapiens C... 218 1e-55 (Q8BW96) RecName: Full=Calcium/cal...6903 |pid:none) Ciona intestinalis Ci-CaM-K mRNA f... 222 1e-56 BC074183_1( BC074183 |pid:none) Xenopus laev...AF (Link to library) AFB623 (Link to dictyBase) - - - Contig-U11996-1 AFB623P (Link to Original

  10. Dicty_cDB: VSF265 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SYDNAVDMWSIGVITYILLCGFPPFLCFISXLII*kn fxr*l*fprtrmdscl*tcqsfh*klncqrsrstsycqtms**plalw**sinwxxc*sp lsx Trans...DMTIKIADFGLSKIFG TGXALXTSCGTPDYVAPEVLTGGSYDNAVDMWSIGVITYILLCGFPPFLCFISXLII*kn fxr*l*fprtrmdscl*tcqsfh*klncqrsrstsycqtms**plalw...m... 134 2e-43 (Q8IU85) RecName: Full=Calcium/calmodulin-dependent protein kina... 135 6e-43 (Q8BW96) RecName: Full=Calcium/cal...e-42 AB076903_1( AB076903 |pid:none) Ciona intestinalis Ci-CaM-K mRNA f... 132 4e-42 protein update 2009. 7....VS (Link to library) VSF265 (Link to dictyBase) - - - Contig-U11996-1 VSF265Z (Link to Original

  11. Dicty_cDB: SSH745 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available knkkikiiftnckkkkkkknfrlikskhfd*hkkakkkkk kkkk--- ---*l*fprtrmdscl*tcqsfh*klncqrsrstsycqtms**plalw...e-07 AE014135_86( AE014135 |pid:none) Drosophila melanogaster chromosom... 57 3e-07 ( Q63450 ) RecName: Full=Calcium/cal...modulin-dependent protein kina... 55 1e-06 ( Q14012 ) RecName: Full=Calcium/calmodulin-dependent...modulin-dependent ser... 171 9e-42 AB076903_1( AB076903 |pid:none) Ciona intestinalis Ci-CaM-K mRNA f... 62...19-1 SSH745P (Link to Original site) SSH745F 193 SSH745Z 261 SSH745P 454 - - Show SSH745 Library SS (Link to

  12. Metodología Innovadora para el Trabajo Fin de Grado en Comunicación Audiovisual

    Directory of Open Access Journals (Sweden)

    Antonio Cantos Ceballos


    Full Text Available El presente trabajo establece una metodología innovadora para abordar el trabajo de Fin de Grado en los estudios superiores de Comuni- cación en España fundamentada en un nuevo paradigma competencial de los entornos personales de aprendizaje. Se utiliza un método empírico junto con otro holístico, cualitativo e integrador que pone en relación el TFG como eje en el que confluyen las Competencias, el Entorno Perso- nal de Aprendizaje, y lo Digital y los Contextos de Movilidad. Asimis- mo, se pone en valor el nuevo rol del profesor universitario, que evolu- ciona de docente a mentor, y el papel autónomo y central del estudiante.

  13. Large-scale trends in the evolution of gene structures within 11 animal genomes.

    Directory of Open Access Journals (Sweden)

    Mark Yandell


    Full Text Available We have used the annotations of six animal genomes (Homo sapiens, Mus musculus, Ciona intestinalis, Drosophila melanogaster, Anopheles gambiae, and Caenorhabditis elegans together with the sequences of five unannotated Drosophila genomes to survey changes in protein sequence and gene structure over a variety of timescales--from the less than 5 million years since the divergence of D. simulans and D. melanogaster to the more than 500 million years that have elapsed since the Cambrian explosion. To do so, we have developed a new open-source software library called CGL (for "Comparative Genomics Library". Our results demonstrate that change in intron-exon structure is gradual, clock-like, and largely independent of coding-sequence evolution. This means that genome annotations can be used in new ways to inform, corroborate, and test conclusions drawn from comparative genomics analyses that are based upon protein and nucleotide sequence similarities.

  14. Inferring noncoding RNA families and classes by means of genome-scale structure-based clustering.

    Directory of Open Access Journals (Sweden)

    Sebastian Will


    Full Text Available The RFAM database defines families of ncRNAs by means of sequence similarities that are sufficient to establish homology. In some cases, such as microRNAs and box H/ACA snoRNAs, functional commonalities define classes of RNAs that are characterized by structural similarities, and typically consist of multiple RNA families. Recent advances in high-throughput transcriptomics and comparative genomics have produced very large sets of putative noncoding RNAs and regulatory RNA signals. For many of them, evidence for stabilizing selection acting on their secondary structures has been derived, and at least approximate models of their structures have been computed. The overwhelming majority of these hypothetical RNAs cannot be assigned to established families or classes. We present here a structure-based clustering approach that is capable of extracting putative RNA classes from genome-wide surveys for structured RNAs. The LocARNA (local alignment of RNA tool implements a novel variant of the Sankoff algorithm that is sufficiently fast to deal with several thousand candidate sequences. The method is also robust against false positive predictions, i.e., a contamination of the input data with unstructured or nonconserved sequences. We have successfully tested the LocARNA-based clustering approach on the sequences of the RFAM-seed alignments. Furthermore, we have applied it to a previously published set of 3,332 predicted structured elements in the Ciona intestinalis genome (Missal K, Rose D, Stadler PF (2005 Noncoding RNAs in Ciona intestinalis. Bioinformatics 21 (Supplement 2: i77-i78. In addition to recovering, e.g., tRNAs as a structure-based class, the method identifies several RNA families, including microRNA and snoRNA candidates, and suggests several novel classes of ncRNAs for which to date no representative has been experimentally characterized.

  15. Brachyury, Foxa2 and the cis-Regulatory Origins of the Notochord.

    Directory of Open Access Journals (Sweden)

    Diana S José-Edwards


    Full Text Available A main challenge of modern biology is to understand how specific constellations of genes are activated to differentiate cells and give rise to distinct tissues. This study focuses on elucidating how gene expression is initiated in the notochord, an axial structure that provides support and patterning signals to embryos of humans and all other chordates. Although numerous notochord genes have been identified, the regulatory DNAs that orchestrate development and propel evolution of this structure by eliciting notochord gene expression remain mostly uncharted, and the information on their configuration and recurrence is still quite fragmentary. Here we used the simple chordate Ciona for a systematic analysis of notochord cis-regulatory modules (CRMs, and investigated their composition, architectural constraints, predictive ability and evolutionary conservation. We found that most Ciona notochord CRMs relied upon variable combinations of binding sites for the transcription factors Brachyury and/or Foxa2, which can act either synergistically or independently from one another. Notably, one of these CRMs contains a Brachyury binding site juxtaposed to an (AC microsatellite, an unusual arrangement also found in Brachyury-bound regulatory regions in mouse. In contrast, different subsets of CRMs relied upon binding sites for transcription factors of widely diverse families. Surprisingly, we found that neither intra-genomic nor interspecific conservation of binding sites were reliably predictive hallmarks of notochord CRMs. We propose that rather than obeying a rigid sequence-based cis-regulatory code, most notochord CRMs are rather unique. Yet, this study uncovered essential elements recurrently used by divergent chordates as basic building blocks for notochord CRMs.

  16. Brachyury, Foxa2 and the cis-Regulatory Origins of the Notochord. (United States)

    José-Edwards, Diana S; Oda-Ishii, Izumi; Kugler, Jamie E; Passamaneck, Yale J; Katikala, Lavanya; Nibu, Yutaka; Di Gregorio, Anna


    A main challenge of modern biology is to understand how specific constellations of genes are activated to differentiate cells and give rise to distinct tissues. This study focuses on elucidating how gene expression is initiated in the notochord, an axial structure that provides support and patterning signals to embryos of humans and all other chordates. Although numerous notochord genes have been identified, the regulatory DNAs that orchestrate development and propel evolution of this structure by eliciting notochord gene expression remain mostly uncharted, and the information on their configuration and recurrence is still quite fragmentary. Here we used the simple chordate Ciona for a systematic analysis of notochord cis-regulatory modules (CRMs), and investigated their composition, architectural constraints, predictive ability and evolutionary conservation. We found that most Ciona notochord CRMs relied upon variable combinations of binding sites for the transcription factors Brachyury and/or Foxa2, which can act either synergistically or independently from one another. Notably, one of these CRMs contains a Brachyury binding site juxtaposed to an (AC) microsatellite, an unusual arrangement also found in Brachyury-bound regulatory regions in mouse. In contrast, different subsets of CRMs relied upon binding sites for transcription factors of widely diverse families. Surprisingly, we found that neither intra-genomic nor interspecific conservation of binding sites were reliably predictive hallmarks of notochord CRMs. We propose that rather than obeying a rigid sequence-based cis-regulatory code, most notochord CRMs are rather unique. Yet, this study uncovered essential elements recurrently used by divergent chordates as basic building blocks for notochord CRMs. PMID:26684323

  17. The good, the bad and the recovery in an assisted migration.

    Directory of Open Access Journals (Sweden)

    Bridget S Green

    Full Text Available BACKGROUND: Assisted migration or translocation of species to ameliorate effects of habitat loss or changing environment is currently under scrutiny as a conservation tool. A large scale experiment of assisted migration over hundreds of kilometres was tested on a morph from a commercial fishery of southern rock lobster Jasus edwardsii, to enhance depleted populations, improve the yield and sustainability of the fishery, and test resilience to a changing climate. METHODOLOGY AND PRINCIPAL FINDINGS: Approximately 10,000 lower-valued, pale-coloured lobsters were moved from deep water to inshore sites (2 in Tasmania [TAS] and 2 in South Australia [SA] where the high-value, red morph occurs. In TAS this was a northwards movement of 1° latitude. Growth was measured only in TAS lobsters, and reproductive status was recorded in lobsters from all locations. Pale females (TAS grew 4 times faster than resident pale lobsters from the original site and twice as fast as red lobsters at their new location. Approximately 30% of translocated pale lobsters deferred reproduction for one year after release (SA and TAS, and grew around 1 mm yr(-1 less compared to translocated pale lobsters that did not defer reproduction. In spite of this stress response to translocation, females that deferred reproduction still grew 2-6 mm yr(-1 more than lobsters at the source site. Lobsters have isometric growth whereby volume increases as a cube of length. Consequently despite the one-year hiatus in reproduction, increased growth increases fecundity of translocated lobsters, as the increase in size provided a larger volume for producing and incubating eggs in future years. CONCLUSIONS AND SIGNIFICANCE: Assisted migration improved egg production and growth, despite a temporary stress response, and offers a tool to improve the production, sustainability and resilience of the fishery.

  18. Fishery induces sperm depletion and reduction in male reproductive potential for crab species under male-biased harvest strategy. (United States)

    Pardo, Luis Miguel; Rosas, Yenifer; Fuentes, Juan Pablo; Riveros, Marcela Paz; Chaparro, Oscar Roberto


    Sperm depletion in males can occur when polygynous species are intensively exploited under a male-biased management strategy. In fisheries involving crabs species, the effects of this type of management on the reproductive potential is far from being understood. This study tests whether male-biased management of the principal Chilean crab fishery is able to affect the potential capacity of Metacarcinus edwardsii males to transfer sperm to females. Five localities in southern Chile, recording contrasting crab fishery landing, were selected to assess the potential of sperm depletion triggered by fishery. Seasonally, male crabs from each locality were obtained. Dry weight and histological condition of vasa deferentia and the Vaso-Somatic Index (VSI) were determined in order to use them as proxies for sperm depletion and male reproductive condition. A manipulative experiment was performed in the laboratory to estimate vasa deferentia weight and VSI from just-mated males in order to obtain a reference point for the potential effects of the fishery on sperm reserves. Sperm storage capacity is significantly affected by fisheries; during the mating season vasa deferentia from localities with low fishery intensity were heavier than those from high intensity fisheries, and these differences were even more evident in large males. Histological section showed that this disparity in vasa deferentia weight was explained principally by differences in the quantity of spermatophores rather than other seminal material. VSI was always higher in males from localities with low fishery intensity. Males from localities with high fishery intensity showed little capacity to recover sperm reserves and the VSI of these males remained below the values of the just-mated males. Detriment in the capacity of males to transfer sperm is the first step to sperm limitation in an exploited population, thus detection of sperm depletion can be an alert to introduce changes in the current management of

  19. A quantitative metric to identify critical elements within seafood supply networks.

    Directory of Open Access Journals (Sweden)

    Éva E Plagányi

    Full Text Available A theoretical basis is required for comparing key features and critical elements in wild fisheries and aquaculture supply chains under a changing climate. Here we develop a new quantitative metric that is analogous to indices used to analyse food-webs and identify key species. The Supply Chain Index (SCI identifies critical elements as those elements with large throughput rates, as well as greater connectivity. The sum of the scores for a supply chain provides a single metric that roughly captures both the resilience and connectedness of a supply chain. Standardised scores can facilitate cross-comparisons both under current conditions as well as under a changing climate. Identification of key elements along the supply chain may assist in informing adaptation strategies to reduce anticipated future risks posed by climate change. The SCI also provides information on the relative stability of different supply chains based on whether there is a fairly even spread in the individual scores of the top few key elements, compared with a more critical dependence on a few key individual supply chain elements. We use as a case study the Australian southern rock lobster Jasus edwardsii fishery, which is challenged by a number of climate change drivers such as impacts on recruitment and growth due to changes in large-scale and local oceanographic features. The SCI identifies airports, processors and Chinese consumers as the key elements in the lobster supply chain that merit attention to enhance stability and potentially enable growth. We also apply the index to an additional four real-world Australian commercial fishery and two aquaculture industry supply chains to highlight the utility of a systematic method for describing supply chains. Overall, our simple methodological approach to empirically-based supply chain research provides an objective method for comparing the resilience of supply chains and highlighting components that may be critical.

  20. Molecular investigations of chikungunya virus during outbreaks in Orissa, Eastern India in 2010. (United States)

    Das, Biswadeep; Sahu, Abhipsa; Das, Mumani; Patra, Aparna; Dwibedi, Bhagirathi; Kar, Santanu K; Hazra, Rupenangshu K


    Chikungunya virus (CHIKV), an arthritogenic alphavirus, is transmitted to humans by mosquitoes of genus Aedes, mainly Aedes aegypti and Aedes albopictus. The resurgence of CHIKV in different parts of India is a point of major public health concern. In 2010, chikungunya outbreaks with high epidemic magnitude were recorded in coastal areas of Orissa, Eastern India, affecting more than 15,000 people coupled with severe arthralgia and prolonged morbidites. Detailed entomological, serological and molecular investigation of this unprecendented outbreak was carried out by collecting and studying 1359 mosquito samples belonging to A. albopictus, A. aegypti, A. vittatus, A. edwardsii and Culex species and 220 patients serum from the affected areas. In this study, CHIKV specific IgM capture-ELISA and reverse-transcription PCR (RT-PCR) were done to detect recent infection of CHIKV in serum samples and adult mosquitoes collected from the affected areas. The high maximum likelihood estimate (MLE) (15.2) in A. albopictus mosquitoes indicated that it was the principal vector involved in transmission of CHIKV in Orissa. Phylogenetic analysis revealed that the CHIKV strains involved in the outbreak belonged to the Indian Ocean Lineage (IOL) group within the East, Central and South African (ECSA) genotype. Genetic characterization of envelope glycoprotein (E1 and E2) genes revealed that all the CHIKV isolates from Orissa had the E1-A226V mutation that enhances viral dissemination and transmissibility by A. albopictus mosquitoes along with E2-L210Q and E2-I211T mutations, which play an epistatic role with E1-A226V mutation in adaptation of CHIKV to A. albopictus by increasing its midgut infectivity, thereby favoring its vectorial capacity. Our results showed the involvement of A. albopictus vector in the recent outbreaks in Orissa and circulation of IOL strains of ECSA genotype of CHIKV with E1-A226V, E2-L210Q and E2-I211T mutations in vectors and patients serum. PMID:22484761

  1. Benthic faunal assemblages from the Holocene middle shelf of the South Evoikos Gulf, central Greece, and their palaeoenvironmental implications (United States)

    Asimina Louvari, Markella; Tsourou, Theodora; Drinia, Hara; Anastasakis, George


    intermediate percentages of organic matter in which at least some sand fraction is present. A strict interpretation based on the known modern distribution of A. beccarii would confine the species to upper shoreface environments (Hayward et al. 2004). The relatively high frequency values of B. marginata indicate a correlation with organic matter enrichment, with seasonal low oxygen content. This hypothesis is testified also by the increase of the opportunistic species V. bradyana. The temporal presence of V. bradyana assemblage indicates a strong influence of Asopos River run-off, with interplay of increasing food availability and low oxygen concentration Three main ostracod assemblages were distinguished from the bottom to the top of the sediment core: At the lower part of the core ostracod assemblage consists mainly of Costa edwardsii, Cytheridea neapolitana, Callistocythere spp., Pterygocythereis jonesii and Leptocythere spp. At the middle part, Costa edwardsii is the dominant species with relative abundances up to 80% of the total ostracod fauna. At the upper part Costa edwardsii is the most abundant species (20-40% of the total fauna) accompanied mainly by Loxoconcha spp., Xestoleberis spp. and Cyprideis torosa. Ostracod abundance and diversity decrease towards the upper unit of the studied core. These data, and AMS radiocarbon ages determined for foraminifera and ostracods, provide evidence of a change from oceanic influence to estuarine influence. This event is also contemporaneous with the period which is generally characterized by increased evaporation rate (initially at the tropic seas), retreat of glaciers and increased rainfalls (Fairbanks, 1989). Fairbanks, R.G., 1989. A 17,000 year glacio-eustatic sea level record: influence of glacial melting rates on the Younger Dryas event and deep ocean circulation. Nature, 342, 637-642. Hayward, B.W., Sabaa, A.T., Grenfell, H.R., 2004. Benthic foraminifera and the Late Quaternary (last 150 ka) palaeoceanographic and

  2. Diversity of nonribosomal peptide synthetase genes in the microbial metagenomes of marine sponges. (United States)

    Pimentel-Elardo, Sheila Marie; Grozdanov, Lubomir; Proksch, Sebastian; Hentschel, Ute


    Genomic mining revealed one major nonribosomal peptide synthetase (NRPS) phylogenetic cluster in 12 marine sponge species, one ascidian, an actinobacterial isolate and seawater. Phylogenetic analysis predicts its taxonomic affiliation to the actinomycetes and hydroxy-phenyl-glycine as a likely substrate. Additionally, a phylogenetically distinct NRPS gene cluster was discovered in the microbial metagenome of the sponge Aplysina aerophoba, which shows highest similarities to NRPS genes that were previously assigned, by ways of single cell genomics, to a Chloroflexi sponge symbiont. Genomic mining studies such as the one presented here for NRPS genes, contribute to on-going efforts to characterize the genomic potential of sponge-associated microbiota for secondary metabolite biosynthesis. PMID:22822366

  3. Results of environmental radioactivity surveys around the Onagawa Nuclear Power Station

    International Nuclear Information System (INIS)

    The results, i.e. nuclide analysis data, of environmental radioactivity surveys carried out around the Onagawa Nuclear Power Station of Tohoku Electric Power Co., Inc., from October, 1981, to December, 1982, are presented in tables; fallout, airborne dust, land water (source water for water service), soil, agricultural products (Japanese radish, rice), index plants (white Dutch clover, mugwort), seawater, sea-bottom deposit, fishes and shellfishes (rock trout, ear shell, ascidian, oyster), index marine products (gulfweed, edible seaweed, purplish Washington clan) seaweed (wakame seaweed) were examined. The Onagawa Nuclear Power Station is in the stage of construction at present, as of March, 1983, therefore, the data are for grasping the background levels in the areas concerned. For this same purpose, certain samples were also taken from other localities in Miyagi Prefecture. (Mori, K.)

  4. Cyanobactins from Cyanobacteria: Current Genetic and Chemical State of Knowledge

    Directory of Open Access Journals (Sweden)

    Joana Martins


    Full Text Available Cyanobacteria are considered to be one of the most promising sources of new, natural products. Apart from non-ribosomal peptides and polyketides, ribosomally synthesized and post-translationally modified peptides (RiPPs are one of the leading groups of bioactive compounds produced by cyanobacteria. Among these, cyanobactins have sparked attention due to their interesting bioactivities and for their potential to be prospective candidates in the development of drugs. It is assumed that the primary source of cyanobactins is cyanobacteria, although these compounds have also been isolated from marine animals such as ascidians, sponges and mollusks. The aim of this review is to update the current knowledge of cyanobactins, recognized as being produced by cyanobacteria, and to emphasize their genetic clusters and chemical structures as well as their bioactivities, ecological roles and biotechnological potential.

  5. Cyanobactins from Cyanobacteria: Current Genetic and Chemical State of Knowledge. (United States)

    Martins, Joana; Vasconcelos, Vitor


    Cyanobacteria are considered to be one of the most promising sources of new, natural products. Apart from non-ribosomal peptides and polyketides, ribosomally synthesized and post-translationally modified peptides (RiPPs) are one of the leading groups of bioactive compounds produced by cyanobacteria. Among these, cyanobactins have sparked attention due to their interesting bioactivities and for their potential to be prospective candidates in the development of drugs. It is assumed that the primary source of cyanobactins is cyanobacteria, although these compounds have also been isolated from marine animals such as ascidians, sponges and mollusks. The aim of this review is to update the current knowledge of cyanobactins, recognized as being produced by cyanobacteria, and to emphasize their genetic clusters and chemical structures as well as their bioactivities, ecological roles and biotechnological potential. PMID:26580631

  6. Cryptic speciation or global spread? The case of a cosmopolitan marine invertebrate with limited dispersal capabilities. (United States)

    R, Pérez-Portela; V, Arranz; M, Rius; X, Turon


    The existence of globally-distributed species with low dispersal capabilities is a paradox that has been explained as a result of human-mediated transport and by hidden diversity in the form of unrecognized cryptic species. Both factors are not mutually exclusive, but relatively few studies have demonstrated the presence of both. Here we analyse the genetic patterns of the colonial ascidian Diplosoma listerianum, a species nowadays distributed globally. The study of a fragment of a mitochondrial gene in localities worldwide revealed the existence of multiple cryptic species. In addition, we found a complex geographic structure and multiple clades occurred in sympatry. One of the species showed strong population structure irrespective of geographical distances, which is coherent with stochastic dispersal linked to human transport. The present study shows the complexity of discerning the role of cryptic diversity from human-driven range shifts worldwide, as well as disentangling the effects of natural and artificial dispersal. PMID:24217373

  7. Viscosity and not biological mechanisms often controls the effects of temperature on ciliary activity and swimming velocity of small aquatic organisms

    DEFF Research Database (Denmark)

    Larsen, Poul Scheel; Riisgård, H. U.


