
Sample records for ascaris suum nematoda

  1. Effect of Penicillium frequentans and Stachybotrys chartarum on respiratory metabolism of developing eggs of Ascaris suum (Nematoda)


    Lidia Kołodziejczyk; Wanda Kuźna-Grygiel; Krystyna Janowicz; Kinga Mazurkiewicz-Zapałowicz


    Effect of saprotrophic soil fungi Penicillium frequentans and Stachybotrys chartarum on respiratory metabolism of Ascaris suum, during its embryogenesis was determined using histoenzymatic methods. Based on histochemical assessment of the enzyme actvity (glycolysis-lactate dehydrogenase-LDH; tricarboxylic acid cycle-succinate dehydrogenase-SDH) changes in the energy metabolism of developing eggs of A. suvm were detected. Of the fungi species tested - P. frequentans caused the most extensive d...

  2. Are Ascaris lumbricoides and Ascaris suum a single species?


    Leles Daniela; Gardner Scott L; Reinhard Karl; Iñiguez Alena; Araujo Adauto


    Abstract Since the original description and naming of Ascaris lumbricoides from humans by Linnaeus in 1758 and later of Ascaris suum from pigs by Goeze 1782, these species have been considered to be valid. Four hypotheses relative to the conspecificity or lack thereof (and thus origin of these species) are possible: 1) Ascaris lumbricoides (usually infecting humans) and Ascaris suum (recorded mostly from pigs) are both valid species, with the two species originating via a speciation event fro...

  3. Transmission dynamics of Ascaris suum in organic pigs


    Gautam, Susmita


    The transmission of Ascaris suum depends upon the type of swine production system. Organic farm with outdoor facilities provide favorable conditions for the development and survival of this soil transmitted helminth. The present study was carried out from late October 2013 to late February 2014 to study the infection dynamics of A. suum in pigs born and raised on two Danish organic.

  4. Immunological studies on Ascaris suum infections in mice

    NARCIS (Netherlands)

    Phan van Than*; Knapen; F.van


    Het betreft een rapportage van onderzoek dat werd verricht door Dr.Phan van Than, Instituut voor Parasitologie, Medische Faculteit Hanoi, Vietnam. Dr.Than heeft zich in het bijzonder bezig gehouden met het toetsen van verschillende antigenen afkomstig van Ascaris suum en Ascaris lumbricoides lar

  5. Untersuchung zur Übertragung von Ascaris suum durch Ratten (Rattus norvegicus).


    Gaberle, Alexandra


    Investigation on the transmission of Ascaris suum by rats (Rattus norvegicus). In this study the possibility of rats being paratenic hosts of Ascaris suum were examined. Therefore an infection of swine with Ascaris suum by infected rats should be provoked. A group of 48 rats were experimentally infected with eggs of Ascaris suum. The rats were killed in different time intervals. They were examined for migrating larvae by digesting the organs and counting the developed larvae and by pr...

  6. Comparative analysis of microRNA profiles between adult Ascaris lumbricoides and Ascaris suum


    Shao, Chang-Chun; Xu, Min-Jun; Alasaad, Samer; Song, Hui-Qun; Peng, Lifei; Tao, Jian-Ping; Zhu, Xing-Quang


    Background: The parasitic nematodes Ascaris lumbricoides and A. suum are of great public health and economic significance, and the two taxa were proposed to represent a single species. miRNAs are known with functions of gene regulations at post-transcriptional level. Results: We herein compared the miRNA profiles of A. lumbricoides and A. suum female adults by Solexa deep sequencing combined with bioinformatics analysis and stem-loop real-time PCR. Using the A. suum genome as the ...

  7. Immunological studies on Ascaris suum infections in mice


    Phan van Than*; Knapen; F


    Het betreft een rapportage van onderzoek dat werd verricht door Dr.Phan van Than, Instituut voor Parasitologie, Medische Faculteit Hanoi, Vietnam. Dr.Than heeft zich in het bijzonder bezig gehouden met het toetsen van verschillende antigenen afkomstig van Ascaris suum en Ascaris lumbricoides larven op geschiktheid voor het opwekken van beschermende immuniteit in muizen. Tevens werd gekeken naar het gebruik van deze antigenen voor het verrichten van serodiagnostiek. Uit het onderzoek is naar v...