    A number of studies have shown that temperature-dependent viscosity of the ambient water controls or strongly affects bio-mechanical activity such as beat frequency of water-pumping cilia in mussels and ascidians, swimming velocity of sperm cells, ciliates and small (micro- and meso-scale) aquatic...... organisms using cilia or small appendages for propulsion. Here we summarize results from the literature and from own studies on bio-mechanical activities in response to changing temperature or manipulated viscosity at constant temperature, both having the same change in kinematic viscosity. The survey is...... used to assess to what extent the response is purely physical/mechanical or biological. We argue that a power-law dependence of bio-mechanical activity (a) on kinematic viscosity (ν), i.e. a ~ ν^−m, should be applied to available data. Based on a general close matching of the response data to power-law...

  8. Settlement and metamorphosis of Styela canopus Savigny larvae in response to some neurotransmitters and thyroxin

    Institute of Scientific and Technical Information of China (English)

    FENG Danqing; HUANG Ying; KE Caihuan; ZHOU Shiqiang; LI Shaojing


    The larvae of ascidian Styela canopus Savigny were treated with epinephrine, norepinephrine, L-DOPA, GABA and thyroxin to test the ability of these compounds to induce or inhibit larval settlement and metamorphosis. The results showed that epinephrine,norepinephrine and L-DOPA at the concentration of 1 μ mol/dm3 induced larval settlement and metamorphosis in S. canopus, with short exposure ( 1 h) to 1 μmoL/dm3 of L-DOPA inducing rapid settlement. In contrast, GABA at the concentrations of 0.1 ~100.0 μmol/dm3 significantly inhibited the settlement and metamorphosis of S. canopus larvae. In addition, thyroxin at 1 ~ 50μg/dm3 had no effect on larval settlement and metamorphosis in S. canopus. These results suggest the importance of neurotransmitters in the settlement and metamorphosis of S. canopus larvae.

  9. Diversity of Nonribosomal Peptide Synthetase Genes in the Microbial Metagenomes of Marine Sponges

    Directory of Open Access Journals (Sweden)

    Ute Hentschel


    Full Text Available Genomic mining revealed one major nonribosomal peptide synthetase (NRPS phylogenetic cluster in 12 marine sponge species, one ascidian, an actinobacterial isolate and seawater. Phylogenetic analysis predicts its taxonomic affiliation to the actinomycetes and hydroxy-phenyl-glycine as a likely substrate. Additionally, a phylogenetically distinct NRPS gene cluster was discovered in the microbial metagenome of the sponge Aplysina aerophoba, which shows highest similarities to NRPS genes that were previously assigned, by ways of single cell genomics, to a Chloroflexi sponge symbiont. Genomic mining studies such as the one presented here for NRPS genes, contribute to on-going efforts to characterize the genomic potential of sponge-associated microbiota for secondary metabolite biosynthesis.

  10. Effect of power plant heated effluent on distribution of sedentary fauna and flora

    International Nuclear Information System (INIS)

    Sedentary fauna and floral assemblages at heated (st.3) and non-heated (st.2) areas of the discharge canal of Madras atomic power station (MAPS) were observed over an annual cycle and compared with those of the intake area (st.1). Barnacles (30-57%) followed by hydroids, ascidians, gree mussels, tube worms (8-12%) brown mussels (5-10%), and sea anemones (10-14%) were conspicuous in the intake area. Macroalgae (15-59%) followed by barnacle (12-34%), tube worm (8-21%) and brown mussel (10-15%) were the components at st.2 whereas st.3 was bare except for bluegreen algal mats (100%) with few periwinkles. (author). 23 refs., 2 figs., 2 tabs

  11. Clinical Marine Toxicology: A European Perspective for Clinical Toxicologists and Poison Centers

    Directory of Open Access Journals (Sweden)

    Luc De Haro


    Full Text Available Clinical marine toxicology is a rapidly changing area. Many of the new discoveries reported every year in Europe involve ecological disturbances—including global warming—that have induced modifications in the chorology, behavior, and toxicity of many species of venomous or poisonous aquatic life including algae, ascidians, fish and shellfish. These changes have raised a number of public issues associated, e.g., poisoning after ingestion of contaminated seafood, envenomation by fish stings, and exposure to harmful microorganism blooms. The purpose of this review of medical and scientific literature in marine toxicology is to highlight the growing challenges induced by ecological disturbances that confront clinical toxicologists during the everyday job in the European Poison Centers.

  12. Microenvironmental Ecology of Phototrophs from Extreme Environments

    DEFF Research Database (Denmark)

    Trampe, Erik

    on spatial distribution of major taxonomic groups of phototrophs, detailed measurements of the optical properties of the ikaite matrix, in combination with various microscopic investigations of the phototrophic biofilms in the ikaite (Manuscript 2). Samples brought back for more advanced microscopy...... in Copenhagen were also used as the initial inocula for enrichments and cultivation of isolates of oxygenic phototrophs from the ikaite columns. Most of the culture work was conducted in the lab of Prof. Richard Castenholz at University of Oregon, OR, USA. Many isolates of phototrophs were obtained, several...... distinct biofilm communities associated with the didemnid ascidian Lissoclinum platella was evaluated by means of microsensor measurements of O2 and scalar irradiance, hyperspectral imaging of pigment distribution, variable chlorophyll fluorescence assessment of relative PSII electron transport rates...

  13. An Early Cambrian tunicate from China. (United States)

    Shu, D G; Chen, L; Han, J; Zhang, X L


    Like the Burgess Shales of Canada, the Chengjiang Lagerstätte from the Lower Cambrian of China is renowned for the detailed preservation as fossils of delicate, soft-bodied creatures, providing an insight into the Cambrian explosion. The fossils of possible hemichordate chordates and vertebrates have attracted particular attention. Tunicates, or urochordates, comprise the most basal chordate clade, and details of their evolution could be important in understanding the sequence of character acquisition that led to the emergence of chordates and vertebrates. However, definitive fossils of tunicates from the Cambrian are scarce or debatable. Here we report a probable tunicate Cheungkongella ancestralis from the Chengjiang fauna. It resembles the extant ascidian tunicate genus Styela whose morphology could be useful in understanding the origin of the vertebrates. PMID:11373678

  14. Data on four apoptosis-related genes in the colonial tunicate Botryllus schlosseri. (United States)

    Franchi, Nicola; Ballin, Francesca; Manni, Lucia; Schiavon, Filippo; Ballarin, Loriano


    The data described are related to the article entitled "Recurrent phagocytosis-induced apoptosis in the cyclical generation change of the compound ascidian Botryllus schlosseri" (Franchi et al., 2016) [1]. Four apoptosis-related genes, showing high similarity with mammalian Bax (a member of the Bcl-2 protein family), AIF1 (apoptosis-inducing factor-1), PARP1 (poly ADP ribose polymerase-1) and IAP7 (inhibitor of apoptosis-7) were identified from the analysis of the trascriptome of B. schlosseri. They were named BsBax, BsAIF1, BsPARP1 and BsIAP7. Here, their deduced amino acid sequence were compared with known sequences of orthologous genes from other deuterostome species together with a study of their identity/similarity. PMID:27294183

  15. Antibiotic, cytotoxic and enzyme inhibitory activity of crude extracts from Brazilian marine invertebrates Atividade antibiótica, citotóxica e de inibição enzimática de extratos brutos de invertebrados marinhos do Brasil

    Directory of Open Access Journals (Sweden)

    Mirna H. R. Seleghim


    Full Text Available Herein we present the results of a screening with 349 crude extracts of Brazilian marine sponges, ascidians, bryozoans and octocorals, against 16 strains of susceptible and antibiotic-resistant bacteria, one yeast (Candida albicans, Mycobacterium tuberculosis H37Rv, three cancer cell lines MCF-7 (breast, B16 (murine melanoma and HCT8 (colon, and Leishmania tarentolae adenine phosphoribosyl transferase (L-APRT enzyme. Less than 15% of marine sponge crude extracts displayed antibacterial activity, both against susceptible and antibiotic-resistant bacteria. Up to 40% of marine sponge crude extracts displayed antimycobacterial activity against M. tuberculosis H37Rv. Cytotoxicity was observed for 18% of marine sponge crude extracts. Finally, less than 3% of sponge extracts inhibited L-APRT. Less than 10% of ascidian crude extracts displayed antibacterial activity. More than 25% of ascidian crude extracts were active against M. tuberculosis and the three cancer cell lines. Only two crude extracts from the ascidian Polysyncraton sp. collected in different seasons (1995 and 1997 displayed activity against L-APRT. Less than 2% of bryozoan and octocoral crude extracts presented antibacterial activity, but a high percentage of crude extracts from bryozoan and octororal displayed cytotoxic (11% and 30%, respectively and antimycobacterial (60% activities. The extract of only one species of bryozoan, Bugula sp., presented inhibitory activity against L-APRT. Overall, the crude extracts of marine invertebrates herein investigated presented a high level of cytotoxic and antimycobacterial activities, a lower level of antibacterial activity and only a small number of crude extracts inhibited L-APRT. Taxonomic analysis of some of the more potently active crude extracts showed the occurrence of biological activity in taxa that have been previously chemically investigated. These include marine sponges belonging to genera Aaptos, Aplysina, Callyspongia, Haliclona

  16. Evolution and origin of merlin, the product of the Neurofibromatosis type 2 (NF2 tumor-suppressor gene

    Directory of Open Access Journals (Sweden)

    Omelyanchuk Leonid V


    Full Text Available Abstract Background Merlin, the product of the Neurofibromatosis type 2 (NF2 tumor suppressor gene, belongs to the ezrin-radixin-moesin (ERM subgroup of the protein 4.1 superfamily, which links cell surface glycoproteins to the actin cytoskeleton. While merlin's functional activity has been examined in mammalian and Drosophila models, little is understood about its evolution, diversity, and overall distribution among different taxa. Results By combining bioinformatic and phylogenetic approaches, we demonstrate that merlin homologs are present across a wide range of metazoan lineages. While the phylogenetic tree shows a monophyletic origin of the ERM family, the origin of the merlin proteins is robustly separated from that of the ERM proteins. The derivation of merlin is thought to be in early metazoa. We have also observed the expansion of the ERM-like proteins within the vertebrate clade, which occurred after its separation from Urochordata (Ciona intestinalis. Amino acid sequence alignment reveals the absence of an actin-binding site in the C-terminal region of all merlin proteins from various species but the presence of a conserved internal binding site in the N-terminal domain of the merlin and ERM proteins. In addition, a more conserved pattern of amino acid residues is found in the region containing the so-called "Blue Box," although some amino acid substitutions in this region exist in the merlin sequences of worms, fish, and Ciona. Examination of sequence variability at functionally significant sites, including the serine-518 residue, the phosphorylation of which modulates merlin's intra-molecular association and function as a tumor suppressor, identifies several potentially important sites that are conserved among all merlin proteins but divergent in the ERM proteins. Secondary structure prediction reveals the presence of a conserved α-helical domain in the central to C-terminal region of the merlin proteins of various species. The

  17. The Foraging Ecology of the Endangered Cape Verde Shearwater, a Sentinel Species for Marine Conservation off West Africa.

    Directory of Open Access Journals (Sweden)

    Vitor H Paiva

    Full Text Available Large Marine Ecosystems such as the Canary Current system off West Africa sustains high abundance of small pelagic prey, which attracts marine predators. Seabirds are top predators often used as biodiversity surrogates and sentinel species of the marine ecosystem health, thus frequently informing marine conservation planning. This study presents the first data on the spatial (GPS-loggers and trophic (stable isotope analysis ecology of a tropical seabird-the endangered Cape Verde shearwater Calonectris edwardsii-during both the incubation and the chick-rearing periods of two consecutive years. This information was related with marine environmental predictors (species distribution models, existent areas of conservation concern for seabirds (i.e. marine Important Bird Areas; marine IBAs and threats to the marine environment in the West African areas heavily used by the shearwaters. There was an apparent inter-annual consistency on the spatial, foraging and trophic ecology of Cape Verde shearwater, but a strong alteration on the foraging strategies of adult breeders among breeding phases (i.e. from incubation to chick-rearing. During incubation, birds mostly targeted a discrete region off West Africa, known by its enhanced productivity profile and thus also highly exploited by international industrial fishery fleets. When chick-rearing, adults exploited the comparatively less productive tropical environment within the islands of Cape Verde, at relatively close distance from their breeding colony. The species enlarged its trophic niche and increased the trophic level of their prey from incubation to chick-rearing, likely to provision their chicks with a more diversified and better quality diet. There was a high overlap between the Cape Verde shearwaters foraging areas with those of European shearwater species that overwinter in this area and known areas of megafauna bycatch off West Africa, but very little overlap with existing Marine Important Bird

  18. Biofouling community pattern on various metallic surfaces in the coastal waters of Kalpakkam, Southwestern Bay of Bengal

    International Nuclear Information System (INIS)

    . 100 cm-2. The major fouling organisms such as, barnacle, green mussel and ascidian constituted ∼ 70-80% of the total fouling. In the present study, sequence of fouling succession was as follows, barnacle - hydroid - sea anemone - ascidian and finally green mussel (Perna viridis Linn. 1758). The paper also discusses species diversity indices (diversity, richness and evenness) in detail. (author)

  19. Phenotypic rescue of a Drosophila model of mitochondrial ANT1 disease

    Directory of Open Access Journals (Sweden)

    Suvi Vartiainen


    Full Text Available A point mutation in the Drosophila gene that codes for the major adult isoform of adenine nuclear translocase (ANT represents a model for human diseases that are associated with ANT insufficiency [stress-sensitive B1 (sesB1]. We characterized the organismal, bioenergetic and molecular phenotype of sesB1 flies then tested strategies to compensate the mutant phenotype. In addition to developmental delay and mechanical-stress-induced seizures, sesB1 flies have an impaired response to sound, defective male courtship, female sterility and curtailed lifespan. These phenotypes, excluding the latter two, are shared with the mitoribosomal protein S12 mutant, tko25t. Mitochondria from sesB1 adults showed a decreased respiratory control ratio and downregulation of cytochrome oxidase. sesB1 adults exhibited ATP depletion, lactate accumulation and changes in gene expression that were consistent with a metabolic shift towards glycolysis, characterized by activation of lactate dehydrogenase and anaplerotic pathways. Females also showed downregulation of many genes that are required for oogenesis, and their eggs, although fertilized, failed to develop to the larval stages. The sesB1 phenotypes of developmental delay and mechanical-stress-induced seizures were alleviated by an altered mitochondrial DNA background. Female sterility was substantially rescued by somatic expression of alternative oxidase (AOX from the sea squirt Ciona intestinalis, whereas AOX did not alleviate developmental delay. Our findings illustrate the potential of different therapeutic strategies for ANT-linked diseases, based on alleviating metabolic stress.

  20. Phenotypic rescue of a Drosophila model of mitochondrial ANT1 disease. (United States)

    Vartiainen, Suvi; Chen, Shanjun; George, Jack; Tuomela, Tea; Luoto, Kaisa R; O'Dell, Kevin M C; Jacobs, Howard T


    A point mutation in the Drosophila gene that codes for the major adult isoform of adenine nuclear translocase (ANT) represents a model for human diseases that are associated with ANT insufficiency [stress-sensitive B(1) (sesB(1))]. We characterized the organismal, bioenergetic and molecular phenotype of sesB(1) flies then tested strategies to compensate the mutant phenotype. In addition to developmental delay and mechanical-stress-induced seizures, sesB(1) flies have an impaired response to sound, defective male courtship, female sterility and curtailed lifespan. These phenotypes, excluding the latter two, are shared with the mitoribosomal protein S12 mutant, tko(25t). Mitochondria from sesB(1) adults showed a decreased respiratory control ratio and downregulation of cytochrome oxidase. sesB(1) adults exhibited ATP depletion, lactate accumulation and changes in gene expression that were consistent with a metabolic shift towards glycolysis, characterized by activation of lactate dehydrogenase and anaplerotic pathways. Females also showed downregulation of many genes that are required for oogenesis, and their eggs, although fertilized, failed to develop to the larval stages. The sesB(1) phenotypes of developmental delay and mechanical-stress-induced seizures were alleviated by an altered mitochondrial DNA background. Female sterility was substantially rescued by somatic expression of alternative oxidase (AOX) from the sea squirt Ciona intestinalis, whereas AOX did not alleviate developmental delay. Our findings illustrate the potential of different therapeutic strategies for ANT-linked diseases, based on alleviating metabolic stress. PMID:24812436

  1. The use of food grade oil in the prevention of vase tunicate fouling on mussel aquaculture gear

    Directory of Open Access Journals (Sweden)

    Jiselle A. BAKKER


    Full Text Available Current mitigation strategies against invasive tunicates on mussel aquaculture gear in Prince Edward Island concentrate on labour-intensive and costly fouling removal. Instead of removal, this study focused on preventing the settlement of the vase tunicate Ciona intestinalis and other fouling organisms by applying a layer of food grade oil to gear prior to recruitment. Laboratory tests established the adherence and persistence of shortening, a food grade oil with a melting point exceeding ambient water temperatures, to rope and mussels. In situ tests showed that shortening decreased C. intestinalis weight and abundance on buoys, spat collector ropes and collector plates but not on mussel socks. Fouling by algae and other tunicates was significantly reduced on most substrates. There were no detrimental effects of shortening treatment on mussel length and abundance on mussel socks, but total mussel weight was significantly lower on shortening-treated socks. Shortening treatment did not significantly affect mussel spat settlement on spat collector ropes, but further evaluation is required. Overall, shortening application has considerable potential for reducing tunicate and other fouling, particularly on buoys.

  2. Functional evolution of ADAMTS genes: Evidence from analyses of phylogeny and gene organization

    Directory of Open Access Journals (Sweden)

    Van Meir Erwin G


    Full Text Available Abstract Background The ADAMTS (A Disintegrin-like and Metalloprotease with Thrombospondin motifs proteins are a family of metalloproteases with sequence similarity to the ADAM proteases, that contain the thrombospondin type 1 sequence repeat motifs (TSRs common to extracellular matrix proteins. ADAMTS proteins have recently gained attention with the discovery of their role in a variety of diseases, including tissue and blood disorders, cancer, osteoarthritis, Alzheimer's and the genetic syndromes Weill-Marchesani syndrome (ADAMTS10, thrombotic thrombocytopenic purpura (ADAMTS13, and Ehlers-Danlos syndrome type VIIC (ADAMTS2 in humans and belted white-spotting mutation in mice (ADAMTS20. Results Phylogenetic analysis and comparison of the exon/intron organization of vertebrate (Homo, Mus, Fugu, chordate (Ciona and invertebrate (Drosophila and Caenorhabditis ADAMTS homologs has elucidated the evolutionary relationships of this important gene family, which comprises 19 members in humans. Conclusions The evolutionary history of ADAMTS genes in vertebrate genomes has been marked by rampant gene duplication, including a retrotransposition that gave rise to a distinct ADAMTS subfamily (ADAMTS1, -4, -5, -8, -15 that may have distinct aggrecanase and angiogenesis functions.

  3. A conserved non-reproductive GnRH system in chordates.

    Directory of Open Access Journals (Sweden)

    Takehiro G Kusakabe

    Full Text Available Gonadotropin-releasing hormone (GnRH is a neuroendocrine peptide that plays a central role in the vertebrate hypothalamo-pituitary axis. The roles of GnRH in the control of vertebrate reproductive functions have been established, while its non-reproductive function has been suggested but less well understood. Here we show that the tunicate Ciona intestinalis has in its non-reproductive larval stage a prominent GnRH system spanning the entire length of the nervous system. Tunicate GnRH receptors are phylogenetically closest to vertebrate GnRH receptors, yet functional analysis of the receptors revealed that these simple chordates have evolved a unique GnRH system with multiple ligands and receptor heterodimerization enabling complex regulation. One of the gnrh genes is conspicuously expressed in the motor ganglion and nerve cord, which are homologous structures to the hindbrain and spinal cord of vertebrates. Correspondingly, GnRH receptor genes were found to be expressed in the tail muscle and notochord of embryos, both of which are phylotypic axial structures along the nerve cord. Our findings suggest a novel non-reproductive role of GnRH in tunicates. Furthermore, we present evidence that GnRH-producing cells are present in the hindbrain and spinal cord of the medaka, Oryzias latipes, thereby suggesting the deep evolutionary origin of a non-reproductive GnRH system in chordates.

  4. Phylogenetic relationships of the Fox (Forkhead) gene family in the Bilateria (United States)

    Mazet, Francoise; Yu, Jr Kai; Liberles, David A.; Holland, Linda Z.; Shimeld, Sebastian M.


    The Forkhead or Fox gene family encodes putative transcription factors. There are at least four Fox genes in yeast, 16 in Drosophila melanogaster (Dm) and 42 in humans. Recently, vertebrate Fox genes have been classified into 17 groups named FoxA to FoxQ. Here, we extend this analysis to invertebrates, using available sequences from D. melanogaster, Anopheles gambiae (Ag), Caenorhabditis elegans (Ce), the sea squirt Ciona intestinalis (Ci) and amphioxus Branchiostoma floridae (Bf), from which we also cloned several Fox genes. Phylogenetic analyses lend support to the previous overall subclassification of vertebrate genes, but suggest that four subclasses (FoxJ, L, N and Q) could be further subdivided to reflect their relationships to invertebrate genes. We were unable to identify orthologs of Fox subclasses E, H, I, J, M and Q1 in D. melanogaster, A. gambiae or C. elegans, suggesting either considerable loss in ecdysozoans or the evolution of these subclasses in the deuterostome lineage. Our analyses suggest that the common ancestor of protostomes and deuterostomes had a minimum complement of 14 Fox genes.

  5. Intra-species sequence comparisons for annotating genomes

    Energy Technology Data Exchange (ETDEWEB)

    Boffelli, Dario; Weer, Claire V.; Weng, Li; Lewis, Keith D.; Shoukry, Malak I.; Pachter, Lior; Keys, David N.; Rubin, Edward M.


    Analysis of sequence variation among members of a single species offers a potential approach to identify functional DNA elements responsible for biological features unique to that species. Due to its high rate of allelic polymorphism and ease of genetic manipulability, we chose the sea squirt, Ciona intestinalis, to explore intra-species sequence comparisons for genome annotation. A large number of C. intestinalis specimens were collected from four continents and a set of genomic intervals amplified, resequenced and analyzed to determine the mutation rates at each nucleotide in the sequence. We found that regions with low mutation rates efficiently demarcated functionally constrained sequences: these include a set of noncoding elements, which we showed in C intestinalis transgenic assays to act as tissue-specific enhancers, as well as the location of coding sequences. This illustrates that comparisons of multiple members of a species can be used for genome annotation, suggesting a path for the annotation of the sequenced genomes of organisms occupying uncharacterized phylogenetic branches of the animal kingdom and raises the possibility that the resequencing of a large number of Homo sapiens individuals might be used to annotate the human genome and identify sequences defining traits unique to our species. The sequence data from this study has been submitted to GenBank under accession nos. AY667278-AY667407.

  6. Larval rearing, metamorphosis, growth and reproduction of the eolid nudibranch hermissenda crassicornis (eschscholtz, 1831) (gastropoda: opisthobranchia). (United States)

    Harrigan, J F; Alkon, D L


    1. Hermissenda crassicornis is a subannual nudibranch species that reproduces year-round. 2. There is a significant positive relationship between adult weight, diameter of the egg mass, estimated number of eggs per egg mass, and average number of eggs per capsule. 3. There is a planktonic veliger stage of 34 days minimum at 13 degrees -15 degrees C. 4. Larvae metamorphose on at least three species of hydroids. 5. To develop in reasonable numbers to a state competent to metamorphose veligers require a diet that includes phytoplankton of larger cell size (10-11 microm) than the commonly used Isochrysis and Monochrysis (5 microm). 6. Although Hermissenda feeds on a wide variety of sessile invertebrate species in the ocean, a diet of tunicate alone (Ciona intestinalis) promotes good growth and survival in the laboratory. 7. Egg mass deposition is initiated only after first copulation, except in the last month of life, and continues from about one-month post-metamorphosis to death, at about four months post-metamorphosis. Generation time (egg-to-egg) may be as short as 2.5 months. 8. A laboratory strain of Hermissenda is being established to provide animals of known history for research on the neural correlates of behavior. Animals, at least initially, are being selected for fast growth rate. PMID:20693369

  7. Detection of marine microalgal biotoxins using bioassays based on functional expression of tunicate xenobiotic receptors in yeast. (United States)

    Richter, Ingrid; Fidler, Andrew E


    Marine microalgae can produce biotoxins that cause widespread poisoning in marine ecosystems and may also affect human health. While established microalgal biotoxins are detectable using chemical methods, a need remains for robust, inexpensive bioassays. Ligand-binding domains (LBDs) from a tunicate nuclear receptor, VDR/PXRα, which is orthologous to both the vertebrate pregnane X receptor (PXR) and the vitamin D receptor (VDR), can be activated by microalgal biotoxins when expressed in mammalian cell lines. Building on this observation, we developed a generic recombinant yeast bioassay platform that expresses chimeric proteins containing tunicate VDR/PXRα LBDs which mediate ligand-dependent transcription of a reporter gene (lacZ) encoding an easily assayed enzyme (β-galactosidase). Recombinant yeast strains expressing VDR/PXRα LBDs from two tunicate species, Ciona intestinalis and Botryllus schlosseri, were exposed to both synthetic and natural toxins. Structurally simple synthetic chemicals (n-butyl-p-aminobenzoate, carbamazepine, p-aminobenzoic acid, and bisphenol-A) generated EC50 values in the μM range, while more structurally complex marine biotoxins (okadaic acid, pectenotoxin-11, and portimine) activated the assays in the nM range. Given the large number of tunicate species, we propose that tunicate VDR/PXR LBDs may be used as 'sensor elements' in similar yeast-based high-throughput bioassays for detection of established microalgal biotoxins and uncharacterised marine bioactive compounds. PMID:25549942

  8. Expression of the alternative oxidase mitigates beta-amyloid production and toxicity in model systems. (United States)

    El-Khoury, Riyad; Kaulio, Eveliina; Lassila, Katariina A; Crowther, Damian C; Jacobs, Howard T; Rustin, Pierre


    Mitochondrial dysfunction has been widely associated with the pathology of Alzheimer's disease, but there is no consensus on whether it is a cause or consequence of disease, nor on the precise mechanism(s). We addressed these issues by testing the effects of expressing the alternative oxidase AOX from Ciona intestinalis, in different models of AD pathology. AOX can restore respiratory electron flow when the cytochrome segment of the mitochondrial respiratory chain is inhibited, supporting ATP synthesis, maintaining cellular redox homeostasis and mitigating excess superoxide production at respiratory complexes I and III. In human HEK293-derived cells, AOX expression decreased the production of beta-amyloid peptide resulting from antimycin inhibition of respiratory complex III. Because hydrogen peroxide was neither a direct product nor substrate of AOX, the ability of AOX to mimic antioxidants in this assay must be indirect. In addition, AOX expression was able to partially alleviate the short lifespan of Drosophila models neuronally expressing human beta-amyloid peptides, whilst abrogating the induction of markers of oxidative stress. Our findings support the idea of respiratory chain dysfunction and excess ROS production as both an early step and as a pathologically meaningful target in Alzheimer's disease pathogenesis, supporting the concept of a mitochondrial vicious cycle underlying the disease. PMID:27094492

  9. Metaphylogeny of 82 gene families sheds a new light on chordate evolution

    Directory of Open Access Journals (Sweden)


    Full Text Available Achieving a better comprehension of the evolution of species has always been an important matter for evolutionary biologists. The deuterostome phylogeny has been described for many years, and three phyla are distinguishable: Echinodermata (including sea stars, sea urchins, etc…, Hemichordata (including acorn worms and pterobranchs, and Chordata (including urochordates, cephalochordates and extant vertebrates. Inside the Chordata phylum, the position of vertebrate species is quite unanimously accepted. Nonetheless, the position of urochordates in regard with vertebrates is still the subject of debate, and has even been suggested by some authors to be a separate phylum from cephalochordates and vertebrates. It was also the case for agnathans species –myxines and hagfish– for which phylogenetic evidence was recently given for a controversial monophyly. This raises the following question: which one of the cephalochordata or urochordata is the sister group of vertebrates and what are their relationships? In the present work, we analyzed 82 protein families presenting homologs between urochordata and other deuterostomes and focused on two points: 1 testing accurately the position of urochordata and cephalochordata phyla in regard with vertebrates as well as chordates monophyly, 2 performing an estimation of the rate of gene loss in the Ciona intestinalis genome. We showed that the urochordate phyla is the vertebrate sister group and that gene loss played a major role in structuring the urochordate genome.

  10. 黄河口海域无脊椎动物群落结构及其变化%Community structure of invertebrate and its change in Huanghe (Yellow River) Estuary

    Institute of Scientific and Technical Information of China (English)

    张焕君; 李凡; 丛日翔; 丛旭日; 任中华; 吕振波


    根据2012年5月、6月、7月上旬、7月下旬、8月、9月在黄河口海域进行的3断面15站位弓子网调查数据,对该海域无脊椎动物群落组成、优势种、生物量、多样性、群落相似性等群落特征进行了研究。结果表明,调查共出现无脊椎动物45种,隶属于9目29科39属,各航次调查种类数在28种至35种之间。纵肋织纹螺(Nassarius variciferus)、口虾蛄(Oratosquilla oratoria)、艾氏活额寄居蟹(Diogenes edwardsii)、葛氏长臂虾(Palaemon gravieri)和扁玉螺(Neverita didyma)是黄河口无脊椎动物群落的主要优势种。调查期间生物量和丰度的变化趋势基本相似,均呈现下降-上升-下降的趋势,生物量最高值出现在8月,丰度最高值出现在7月下旬。各航次调查Shannon-Wiener多样性在1.482~1.719,5月最低,6月最高。Bray-Curtis相似性和ANOSIM相似性分析表明相近航次间群落相似性较高,5月、6月群落与8月、9月群落差异显著。根据研究结果,可以得出以下结论:1)黄河口无脊椎动物群落以小型、低质种类为主,与20世纪80年代相比,资源质量进一步下降;2)与20世纪80年代相比,生物量月间分布发生明显变化;3)与断面A(距河口10 km)、断面C(距河口40 km)相比,断面B(距河口20 km)无脊椎动物生物量和多样性在各航次间波动剧烈且规律性较差,表明断面 B 的无脊椎动物群落受黄河水沙输入影响更大;4)调水调沙虽对黄河口无脊椎动物群落结构产生一定程度的影响,但不是导致无脊椎动物群落更替的主要因素。%The Yellow River is the largest river in north China which greatly affects the environment of Bohai Sea. The freshwater input and suspended sediments have sustained the morphology and ecology of the river mouth, located in the northeastern modern Yellow River subaerial delta and was formed after the Yellow River shifted again at the north bank of the Qingshuigou course in June

  11. An epizootic of Florida manatees associated with a dinoflagellate bloom (United States)

    O'Shea, T.J.; Rathbun, G.B.; Bonde, R.K.; Buergelt, C.D.; Odell, D.K.


    Over a 10-wk period in early 1982, 39 Florida manatees (Trichechus manatus latirostris) were found dead in the lower Caloosahatchee River and nearby waters of southwestern Florida. Two were killed by boats. The remainder showed no evidence of trauma. Lesions indicative of infectious agents were not identified, and bacteriological and contaminant residue findings were unremarkable. Nonspecific lesions of congestion and hemorrhage were identified in brain tissue. Numerous reports were also received of manatee morbidity. Some distressed manatees showed no biochemical lesions in clinical analyses of blood samples and recovered quickly. Timing of manatee illnesses coincided with fish and double-crested cormorant (Phalacrocorax auritus) mortality and morbidity. A widespread bloom of the dinoflagellate red tide organism (Gymnodinium breve) also coincided with these incidents. G. breve produces potent neurotoxins (brevetoxins). Circumstantial evidence links these events, and possible routes of exposure may include ingestion of filter-feeding ascidians. Ecological conditions that magnified the extent of the epizootic included an early dispersal of manatees into the area from a nearby winter aggregation site and unusually high salinities that facilitated the inshore spread of the red tide bloom. Management responses to future episodes of red tide in manatee areas are suggested.

  12. Observations on the morphology of embryonic and larval development in Styela canopus Savigny

    Institute of Scientific and Technical Information of China (English)

    Huang Ying; Ke Caihuan; Feng Danqing; Zhou Shiqiang; Li Fuxue


    The morphological characters on different developmental phases of embryo and larva and the schedule of the whole early developmental process in Styela canopus were observed and described.The types of reproduction and early development as well as the morphology of egg and larva in different ascidian species were compared. Styela canopus is oviparous. Its egg, 230.4~336.0 μm in diameter, is equipped with extraembryonic cell layers measured 43.2~ 63.0 μm thick. The early development of Styela canopus is typical urodele development, including fertilization, cleavage, gastrulation, tadpole in membrane, tadpole, initiating metamorphosis and juvenile. The tadpole of Styela canopus, with a length of 0.6~0.9 mm, consists of trunk and tail. There are obvious notochord, ocellus and adhesive papillae in the tadpole. Under the water temperature of (25 ± 0.5)℃ and the salinity of 27.0, the larva was hatched after 9.5~ 11.0 h since the fertilization.

  13. Cryptic species and genetic structure in Didemnum granulatum Tokioka, 1954 (Tunicata: Ascidiacea) from the southern Brazilian coast. (United States)

    Bouzon, J L; Vargas, S M; Oliveira Neto, J F; Stoco, P H; Brandini, F P


    Didemnum granulatum is a colonial fouling ascidian that lives in subtidal substrates, worldwide. It exhibits two morphotypes, orange and beige. In this study, we verified if the color morphotypes and/or the spatial distribution of specimens in different islands might be associated to patterns of genetic structure of a single species, or if they represent distinct cryptic species. Specimens were collected in four islands, along the coast of the Santa Catarina state. A segment of 490 bp from the mitochondrial gene cytochrome c oxidase subunit 1 (COI) was amplified from 45 samples. Twenty-one haplotypes were identified. The total haplotype diversity (0.912) and the total nucleotide diversity (0.044) were high. The global Fst of the populations analyzed was 0.97, with most of the variation occurring between orange and beige groups (82.19%). The variation found between populations within groups was 15.37%, and 2.45% within populations. Haplotype networks and the neighbor-joining tree showed clear genetic divergence between individuals of distinct colors, and between the islands. These evidences strongly support the presence of a complex of two cryptic species for D. granulatum occupying the studied area. Both species were also highly genetically structured between islands, suggesting that the conservation process of these populations is complex. PMID:25627604

  14. The cult of amphioxus in German Darwinism; or, our gelatinous ancestors in Naples' blue and balmy bay. (United States)

    Hopwood, Nick


    Biologists having rediscovered amphioxus, also known as the lancelet or Branchiostoma, it is time to reassess its place in early Darwinist debates over vertebrate origins. While the advent of the ascidian-amphioxus theory and challenges from various competitors have been, documented, this article offers a richer account of the public appeal of amphioxus as a primitive ancestor. The focus is on how the 'German Darwin' Ernst Haeckel persuaded general magazine and newspaper readers to revere this "flesh of our flesh and blood of our blood", and especially on Das neue Laienbrevier des Haeckelismus (The new lay breviary of Haeckelism) by Moritz Reymond with cartoons by Fritz Steub. From the late 1870s these successful little books of verse introduced the Neapolitan discoveries that made the animal's name and satirized Haeckel's rise as high priest of its cult. One song is reproduced and translated here, with a contemporary "imitation" by the Canadian palaeontologist Edward John Chapman, and extracts from others. Predating the American "It's a long way from amphioxus" by decades, these rhymes dramatize neglected 'species politics' of Darwinism and highlight the roles of humour in negotiating evolution. PMID:26013195

  15. Polarization of PI3K Activity Initiated by Ooplasmic Segregation Guides Nuclear Migration in the Mesendoderm. (United States)

    Takatori, Naohito; Oonuma, Kouhei; Nishida, Hiroki; Saiga, Hidetoshi


    Asymmetric localization of RNA is a widely observed mechanism of cell polarization. Using embryos of the ascidian, Halocynthia roretzi, we previously showed that mesoderm and endoderm fates are separated by localization of mRNA encoding a transcription factor, Not, to the future mesoderm-side cytoplasm of the mesendoderm cell through asymmetric positioning of the nucleus. Here, we investigated the mechanism that defines the direction of the nuclear migration. We show that localization of PtdIns(3,4,5)P3 to the future mesoderm region determines the direction of nuclear migration. Localization of PtdIns(3,4,5)P3 was dependent on the localization of PI3Kα to the future mesoderm region. PI3Kα was first localized at the 1-cell stage by the ooplasmic movement. Activity of localized PI3Kα at the 4-cell stage was required for the localization of PI3Kα up to the nuclear migration. Our results provide the scaffold for understanding the chain of causality leading to the separation of germ layer fates. PMID:26555053

  16. NMR structural determination of unique invertebrate glycosaminoglycans endowed with medical properties. (United States)

    Pomin, Vitor H


    Glycosaminoglycans (GAGs) are sulfated polysaccharides of complex structure endowed with numerous biomedical functions. Although ubiquitously distributed in vertebrates, GAGs can also occur in certain terrestrial or marine invertebrates. Solution nuclear magnetic resonance (NMR) spectroscopy has been the analytical technique mostly employed in structural characterization of GAGs from any source. This review aims at illustrating the application of NMR in structural determination of few representative invertebrate GAG examples of unique structures and endowed with therapeutic actions. They are the holothurian fucosylated chondroitin sulfate, the acharan sulfate isolated from the snail Achatina fulica, the dermatan sulfates with distinct sulfation patterns extracted from ascidian species, the sulfated glucuronic acid-containing heparan sulfate isolated from the gastropode Nodipecten nodosum, and the hybrid heparin/heparan sulfate molecule obtained from the shrimp Litopenaeus vannamei. These invertebrate GAGs exhibit distinct structures when compared to those extracted from mammalian GAGs. The distinct structures of the invertebrate GAGs lead also to different mechanisms of actions as compared to the mammalian GAG standards. Invertebrate GAGs comprise promising therapeutic candidates in fights against diseases. Solution NMR has been playing a pivotal role in this carbohydrate-based drug research, discovery and development. PMID:26083200

  17. A protein involved in the assembly of an extracellular calcium storage matrix. (United States)

    Glazer, Lilah; Shechter, Assaf; Tom, Moshe; Yudkovski, Yana; Weil, Simy; Aflalo, Eliahu David; Pamuru, Ramachandra Reddy; Khalaila, Isam; Bentov, Shmuel; Berman, Amir; Sagi, Amir


    Gastroliths, the calcium storage organs of crustaceans, consist of chitin-protein-mineral complexes in which the mineral component is stabilized amorphous calcium carbonate. To date, only three proteins, GAP 65, gastrolith matrix protein (GAMP), and orchestin, have been identified in gastroliths. Here, we report a novel protein, GAP 10, isolated from the gastrolith of the crayfish Cherax quadricarinatus and specifically expressed in its gastrolith disc. The encoding gene was cloned by partial sequencing of the protein extracted from the gastrolith matrix. Based on an assembled microarray cDNA chip, GAP 10 transcripts were found to be highly (12-fold) up-regulated in premolt gastrolith disc and significantly down-regulated in the hypodermis at the same molt stage. The deduced protein sequence of GAP 10 lacks chitin-binding domains and does not show homology to known proteins in the GenBank data base. It does, however, have an amino acid composition that has similarity to proteins extracted from invertebrate and ascidian-calcified extracellular matrices. The GAP 10 sequence contains a predicted signal peptide and predicted phosphorylation sites. In addition, the protein is phosphorylated and exhibits calcium-binding ability. Repeated daily injections of GAP 10 double strand RNA to premolt C. quadricarinatus resulted in a prolonged premolt stage and in the development of gastroliths with irregularly rough surfaces. These findings suggest that GAP 10 may be involved in the assembly of the gastrolith chitin-protein-mineral complex, particularly in the deposition of amorphous calcium carbonate. PMID:20150428

  18. Physical association between a novel plasma-membrane structure and centrosome orients cell division (United States)

    Negishi, Takefumi; Miyazaki, Naoyuki; Murata, Kazuyoshi; Yasuo, Hitoyoshi; Ueno, Naoto


    In the last mitotic division of the epidermal lineage in the ascidian embryo, the cells divide stereotypically along the anterior-posterior axis. During interphase, we found that a unique membrane structure invaginates from the posterior to the centre of the cell, in a microtubule-dependent manner. The invagination projects toward centrioles on the apical side of the nucleus and associates with one of them. Further, a cilium forms on the posterior side of the cell and its basal body remains associated with the invagination. A laser ablation experiment suggests that the invagination is under tensile force and promotes the posterior positioning of the centrosome. Finally, we showed that the orientation of the invaginations is coupled with the polarized dynamics of centrosome movements and the orientation of cell division. Based on these findings, we propose a model whereby this novel membrane structure orchestrates centrosome positioning and thus the orientation of cell division axis. DOI: PMID:27502556

  19. Macrofauna associated to Mycale microsigmatosa (Porifera, Demospongiae) in Rio de Janeiro State, SE Brazil (United States)

    Ribeiro, Suzi M.; Omena, Elianne P.; Muricy, Guilherme


    The macrofauna (endo- and epi-biotic) associated to the sponge Mycale ( Carmia) microsigmatosa Arndt, 1927 was studied at three sites in Rio de Janeiro State, Brazil (Arraial do Cabo, Niterói, and Rio de Janeiro). A total of 2235 individuals (over 1 mm long) of 75 invertebrate species were found associated to 19 specimens of the sponge. The most abundant and diverse taxa were the crustaceans (83%, 31 spp.), polychetes (10%, 18 spp.), and molluscs (3.7%, 15 spp.). Cnidarians, platyhelminthes, ascidians, echinoderms, pycnogonids, bryozoans, and sponges were also represented. Amphipod crustaceans were the dominant group, comprising 61% of all individuals collected. Species richness and abundance of associated fauna were highly correlated with sponge volume, but diversity and evenness were not. The site of collection influenced the species composition of the fauna associated to M. microsigmatosa but did not change significantly its diversity, abundance, richness, and dominance patterns of higher taxa. Pregnant females and juvenile stages of 29% of the species associated, including crustaceans, molluscs, echinoderms, and pycnogonids were frequently found inside M. microsigmatosa. Although many of these organisms do occur and reproduce in other habitats outside the sponge as well, M. microsigmatosa is also important for their reproduction and survivorship, thus contributing for the maintenance of biodiversity in Southwestern Atlantic sublittoral rocky shores.