  8. Inactivation of Ascaris suum by short-chain fatty acids (United States)

    Ascaris suum eggs were inactivated in distilled water and digested sludge by butanoic, pentanoic and hexanoic acids. The fatty acids (FA) were only effective when protonated and at sufficient concentration. The conjugate bases were not effective at the concentrations evaluated. Predictions from an ...

  9. Bacillus thuringiensis-derived Cry5B has potent anthelmintic activity against Ascaris suum (United States)

    Ascaris suum and Ascaris lumbricoides are two closely related geo-helminth parasites that ubiquitously infect pigs and humans, respectively. Ascaris suum infection in pigs is considered a good model for A. lumbricoides infection in humans because of a similar biology and tissue migration to the inte...

  10. Comparative analysis of microRNA profiles between adult Ascaris lumbricoides and Ascaris suum


    Shao, Chang-Chun; Xu, Min-Jun; Alasaad, Samer; Song, Hui-Qun; Peng, Lifei; Tao, Jian-Ping; Zhu, Xing-Quang


    Abstract Background The parasitic nematodes Ascaris lumbricoides and A. suum are of great public health and economic significance, and the two taxa were proposed to represent a single species. miRNAs are known with functions of gene regulations at post-transcriptional level. Results We herein compared the miRNA profiles of A. lumbricoides and A. suum female adults by Solexa deep sequencing combined with bioinformatics analysis and stem-loop real-time PCR. Using the A. suum genome as the refer...

  11. Comparative analysis of microRNA profiles between adult Ascaris lumbricoides and Ascaris suum


    Shao, Chang-Chun; Xu, Min-Jun; Alasaad, Samer; Song, Hui-Qun; Peng, Lifei; Tao, Jian-Ping; Zhu, Xing-Quan


    Background The parasitic nematodes Ascaris lumbricoides and A. suum are of great public health and economic significance, and the two taxa were proposed to represent a single species. miRNAs are known with functions of gene regulations at post-transcriptional level. Results We herein compared the miRNA profiles of A. lumbricoides and A. suum female adults by Solexa deep sequencing combined with bioinformatics analysis and stem-loop real-time PCR. Using the A. suum genome as the reference geno...

  12. Effects of Disinfectants on Larval Development of Ascaris suum Eggs. (United States)

    Oh, Ki-Seok; Kim, Geon-Tae; Ahn, Kyu-Sung; Shin, Sung-Shik


    The objective of this study was to evaluate the effects of several different commercial disinfectants on the embryogenic development of Ascaris suum eggs. A 1-ml aliquot of each disinfectant was mixed with approximately 40,000 decorticated or intact A. suum eggs in sterile tubes. After each treatment time (at 0.5, 1, 5, 10, 30, and 60 min), disinfectants were washed away, and egg suspensions were incubated at 25˚C in distilled water for development of larvae inside. At 3 weeks of incubation after exposure, ethanol, methanol, and chlorohexidin treatments did not affect the larval development of A. suum eggs, regardless of their concentration and treatment time. Among disinfectants tested in this study, 3% cresol, 0.2% sodium hypochlorite and 0.02% sodium hypochlorite delayed but not inactivated the embryonation of decorticated eggs at 3 weeks of incubation, because at 6 weeks of incubation, undeveloped eggs completed embryonation regardless of exposure time, except for 10% povidone iodine. When the albumin layer of A. suum eggs remained intact, however, even the 10% povidone iodine solution took at least 5 min to reasonably inactivate most eggs, but never completely kill them with even 60 min of exposure. This study demonstrated that the treatment of A. suum eggs with many commercially available disinfectants does not affect the embryonation. Although some disinfectants may delay or stop the embryonation of A. suum eggs, they can hardly kill them completely. PMID:26951988

  13. Bacillus thuringiensis-derived Cry5B Has Potent Anthelmintic Activity against Ascaris suum


    Urban, Joseph F.; Hu, Yan; Miller, Melanie M; Scheib, Ulrike; Ying Y Yiu; Aroian, Raffi V.