  20. Characteristics of the Mesophotic Megabenthic Assemblages of the Vercelli Seamount (North Tyrrhenian Sea) (United States)

    Bo, Marzia; Bertolino, Marco; Borghini, Mireno; Castellano, Michela; Covazzi Harriague, Anabella; Di Camillo, Cristina Gioia; Gasparini, GianPietro; Misic, Cristina; Povero, Paolo; Pusceddu, Antonio; Schroeder, Katrin; Bavestrello, Giorgio


    The biodiversity of the megabenthic assemblages of the mesophotic zone of a Tyrrhenian seamount (Vercelli Seamount) is described using Remotely Operated Vehicle (ROV) video imaging from 100 m depth to the top of the mount around 61 m depth. This pinnacle hosts a rich coralligenous community characterized by three different assemblages: (i) the top shows a dense covering of the kelp Laminaria rodriguezii; (ii) the southern side biocoenosis is mainly dominated by the octocorals Paramuricea clavata and Eunicella cavolinii; while (iii) the northern side of the seamount assemblage is colonized by active filter-feeding organisms such as sponges (sometimes covering 100% of the surface) with numerous colonies of the ascidian Diazona violacea, and the polychaete Sabella pavonina. This study highlights, also for a Mediterranean seamount, the potential role of an isolated rocky peak penetrating the euphotic zone, to work as an aggregating structure, hosting abundant benthic communities dominated by suspension feeders, whose distribution may vary in accordance to the geomorphology of the area and the different local hydrodynamic conditions. PMID:21304906

  1. Acquisition of the dorsal structures in chordate amphioxus (United States)

    Morov, Arseniy R.; Ukizintambara, Tharcisse; Sabirov, Rushan M.


    Acquisition of dorsal structures, such as notochord and hollow nerve cord, is likely to have had a profound influence upon vertebrate evolution. Dorsal formation in chordate development thus has been intensively studied in vertebrates and ascidians. However, the present understanding does not explain how chordates acquired dorsal structures. Here we show that amphioxus retains a key clue to answer this question. In amphioxus embryos, maternal nodal mRNA distributes asymmetrically in accordance with the remodelling of the cortical cytoskeleton in the fertilized egg, and subsequently lefty is first expressed in a patch of blastomeres across the equator where wnt8 is expressed circularly and which will become the margin of the blastopore. The lefty domain co-expresses zygotic nodal by the initial gastrula stage on the one side of the blastopore margin and induces the expression of goosecoid, not-like, chordin and brachyury1 genes in this region, as in the oral ectoderm of sea urchin embryos, which provides a basis for the formation of the dorsal structures. The striking similarity in the gene regulations and their respective expression domains when comparing dorsal formation in amphioxus and the determination of the oral ectoderm in sea urchin embryos suggests that chordates derived from an ambulacrarian-type blastula with dorsoventral inversion. PMID:27307516

  2. Acquisition of the dorsal structures in chordate amphioxus. (United States)

    Morov, Arseniy R; Ukizintambara, Tharcisse; Sabirov, Rushan M; Yasui, Kinya


    Acquisition of dorsal structures, such as notochord and hollow nerve cord, is likely to have had a profound influence upon vertebrate evolution. Dorsal formation in chordate development thus has been intensively studied in vertebrates and ascidians. However, the present understanding does not explain how chordates acquired dorsal structures. Here we show that amphioxus retains a key clue to answer this question. In amphioxus embryos, maternal nodal mRNA distributes asymmetrically in accordance with the remodelling of the cortical cytoskeleton in the fertilized egg, and subsequently lefty is first expressed in a patch of blastomeres across the equator where wnt8 is expressed circularly and which will become the margin of the blastopore. The lefty domain co-expresses zygotic nodal by the initial gastrula stage on the one side of the blastopore margin and induces the expression of goosecoid, not-like, chordin and brachyury1 genes in this region, as in the oral ectoderm of sea urchin embryos, which provides a basis for the formation of the dorsal structures. The striking similarity in the gene regulations and their respective expression domains when comparing dorsal formation in amphioxus and the determination of the oral ectoderm in sea urchin embryos suggests that chordates derived from an ambulacrarian-type blastula with dorsoventral inversion. PMID:27307516

  3. Tunicates: exploring the sea shores and roaming the open ocean. A tribute to Thomas Huxley. (United States)

    Lemaire, Patrick; Piette, Jacques


    This review is a tribute to the remarkable contributions of Thomas Huxley to the biology of tunicates, the likely sister group of vertebrates. In 1851, the great biologist and philosopher published two landmark papers on pelagic tunicates in the Philosophical Transactions of the Royal Society. They were dedicated to the description of the adult anatomy and life cycle of thaliaceans and appendicularians, the pelagic relatives of ascidians. In the first part of this review, we discuss the novel anatomical observations and evolutionary hypotheses made by Huxley, which would have a lasting influence on tunicate biology. We also briefly comment on the more philosophical reflections of Huxley on individuality. In the second part, we stress the originality and relevance of past and future studies of tunicates in the resolution of major biological issues. In particular, we focus on the complex relationship between genotype and phenotype and the phenomenon of developmental system drift. We propose that more than 150 years after Huxley's papers, tunicate embryos are still worth studying in their own right, independently of their evolutionary proximity to vertebrates, as they provide original and crucial insights into the process of animal evolution. Tunicates are still at the forefront of biological research. PMID:26085517

  4. A non-oxo methanolate-bridged divanadium(IV) complex with tris(2-sulfanidylphenyl)phosphane ligands: synthesis, structural characterization and magnetic investigation. (United States)

    Wu, Hong Ming; Chang, Ya Ho; Su, Chia Lin; Lee, Gene Hsiang; Hsu, Hua Fen


    Vanadium chemistry is of interest due its biological relevance and medical applications. In particular, the interactions of high-valent vanadium ions with sulfur-containing biologically important molecules, such as cysteine and glutathione, might be related to the redox conversion of vanadium in ascidians, the function of amavadin (a vanadium-containing anion) and the antidiabetic behaviour of vanadium compounds. A mechanistic understanding of these aspects is important. In an effort to investigate high-valent vanadium-sulfur chemistry, we have synthesized and characterized the non-oxo divanadium(IV) complex salt tetraphenylphosphonium tri-μ-methanolato-κ(6)O:O-bis({tris[2-sulfanidyl-3-(trimethylsilyl)phenyl]phosphane-κ(4)P,S,S',S''}vanadium(IV)) methanol disolvate, (C24H20P)[V(IV)2(μ-OCH3)3(C27H36PS3)2]·2CH3OH. Two V(IV) metal centres are bridged by three methanolate ligands, giving a C2-symmetric V2(μ-OMe)3 core structure. Each V(IV) centre adopts a monocapped trigonal antiprismatic geometry, with the P atom situated in the capping position and the three S atoms and three O atoms forming two triangular faces of the trigonal antiprism. The magnetic data indicate a paramagnetic nature of the salt, with an S = 1 spin state. PMID:27146571

  5. Investigation of Indolglyoxamide and Indolacetamide Analogues of Polyamines as Antimalarial and Antitrypanosomal Agents

    Directory of Open Access Journals (Sweden)

    Jiayi Wang


    Full Text Available Pure compound screening has previously identified the indolglyoxy lamidospermidine ascidian metabolites didemnidine A and B (2 and 3 to be weak growth inhibitors of Trypanosoma brucei rhodesiense (IC50 59 and 44 μM, respectively and Plasmodium falciparum (K1 dual drug resistant strain (IC50 41 and 15 μM, respectively, but lacking in selectivity (L6 rat myoblast, IC50 24 μM and 25 μM, respectively. To expand the structure–activity relationship of this compound class towards both parasites, we have prepared and biologically tested a library of analogues that includes indoleglyoxyl and indoleacetic “capping acids”, and polyamines including spermine (PA3-4-3 and extended analogues PA3-8-3 and PA3-12-3. 7-Methoxy substituted indoleglyoxylamides were typically found to exhibit the most potent antimalarial activity (IC50 10–92 nM but with varying degrees of selectivity versus the L6 rat myoblast cell line. A 6-methoxyindolglyoxylamide analogue was the most potent growth inhibitor of T. brucei (IC50 0.18 μM identified in the study: it, however, also exhibited poor selectivity (L6 IC50 6.0 μM. There was no apparent correlation between antimalarial and anti-T. brucei activity in the series. In vivo evaluation of one analogue against Plasmodium berghei was undertaken, demonstrating a modest 20.9% reduction in parasitaemia.

  6. Structural shifts of aldehyde dehydrogenase enzymes were instrumental for the early evolution of retinoid-dependent axial patterning in metazoans. (United States)

    Sobreira, Tiago J P; Marlétaz, Ferdinand; Simões-Costa, Marcos; Schechtman, Deborah; Pereira, Alexandre C; Brunet, Frédéric; Sweeney, Sarah; Pani, Ariel; Aronowicz, Jochanan; Lowe, Christopher J; Davidson, Bradley; Laudet, Vincent; Bronner, Marianne; de Oliveira, Paulo S L; Schubert, Michael; Xavier-Neto, José


    Aldehyde dehydrogenases (ALDHs) catabolize toxic aldehydes and process the vitamin A-derived retinaldehyde into retinoic acid (RA), a small diffusible molecule and a pivotal chordate morphogen. In this study, we combine phylogenetic, structural, genomic, and developmental gene expression analyses to examine the evolutionary origins of ALDH substrate preference. Structural modeling reveals that processing of small aldehydes, such as acetaldehyde, by ALDH2, versus large aldehydes, including retinaldehyde, by ALDH1A is associated with small versus large substrate entry channels (SECs), respectively. Moreover, we show that metazoan ALDH1s and ALDH2s are members of a single ALDH1/2 clade and that during evolution, eukaryote ALDH1/2s often switched between large and small SECs after gene duplication, transforming constricted channels into wide opened ones and vice versa. Ancestral sequence reconstructions suggest that during the evolutionary emergence of RA signaling, the ancestral, narrow-channeled metazoan ALDH1/2 gave rise to large ALDH1 channels capable of accommodating bulky aldehydes, such as retinaldehyde, supporting the view that retinoid-dependent signaling arose from ancestral cellular detoxification mechanisms. Our analyses also indicate that, on a more restricted evolutionary scale, ALDH1 duplicates from invertebrate chordates (amphioxus and ascidian tunicates) underwent switches to smaller and narrower SECs. When combined with alterations in gene expression, these switches led to neofunctionalization from ALDH1-like roles in embryonic patterning to systemic, ALDH2-like roles, suggesting functional shifts from signaling to detoxification. PMID:21169504

  7. Structural shifts of aldehyde dehydrogenase enzymes were instrumental for the early evolution of retinoid-dependent axial patterning in metazoans (United States)

    Sobreira, Tiago J. P.; Marlétaz, Ferdinand; Simões-Costa, Marcos; Schechtman, Deborah; Pereira, Alexandre C.; Brunet, Frédéric; Sweeney, Sarah; Pani, Ariel; Aronowicz, Jochanan; Lowe, Christopher J.; Davidson, Bradley; Laudet, Vincent; Bronner, Marianne; de Oliveira, Paulo S. L.; Schubert, Michael; Xavier-Neto, José


    Aldehyde dehydrogenases (ALDHs) catabolize toxic aldehydes and process the vitamin A-derived retinaldehyde into retinoic acid (RA), a small diffusible molecule and a pivotal chordate morphogen. In this study, we combine phylogenetic, structural, genomic, and developmental gene expression analyses to examine the evolutionary origins of ALDH substrate preference. Structural modeling reveals that processing of small aldehydes, such as acetaldehyde, by ALDH2, versus large aldehydes, including retinaldehyde, by ALDH1A is associated with small versus large substrate entry channels (SECs), respectively. Moreover, we show that metazoan ALDH1s and ALDH2s are members of a single ALDH1/2 clade and that during evolution, eukaryote ALDH1/2s often switched between large and small SECs after gene duplication, transforming constricted channels into wide opened ones and vice versa. Ancestral sequence reconstructions suggest that during the evolutionary emergence of RA signaling, the ancestral, narrow-channeled metazoan ALDH1/2 gave rise to large ALDH1 channels capable of accommodating bulky aldehydes, such as retinaldehyde, supporting the view that retinoid-dependent signaling arose from ancestral cellular detoxification mechanisms. Our analyses also indicate that, on a more restricted evolutionary scale, ALDH1 duplicates from invertebrate chordates (amphioxus and ascidian tunicates) underwent switches to smaller and narrower SECs. When combined with alterations in gene expression, these switches led to neofunctionalization from ALDH1-like roles in embryonic patterning to systemic, ALDH2-like roles, suggesting functional shifts from signaling to detoxification. PMID:21169504

  8. Amyloid/Melanin distinctive mark in invertebrate immunity

    Directory of Open Access Journals (Sweden)

    A Grimaldi


    Full Text Available Protostomes and Deuterostomes show the same nexus between melanin production, and amyloid fibril production, i.e., the presence of melanin is indissolubly linked to amyloid scaffold that, in turn, is conditioned by the redox status/cytoplasmic pH modification, pro-protein cleavage presence, adrenocorticotropin hormone (ACTH, melanocyte-stimulating hormone (α-MSH, and neutral endopeptidase (NEP overexpressions. These events represent the crucial component of immune response in invertebrates, while in vertebrates these series of occurrences could be interpreted as a modest and very restricted innate immune response. On the whole, it emerges that the mechanisms involving amyloid fibrils/pigment synthesis in phylogenetically distant metazoan (viz, cnidaria, molluscs, annelids, insects, ascidians and vertebrates are evolutionary conserved. Furthermore, our data show the relationship between immune and neuroendocrine systems in amyloid/melanin synthesis. Indeed the process is closely associated to ACTH-α-MSH production, and their role in stress responses leading to pigment production reflects and confirms again their ancient phylogeny.

  9. Pyridinoacridine alkaloids of marine origin: NMR and MS spectral data, synthesis, biosynthesis and biological activity

    Directory of Open Access Journals (Sweden)

    Louis P. Sandjo


    Full Text Available This review focuses on pyridoacridine-related metabolites as one biologically interesting group of alkaloids identified from marine sources. They are produced by marine sponges, ascidians and tunicates, and they are structurally comprised of four to eight fused rings including heterocycles. Acridine, acridone, dihydroacridine, and quinolone cores are features regularly found in these alkaloid skeletons. The lack of hydrogen atoms next to quaternary carbon atoms for two or three rings makes the chemical shift assignment a difficult task. In this regard, one of the aims of this review is the compilation of previously reported, pyridoacridine 13C NMR data. Observations have been made on the delocalization of electrons and the presence of some functional groups that lead to changes in the chemical shift of some carbon resonances. The lack of mass spectra information for these alkaloids due to the compactness of their structures is further discussed. Moreover, the biosynthetic pathways of some of these metabolites have been shown since they could inspire biomimetic synthesis. The synthesis routes used to prepare members of these marine alkaloids (as well as their analogues, which are synthesized for biological purposes are also discussed. Pyridoacridines were found to have a large spectrum of bioactivity and this review highlights and compares the pharmacophores that are responsible for the observed bioactivity.

  10. Climate change and glacier retreat drive shifts in an Antarctic benthic ecosystem. (United States)

    Sahade, Ricardo; Lagger, Cristian; Torre, Luciana; Momo, Fernando; Monien, Patrick; Schloss, Irene; Barnes, David K A; Servetto, Natalia; Tarantelli, Soledad; Tatián, Marcos; Zamboni, Nadia; Abele, Doris


    The Antarctic Peninsula (AP) is one of the three places on Earth that registered the most intense warming in the last 50 years, almost five times the global mean. This warming has strongly affected the cryosphere, causing the largest ice-shelf collapses ever observed and the retreat of 87% of glaciers. Ecosystem responses, although increasingly predicted, have been mainly reported for pelagic systems. However, and despite most Antarctic species being benthic, responses in the Antarctic benthos have been detected in only a few species, and major effects at assemblage level are unknown. This is probably due to the scarcity of baselines against which to assess change. We performed repeat surveys of coastal benthos in 1994, 1998, and 2010, analyzing community structure and environmental variables at King George Island, Antarctica. We report a marked shift in an Antarctic benthic community that can be linked to ongoing climate change. However, rather than temperature as the primary factor, we highlight the resulting increased sediment runoff, triggered by glacier retreat, as the potential causal factor. The sudden shift from a "filter feeders-ascidian domination" to a "mixed assemblage" suggests that thresholds (for example, of tolerable sedimentation) and alternative equilibrium states, depending on the reversibility of the changes, could be possible traits of this ecosystem. Sedimentation processes will be increasing under the current scenario of glacier retreat, and attention needs to be paid to its effects along the AP. PMID:26702429

  11. Characteristics of the mesophotic megabenthic assemblages of the vercelli seamount (north tyrrhenian sea.

    Directory of Open Access Journals (Sweden)

    Marzia Bo

    Full Text Available The biodiversity of the megabenthic assemblages of the mesophotic zone of a Tyrrhenian seamount (Vercelli Seamount is described using Remotely Operated Vehicle (ROV video imaging from 100 m depth to the top of the mount around 61 m depth. This pinnacle hosts a rich coralligenous community characterized by three different assemblages: (i the top shows a dense covering of the kelp Laminaria rodriguezii; (ii the southern side biocoenosis is mainly dominated by the octocorals Paramuricea clavata and Eunicella cavolinii; while (iii the northern side of the seamount assemblage is colonized by active filter-feeding organisms such as sponges (sometimes covering 100% of the surface with numerous colonies of the ascidian Diazona violacea, and the polychaete Sabella pavonina. This study highlights, also for a Mediterranean seamount, the potential role of an isolated rocky peak penetrating the euphotic zone, to work as an aggregating structure, hosting abundant benthic communities dominated by suspension feeders, whose distribution may vary in accordance to the geomorphology of the area and the different local hydrodynamic conditions.

  12. Cyanobacteria in Coral Reef Ecosystems: A Review

    Directory of Open Access Journals (Sweden)

    L. Charpy


    Full Text Available Cyanobacteria have dominated marine environments and have been reef builders on Earth for more than three million years (myr. Cyanobacteria still play an essential role in modern coral reef ecosystems by forming a major component of epiphytic, epilithic, and endolithic communities as well as of microbial mats. Cyanobacteria are grazed by reef organisms and also provide nitrogen to the coral reef ecosystems through nitrogen fixation. Recently, new unicellular cyanobacteria that express nitrogenase were found in the open ocean and in coral reef lagoons. Furthermore, cyanobacteria are important in calcification and decalcification. All limestone surfaces have a layer of boring algae in which cyanobacteria often play a dominant role. Cyanobacterial symbioses are abundant in coral reefs; the most common hosts are sponges and ascidians. Cyanobacteria use tactics beyond space occupation to inhibit coral recruitment. Cyanobacteria can also form pathogenic microbial consortia in association with other microbes on living coral tissues, causing coral tissue lysis and death, and considerable declines in coral reefs. In deep lagoons, coccoid cyanobacteria are abundant and are grazed by ciliates, heteroflagellates, and the benthic coral reef community. Cyanobacteria produce metabolites that act as attractants for some species and deterrents for some grazers of the reef communities.

  13. Biochemical and toxicological evaluation of nano-heparins in cell functional properties, proteasome activation and expression of key matrix molecules. (United States)

    Piperigkou, Zoi; Karamanou, Konstantina; Afratis, Nikolaos A; Bouris, Panagiotis; Gialeli, Chrysostomi; Belmiro, Celso L R; Pavão, Mauro S G; Vynios, Dimitrios H; Tsatsakis, Aristidis M


    The glycosaminoglycan heparin and its derivatives act strongly on blood coagulation, controlling the activity of serine protease inhibitors in plasma. Nonetheless, there is accumulating evidence highlighting different anticancer activities of these molecules in numerous types of cancer. Nano-heparins may have great biological significance since they can inhibit cell proliferation and invasion as well as inhibiting proteasome activation. Moreover, they can cause alterations in the expression of major modulators of the tumor microenvironment, regulating cancer cell behavior. In the present study, we evaluated the effects of two nano-heparin formulations: one isolated from porcine intestine and the other from the sea squirt Styela plicata, on a breast cancer cell model. We determined whether these nano-heparins are able to affect cell proliferation, apoptosis and invasion, as well as proteasome activity and the expression of extracellular matrix molecules. Specifically, we observed that nano-Styela compared to nano-Mammalian analogue has higher inhibitory role on cell proliferation, invasion and proteasome activity. Moreover, nano-Styela regulates cell apoptosis, expression of inflammatory molecules, such as IL-6 and IL-8 and reduces the expression levels of extracellular matrix macromolecules, such as the proteolytic enzymes MT1-MMP, uPA and the cell surface proteoglycans syndecan-1 and -2, but not on syndecan-4. The observations reported in the present article indicate that nano-heparins and especially ascidian heparin are effective agents for heparin-induced effects in critical cancer cell functions, providing an important possibility in pharmacological targeting. PMID:26476401

  14. A profile of the in vitro antitumor activity of lissoclinolide

    International Nuclear Information System (INIS)

    Lissoclinolide is a small non-nitrogenous lactone isolated from the marine ascidian Lissoclinum patella. Previous studies of lissoclinolide (isolated from a fungus and an actinomycete) have identified varying activity against both Gram-negative and Gram-positive bacteria. In this study, lissoclinolide was able to inhibit cell growth in various mammalian tumor lines at an average IC50 of 395 nM (determined by MTT conversion after 48-h treatment). Treatment of HCT 116 human colon tumor cells with 2.4 μM lissoclinolide resulted in a strong arrest in the G2/M phase of the cell cycle after 24-h exposure. A daughter cell line lacking p53 showed an identical response while there was a slight increase in cytotoxicity towards a p21 null cell line. Although treatment with 2.4 μM lissoclinolide did not result in apoptosis after 48 h, this arrest was not reversible when drug wash out was attempted. The mechanism of action does not appear to involve tubulin, ubiquitin-specific isopeptidases, p53 or p21. COMPARE analysis in the NCI 60 cell line tumor panel revealed a moderate selectivity towards colon tumor cell lines

  15. Forming a tough shell via an intracellular matrix and cellular junctions in the tail epidermis of Oikopleura dioica (Chordata: Tunicata: Appendicularia) (United States)

    Nakashima, Keisuke; Nishino, Atsuo; Hirose, Euichi


    A postanal tail is a major synapomorphy of the phylum Chordata, which is composed of three subphyla: Vertebrata, Cephalochordata, and Tunicata (Urochordata). Among tunicates, appendicularians are the only group that retains the tail in the adult, and the adult tail functions in locomotion and feeding in combination with a cellulose-based house structure. Given the phylogenetic position of tunicates, the appendicularian adult tail may possess ancestral features of the chordate tail. We assess the ultrastructural development of the tail epidermis of the appendicularian Oikopleura dioica. The epidermis of the larval tail is enclosed by the larval envelope, which is a thin sheet similar to the outer tunic layer of ascidian larvae. The epidermis of the adult tail seems to bear no tunic-like cellulosic integuments, and the tail fin is a simple folding of the epidermis. Every epidermal cell, except for the triangular cells at the edge of the tail fin, has a conspicuous matrix layer of fibrous content in the apical cytoplasm without enclosing membranes. The epidermis of the larval tail does not have a fibrous matrix layer, suggesting the production of the layer during larval development and metamorphosis. Zonulae adhaerentes firmly bind the epidermal cells of the adult tail to one another, and the dense microfilaments lining the cell borders constitute a mechanical support for the cell membranes. The intracellular matrix, cell junctions, and cytoskeletons probably make the tail epidermis a tough, flexible shell supporting the active beating of the oikopleuran adult tail.

  16. Distribution and diversity of tunicates utilizing eelgrass as substrate in the western North Atlantic between 39° and 47° north latitude (New Jersey to Newfoundland) (United States)

    Carman, M R; Colarusso, Phillip D; Nelson, Eric P; Grunden, David W; Wong, Melisa C; McKenzie, Cynthia; Matheson, Kyle; Davidson, Jeffrey G.; Fox, Sophia; Neckles, Hilary A.; Bayley, Holly; Schott, Stephen; Dijkstra, Jennifer A; Stewart-Clark, Sarah


    Seagrass meadows are ecologically important habitats that are declining globally at an accelerating rate due to natural and anthropogenic stressors. Their decline is a serious concern as this habitat provides many ecosystem services. Eelgrass (Zostera marina) is the dominant seagrass species in the western North Atlantic. It has recently been established that invasive tunicate species possibly threaten the health of eelgrass beds. Colonization of eelgrass leaves by tunicates can inhibit eelgrass growth and may cause shoot mortality. To document the distribution and diversity of tunicate species that attach to eelgrass in the western North Atlantic, we surveyed twenty-one eelgrass sites from New Jersey to Newfoundland. Eight species of tunicates were found to be colonizing eelgrass, of which 6 are considered invasive. Botrylloides violaceus and Botryllus schlosseri were most commonly attached to eelgrass, with B. schlosseri having the largest latitudinal range of any species. Tunicate faunas attached to eelgrass were less diverse north of Gloucester, Massachusetts, where individual survey sites exhibited two species at most and only 4 of the 8 species observed in this study. Percent tunicate cover on eelgrass tended to fall within the 1–25 range, with occasional coverage up to >75–100. Density of eelgrass was highly variable among sites, ranging from <1 to 820 shoots/m². The solitary tunicate Ciona intestinalis was only found on eelgrass at the highest latitude sampled, in Newfoundland, where it is a new invader. The tunicates observed in this study, both solitary and colonial, are viable when attached to eelgrass and pose a potential threat to overgrow and weaken seagrass shoots and reduce the sustainability of seagrass meadows.

  17. Diverse forms of RPS9 splicing are part of an evolving autoregulatory circuit. (United States)

    Plocik, Alex M; Guthrie, Christine


    Ribosomal proteins are essential to life. While the functions of ribosomal protein-encoding genes (RPGs) are highly conserved, the evolution of their regulatory mechanisms is remarkably dynamic. In Saccharomyces cerevisiae, RPGs are unusual in that they are commonly present as two highly similar gene copies and in that they are over-represented among intron-containing genes. To investigate the role of introns in the regulation of RPG expression, we constructed 16 S. cerevisiae strains with precise deletions of RPG introns. We found that several yeast introns function to repress rather than to increase steady-state mRNA levels. Among these, the RPS9A and RPS9B introns were required for cross-regulation of the two paralogous gene copies, which is consistent with the duplication of an autoregulatory circuit. To test for similar intron function in animals, we performed an experimental test and comparative analyses for autoregulation among distantly related animal RPS9 orthologs. Overexpression of an exogenous RpS9 copy in Drosophila melanogaster S2 cells induced alternative splicing and degradation of the endogenous copy by nonsense-mediated decay (NMD). Also, analysis of expressed sequence tag data from distantly related animals, including Homo sapiens and Ciona intestinalis, revealed diverse alternatively-spliced RPS9 isoforms predicted to elicit NMD. We propose that multiple forms of splicing regulation among RPS9 orthologs from various eukaryotes operate analogously to translational repression of the alpha operon by S4, the distant prokaryotic ortholog. Thus, RPS9 orthologs appear to have independently evolved variations on a fundamental autoregulatory circuit. PMID:22479208

  18. Diverse forms of RPS9 splicing are part of an evolving autoregulatory circuit.

    Directory of Open Access Journals (Sweden)

    Alex M Plocik

    Full Text Available Ribosomal proteins are essential to life. While the functions of ribosomal protein-encoding genes (RPGs are highly conserved, the evolution of their regulatory mechanisms is remarkably dynamic. In Saccharomyces cerevisiae, RPGs are unusual in that they are commonly present as two highly similar gene copies and in that they are over-represented among intron-containing genes. To investigate the role of introns in the regulation of RPG expression, we constructed 16 S. cerevisiae strains with precise deletions of RPG introns. We found that several yeast introns function to repress rather than to increase steady-state mRNA levels. Among these, the RPS9A and RPS9B introns were required for cross-regulation of the two paralogous gene copies, which is consistent with the duplication of an autoregulatory circuit. To test for similar intron function in animals, we performed an experimental test and comparative analyses for autoregulation among distantly related animal RPS9 orthologs. Overexpression of an exogenous RpS9 copy in Drosophila melanogaster S2 cells induced alternative splicing and degradation of the endogenous copy by nonsense-mediated decay (NMD. Also, analysis of expressed sequence tag data from distantly related animals, including Homo sapiens and Ciona intestinalis, revealed diverse alternatively-spliced RPS9 isoforms predicted to elicit NMD. We propose that multiple forms of splicing regulation among RPS9 orthologs from various eukaryotes operate analogously to translational repression of the alpha operon by S4, the distant prokaryotic ortholog. Thus, RPS9 orthologs appear to have independently evolved variations on a fundamental autoregulatory circuit.

  19. Migratory neuronal progenitors arise from the neural plate borders in tunicates. (United States)

    Stolfi, Alberto; Ryan, Kerrianne; Meinertzhagen, Ian A; Christiaen, Lionel


    The neural crest is an evolutionary novelty that fostered the emergence of vertebrate anatomical innovations such as the cranium and jaws. During embryonic development, multipotent neural crest cells are specified at the lateral borders of the neural plate before delaminating, migrating and differentiating into various cell types. In invertebrate chordates (cephalochordates and tunicates), neural plate border cells express conserved factors such as Msx, Snail and Pax3/7 and generate melanin-containing pigment cells, a derivative of the neural crest in vertebrates. However, invertebrate neural plate border cells have not been shown to generate homologues of other neural crest derivatives. Thus, proposed models of neural crest evolution postulate vertebrate-specific elaborations on an ancestral neural plate border program, through acquisition of migratory capabilities and the potential to generate several cell types. Here we show that a particular neuronal cell type in the tadpole larva of the tunicate Ciona intestinalis, the bipolar tail neuron, shares a set of features with neural-crest-derived spinal ganglia neurons in vertebrates. Bipolar tail neuron precursors derive from caudal neural plate border cells, delaminate and migrate along the paraxial mesoderm on either side of the neural tube, eventually differentiating into afferent neurons that form synaptic contacts with both epidermal sensory cells and motor neurons. We propose that the neural plate borders of the chordate ancestor already produced migratory peripheral neurons and pigment cells, and that the neural crest evolved through the acquisition of a multipotent progenitor regulatory state upstream of multiple, pre-existing neural plate border cell differentiation programs. PMID:26524532

  20. Evolutionary origins of retinoid active short-chain dehydrogenases/reductases of SDR16C family. (United States)

    Belyaeva, Olga V; Chang, Chenbei; Berlett, Michael C; Kedishvili, Natalia Y


    Vertebrate enzymes that belong to the 16C family of short-chain dehydrogenases/reductases (SDR16C) were shown to play an essential role in the control of retinoic acid (RA) levels during development. To trace the evolution of enzymatic function of SDR16C family, and to examine the origins of the pathway for RA biosynthesis from vitamin A, we identified putative SDR16C enzymes through the extensive search of available genome sequencing data in a subset of species representing major metazoan phyla. The phylogenetic analysis revealed that enzymes from protostome, non-chordate deuterostome and invertebrate chordate species are found in three clades of SDR16C family containing retinoid active enzymes, which are retinol dehydrogenase 10 (RDH10), retinol dehydrogenases E2 (RDHE2) and RDHE2-similar, and dehydrogenase reductase (SDR family) member 3 (DHRS3). For the initial functional analysis, we cloned RDH10- and RDHE2-related enzymes from the early developmental stages of a non-chordate deuterostome, green sea urchin Lytechinus variegatus, and an invertebrate chordate, sea squirt Ciona intestinalis. In situ hybridization revealed that these proteins are expressed in a pattern relevant to development, while assays performed on proteins expressed in mammalian cell culture showed that they possess retinol-oxidizing activity as their vertebrate homologs. The existence of invertebrate homologs of DHRS3 was inferred from the analysis of phylogeny and cofactor-binding residues characteristic of preference for NADP(H). The presence of invertebrate homologs in the DHRS3 group of SDR16C is interesting in light of the complex mutually activating interaction, which we have recently described for human RDH10 and DHRS3 enzymes. Further functional analysis of these homologs will establish whether this interaction evolved to control retinoid homeostasis only in vertebrates, or is also conserved in pre-vertebrates. PMID:25451586

  1. Identifying single copy orthologs in Metazoa.

    Directory of Open Access Journals (Sweden)

    Christopher J Creevey


    Full Text Available The identification of single copy (1-to-1 orthologs in any group of organisms is important for functional classification and phylogenetic studies. The Metazoa are no exception, but only recently has there been a wide-enough distribution of taxa with sufficiently high quality sequenced genomes to gain confidence in the wide-spread single copy status of a gene.Here, we present a phylogenetic approach for identifying overlooked single copy orthologs from multigene families and apply it to the Metazoa. Using 18 sequenced metazoan genomes of high quality we identified a robust set of 1,126 orthologous groups that have been retained in single copy since the last common ancestor of Metazoa. We found that the use of the phylogenetic procedure increased the number of single copy orthologs found by over a third more than standard taxon-count approaches. The orthologs represented a wide range of functional categories, expression profiles and levels of divergence.To demonstrate the value of our set of single copy orthologs, we used them to assess the completeness of 24 currently published metazoan genomes and 62 EST datasets. We found that the annotated genes in published genomes vary in coverage from 79% (Ciona intestinalis to 99.8% (human with an average of 92%, suggesting a value for the underlying error rate in genome annotation, and a strategy for identifying single copy orthologs in larger datasets. In contrast, the vast majority of EST datasets with no corresponding genome sequence available are largely under-sampled and probably do not accurately represent the actual genomic complement of the organisms from which they are derived.

  2. The synapsin gene family in basal chordates: evolutionary perspectives in metazoans

    Directory of Open Access Journals (Sweden)

    De Bernardi Fiorenza


    Full Text Available Abstract Background Synapsins are neuronal phosphoproteins involved in several functions correlated with both neurotransmitter release and synaptogenesis. The comprehension of the basal role of the synapsin family is hampered in vertebrates by the existence of multiple synapsin genes. Therefore, studying homologous genes in basal chordates, devoid of genome duplication, could help to achieve a better understanding of the complex functions of these proteins. Results In this study we report the cloning and characterization of the Ciona intestinalis and amphioxus Branchiostoma floridae synapsin transcripts and the definition of their gene structure using available C. intestinalis and B. floridae genomic sequences. We demonstrate the occurrence, in both model organisms, of a single member of the synapsin gene family. Full-length synapsin genes were identified in the recently sequenced genomes of phylogenetically diverse metazoans. Comparative genome analysis reveals extensive conservation of the SYN locus in several metazoans. Moreover, developmental expression studies underline that synapsin is a neuronal-specific marker in basal chordates and is expressed in several cell types of PNS and in many, if not all, CNS neurons. Conclusion Our study demonstrates that synapsin genes are metazoan genes present in a single copy per genome, except for vertebrates. Moreover, we hypothesize that, during the evolution of synapsin proteins, new domains are added at different stages probably to cope up with the increased complexity in the nervous system organization. Finally, we demonstrate that protochordate synapsin is restricted to the post-mitotic phase of CNS development and thereby is a good marker of postmitotic neurons.

  3. Early evolution of ionotropic GABA receptors and selective regimes acting on the mammalian-specific theta and epsilon subunits.

    Directory of Open Access Journals (Sweden)

    Christopher J Martyniuk

    Full Text Available BACKGROUND: The amino acid neurotransmitter GABA is abundant in the central nervous system (CNS of both invertebrates and vertebrates. Receptors of this neurotransmitter play a key role in important processes such as learning and memory. Yet, little is known about the mode and tempo of evolution of the receptors of this neurotransmitter. Here, we investigate the phylogenetic relationships of GABA receptor subunits across the chordates and detail their mode of evolution among mammals. PRINCIPAL FINDINGS: Our analyses support two major monophyletic clades: one clade containing GABA(A receptor alpha, gamma, and epsilon subunits, and another one containing GABA(A receptor rho, beta, delta, theta, and pi subunits. The presence of GABA receptor subunits from each of the major clades in the Ciona intestinalis genome suggests that these ancestral duplication events occurred before the divergence of urochordates. However, while gene divergence proceeded at similar rates on most receptor subunits, we show that the mammalian-specific subunits theta and epsilon experienced an episode of positive selection and of relaxed constraints, respectively, after the duplication event. Sites putatively under positive selection are placed on a three-dimensional model obtained by homology-modeling. CONCLUSIONS: Our results suggest an early divergence of the GABA receptor subunits, before the split from urochordates. We show that functional changes occurred in the lineages leading to the mammalian-specific subunit theta, and we identify the amino acid sites putatively responsible for the functional divergence. We discuss potential consequences for the evolution of mammals and of their CNS.

  4. Characterization, developmental expression and evolutionary features of the huntingtin gene in the amphioxus Branchiostoma floridae

    Directory of Open Access Journals (Sweden)

    Cattaneo Elena


    Full Text Available Abstract Background Huntington's disease is an inherited neurodegenerative disorder that is caused by the expansion of an N-terminal polyQ stretch in the huntingtin protein. In order to investigate the hypothesis that huntingtin was already involved in development of the nervous system in the last common ancestor of chordates, we isolated and characterised the huntingtin homologue from the amphioxus Branchiostoma floridae. In the present paper the amphioxus general term must be referred to Branchiostoma floridae. Results In this report, we show that the exon-intron organization of the amphioxus huntingtin gene is highly conserved with that of other vertebrates species. The AmphiHtt protein has two glutamine residues in the position of the typical vertebrate polyQ tract. Sequence conservation is greater along the entire length of the protein than in a previously identified Ciona huntingtin. The first three N-terminal HEAT repeats are highly conserved in vertebrates and amphioxus, although exon rearrangement has occurred in this region. AmphiHtt expression is detectable by in situ hybridization starting from the early neurula stage, where it is found in cells of the neural plate. At later stages, it is retained in the neural compartment but also it appears in limited and well-defined groups of non-neural cells. At subsequent larval stages, AmphiHtt expression is detected in the neural tube, with the strongest signal being present in the most anterior part. Conclusion The cloning of amphioxus huntingtin allows to infer that the polyQ in huntingtin was already present 540 million years ago and provides a further element for the study of huntingtin function and its evolution along the deuterostome branch.

  5. P Transposable Elements in Drosophila and other Eukaryotic Organisms. (United States)

    Majumdar, Sharmistha; Rio, Donald C


    P transposable elements were discovered in Drosophila as the causative agents of a syndrome of genetic traits called hybrid dysgenesis. Hybrid dysgenesis exhibits a unique pattern of maternal inheritance linked to the germline-specific small RNA piwi-interacting (piRNA) pathway. The use of P transposable elements as vectors for gene transfer and as genetic tools revolutionized the field of Drosophila molecular genetics. P element transposons have served as a useful model to investigate mechanisms of cut-and-paste transposition in eukaryotes. Biochemical studies have revealed new and unexpected insights into how eukaryotic DNA-based transposons are mobilized. For example, the P element transposase makes unusual 17nt-3' extended double-strand DNA breaks at the transposon termini and uses guanosine triphosphate (GTP) as a cofactor to promote synapsis of the two transposon ends early in the transposition pathway. The N-terminal DNA binding domain of the P element transposase, called a THAP domain, contains a C2CH zinc-coordinating motif and is the founding member of a large family of animal-specific site-specific DNA binding proteins. Over the past decade genome sequencing efforts have revealed the presence of P element-like transposable elements or P element transposase-like genes (called THAP9) in many eukaryotic genomes, including vertebrates, such as primates including humans, zebrafish and Xenopus, as well as the human parasite Trichomonas vaginalis, the sea squirt Ciona, sea urchin and hydra. Surprisingly, the human and zebrafish P element transposase-related THAP9 genes promote transposition of the Drosophila P element transposon DNA in human and Drosophila cells, indicating that the THAP9 genes encode active P element "transposase" proteins. PMID:26104714

  6. New Mediterranean Biodiversity Records (December 2012

    Directory of Open Access Journals (Sweden)



    Full Text Available This paper presents records extending or confirming the distribution of Mediterranean species. Three alien algae are included, namely Codium taylorii reported for the first time from the Aegean and Turkey (Izmir Gulf, Caulerpa racemosa var. cylindracea (Karpathos and Chalki Isl., Aegean Sea and Ganonema farinosum (Karpathos Isl., Aegean Sea. As far as animals are concerned, Litarachna divergens (Acari: Hydrachnidia was recorded (Side, Eastern Mediterranean and represents a new amendment at genus level for Turkish fauna. Other invertebrates include alien species such as the crabs Dyspanopeus sayi (Lago Fusaro, SW Italy, Percnon gibbesi (Larnaca, Cyprus; Karpathos and Chalki Isl., Aegean Sea and Callinectes sapidus (Voda estuary, NW Greece, the nudibranch Aplysia dactylomela (Boka Kotorska Bay, Montenegro, the gastropod Conomurex persicus (Karpathos and ChalkiIsl., Aegean Sea and the bryozoan Electra tenella (Livorno harbour and Messina Straits area. The alien fish Siganus luridus, Siganus rivulatus, Fistularia commersonii, Sphyraena chrysotaenia and Sargocentron rubrum are also reported from the islands of Karpathos and Chalki, and Pteragogus pelycus from Heraklion Bay, Crete. In addition, new localities for four rare Mediterranean inhabitants are given: the cephalopod Thysanoteuthis rhombus (NW Sardinia and the fish: Lampris guttatus (Calabria, S Italy, Petromyzon marinus (Gokova Bay and Remora australis (Saronikos Gulf, while the opisthobranch gastropod Cerberilla bernadettae is reported for the first time from the E Mediterranean (Cyprus. Finally, three species of the Aegean ascidiofauna are recorded for the first time: Lissoclinum perforatum, Ciona roulei and Ecteinascidia turbinata. Furthermore, it was established that Phallusia nigra has extended its distributional range to the north of the Aegean Sea.

  7. RNA-seq-based metatranscriptomic and microscopic investigation reveals novel metalloproteases of Neobodo sp. as potential virulence factors for soft tunic syndrome in Halocynthia roretzi.

    Directory of Open Access Journals (Sweden)

    Ho Bin Jang

    Full Text Available Bodonids and trypanosomatids are derived from a common ancestor with the bodonids being a more primitive lineage. The Neobodonida, one of the three clades of bodonids, can be free-living, commensal or parasitic. Despite the ecological and evolutionary significance of these organisms, however, many of their biological and pathological features are currently unknown. Here, we employed metatranscriptomics using RNA-seq technology combined with field-emission microscopy to reveal the virulence factors of a recently described genus of Neobodonida that is considered to be responsible for ascidian soft tunic syndrome (AsSTS, but whose pathogenesis is unclear. Our microscopic observation of infected tunic tissues suggested putative virulence factors, enabling us to extract novel candidate transcripts; these included cysteine proteases of the families C1 and C2, serine proteases of S51 and S9 families, and metalloproteases grouped into families M1, M3, M8, M14, M16, M17, M24, M41, and M49. Protease activity/inhibition assays and the estimation of expression levels within gene clusters allowed us to identify metalloprotease-like enzymes as potential virulence attributes for AsSTS. Furthermore, a multimarker-based phylogenetic analysis using 1,184 concatenated amino acid sequences clarified the order Neobodo sp. In sum, we herein used metatranscriptomics to elucidate the in situ expression profiles of uncharacterized putative transcripts of Neobodo sp., combined these results with microscopic observation to select candidate genes relevant to pathogenesis, and used empirical screening to define important virulence factors.