    Ascaris suum and Ascaris lumbricoides are two closely related geo-helminth parasites that ubiquitously infect pigs and humans, respectively. Ascaris suum infection in pigs is considered a good model for A. lumbricoides infection in humans because of a similar biology and tissue migration to the intestines. Ascaris lumbricoides infections in children are associated with malnutrition, growth and cognitive stunting, immune defects, and, in extreme cases, life-threatening blockage of the digestiv...

  14. Elektroforetska analiza proteina iz spolnih organa i kutikule glista Ascaris lumbricoides i Ascaris suum


    Alba, Julisar Elaine; Normandee Comia, Mary; Oyong, Glenn; Claveria, Florencia


    Ascaris lumbricoides i Ascaris suum bili su analizirani radi utvrđivanja sličnosti i razlike u elektroforetskoj pokretljivosti proteina iz njihove kutikule i spolnih organa. U obje vrste dokazana je znatna sličnost proteinskoga profila. Elektroforezom iscrpka kutikule ženki ustanovljeno je deset zajedničkih vrpci za obje vrste, dok je elektroforezom proteina kutikule mužjaka dobiveno 12 zajedničkih vrpci proteina od čega je najmanje pet proteina bilo zajedničko za oba spola. Usporedbom protei...

  15. Comparison of different monoclonal antibodies against immunosuppressive proteins of Ascaris suum


    T.M. Oshiro; A. Rafael; C.S. Enobe; Fernandes, I; Macedo-Soares, M.F.


    The extract of Ascaris suum suppresses the humoral and cellular immune responses to unrelated antigens in the mouse. In order to further characterize the suppressive components of A. suum, we produced specific monoclonal antibodies which can provide an important tool for the identification of these proteins. The A. suum immunosuppressive fractions isolated by gel filtration from an extract of adult worms were used to immunize BALB/c mice. Popliteal lymph node cells taken from the immunized an...

  16. In vivo testing of alternatives for conventional treatment of Ascaris suum in pigs


    Krimpen, van, M.M.; Binnendijk, G.P.; Borgsteede, F.H.M.; Gaasenbeek, C.P.H.


    Summary The percentage of disapproved livers of growing and finishing pigs has been increased significantly during the last years. In organic pig farms, this percentage is often higher than in conventional pig farms. In most cases, disapproved livers are the result of an infection with Ascaris suum. Usually, an infection of Ascaris suum is treated or controlled by using conventional synthetic drugs belonging to the benzimidazoles, levamisole and macrocyclic lactones. Organic farmers, howev...

  17. Ascaris suum in Saskatchewan Pigs: An Abattoir Survey of Prevalence and Intensity of Infection


    Polley, L. R.; Mostert, P. E.


    In a survey of 2500 market weight pigs in a Saskatchewan abattoir, 37% were infected with adult Ascaris suum and in 46% there were milkspot hepatic lesions. A total of 60% of the pigs examined had some evidence of A. suum infection. Most infected pigs contained less than 50 adult ascarids.

  18. Anthelmintic effects of phytogenic feed additives in Ascaris suum inoculated pigs

    NARCIS (Netherlands)

    Krimpen, van M.M.; Binnendijk, G.P.; Borgsteede, F.H.M.; Gaasenbeek, C.P.H.


    Two experiments were performed to determine the anthelmintic effect of some phytogenic feed additives on a mild infection of Ascaris suum in growing and finishing pigs. Usually, an infection of A. suum is controlled by using conventional synthetic drugs. Organic farmers, however, prefer a non-pharma

  19. Phosphorylation of the pyruvate dehydrogenase complex isolated from Ascaris suum

    Energy Technology Data Exchange (ETDEWEB)

    Thissen, J.; Komuniecki, R.