  8. Short-term post-mortality predation and scavenging and longer-term recovery after anoxia in the northern Adriatic Sea

    Directory of Open Access Journals (Sweden)

    M. Blasnig


    Full Text Available In the Mediterranean, the northern Adriatic Sea shows most features known to promote late-summer hypoxia and anoxia. These features, along with anthropogenic eutrophication and marine snow events, have led to repeated benthic mortalities here. The present study was designed to document the post-anoxia macrofauna dynamics. We deployed an underwater instrument to induce small-scale anoxia in situ (total area 0.5 m2. Two time-lapse camera deployments examined short-term scavenging of the moribund and dead organisms (multi-species clumps consisting of sponges and ascidians over a 3-day period (August 2008: 71.5 h, September 2008: 67.5 h. Longer-term recovery (2 yr in the same two plots was examined with an independent photo-series. Predators and scavengers arrived in a distinct sequence. The first to arrive were demersal (Gobius niger, Serranus hepatus and benthopelagic fishes (Diplodus vulgaris, Pagellus erythrinus, followed by hermit crabs (Paguristes eremita, showing a clear day/night rhythm in presence and gastropods (Hexaplex trunculus. This sequence of arrival is attributed to the relative speeds of the organisms and their densities. The scavengers remained in dense aggregations (e.g. up to 33 P. eremita individuals at one time as long as the dead organisms were available. The whole sessile fauna was largely removed or consumed within 7 (August plot and 13 (September plot days after anoxia. No macroepibenthic recovery took place in the experimental plots one and two years after anoxia. This study underlines the sensitivity of this soft-bottom community and supports calls for reducing additional anthropogenic disturbances such as damaging commercial fishing practices that impede recolonization and threaten benthic community structure and function over the long-term.

  9. Deep-water stands of Cystoseira zosteroides C. Agardh (Fucales, Ochrophyta) in the Northwestern Mediterranean: Insights into assemblage structure and population dynamics (United States)

    Ballesteros, Enric; Garrabou, Joaquim; Hereu, Bernat; Zabala, Mikel; Cebrian, Emma; Sala, Enric


    Populations dominated by Cystoseira zosteroides, an endemic and threatened Mediterranean seaweed, colonize deep-water rocky habitats down to more than 50 m depth. Assemblages dominated by this species display high algal and invertebrate species richness. Algal biomass averages 1134 g dw m -2. Erect and turf algae account for only 25% of total algal dry weight, while encrusting corallines are responsible for the remaining 75%. Sponges, bryozoans and ascidians constitute the dominant sessile macrofauna. Cystoseira zosteroides is the dominant erect algae, with a mean biomass of 60.6 g dw m -2, and densities ranging from 4 to 7 plants m -2. The alien turf alga Womersleyella setacea has a biomass of 104.2 g dw m -2 and covers most of the understory substrate. The size-frequency distribution of C. zosteroides populations shows differences over time. Mean annual growth of the main axis is around 0.5 cm and mean annual mortality rate is lower than 2%. Recruitment was almost nil during the studied period of time (10 years). Processes structuring these deep-water Cystoseira stands must be driven by episodic disturbances, after-disturbance recruitment pulses, and long periods of steady growth that last at least 10 years. However, it is also possible that recruitment is irreversibly inhibited by the alien alga W. setacea in which case these old-growth stands are faced with extinction. The highly diversified assemblages and the low growth and low mortality rates of C. zosteroides indicate high vulnerability to natural and anthropogenic disturbances, and call for effective measures to ensure their conservation.

  10. A Tale of Two Drug Targets: The Evolutionary History of BACE1 and BACE2

    Directory of Open Access Journals (Sweden)

    Christopher eSouthan


    Full Text Available The beta amyloid (APP cleaving enzyme (BACE1 has been a drug target for Alzheimer's Disease (AD since 1999 with lead inhibitors now entering clinical trials. In 2011, the paralogue, BACE2, became a new target for type II diabetes (T2DM having been identified as a TMEM27 secretase regulating pancreatic β cell function. However, the normal roles of both enzymes are unclear. This study outlines their evolutionary history and new opportunities for functional genomics. We identified 30 homologues (UrBACEs in basal phyla including Placozoans, Cnidarians, Choanoflagellates, Porifera, Echinoderms, Annelids, Mollusks and Ascidians (but not Ecdysozoans. UrBACEs are predominantly single copy, show 35% to 45% protein sequence identity with mammalian BACE1, are approximately 100 residues longer than cathepsin paralogues with an aspartyl protease domain flanked by a signal peptide and a C-terminal transmembrane domain. While multiple paralogues in Trichoplax and Monosiga pre-date the nervous system, duplication of the UrBACE in fish gave rise to BACE1 and BACE2 in the vertebrate lineage. The latter evolved more rapidly as the former maintained the emergent neuronal role. In mammals, Ka/Ks for BACE2 is higher than BACE1 but low ratios for both suggest purifying selection. The 5’ exons show higher Ka/Ks than the catalytic section. Model organism genomes show the absence of certain BACE human substrates when the UrBACE is present. Experiments could thus reveal undiscovered substrates and roles. The human protease double-target status means that evolutionary trajectories and functional shifts associated with different substrates will have implications for the development of clinical candidates for both AD and T2DM. A rational basis for inhibition specificity ratios and assessing target-related side effects will be facilitated by a more complete picture of BACE1 and BACE2 functions informed by their evolutionary context.

  11. An efficient method to find potentially universal population genetic markers, applied to metazoans

    Directory of Open Access Journals (Sweden)

    Chenuil Anne


    Full Text Available Abstract Background Despite the impressive growth of sequence databases, the limited availability of nuclear markers that are sufficiently polymorphic for population genetics and phylogeography and applicable across various phyla restricts many potential studies, particularly in non-model organisms. Numerous introns have invariant positions among kingdoms, providing a potential source for such markers. Unfortunately, most of the few known EPIC (Exon Primed Intron Crossing loci are restricted to vertebrates or belong to multigenic families. Results In order to develop markers with broad applicability, we designed a bioinformatic approach aimed at avoiding multigenic families while identifying intron positions conserved across metazoan phyla. We developed a program facilitating the identification of EPIC loci which allowed slight variation in intron position. From the Homolens databases we selected 29 gene families which contained 52 promising introns for which we designed 93 primer pairs. PCR tests were performed on several ascidians, echinoderms, bivalves and cnidarians. On average, 24 different introns per genus were amplified in bilaterians. Remarkably, five of the introns successfully amplified in all of the metazoan genera tested (a dozen genera, including cnidarians. The influence of several factors on amplification success was investigated. Success rate was not related to the phylogenetic relatedness of a taxon to the groups that most influenced primer design, showing that these EPIC markers are extremely conserved in animals. Conclusions Our new method now makes it possible to (i rapidly isolate a set of EPIC markers for any phylum, even outside the animal kingdom, and thus, (ii compare genetic diversity at potentially homologous polymorphic loci between divergent taxa.

  12. Anti-Infective Potential of Marine Invertebrates and Seaweeds from the Brazilian Coast

    Directory of Open Access Journals (Sweden)

    Mario Steindel


    Full Text Available This manuscript describes the evaluation of anti-infective potential in vitro of organic extracts from nine sponges, one ascidian, two octocorals, one bryozoan, and 27 seaweed species collected along the Brazilian coast. Antimicrobial activity was tested against Staphylococcus aureus (ATCC 25923, Enterococcus faecalis (ATCC 29212, Pseudomonas aeruginosa (ATCC 27853, Escherichia coli (ATCC 25922 and Candida albicans (ATCC 10231 by the disk diffusion method. Antiprotozoal activity was evaluated against Leishmania braziliensis (MHOM/BR/96/LSC96-H3 promastigotes and Trypanosoma cruzi (MHOM/BR/00/Y epimastigotes by MTT assay. Activity against intracellular amastigotes of T. cruzi and L. brasiliensis in murine macrophages was also evaluated. Antiviral activity was tested against Herpes Simplex Virus type 1 (HSV-1, KOS strain by the plaque number reduction assay (IC50. Cytotoxicity on VERO cells was evaluated by the MTT assay (CC50. The results were expressed as SI = CC50/IC50. The most promising antimicrobial results were obtained against S. aureus and C. albicans with Dragmacidon reticulatum. Among the seaweeds, only Osmundaria obtusiloba showed moderate activity against P. aeruginosa. Concerning antiprotozoal activity, Bugula neritina, Carijoa riseii, Dragmaxia anomala and Haliclona (Halichoclona sp. showed the most interesting results, mainly against extracellular promastigote forms of L. braziliensis (66, 35.9, 97.2, and 43.6% inhibition, respectively. Moreover, six species of seaweeds Anadyomene saldanhae, Caulerpa cupressoides, Canistrocarpus cervicornis, Dictyota sp., Ochtodes secundiramea, and Padina sp. showed promising results against L. braziliensis (87.9, 51.7, 85.9, 93.3, 99.7, and 80.9% inhibition, respectively, and only Dictyota sp. was effective against T. cruzi (60.4% inhibition. Finally, the antiherpes activity was also evaluated, with Haliclona (Halichoclona sp. and Petromica citrina showing the best results (SI = 11.9 and SI > 5

  13. New Mediterranean Biodiversity Records (October, 2014

    Directory of Open Access Journals (Sweden)



    Full Text Available The Collective Article ‘New Mediterranean Biodiversity Records’ of the Mediterranean Marine Science journal offers the means to publish biodiversity records in the Mediterranean Sea. The current article is divided in two parts, for records of alien and native species respectively. The new records of alien species include: the red alga Asparagopsis taxiformis (Crete and Lakonicos Gulf (Greece; the red alga Grateloupia turuturu (along the Israeli Mediterranean shore; the mantis shrimp Clorida albolitura (Gulf of Antalya, Turkey; the mud crab Dyspanopeus sayi (Mar Piccolo of Taranto, Ionian Sea; the blue crab Callinectes sapidus (Chios Island, Greece; the isopod Paracerceis sculpta (northern Aegean Sea, Greece; the sea urchin Diadema setosum (Gökova Bay, Turkey; the molluscs Smaragdia souverbiana, Murex forskoehlii, Fusinus verrucosus, Circenita callipyga, and Aplysia dactylomela (Syria; the cephalaspidean mollusc Haminoea cyanomarginata (Baia di Puolo, Massa Lubrense, Campania, southern Italy; the topmouth gudgeon Pseudorasbora parva (Civitavecchia, Tyrrhenian Sea; the fangtooth moray Enchelycore anatine (Plemmirio marine reserve, Sicily; the silver-cheeked toadfish Lagocephalus sceleratus (Saros Bay, Turkey; and Ibiza channel, Spain; the Indo-Pacific ascidian Herdmania momusin Kastelorizo Island (Greece; and the foraminiferal Clavulina multicam erata (Saronikos Gulf, Greece. The record of L. sceleratus in Spain consists the deepest (350-400m depth record of the species in the Mediterranean Sea. The new records of native species include: first record of the ctenophore Cestum veneris in Turkish marine waters; the presence of Holothuria tubulosa and Holothuria polii in the Bay of Igoumenitsa (Greece; the first recorded sighting of the bull ray Pteromylaeus bovinus in Maltese waters; and a new record of the fish Lobotes surinamensis from Maliakos Gulf. 

  14. Tough adults, frail babies: an analysis of stress sensitivity across early life-history stages of widely introduced marine invertebrates.

    Directory of Open Access Journals (Sweden)

    M Carmen Pineda

    Full Text Available All ontogenetic stages of a life cycle are exposed to environmental conditions so that population persistence depends on the performance of both adults and offspring. Most studies analysing the influence of abiotic conditions on species performance have focussed on adults, while studies covering early life-history stages remain rare. We investigated the responses of early stages of two widely introduced ascidians, Styela plicata and Microcosmus squamiger, to different abiotic conditions. Stressors mimicked conditions in the habitats where both species can be found in their distributional ranges and responses were related to the selection potential of their populations by analysing their genetic diversity. Four developmental stages (egg fertilisation, larval development, settlement, metamorphosis were studied after exposure to high temperature (30°C, low salinities (26 and 22‰ and high copper concentrations (25, 50 and 100 µg/L. Although most stressors effectively led to failure of complete development (fertilisation through metamorphosis, fertilisation and larval development were the most sensitive stages. All the studied stressors affected the development of both species, though responses differed with stage and stressor. S. plicata was overall more resistant to copper, and some stages of M. squamiger to low salinities. No relationship was found between parental genetic composition and responses to stressors. We conclude that successful development can be prevented at several life-history stages, and therefore, it is essential to consider multiple stages when assessing species' abilities to tolerate stress. Moreover, we found that early development of these species cannot be completed under conditions prevailing where adults live. These populations must therefore recruit from elsewhere or reproduce during temporal windows of more benign conditions. Alternatively, novel strategies or behaviours that increase overall reproductive success

  15. Tolerance of sponge assemblages to temperature anomalies: resilience and proliferation of sponges following the 1997-8 El-Nino southern oscillation.

    Directory of Open Access Journals (Sweden)

    Francisco Kelmo

    Full Text Available Coral reefs across the world are under threat from a range of stressors, and while there has been considerable focus on the impacts of these stressors on corals, far less is known about their effect on other reef organisms. The 1997-8 El-Niño Southern Oscillation (ENSO had notable and severe impacts on coral reefs worldwide, but not all reef organisms were negatively impacted by this large-scale event. Here we describe how the sponge fauna at Bahia, Brazil was influenced by the 1997-8 ENSO event. Sponge assemblages from three contrasting reef habitats (reef tops, walls and shallow banks at four sites were assessed annually from 1995 to 2011. The within-habitat sponge diversity did not vary significantly across the study period; however, there was a significant increase in density in all habitats. Multivariate analyses revealed no significant difference in sponge assemblage composition (ANOSIM between pre- and post-ENSO years for any of the habitats, suggesting that neither the 1997-8 nor any subsequent smaller ENSO events have had any measurable impact on the reef sponge assemblage. Importantly, this is in marked contrast to the results previously reported for a suite of other taxa (including corals, echinoderms, bryozoans, and ascidians, which all suffered mass mortalities as a result of the ENSO event. Our results suggest that of all reef taxa, sponges have the potential to be resilient to large-scale thermal stress events and we hypothesize that sponges might be less affected by projected increases in sea surface temperature compared to other major groups of reef organisms.

  16. Histamine Stimulates Ciliary Beat Frequency via the H2 Receptor in the Protochordate Botryllus schlosseri. (United States)

    Cima, Francesca; Franchi, Nicola


    Histamine is a biogenic molecule that plays a role in many physiological pathways via binding to a specific receptor. Histaminergic receptors belong to the large family of seven-transmembrane α-helix domain receptors classified in mammals into four distinct classes: H1, H2, H3, and H4. Despite being widely studied in vertebrates, few data are available on the invertebrate receptors, with only predicted H1 and H2 sequences for nonchordate deuterostomes. Here, we report the first characterized transcript sequence for an H2 receptor from the colonial ascidian Botryllus schlosseri, describing the localization of both transcript and protein during blastogenic development through in situ hybridization and immunohistochemistry. Its phylogenetic relationships with deuterostome orthologous proteins are reported, its role in ciliary beat frequency (CBF) in cultured stigma cells of the branchial basket is outlined, and the effects of histamine and its receptor agonists and antagonists are analyzed. In the presence of increasing concentrations of histamine in the medium, CBF increases similarly to the selective H2 receptor agonist dimaprit. In contrast, ranitidine, which is an inhibitor of the H2 receptor, causes a significant inhibition of CBF, similar to that observed after preincubation with the specific anti-BsHRH2 or the anti-human HRH2 antibody. In cells bordering the branchial basket stigmata, both antibodies colocalize in the proximal region of the ciliary plasmalemma, and histamine is present inside vesicles of the apical region, thus supporting the hypothesis of a histamine-binding H2 receptor control of the pharyngeal mucociliary transport similar to that of the upper respiratory tract and middle ear in mammals. PMID:27139577

  17. Carbonate production and deposition in a warm-temperate macroalgal environment, Investigator Strait, South Australia (United States)

    James, Noel P.; Bone, Yvonne


    The prolific macroalgal forests in shallow (red algae that are grazed by herbivorous gastropods, 2) an intermediate, 5-20 cm-high community of fleshy red algae, and 3) a 20-100 cm+-high canopy of large phaeophytes (especially Ecklonia, Cystophora and Xiophora) whose blades are locally encrusted with bryozoans, such as Membranipora membranacea, and spirorbids. Concealed surfaces of subvertical rock walls and cryptic habitats behind the macroalgal curtain have two tiers; 1) a cornucopia of encrusting plants and animals, especially crustose and geniculate corallines in shallow water, that give way in water depths > 4 m to numerous bryozoans (especially fenestrates), serpulid worms, numerous and diverse demosponges, ascidians, small solitary corals, epifaunal echinoids, and gastropods, and 2) a veil of macroalgae (mainly Cystophora and Ecklonia) that drapes down and shades the rock walls. Most carbonate sediment production does not come from calcareous epiphytes on the macroalgae but comes from the coralline algae and calcareous invertebrates living on the rock walls and in concealed depressions. Mollusks (gastropods and bivalves) and geniculate coralline algae with numerous lithoclasts, crustose coralline fragments, barnacle plates, serpulid worms, bryozoans, and large benthic foraminifers (especially Amphistegina) dominate the resultant gravels and sands; but there is little or no mud. This is because carbonate sediment is the result of production not only in the macrophyte factory but also in adjacent seagrass factories. Particles produced in the macroalgal factory are shed onto the adjacent seafloor, where they form the requisite sandy substrates for quick colonization by seagrasses. Thus, over time the sediment in this shallow but hydrodynaically energetic environment becomes a mixture of materials from the two sources with seagrasses contributing gastropods, large benthic foraminifers, spirorbids, bryozoans and articulated corallines to the sediment milieu. If

  18. Discovery and Evaluation of Thiazinoquinones as Anti-Protozoal Agents

    Directory of Open Access Journals (Sweden)

    Marcel Kaiser


    Full Text Available Pure compound screening has identified the dioxothiazino-quinoline-quinone ascidian metabolite ascidiathiazone A (2 to be a moderate growth inhibitor of Trypanosoma brucei rhodesiense (IC50 3.1 μM and Plasmodium falciparum (K1 dual drug resistant strain (IC50 3.3 μM while exhibiting low levels of cytotoxicity (L6, IC50 167 μM. A series of C-7 amide and Δ2(3 analogues were prepared that explored the influence of lipophilicity and oxidation state on observed anti-protozoal activity and selectivity. Little variation in anti-malarial potency was observed (IC50 0.62–6.5 μM, and no correlation was apparent between anti-malarial and anti-T. brucei activity. Phenethylamide 7e and Δ2(3-glycine analogue 8k exhibited similar anti-Pf activity to 2 but with slightly enhanced selectivity (SI 72 and 93, respectively, while Δ2(3-phenethylamide 8e (IC50 0.67 μM, SI 78 exhibited improved potency and selectivity towards T. brucei rhodesiense compared to the natural product hit. A second series of analogues were prepared that replaced the quinoline ring of 2 with benzofuran or benzothiophene moieties. While esters 10a/10b and 15 were once again found to exhibit cytotoxicity, carboxylic acid analogues exhibited potent anti-Pf activity (IC50 0.34–0.035 μM combined with excellent selectivity (SI 560–4000. In vivo evaluation of a furan carboxylic acid analogue against P. berghei was undertaken, demonstrating 85.7% and 47% reductions in parasitaemia with ip or oral dosing respectively.

  19. Cell signaling and transcription factor genes expressed during whole body regeneration in a colonial chordate

    Directory of Open Access Journals (Sweden)

    Rinkevich Baruch


    Full Text Available Abstract Background The restoration of adults from fragments of blood vessels in botryllid ascidians (termed whole body regeneration [WBR] represents an inimitable event in the chordates, which is poorly understood on the mechanistic level. Results To elucidate mechanisms underlying this phenomenon, a subtracted EST library for early WBR stages was previously assembled, revealing 76 putative genes belonging to major signaling pathways, including Notch/Delta, JAK/STAT, protein kinases, nuclear receptors, Ras oncogene family members, G-Protein coupled receptor (GPCR and transforming growth factor beta (TGF-β signaling. RT-PCR on selected transcripts documented specific up-regulation in only regenerating fragments, pointing to a broad activation of these signaling pathways at onset of WBR. The followed-up expression pattern of seven representative transcripts from JAK/STAT signaling (Bl-STAT, the Ras oncogene family (Bl-Rap1A, Bl-Rab-33, the protein kinase family (Bl-Mnk, Bl-Cnot, Bl-Slit and Bl-Bax inhibitor, revealed systemic and site specific activations during WBR in a sub-population of circulatory cells. Conclusion WBR in the non-vertebrate chordate Botrylloides leachi is a multifaceted phenomenon, presided by a complex array of cell signaling and transcription factors. Above results, provide a first insight into the whole genome molecular machinery of this unique regeneration process, and reveal the broad participation of cell signaling and transcription factors in the process. While regeneration involves the participation of specific cell populations, WBR signals are systemically expressed at the organism level.