    The pyruvate dehydrogenase complex (PDC) from body wall muscle of the porcine nematode, Ascaris suum, plays a pivotal role in anaerobic mitochondrial metabolism. As in mammalian mitochondria, PDC activity is inhibited by the phosphorylation of the ..cap alpha..PDH subunit, catalyzed by an associated PDH/sub a/ kinase. However, in contrast to PDC's isolated from all other eukaryotic sources, phosphorylation decreases the mobility of the ..cap alpha..PDH subunit on SDS-PAGE and permits the separation of the phosphorylated and nonphosphorylated ..cap alpha..PDH's. Phosphorylation and the inactivation of the Ascaris PDC correspond directly, and the additional phosphorylation that occurs after complete inactivation in mammalian PDC's is not observed. The purified ascarid PDC incorporates 10 nmoles /sup 32/P/mg P. Autoradiography of the radiolabeled PDC separated by SDS-PAGE yields a band which corresponds to the phosphorylated ..cap alpha..PDH and a second, faint band which is present only during the first three minutes of PDC inactivation, intermediate between the phosphorylated and nonphosphorylated ..cap alpha..PDH subunit. Tryptic digests of the /sup 32/P-PDC yields one major phosphopeptide, when separated by HPLC, and its amino acid sequence currently is being determined.

  20. Phosphorylation of the pyruvate dehydrogenase complex isolated from Ascaris suum

    International Nuclear Information System (INIS)

    The pyruvate dehydrogenase complex (PDC) from body wall muscle of the porcine nematode, Ascaris suum, plays a pivotal role in anaerobic mitochondrial metabolism. As in mammalian mitochondria, PDC activity is inhibited by the phosphorylation of the αPDH subunit, catalyzed by an associated PDH/sub a/ kinase. However, in contrast to PDC's isolated from all other eukaryotic sources, phosphorylation decreases the mobility of the αPDH subunit on SDS-PAGE and permits the separation of the phosphorylated and nonphosphorylated αPDH's. Phosphorylation and the inactivation of the Ascaris PDC correspond directly, and the additional phosphorylation that occurs after complete inactivation in mammalian PDC's is not observed. The purified ascarid PDC incorporates 10 nmoles 32P/mg P. Autoradiography of the radiolabeled PDC separated by SDS-PAGE yields a band which corresponds to the phosphorylated αPDH and a second, faint band which is present only during the first three minutes of PDC inactivation, intermediate between the phosphorylated and nonphosphorylated αPDH subunit. Tryptic digests of the 32P-PDC yields one major phosphopeptide, when separated by HPLC, and its amino acid sequence currently is being determined

  1. Survival of salmonella and Ascaris suum eggs in a thermophilic biogas plant

    Energy Technology Data Exchange (ETDEWEB)

    Plym-Forshell, L. [Swedish Univ. of Agricultural Sciences, Dept. of Animal Hygiene, Faculty of Veterinary Medicine, Skara (Denmark)


    In a continuous biogas plant, receiving manure from 200 dairy cows and 400 calves and young stock, survival of salmonella and Ascaris suum eggs was studied. The bacteria and parasite eggs were kept in filter sacs in the manure that ha a temperature of 55 deg. C. No viable salmonella or Ascaris suum eggs could be found after 24 h in the digester. Survival of salmonella and Ascaris suum eggs was also studied in the manure pit where the manure was stored after digestion. The temperature in the manure pit varied between 22-27 deg. C. Salmonella survived 35 but not 42 days. On day 56, when the experiments had to be stooped, 60% of the Ascaris eggs were viable. (au) 30 refs.

  2. Immunizing pigs with Ascaris suum hemoglobin increases the inflammatory response in the liver but fails to induce a protective immunity (United States)

    To determine whether purified Ascaris suum hemoglobin (AsHb) is a suitable vaccine candidate for the control of Ascaris infections, pigs were 30 vaccinated with AsHb in combination with QuilA adjuvant and challenged with A. suum eggs. The number of liver lesions and worms in the intestine was assess...

  3. DNA extraction from Ascaris suum muscle tissue


    Di Mito, Carmela; Betschart, Bruno


    A new method for the extraction of DNA from Ascaris suum muscle has been developed. It combines a standard SDS-based extraction with a plant DNA extraction procedure. The use of SDS and proteinase K allows the elimination of proteins, while CTAB and polyclar AT eliminate glycogen and polyphenols. The DNA thus obtained can easily be digested by endonucleases and amplified by PCR.

  4. Effect of some herbs as alternative for conventional treatment of Ascaris suum in pigs

    NARCIS (Netherlands)

    Krimpen, van M.M.; Binnendijk, G.P.; Borgsteede, F.H.M.; Gaasenbeek, C.P.H.


    Het doel van het onderzoek was na te gaan wat de preventieve werking is van drie enkelvoudige kruiden, elk met een verschillend vermeend werkingsmechanisme (proteolytische enzymen, alkaloïden, bitterstoffen), op een milde besmetting met spoelwormen (Ascaris suum) bij vleesvarkens. Het besmettingsniv

  5. Galloylated proanthocyanidins from shea (Vitellaria paradoxa) meal have potent anthelmintic activity against Ascaris suum

    DEFF Research Database (Denmark)

    Ramsay, A; Williams, A R; Thamsborg, S M;


    -O-gallates, especially EGCg (575mg/kg meal), which is known for its health and anti-parasitic benefits. Proanthocyanidins were isolated and tested for bioactivity against Ascaris suum, which is an important parasite of pigs. Migration and motility tests revealed that these PA have potent activity against this parasitic...

  6. A role for eosinophils in the intestinal immunity against infective Ascaris suum larvae.

    Directory of Open Access Journals (Sweden)

    Dries Masure

    Full Text Available The aim of this study was to explore the mechanisms of resistance against invading Ascaris suum larvae in pigs. Pigs received a low dose of 100 A. suum eggs daily for 14 weeks. This resulted in a >99% reduction in the number of larvae that could migrate through the host after a challenge infection of 5000 A. suum eggs, compared to naïve pigs. Histological analysis at the site of parasite entry, i.e. the caecum, identified eosinophilia, mastocytosis and goblet cell hyperplasia. Increased local transcription levels of genes for IL5, IL13, eosinophil peroxidase and eotaxin further supported the observed eosinophil influx. Further analysis showed that eosinophils degranulated in vitro in response to contact with infective Ascaris larvae in the presence of serum from both immune and naïve animals. This effect was diminished with heat-inactivated serum, indicating a complement dependent mechanism. Furthermore, eosinophils were efficient in killing the larvae in vitro when incubated together with serum from immune animals, suggesting that A. suum specific antibodies are required for efficient elimination of the larvae. Together, these results indicate an important role for eosinophils in the intestinal defense against invading A. suum larvae.

  7. Profiling gene expression in mesenteric lymph nodes in pigs with different levels of resistance to Ascaris suum

    DEFF Research Database (Denmark)

    Skallerup, Per; Nejsum, Peter; Cirera, Susanna;


    A single nucleotide polymorphism on chromosome 4 (SNP TXNIP) has been reported to be associated with roundworm (Ascaris suum) burden in pigs. The objective of the present study was to profile the immune response mounted by pigs with two SNP TXNIP genotypes following an A. suum infection. We selec...

  8. Mitochondrial ultrastructural and atpase changes during the life cycle of Ascaris Suum


    Rodrick, G E; S. D. Long; W. A. Sodeman Junior; Smith, D. L.


    Ultrastructural morphology and ATPase specific activities of mitochondria isolated from 1-celled fertilized egg, 10-day embryo, 21-day infective larvae and adult body wall muscle of Ascaris suum and rat liver were determined and compared. Although cristae of both muscle and egg mitochondria contained numerous elementary particles with head pieces of conventional diameter (85 A), each muscle mitochondrion contained relatively few, short cristae with a diminished frequency of elementary particl...