  20. Ultrastructure, molecular phylogenetics, and chlorophyll a content of novel cyanobacterial symbionts in temperate sponges. (United States)

    Erwin, Patrick M; López-Legentil, Susanna; Turon, Xavier


    Marine sponges often harbor photosynthetic symbionts that may enhance host metabolism and ecological success, yet little is known about the factors that structure the diversity, specificity, and nature of these relationships. Here, we characterized the cyanobacterial symbionts in two congeneric and sympatric host sponges that exhibit distinct habitat preferences correlated with irradiance: Ircinia fasciculata (higher irradiance) and Ircinia variabilis (lower irradiance). Symbiont composition was similar among hosts and dominated by the sponge-specific cyanobacterium Synechococcus spongiarum. Phylogenetic analyses of 16S-23S rRNA internal transcribed spacer (ITS) gene sequences revealed that Mediterranean Ircinia spp. host a specific, novel symbiont clade ("M") within the S. spongiarum species complex. A second, rare cyanobacterium related to the ascidian symbiont Synechocystis trididemni was observed in low abundance in I. fasciculata and likewise corresponded to a new symbiont clade. Symbiont communities in I. fasciculata exhibited nearly twice the chlorophyll a concentrations of I. variabilis. Further, S. spongiarum clade M symbionts in I. fasciculata exhibited dense intracellular aggregations of glycogen granules, a storage product of photosynthetic carbon assimilation rarely observed in I. variabilis symbionts. In both host sponges, S. spongiarum cells were observed interacting with host archeocytes, although the lower photosynthetic activity of Cyanobacteria in I. variabilis suggests less symbiont-derived nutritional benefit. The observed differences in clade M symbionts among sponge hosts suggest that ambient irradiance conditions dictate symbiont photosynthetic activity and consequently may mediate the nature of host-symbiont relationships. In addition, the plasticity exhibited by clade M symbionts may be an adaptive attribute that allows for flexibility in host-symbiont interactions across the seasonal fluctuations in light and temperature characteristic of

  1. A single and rapid calcium wave at egg activation in Drosophila

    Directory of Open Access Journals (Sweden)

    Anna H. York-Andersen


    Full Text Available Activation is an essential process that accompanies fertilisation in all animals and heralds major cellular changes, most notably, resumption of the cell cycle. While activation involves wave-like oscillations in intracellular Ca2+ concentration in mammals, ascidians and polychaete worms and a single Ca2+ peak in fish and frogs, in insects, such as Drosophila, to date, it has not been shown what changes in intracellular Ca2+ levels occur. Here, we utilise ratiometric imaging of Ca2+ indicator dyes and genetically encoded Ca2+ indicator proteins to identify and characterise a single, rapid, transient wave of Ca2+ in the Drosophila egg at activation. Using genetic tools, physical manipulation and pharmacological treatments we demonstrate that the propagation of the Ca2+ wave requires an intact actin cytoskeleton and an increase in intracellular Ca2+ can be uncoupled from egg swelling, but not from progression of the cell cycle. We further show that mechanical pressure alone is not sufficient to initiate a Ca2+ wave. We also find that processing bodies, sites of mRNA decay and translational regulation, become dispersed following the Ca2+ transient. Based on this data we propose the following model for egg activation in Drosophila: exposure to lateral oviduct fluid initiates an increase in intracellular Ca2+ at the egg posterior via osmotic swelling, possibly through mechano-sensitive Ca2+ channels; a single Ca2+ wave then propagates in an actin dependent manner; this Ca2+ wave co-ordinates key developmental events including resumption of the cell cycle and initiation of translation of mRNAs such as bicoid.

  2. Population genetics features for persistent, but transient, Botryllus schlosseri (Urochordata) congregations in a central Californian marina. (United States)

    Karahan, Arzu; Douek, Jacob; Paz, Guy; Rinkevich, Baruch


    The colonial tunicate Botryllus schlosseri is a globally distributed, invasive ascidian that has colonized the Californian coasts of the USA during the mid-late 1940s and has, since the late 1980s, spread north to Washington. This study analyzes the population genetic characteristics of transient populations residing at the Elkhorn Yacht-Club (EYC), in central California (seven sessions, 1996-2008), which suffered periodic catastrophes caused by episodic fresh-water floods and a single sampling session (in the year 2001) of five West-Coast populations using the mtDNA COI gene and five microsatellite markers. EYC microsatellite results were further compared with the closely situated but persistent population of the Santa Cruz Harbor (SCH) to understand the impact on EYC population regeneration processes after the 2005-flood catastrophe. All microsatellites were highly polymorphic, revealing a large number of unique alleles at different sampling dates. Whereas pairwise θ did not reveal significant differences between the EYC time-series samplings, the overall θ was significant, as it was between all the 2001 West Coast populations. The most likely cluster number was 3 for the EYC samples whereas two K values were obtained (2 and 5) for the 2001 samples. Tajima's D and Fu's/Fs tests did not reject the null hypothesis for COI neutral evolution, except for in the EYC-2000, 2007 and two 2001 samplings. The wide geographical range of the analyses has indicated that following the EYC 2005-flood catastrophe, newcomers could have originated from neighboring populations, from deep-water colonies that may have escaped the 2005 low salinity event, or less expectedly, from far away West-Coast populations, while revealing that the SCH population is the most probable source for the EYC population. PMID:27154209

  3. In vivo antithrombotic properties of a heparin from the oocyte test cells of the sea squirt Styela plicata(Chordata-Tunicata

    Directory of Open Access Journals (Sweden)

    L. Cardilo-Reis


    Full Text Available In the ascidian Styela plicata, the oocytes are surrounded by two types of accessory cells named follicle cells and test cells. A heparin-like substance with an anticoagulant activity equivalent to 10% of mammalian heparin and about 5% as potent as the mammalian counterpart for the inhibition of thrombin by antithrombin was isolated from the oocyte test cells. In the present study, we compared the antithrombotic and hemorrhagic effects of sea squirt oocyte test cell heparin with those of porcine heparin in rat models of venous thrombosis and blood loss. Intravenous administration of the oocyte test cell heparin to Wistar rats (both sexes, weighing ~300 g, N = 4 in each group at a dose of 5.0 mg/kg body weight, which produced a 1.8-fold increase in plasma activated partial thromboplastin time, inhibited thrombosis by 45 ± 13.5% (mean ± SD without any bleeding effect. The same dose of porcine heparin inhibited thrombosis by 100 ± 1.4%, but produced a blood loss three times greater than that of the saline-treated control. However, 10-fold reduction of the dose of porcine heparin to 0.5 mg/kg body weight, which produced a 5-fold increase in plasma-activated partial thromboplastin time, inhibited thrombosis by 70 ± 13% without any bleeding effect. The antithrombotic properties of a new heparin isolated from test cells of the sea squirt S. plicata, reported here for the first time, indicate that, although sea squirt oocyte test cell heparin was a poor anticoagulant compared to porcine heparin, it had a significant antithrombotic effect without causing bleeding.

  4. Cellulose Synthesis in Agrobacterium tumefaciens

    Energy Technology Data Exchange (ETDEWEB)

    Alan R. White; Ann G. Matthysse


    We have cloned the celC gene and its homologue from E. coli, yhjM, in an expression vector and expressed the both genes in E. coli; we have determined that the YhjM protein is able to complement in vitro cellulose synthesis by extracts of A. tumefaciens celC mutants, we have purified the YhjM protein product and are currently examining its enzymatic activity; we have examined whole cell extracts of CelC and various other cellulose mutants and wild type bacteria for the presence of cellulose oligomers and cellulose; we have examined the ability of extracts of wild type and cellulose mutants including CelC to incorporate UDP-14C-glucose into cellulose and into water-soluble, ethanol-insoluble oligosaccharides; we have made mutants which synthesize greater amounts of cellulose than the wild type; and we have examined the role of cellulose in the formation of biofilms by A. tumefaciens. In addition we have examined the ability of a putative cellulose synthase gene from the tunicate Ciona savignyi to complement an A. tumefaciens celA mutant. The greatest difference between our knowledge of bacterial cellulose synthesis when we started this project and current knowledge is that in 1999 when we wrote the original grant very few bacteria were known to synthesize cellulose and genes involved in this synthesis were sequenced only from Acetobacter species, A. tumefaciens and Rhizobium leguminosarum. Currently many bacteria are known to synthesize cellulose and genes that may be involved have been sequenced from more than 10 species of bacteria. This additional information has raised the possibility of attempting to use genes from one bacterium to complement mutants in another bacterium. This will enable us to examine the question of which genes are responsible for the three dimensional structure of cellulose (since this differs among bacterial species) and also to examine the interactions between the various proteins required for cellulose synthesis. We have carried out one

  5. Sediment Burial Intolerance of Marine Macroinvertebrates. (United States)

    Hendrick, Vicki J; Hutchison, Zoë L; Last, Kim S


    The marine environment contains suspended particulate matter which originates from natural and anthropogenic sources. Settlement of this material can leave benthic organisms susceptible to smothering, especially if burial is sudden i.e. following storms or activities such as dredging. Their survival will depend on their tolerance to, and their ability to escape from burial. Here we present data from a multi-factorial experiment measuring burial responses incorporating duration, sediment fraction and depth. Six macroinvertebrates commonly found in sediment rich environments were selected for their commercial and/or conservation importance. Assessments revealed that the brittle star (Ophiura ophiura), the queen scallop (Aequipecten opercularis) and the sea squirt (Ciona intestinalis) were all highly intolerant to burial whilst the green urchin (Psammichinus miliaris) and the anemone (Sagartiogeton laceratus), showed intermediate and low intolerance respectively, to burial. The least intolerant, with very high survival was the Ross worm (Sabellaria spinulosa). With the exception of C. intestinalis, increasing duration and depth of burial with finer sediment fractions resulted in increased mortality for all species assessed. For C. intestinalis depth of burial and sediment fraction were found to be inconsequential since there was complete mortality of all specimens buried for more than one day. When burial emergence was assessed O. ophiura emerged most frequently, followed by P. miliaris. The former emerged most frequently from the medium and fine sediments whereas P. miliaris emerged more frequently from coarse sediment. Both A. opercularis and S. laceratus showed similar emergence responses over time, with A. opercularis emerging more frequently under coarse sediments. The frequency of emergence of S. laceratus increased with progressively finer sediment and C. intestinalis did not emerge from burial irrespective of sediment fraction or depth. Finally, and perhaps

  6. Sediment Burial Intolerance of Marine Macroinvertebrates.

    Directory of Open Access Journals (Sweden)

    Vicki J Hendrick

    Full Text Available The marine environment contains suspended particulate matter which originates from natural and anthropogenic sources. Settlement of this material can leave benthic organisms susceptible to smothering, especially if burial is sudden i.e. following storms or activities such as dredging. Their survival will depend on their tolerance to, and their ability to escape from burial. Here we present data from a multi-factorial experiment measuring burial responses incorporating duration, sediment fraction and depth. Six macroinvertebrates commonly found in sediment rich environments were selected for their commercial and/or conservation importance. Assessments revealed that the brittle star (Ophiura ophiura, the queen scallop (Aequipecten opercularis and the sea squirt (Ciona intestinalis were all highly intolerant to burial whilst the green urchin (Psammichinus miliaris and the anemone (Sagartiogeton laceratus, showed intermediate and low intolerance respectively, to burial. The least intolerant, with very high survival was the Ross worm (Sabellaria spinulosa. With the exception of C. intestinalis, increasing duration and depth of burial with finer sediment fractions resulted in increased mortality for all species assessed. For C. intestinalis depth of burial and sediment fraction were found to be inconsequential since there was complete mortality of all specimens buried for more than one day. When burial emergence was assessed O. ophiura emerged most frequently, followed by P. miliaris. The former emerged most frequently from the medium and fine sediments whereas P. miliaris emerged more frequently from coarse sediment. Both A. opercularis and S. laceratus showed similar emergence responses over time, with A. opercularis emerging more frequently under coarse sediments. The frequency of emergence of S. laceratus increased with progressively finer sediment and C. intestinalis did not emerge from burial irrespective of sediment fraction or depth. Finally

  7. Observations of recruitment and colonization by tunicates and associated invertebrates using giant one-meter2 recruitment plates at Woods Hole, Massachusetts (United States)

    Valentine, Page C.; Carman, M.R.; Blackwood, Dann S.


    Large recruitment plates measuring 1 × 1 m were deployed over an 18-month period from September 2013 to March 2015 for the purpose of documenting recruitment and colonization processes of marine invertebrate species at Woods Hole, Massachusetts. Each side of two plates was subdivided into 16 subareas (25 × 25 cm), and an observational strategy was developed whereby, at approximately two-week intervals, a different subarea was cleaned. Using this approach, we were able to photographically document species recruitment and growth interactions. Water temperature records from the site show that steady warming and cooling between 3 and 20° C changed at a mean rate of 0.2 ° C d-1. However, temperature changes during the coolest and warmest parts of the temperature cycle were highly variable. In 2014, between the first and last occurrence of 0° C, temperatures were ≤0° C 15 percent of the time, but in 2015 temperatures were ≤0° C 93 percent of the time. In 2014, between the first and last occurrence of 21° C, temperatures were ≥21° C 88 percent of the time, and this warm period correlated with the disappearance of the hydroid Ectopleura crocea, the solitary tunicates Ascidiella aspersa and Ciona intestinalis, and the 2013 generation of Botrylloides violaceus. In Woods Hole, large plates provided enough space to accommodate both fast- and slow-colonizing species, resulting in the establishment of a diverse assemblage that was observed over a long time period. The most successful colonizing species had relatively long reproductive and recruitment periods, grew rapidly, repelled settlement onto their surfaces by larvae of any species, defended themselves against overgrowth by any species, overwintered, and lived a long time. Of the three dominant species observed in this study, the colonial tunicates Didemnum vexillum and Botrylloides violaceus had these qualities; the encrusting colonial bryozoan Schizoporella unicornis had all but one, it grew more slowly

  8. FAM20: an evolutionarily conserved family of secreted proteins expressed in hematopoietic cells

    Directory of Open Access Journals (Sweden)

    Cobos Everardo


    Full Text Available Abstract Background Hematopoiesis is a complex developmental process controlled by a large number of factors that regulate stem cell renewal, lineage commitment and differentiation. Secreted proteins, including the hematopoietic growth factors, play critical roles in these processes and have important biological and clinical significance. We have employed representational difference analysis to identify genes that are differentially expressed during experimentally induced myeloid differentiation in the murine EML hematopoietic stem cell line. Results One identified clone encoded a previously unidentified protein of 541 amino acids that contains an amino terminal signal sequence but no other characterized domains. This protein is a member of family of related proteins that has been named family with sequence similarity 20 (FAM20 with three members (FAM20A, FAM20B and FAM20C in mammals. Evolutionary comparisons revealed the existence of a single FAM20 gene in the simple vertebrate Ciona intestinalis and the invertebrate worm Caenorhabditis elegans and two genes in two insect species, Drosophila melanogaster and Anopheles gambiae. Six FAM20 family members were identified in the genome of the pufferfish, Fugu rubripes and five members in the zebrafish, Danio rerio. The mouse Fam20a protein was ectopically expressed in a mammalian cell line and found to be a bona fide secreted protein and efficient secretion was dependent on the integrity of the signal sequence. Expression analysis revealed that the Fam20a gene was indeed differentially expressed during hematopoietic differentiation and that the other two family members (Fam20b and Fam20c were also expressed during hematcpoiesis but that their mRNA levels did not vary significantly. Likewise FAM20A was expressed in more limited set of human tissues than the other two family members. Conclusions The FAM20 family represents a new family of secreted proteins with potential functions in regulating

  9. Phylogenetic analysis of the tenascin gene family: evidence of origin early in the chordate lineage

    Directory of Open Access Journals (Sweden)

    Tucker RP


    Full Text Available Abstract Background Tenascins are a family of glycoproteins found primarily in the extracellular matrix of embryos where they help to regulate cell proliferation, adhesion and migration. In order to learn more about their origins and relationships to each other, as well as to clarify the nomenclature used to describe them, the tenascin genes of the urochordate Ciona intestinalis, the pufferfish Tetraodon nigroviridis and Takifugu rubripes and the frog Xenopus tropicalis were identified and their gene organization and predicted protein products compared with the previously characterized tenascins of amniotes. Results A single tenascin gene was identified in the genome of C. intestinalis that encodes a polypeptide with domain features common to all vertebrate tenascins. Both pufferfish genomes encode five tenascin genes: two tenascin-C paralogs, a tenascin-R with domain organization identical to mammalian and avian tenascin-R, a small tenascin-X with previously undescribed GK repeats, and a tenascin-W. Four tenascin genes corresponding to tenascin-C, tenascin-R, tenascin-X and tenascin-W were also identified in the X. tropicalis genome. Multiple sequence alignment reveals that differences in the size of tenascin-W from various vertebrate classes can be explained by duplications of specific fibronectin type III domains. The duplicated domains are encoded on single exons and contain putative integrin-binding motifs. A phylogenetic tree based on the predicted amino acid sequences of the fibrinogen-related domains demonstrates that tenascin-C and tenascin-R are the most closely related vertebrate tenascins, with the most conserved repeat and domain organization. Taking all lines of evidence together, the data show that the tenascins referred to as tenascin-Y and tenascin-N are actually members of the tenascin-X and tenascin-W gene families, respectively. Conclusion The presence of a tenascin gene in urochordates but not other invertebrate phyla

  10. Amphioxus (Branchiostoma floridae has orthologs of vertebrate odorant receptors

    Directory of Open Access Journals (Sweden)

    Taylor John S


    Full Text Available Abstract Background A common feature of chemosensory systems is the involvement of G protein-coupled receptors (GPCRs in the detection of environmental stimuli. Several lineages of GPCRs are involved in vertebrate olfaction, including trace amine-associated receptors, type 1 and 2 vomeronasal receptors and odorant receptors (ORs. Gene duplication and gene loss in different vertebrate lineages have lead to an enormous amount of variation in OR gene repertoire among species; some fish have fewer than 100 OR genes, while some mammals possess more than 1000. Fascinating features of the vertebrate olfactory system include allelic exclusion, where each olfactory neuron expresses only a single OR gene, and axonal guidance where neurons expressing the same receptor project axons to common glomerulae. By identifying homologous ORs in vertebrate and in non-vertebrate chordates, we hope to expose ancestral features of the chordate olfactory system that will help us to better understand the evolution of the receptors themselves and of the cellular components of the olfactory system. Results We have identified 50 full-length and 11 partial ORs in Branchiostoma floridae. No ORs were identified in Ciona intestinalis. Phylogenetic analysis places the B. floridae OR genes in a monophyletic clade with the vertebrate ORs. The majority of OR genes in amphioxus are intronless and many are also tandemly arrayed in the genome. By exposing conserved amino acid motifs and testing the ability of those motifs to discriminate between ORs and non-OR GPCRs, we identified three OR-specific amino acid motifs common in cephalochordate, fish and mammalian and ORs. Conclusion Here, we show that amphioxus has orthologs of vertebrate ORs. This conclusion demonstrates that the receptors, and perhaps other components of vertebrate olfaction, evolved at least 550 million years ago. We have also identified highly conserved amino acid motifs that may be important for maintaining

  11. Structural, phylogenetic and docking studies of D-amino acid oxidase activator (DAOA, a candidate schizophrenia gene

    Directory of Open Access Journals (Sweden)

    Sehgal Sheikh


    Full Text Available Abstract Background Schizophrenia is a neurodegenerative disorder that occurs worldwide and can be difficult to diagnose. It is the foremost neurological disorder leading to suicide among patients in both developed and underdeveloped countries. D-amino acid oxidase activator (DAOA, also known as G72, is directly implicated in the glutamateric hypothesis of schizophrenia. It activates D-amino acid oxidase, which oxidizes D-serine, leading to modulation of the N-methyl-D-aspartate receptor. Methods MODELLER (9v10 was utilized to generate three dimensional structures of the DAOA candidate gene. The HOPE server was used for mutational analysis. The Molecular Evolutionary Genetics Analysis (MEGA5 tool was utilized to reconstruct the evolutionary history of the candidate gene DAOA. AutoDock was used for protein-ligand docking and Gramm-X and PatchDock for protein-protein docking. Results A suitable template (1ZCA was selected by employing BLASTp on the basis of 33% query coverage, 27% identity and E-value 4.9. The Rampage evaluation tool showed 91.1% favored region, 4.9% allowed region and 4.1% outlier region in DAOA. ERRAT demonstrated that the predicted model had a 50.909% quality factor. Mutational analysis of DAOA revealed significant effects on hydrogen bonding and correct folding of the DAOA protein, which in turn affect protein conformation. Ciona was inferred as the outgroup. Tetrapods were in their appropriate clusters with bifurcations. Human amino acid sequences are conserved, with chimpanzee and gorilla showing more than 80% homology and bootstrap value based on 1000 replications. Molecular docking analysis was employed to elucidate the binding mode of the reported ligand complex for DAOA. The docking experiment demonstrated that DAOA is involved in major amino acid interactions: the residues that interact most strongly with the ligand C28H28N3O5PS2 are polar but uncharged (Gln36, Asn38, Thr 122 and non-polar hydrophobic (Ile119, Ser171

  12. A manual collection of Syt, Esyt, Rph3a, Rph3al, Doc2, and Dblc2 genes from 46 metazoan genomes - an open access resource for neuroscience and evolutionary biology

    Directory of Open Access Journals (Sweden)

    Craxton Molly


    Full Text Available Abstract Background Synaptotagmin proteins were first identified in nervous tissue, residing in synaptic vesicles. Synaptotagmins were subsequently found to form a large family, some members of which play important roles in calcium triggered exocytic events. These members have been investigated intensively, but other family members are not well understood, making it difficult to grasp the meaning of family membership in functional terms. Further difficulty arises as families are defined quite legitimately in different ways: by common descent or by common possession of distinguishing features. One definition does not necessarily imply the other. The evolutionary range of genome sequences now available, can shed more light on synaptotagmin gene phylogeny and clarify family relationships. The aim of compiling this open access collection of synaptotagmin and synaptotagmin-like sequences, is that its use may lead to greater understanding of the biological function of these proteins in an evolutionary context. Results 46 metazoan genomes were examined and their complement of Syt, Esyt, Rph3a, Rph3al, Doc2 and Dblc2 genes identified. All of the sequences were compared, named, then examined in detail. Esyt genes were formerly named Fam62. The species in this collection are Trichoplax, Nematostella, Capitella, Helobdella, Lottia, Ciona, Strongylocentrotus, Branchiostoma, Ixodes, Daphnia, Acyrthosiphon, Tribolium, Nasonia, Apis, Anopheles, Drosophila, Caenorhabditis, Takifugu, Tetraodon, Gasterosteus, Oryzias, Danio, Xenopus, Anolis, Gallus, Taeniopygia,Ornithorhynchus, Monodelphis, Mus and Homo. All of the data described in this paper is available as additional files. Conclusions Only a subset of synaptotagmin proteins appear able to function as calcium triggers. Syt1, Syt7 and Syt9 are ancient conserved synaptotagmins of this type. Some animals carry extensive repertoires of synaptotagmin genes. Other animals of no less complexity, carry only a small

  13. Etude comparative des conditions environnementales potentiellement limitantes dans l'etablissement d'une espece aquatique envahissante Clona intestinalis (Linnaeus, 1767) dans deux systemes de bassins versants a l'ile-du Prince-Edouard, Canada (United States)

    Mclaughlin, Janelle

    rate, larval establishment and survival of juvenile tunicates. All these elements can potentially be key factors on limiting the establishment of a population of C. intestinalis in the Orwell Bay aquatic system. Keywords: Invasive species, watershed, biogeography, tunicate, Ciona intestinalis, universal soil loss equation, hydrodynamic modeling, correspondence analysis, turbidity, environmental tolerance.