  9. Effect of disinfectants on viability of Ascaris suum and Ascaridia galli eggs


    Gautam, Susmita; Petkeviciute, Egle; Takeuchi-Storm, Nao; Thapa, Sundar; Mejer, Helena


    Ascaris suum and Ascaridia galli, the large round worm of pigs and poultry, respectively, persist even in intensive management systems, where a high level of hygiene is practiced. It is necessary to control these helminths to minimize production losses and improve animal welfare. Commercial disinfectants are commonly used to clean pens in conventional pig and poultry farms but their efficacy against the thick-shelled nematode eggs has not been sufficiently documented. However, it might be dif...

  10. Survival of Ascaris suum and Ascaridia galli eggs in liquidmanure at different ammonia concentrations andtemperatures


    Katakam, Kiran Kumar; Mejer, Helena; Dalsgaard, Anders; Kyyvsgaard, Niels Christian; Thamsborg, Stig Milan


    tEggs of Ascaris suum from pigs are highly resistant and commonly used as a conservativeindicator of pathogen inactivation during slurry storage. Eggs of Ascaridia galli, the poultryascarid, are also known to be highly resistant but the suitability as an indicator of pathogeninactivation has never been tested. Pig slurry has to be stored for several months to inac-tivate pathogens but chemical treatment of slurry may reduce this time. The suitability ofA. galli as an indicator of slurry sanit...

  11. Ascaris suum: molecular cloning of an intermediate filament


    Bisoffi, Marco; Betschart, Bruno


    It has been proposed that intermediate filament proteins are involved in force transduction from the muscle cells through the hypodermis to the cuticle of nematodes. An additional role of intermediate filaments as excretory/secretory components of parasitic nematodes is under discussion. We report on the molecular characterization of the cDNA clone AsIF of the intestinal nematode parasite Ascaris suum, encoding a member of the intermediate filament protein family by sequence comparison with i...

  12. In vitro synthesis of the pyruvate dehydrogenase complex components of Ascaris suum mitochondria

    Energy Technology Data Exchange (ETDEWEB)

    Desai, S.; Ruff, V.; DuBrul, E.F.; Komuniecki, R.W.


    The pyruvate dehydrogenase complex (PDC) plays a pivotal role in the anaerobic metabolism of Ascaris suum mitochondria. They have initiated a series of studies on the in vitro synthesis and mitochondrial import of PDC. PDC has been purified from adult Ascaris body wall muscle, fully phosphorylated in vitro, and separated into its component subunits on SDS/PAGE. The individual components were electroeluted from the gels and used to immunize rabbits. IgG's to the individual subunits were prepared from antisera and their specificities were verified by immuno-blotting. Each IgG identified a single specific band at the appropriate location in extracts of adult Ascaris body wall muscle mitochondria. Poly A/sup +/-RNA was prepared from body wall muscle and translated in a reticylocyte lysate system using /sup 35/S-methionine. Translation products were immunoprecipitated with specific IgG's, electrophoresed, and fluorographed. Each immunoprecipitation gave rise to a single radioactive polypeptide that was slightly larger than the specific PDC subunit isolated from the adult mitochondria. This system has demonstrated its feasibility for the study of mitochondrial import of a multienzyme complex that is critical for the anaerobic mitochondrial metabolism of Ascaris suum.

  13. In vitro synthesis of the pyruvate dehydrogenase complex components of Ascaris suum mitochondria

    International Nuclear Information System (INIS)

    The pyruvate dehydrogenase complex (PDC) plays a pivotal role in the anaerobic metabolism of Ascaris suum mitochondria. They have initiated a series of studies on the in vitro synthesis and mitochondrial import of PDC. PDC has been purified from adult Ascaris body wall muscle, fully phosphorylated in vitro, and separated into its component subunits on SDS/PAGE. The individual components were electroeluted from the gels and used to immunize rabbits. IgG's to the individual subunits were prepared from antisera and their specificities were verified by immuno-blotting. Each IgG identified a single specific band at the appropriate location in extracts of adult Ascaris body wall muscle mitochondria. Poly A+-RNA was prepared from body wall muscle and translated in a reticylocyte lysate system using 35S-methionine. Translation products were immunoprecipitated with specific IgG's, electrophoresed, and fluorographed. Each immunoprecipitation gave rise to a single radioactive polypeptide that was slightly larger than the specific PDC subunit isolated from the adult mitochondria. This system has demonstrated its feasibility for the study of mitochondrial import of a multienzyme complex that is critical for the anaerobic mitochondrial metabolism of Ascaris suum

  14. Direct anthelmintic effects of condensed tannins from diverse plant sources against Ascaris suum.

    Directory of Open Access Journals (Sweden)

    Andrew R Williams

    Full Text Available Ascaris suum is one of the most prevalent nematode parasites in pigs and causes significant economic losses, and also serves as a good model for A. lumbricoides, the large roundworm of humans that is ubiquitous in developing countries and causes malnutrition, stunted growth and compromises immunity to other pathogens. New treatment options for Ascaris infections are urgently needed, to reduce reliance on the limited number of synthetic anthelmintic drugs. In areas where Ascaris infections are common, ethno-pharmacological practices such as treatment with natural plant extracts are still widely employed. However, scientific validation of these practices and identification of the active compounds are lacking, although observed effects are often ascribed to plant secondary metabolites such as tannins. Here, we extracted, purified and characterised a wide range of condensed tannins from diverse plant sources and investigated anthelmintic effects against A. suum in vitro. We show that condensed tannins can have potent, direct anthelmintic effects against A. suum, as evidenced by reduced migratory ability of newly hatched third-stage larvae and reduced motility and survival of fourth-stage larvae recovered from pigs. Transmission electron microscopy showed that CT caused significant damage to the cuticle and digestive tissues of the larvae. Furthermore, we provide evidence that the strength of the anthelmintic effect is related to the polymer size of the tannin molecule. Moreover, the identity of the monomeric structural units of tannin polymers may also have an influence as gallocatechin and epigallocatechin monomers exerted significant anthelmintic activity whereas catechin and epicatechin monomers did not. Therefore, our results clearly document direct anthelmintic effects of condensed tannins against Ascaris and encourage further in vivo investigation to determine optimal strategies for the use of these plant compounds for the prevention and

  15. Ecology and viability of eggs of the pig round worm (Ascaris suum) – on-farm and laboratory studies


    Katakam, Kiran Kumar


    Ascaris suum is a highly prevalent parasitic helminth in pig production systems worldwide. In most industrialized countries production systems are highly intensive and fully in-doors (low prevalence of parasites) but there is a growing market for pigs produced out-door or under organic pig farming conditions (high prevalence of parasites). In organic pig production there is a number of factors related to housing and management practices that predispose for A. suum infections. These practices ...

  16. Early stages of Ascaris suum induce airway inflammation and hyperreactivity in a mouse model. (United States)

    Enobe, C S; Araújo, C A; Perini, A; Martins, M A; Macedo, M S; Macedo-Soares, M F


    The inflammatory and functional changes that occur in murine lung after infection with 2500 infective Ascaris suum eggs were studied in this work. A sequential influx of neutrophils, mononuclear cells and eosinophils occurred into airways concomitantly with migration of larvae from liver to the lungs. Histological analysis of the lung showed a severe intra-alveolar haemorrhage at the peak of larval migration (day 8) and the most intense inflammatory cell infiltrate on day 14. Ascaris L3 were found in alveolar spaces and inside bronchioles on day 8. The number of eosinophils was elevated in the blood on days 8 and 14. The peak of eosinophil influx into the lung was at day 14, as indicated by the high levels of eosinophil peroxidase activity, followed by their migration into the airways. The antibody response against egg and larval antigens consisted mainly of IgG1 and IgM, and also of IgE and anaphylactic IgG1, that cross-reacted with adult worm antigens. Total IgE levels were substantially elevated during the infection. Measurement of lung mechanical parameters showed airway hyperreactivity in infected mice. In conclusion, the murine model of A. suum infection mimics the Th2-induced parameters observed in pigs and humans and can be used to analyse the immunoregulatory properties of this helminth. PMID:16916369


    There is spontaneous cure of a large portion of Ascaris suum 4th-stage larvae (L4) from the jejunum of infected pigs between 14 and 21 days after inoculation (DAI). Those L4 that remain in the jejunum continue to develop while those that have moved to the ileum are eventually expelled from the inte...