  14. Epitope of titin A-band-specific monoclonal antibody Tit1 5 H1.1 is highly conserved in several Fn3 domains of the titin molecule. Centriole staining in human, mouse and zebrafish cells

    Directory of Open Access Journals (Sweden)

    Mikelsaar Aavo-Valdur


    Full Text Available Abstract Background Previously we have reported on the development of a new mouse anti-titin monoclonal antibody, named MAb Titl 5 H1.1, using the synthetic peptide N-AVNKYGIGEPLESDSVVAK-C which corresponds to an amino acid sequence in the A-region of the titin molecule as immunogen. In the human skeletal muscles, MAb Titl 5 H1.1 reacts specifically with titin in the A-band of the sarcomere and in different non-muscle cell types with nucleus and cytoplasm, including centrioles. In this report we have studied the evolutionary aspects of the binding of MAb Tit1 5 H1.1 with its target antigen (titin. Results We have specified the epitope area of MAb Tit1 5 H1.1 by subpeptide mapping to the hexapeptide N-AVNKYG-C. According to protein databases this amino acid sequence is located in the COOH-terminus of several different Fn3 domains of the A-region of titin molecule in many organisms, such as human being, mouse, rabbit, zebrafish (Danio rerio, and even in sea squirt (Ciona intestinalis. Our immunohisto- and cytochemical studies with MAb Tit1 5 H1.1 in human, mouse and zebrafish tissues and cell cultures showed a striated staining pattern in muscle cells and also staining of centrioles, cytoplasm and nuclei in non-muscle cells. Conclusions The data confirm that titin can play, in addition to the known roles in striated muscle cells also an important role in non-muscle cells as a centriole associated protein. This phenomenon is highly conserved in the evolution and is related to Fn3 domains of the titin molecule. Using titin A-band-specific monoclonal antibody MAb Tit1 5 H1.1 it was possible to locate titin in the sarcomeres of skeletal muscle cells and in the centrioles, cytoplasm and nuclei of non-muscle cells in phylogenetically so distant organisms as Homo sapiens, Mus musculus and zebrafish (Danio rerio.

  15. Identification and correction of abnormal, incomplete and mispredicted proteins in public databases

    Directory of Open Access Journals (Sweden)

    Bányai László


    Full Text Available Abstract Background Despite significant improvements in computational annotation of genomes, sequences of abnormal, incomplete or incorrectly predicted genes and proteins remain abundant in public databases. Since the majority of incomplete, abnormal or mispredicted entries are not annotated as such, these errors seriously affect the reliability of these databases. Here we describe the MisPred approach that may provide an efficient means for the quality control of databases. The current version of the MisPred approach uses five distinct routines for identifying abnormal, incomplete or mispredicted entries based on the principle that a sequence is likely to be incorrect if some of its features conflict with our current knowledge about protein-coding genes and proteins: (i conflict between the predicted subcellular localization of proteins and the absence of the corresponding sequence signals; (ii presence of extracellular and cytoplasmic domains and the absence of transmembrane segments; (iii co-occurrence of extracellular and nuclear domains; (iv violation of domain integrity; (v chimeras encoded by two or more genes located on different chromosomes. Results Analyses of predicted EnsEMBL protein sequences of nine deuterostome (Homo sapiens, Mus musculus, Rattus norvegicus, Monodelphis domestica, Gallus gallus, Xenopus tropicalis, Fugu rubripes, Danio rerio and Ciona intestinalis and two protostome species (Caenorhabditis elegans and Drosophila melanogaster have revealed that the absence of expected signal peptides and violation of domain integrity account for the majority of mispredictions. Analyses of sequences predicted by NCBI's GNOMON annotation pipeline show that the rates of mispredictions are comparable to those of EnsEMBL. Interestingly, even the manually curated UniProtKB/Swiss-Prot dataset is contaminated with mispredicted or abnormal proteins, although to a much lesser extent than UniProtKB/TrEMBL or the EnsEMBL or GNOMON

  16. A review of contemporary patterns of endemism for shallow water reef fauna in the Red Sea

    KAUST Repository

    DiBattista, Joseph


    Aim The Red Sea is characterised by a unique fauna and historical periods of desiccation, hypersalinity and intermittent isolation. The origin and contemporary composition of reef-associated taxa in this region can illuminate biogeographical principles about vicariance and the establishment (or local extirpation) of existing species. Here we aim to: (1) outline the distribution of shallow water fauna between the Red Sea and adjacent regions, (2) explore mechanisms for maintaining these distributions and (3) propose hypotheses to test these mechanisms. Location Red Sea, Gulf of Aden, Arabian Sea, Arabian Gulf and Indian Ocean. Methods Updated checklists for scleractinian corals, fishes and non-coral invertebrates were used to determine species richness in the Red Sea and the rest of the Arabian Peninsula and assess levels of endemism. Fine-scale diversity and abundance of reef fishes within the Red Sea were explored using ecological survey data. Results Within the Red Sea, we recorded 346 zooxanthellate and azooxanthellate scleractinian coral species of which 19 are endemic (5.5%). Currently 635 species of polychaetes, 211 echinoderms and 79 ascidians have been documented, with endemism rates of 12.6%, 8.1% and 16.5% respectively. A preliminary compilation of 231 species of crustaceans and 137 species of molluscs include 10.0% and 6.6% endemism respectively. We documented 1071 shallow fish species, with 12.9% endemic in the entire Red Sea and 14.1% endemic in the Red Sea and Gulf of Aden. Based on ecological survey data of endemic fishes, there were no major changes in species richness or abundance across 1100 km of Saudi Arabian coastline. Main conclusions The Red Sea biota appears resilient to major environmental fluctuations and is characterized by high rates of endemism with variable degrees of incursion into the Gulf of Aden. The nearby Omani and Arabian Gulfs also have variable environments and high levels of endemism, but these are not consistently distinct

  17. The fester locus in Botryllus schlosseri experiences selection

    Directory of Open Access Journals (Sweden)

    Nydam Marie L


    Full Text Available Abstract Background Allorecognition, the ability of an organism to distinguish self from non-self, occurs throughout the entire tree of life. Despite the prevalence and importance of allorecognition systems, the genetic basis of allorecognition has rarely been characterized outside the well-known MHC (Major Histocompatibility Complex in vertebrates and SI (Self-Incompatibility in plants. Where loci have been identified, their evolutionary history is an open question. We have previously identified the genes involved in self/non-self recognition in the colonial ascidian Botryllus schlosseri, and we can now begin to investigate their evolution. In B. schlosseri, colonies sharing 1 or more alleles of a gene called FuHC (Fusion Histocompatibility will fuse. Protein products of a locus called fester, located ~300 kb from FuHC, have been shown to play multiple roles in the histocompatibility reaction, as activating and/or inhibitory receptors. We test whether the proteins encoded by this locus are evolving neutrally or are experiencing balancing, directional, or purifying selection. Results Nearly all of the variation in the fester locus resides within populations. The 13 housekeeping genes (12 nuclear genes and mitochondrial cytochrome oxidase I have substantially more structure among populations within groups and among groups than fester. All polymorphism statistics (Tajima's D, Fu and Li's D* and F* are significantly negative for the East Coast A-type alleles, and Fu and Li's F* statistic is significantly negative for the West Coast A-type alleles. These results are likely due to selection rather than demography, given that 10 of the housekeeping loci have no populations with significant values for any of the polymorphism statistics. The majority of codons in the fester proteins have ω values 95% posterior probability of ω values > 1. Conclusion Fester proteins are evolving non-neutrally. The polymorphism statistics are consistent with either

  18. Differential responses of emergent intertidal coral reef fauna to a large-scale El-Niño southern oscillation event: sponge and coral resilience. (United States)

    Kelmo, Francisco; Bell, James J; Moraes, Simone Souza; Gomes, Rilza da Costa Tourinho; Mariano-Neto, Eduardo; Attrill, Martin J


    There is a paucity of information on the impacts of the 1997-8 El Niño event and subsequent climatic episodes on emergent intertidal coral reef assemblages. Given the environmental variability intertidal reefs experience, such reefs may potentially be more resilient to climatic events and provide important insights into the adaptation of reef fauna to future ocean warming. Here we report the results of a 17-year (1995-2011) biodiversity survey of four emergent coral reef ecosystems in Bahia, Brazil, to assess the impact of a major El Niño event on the reef fauna, and determine any subsequent recovery. The densities of two species of coral, Favia gravida and Siderastrea stellata, did not vary significantly across the survey period, indicating a high degree of tolerance to the El Niño associated stress. However, there were marked decreases in the diversity of other taxa. Molluscs, bryozoans and ascidians suffered severe declines in diversity and abundance and had not recovered to pre-El Niño levels by the end of the study. Echinoderms were reduced to a single species in 1999, Echinometra lucunter, although diversity levels had recovered by 2002. Sponge assemblages were not impacted by the 1997-8 event and their densities had increased by the study end. Multivariate analysis indicated that a stable invertebrate community had re-established on the reefs after the El Niño event, but it has a different overall composition to the pre-El Niño community. It is unclear if community recovery will continue given more time, but our study highlights that any increase in the frequency of large-scale climatic events to more than one a decade is likely to result in a persistent lower-diversity state. Our results also suggest some coral and sponge species are particularly resilient to the El Niño-associated stress and therefore represent suitable models to investigate temperature adaptation in reef organisms. PMID:24675785

  19. Hemichordates and the Origin of Chordates (United States)

    Gerhart, John; Kirschner, Marc; Lowe, Chris


    At the start of the period of the NASA grant three years ago, we had no information on the organization and development of the body axis of the hemichordate, Saccoglossus kowalevskii. Now we have substantial findings about the anteroposterior axis and dorsoventral axis, and based on this information, we have new insights about the origin of chordates from ancestral deuterostomes. We found ways to obtain and preserve large numbers of embryos and hatched juveniles. We can now collect about 40,000 embryos in the month of September, the time of S. kowalevskii spawning at Woods Hole. Excellent cDNA libraries were prepared from three developmental stages. From these libraries, we directly isolated about 30 gene ortholog sequences by screening and pcr techniques, all of these sequences of interest in the inquiry about the animal's organization and development. We also performed a mid-sized EST project (60,000 randomly picked clones, many of these arrayed). About half of these have been analyzed so far by blastx and are suitable for direct use of clones. We have obtained about 50 interesting sequences from this set. The rest still await analysis. Thus, at this time we have isolated orthologs of 80 genes that are known to be expressed in chordates in conserved domains and known to have interesting roles in chordate organization and development. The orthology of the S. kowalevskii sequences has been verified by neighbor joining and parsimony methods, with bootstrap estimates of validity. The S. kowalevskii sequences cluster with other deuterostome sequences, namely, other hemichordates, echinoderms, ascidians, amphioxus, or vertebrates, depending on what sequences are available in the database for comparison. We have used these sequences to do high quality in situ hybridization on S. kowalevskii embryos, and the results can be divided into three sections-those concerning the anteroposterior axis of S. kowalevskii in comparison to the same axis of chordates, those concerning

  20. Evolution of the interaction between Runx2 and VDR, two transcription factors involved in osteoblastogenesis

    Directory of Open Access Journals (Sweden)

    Barriga Elias H


    , using pull-down experiments between recombinant proteins, we show that the VDR homologue from teleosts, but not from ascidians, is able to directly interact with the mammalian Runx2 homologue. Conclusions We propose an evolutionary scenario for the assembly of the molecular machinery involving Runx2 and VDR in vertebrates. In the last common ancestor of actinopterygians and sacropterygians, the three Runx paralogues possessed the potential to physically and functionally interact with the VDR protein. Therefore, 1α,25-dihydroxyvitamin D3 might have been able to modulate the transcriptional activity of Runx1, Runx2 or Runx3 in the tissues expressing VDR. After the split from amphibians, in the lineage leading to amniotes, Runx2 and VDR became robustly co-expressed in developing skeletal elements, and their regulatory interaction was incorporated in the genetic program involved in the specification and differentiation of osteoblasts.

  1. Sperm precedence in a novel context: mating in a sessile marine invertebrate with dispersing sperm. (United States)

    Bishop, J D; Pemberton, A J; Noble, L R


    The compound ascidian Diplosoma listerianum releases aquatic sperm which are dispersed passively to potential mates as individual gametes prior to storage of sperm, internal fertilization and brooding of embryos. The storage of exogenous sperm enables D. listerianum to produce a lengthy series of progeny following a brief period of mating. Molecular paternity analysis following sequential mating of colonies in laboratory culture revealed a consistent pattern with a clear initial bias in paternity towards the first of two acting males. The sites of sperm storage and fertilization and the morphology of the ovary in D. listerianum suggest that this bias reflects first-in-first-out use of individual stored gametes. The proportion of second-male paternity subsequently increased with time within the progeny arrays. This may have reflected the ageing or passive loss of first-male sperm. It is also possible that the modular nature of the organism contributed to this temporal trend: any recently budded colony modules maturing in the interval between matings would have been available exclusively to second-male sperm as virgin zooids. Two sets of mating trials were run. In the first, the collection of progeny suffered an interruption of 13 days and each male gained a larger proportion of recorded paternity within the progeny analysed when mating first rather than when mating second. In one mating combination, the first male obtained almost 100% of recorded paternity. In the second set of trials, with different clonal combinations, the complete sequence of progeny was collected and the estimated overall proportion of second-male paternity (P2) was consistently > 0.5. Taken as a whole, the results suggest that the overall P2-value can vary widely within the population studied. Proposed mechanisms of mating-order effects in species with copulatory mating include several which can have no counterpart in indirect aquatic mating since they involve the active removal, sealing off

  2. Proximate composition of marine invertebrates from tropical coastal waters, with emphasis on the relationship between nitrogen and protein contents

    Directory of Open Access Journals (Sweden)

    Graciela S Diniz


    Full Text Available The chemical profiles of Desmapsamma anchorata, Hymeniacidon heliophila (Porifera, Bunodosoma caissarum, Renilla muelleri (Cnidaria, Aplysia brasiliana, Eledone massyae, Isognomon bicolor (Mollusca, Echinaster brasiliensis, Echinometra lucunter, Holothuria grisea, Lytechinus variegatus (Echinodermata, and Phallusia nigra (Chordata were determined. Hydrosoluble protein was the most abundant class of substances for all species, except for the ascidian Phallusia nigra, in which the carbohydrate content was higher. The percentages of hydrosoluble protein (dry weight, dw varied widely among the invertebrates, ranging from 5.88% (R. muelleri to 47.6% (Eledone massyae of the dw .The carbohydrate content fluctuated from 1.3% (R. muelleri to 18.4% (Aplysia brasiliana of the dw. For most of the species, lipid was the second most abundant class of substances, varying from 2.8% (R. muelleri to 25.3% (Echinaster brasiliensis of the dw. Wide variations were also found for the invertebrates nitrogen content, with the lowest value recorded in the cnidarian R. muelleri (2.02% of the dw and the highest in the molluscan E. massyae (12.7% of the dw. The phosphorus content of the dw varyed from 0.24% (R. muelleri to 1.16% (E. massyae. The amino acid composition varied largely among the species, but for most of the species glycine, arginine, glutamic acid, and aspartic acid were the most abundant amino acids, with histidine and tyrosine among the less abundant amino acids. The actual content of total protein in the samples was calculated by the sum of amino acid residues, establishing dw values that fluctuated from 11.1% (R. muelleri to 66.7% (E. massyae. The proteinaceous nitrogen content was high in all species, with an average value of 97.3% of the total nitrogen. From data of total amino acid residues and total nitrogen, specific nitrogen-to-protein conversion factors were calculated for each species. The nitrogen-to-protein conversion factors ranged from 5.10 to

  3. Zoogeografia storica e attuale dei carnivori e degli ungulati italiani

    Directory of Open Access Journals (Sweden)

    Marco Masseti


    futuro a preservare inalterate le caratteristiche genetiche dei taxa "nativi" del territorio italiano. A parte alcuni casi di ampliamento spontaneo degli areali di distribuzione, anche le attuali composizioni a carnivori mostrano spesso le evidenze di un'alterazione preoccupante dei quadri biogeografici originari. L'eredità della ridefinizione globale degli equilibri ecologici originari italiani, condotta dall'uomo a partire dalle epoche preistoriche e continuata in quelle storiche senza apparente soluzione di continuità, suscita problemi di conservazione e di gestione non indifferenti. Fra di essi, deve essere tenuta in particolare conto la constatazione del fatto che, nella maggior parte dei casi, è impossibile ricostruire gli ecosistemi naturali del passato, poiché questi sono andati definitivamente distrutti e perduti da millenni. Riguardo, poi, alla vulnerabilità degli ecosistemi è anche piuttosto difficile riuscire a scongiurare in forma preventiva il rischio di nuove, future introduzioni. Va infine notato che in più di un caso le definizioni tassonomiche di cui disponiamo sono state basate su caratteri spesso inconsistenti e variabili, suscitando ancora oggi perplessità sulla validità sistematica di certi taxa, soprattutto se considerati a livello subspecifico. Carnivori Canis aureus (L., 1758 Canis lupus L., 1758 Vulpes vulpes (L., 1758 Nyctereutes procyonoides (Gray, 1834 Ursus arctos (L., 1758 Procion lotor (L., 1758 Mustela erminea L., 1758 Mustela nivalis L., 1766 Mustela putorius L., 1758 Mustela vison Schreber, 1777 Martes foina (Erxleben, 1777 Martes martes (L., 1758 Meles meles (L., 1758 Lutra lutra (L., 1758 Genetta genetta (L., 1758 Herpestes edwardsii (E. Geoffroy, 1818 Felis silvestris Schreber, 1775 Lynx lynx (L., 1758 Artiodattili Sus scrofa

  4. A Microscopic Capacitor Model of Voltage Coupling in Membrane Proteins: Gating Charge Fluctuations in Ci-VSD. (United States)

    Kim, Ilsoo; Warshel, Arieh


    The voltage sensitivity of membrane proteins is reflected in the response of the voltage sensing domains (VSDs) to the changes in membrane potential. This response is implicated in the displacement of positively charged residues, associated with the conformational changes of VSDs. The displaced charges generate nonlinear (i.e., voltage-dependent) capacitance current called the gating current (and its corresponding gating charge), which is a key experimental quantity that characterizes voltage activation in VSMP. However, the relevant theoretical/computational approaches, aimed to correlate the structural information on VSMP to electrophysiological measurements, have been rather limited, posing a broad challenge in computer simulations of VSMP. Concomitant with the development of our coarse-graining (CG) model of voltage coupling, we apply our theoretical framework for the treatments of voltage effects in membrane proteins to modeling the VSMP activation, taking the VSDs (Ci-VSD) derived from the Ciona intestinalis voltage sensitive phosphatase (Ci-VSP) as a model system. Our CG model reproduces the observed gating charge of Ci-VSD activation in several different perspectives. In particular, a new closed-form expression of the gating charge is evaluated in both nonequilibrium and equilibrium ways, while considering the fluctuation-dissipation relation that connects a nonequilibrium measurement of the gating charge to an equilibrium measurement of charge fluctuations (i.e., the voltage-independent linear component of membrane capacitance). In turn, the expression uncovers a novel link that connects an equilibrium measurement of the voltage-independent linear capacitance to a nonequilibrium measurement of the voltage-dependent nonlinear capacitance (whose integral over voltage is equal to the gating charge). In addition, our CG model yields capacitor-like voltage dependent free energy parabolas, resulting in the free energy difference and the free energy barrier for

  5. Mercado global y ciudadanía civil. La recuperación del horizonte de la emancipación humana en la filosofía política de Franz Hinkelammert

    Directory of Open Access Journals (Sweden)

    Estela Fernández Nadal


    Full Text Available A par tir del aná li sis crí ti co de las obras fun da men ta les de Hin ke lam mert, pro cu ra mos sis te ma ti zar su pen sa mien to éti co y po lí ti co en tor no de la opo si ción “mer ca do glo bal/ciu da da - nía ci vil”. Des ta ca mos el es fuer zo por res ca tar las po ten cia li da des li ber ta rias de la ca te go ría de ciu da da nía sin des co no cer sus lí mi tes ideo ló gi - cos y prác ti cos. Por una par te, está cla ro que la apa ri ción del “ciu da da no” es el re sul ta do his tó ri - co de las re vo lu cio nes bur gue sas y el pro duc to de una ope ra ción de ho mo lo ga ción que pone en tre pa rén te sis las de si gual da des rea les, sin su pri mir - las. Pero por otro, la “ciu da da nía” en cie rra una pa ra do ja con al can ces eman ci pa to rios, pues re - mi te a la fun da ción del es pa cio pú bli co, que se le - gi ti ma como an te rior a las de man das e in te re ses pri va dos. A par tir de allí, nues tro fi ló so fo con - clu ye la ne ce si dad de in te grar la crí ti ca mar xis ta a la ley del va lor como re gu la do ra de las re la cio - nes so cia les y a la igual dad con trac tual como pro duc to ra de dis cri mi na cio nes al in te rior de la so cie dad bur gue sa, con el ho ri zon te de la ciu da - da nía ci vil que pro ce de de la tra di ción del ra ciona lismoliberal. Sinembargo Hin ke lam mert no se con ten ta con pos tu lar una síntesis en tre dos tradiciones diferentes; por el contrario, propone una reflexión inquietante, completamente discordante en el contexto actual de la filosofía política y ajena a la preocupación por legitimar la democracia como forma de organización política acotada en el ejercicio de procedimientos de representación y delegación, y ciega ante las interpelaciones del sujeto real.