  18. Ascaris suum infection negatively affects the response to a Mycoplasma hyopneumoniae vaccination and subsequent challenge infection in pigs

    DEFF Research Database (Denmark)

    Steenhard, Nina R.; Jungersen, Gregers; Kokotovic, Branko; Beshah, Ethiopia; Dawson, Harry; Urban Jr., Joseph F.; Roepstorff, Allan; Thamsborg, Stig M.


    posed in this study was that a concurrent Ascaris suum infection of pigs vaccinated with a Mycoplasma hyopneumoniae (Mh)vaccine would modulate the protectiveimmuneresponse to a subsequent challenge infection. Four groups of pigs were either (1) untreated (group C), (2) vaccinated againstMh 3 weeks after...

  19. L3L4ES antigen and secretagogues induce histamine release from porcine peripheral blood basophils after Ascaris suum infection (United States)

    The aim of this paper was to investigate the role of porcine basophils in protective immunity. Experimental pigs were infected with 1,000 Ascaris suum eggs daily for 21 days. Control pigs were maintained helminth-free. Circulating porcine basophils were isolated from the anti-coagulated whole blood ...

  20. Ascaris suum infection negatively affects the response to a Mycoplasma hyopneumoniae vaccination and subsequent challenge infection in pigs (United States)

    It is vital to understand the possible mechanisms that may impair optimal vaccine efficacy. The hypothesis posed in this study was that a concurrent Ascaris suum infection of pigs vaccinated with a Mycoplasma hyopneumoniae (Mh) vaccine would modulate the protective immune response to a subsequent ch...

  1. Comparison of different monoclonal antibodies against immunosuppressive proteins of Ascaris suum. (United States)

    Oshiro, T M; Rafael, A; Enobe, C S; Fernandes, I; Macedo-Soares, M F


    The extract of Ascaris suum suppresses the humoral and cellular immune responses to unrelated antigens in the mouse. In order to further characterize the suppressive components of A. suum, we produced specific monoclonal antibodies which can provide an important tool for the identification of these proteins. The A. suum immunosuppressive fractions isolated by gel filtration from an extract of adult worms were used to immunize BALB/c mice. Popliteal lymph node cells taken from the immunized animals were fused with SP2/O myeloma cells and the cloned hybrid cells obtained were screened to determine the specificity of secreted antibodies. Three monoclonal antibodies named MAIP-1, MAIP-2 and MAIP-3 were selected and were shown to react with different epitopes of high molecular weight proteins from the A. suum extract. All antibody molecules have kappa-type light chains but differ in heavy chain isotype. MAIP-1 is a mouse IgM, MAIP-2 is an IgA immunoglobulin and MAIP-3 is an IgG1 immunoglobulin and they recognize the antigen with affinity constants of 1.3 x 10(10) M-1, 7.1 x 10(9) M-1 and 3.8 x 10(7) M-1, respectively. The proteins recognized by these monoclonal antibodies (PAS-1, PAS-2 and PAS-3) were purified from the crude extract by affinity chromatography and injected with ovalbumin in BALB/c mice in order to determine their suppressive activity on heterologous antibody production. It was demonstrated that these three proteins are able to significantly suppress anti-ovalbumin antibody secretion, with PAS-1 being more efficient than the others. PMID:14762577

  2. Comparison of different monoclonal antibodies against immunosuppressive proteins of Ascaris suum

    Directory of Open Access Journals (Sweden)

    T.M. Oshiro


    Full Text Available The extract of Ascaris suum suppresses the humoral and cellular immune responses to unrelated antigens in the mouse. In order to further characterize the suppressive components of A. suum, we produced specific monoclonal antibodies which can provide an important tool for the identification of these proteins. The A. suum immunosuppressive fractions isolated by gel filtration from an extract of adult worms were used to immunize BALB/c mice. Popliteal lymph node cells taken from the immunized animals were fused with SP2/O myeloma cells and the cloned hybrid cells obtained were screened to determine the specificity of secreted antibodies. Three monoclonal antibodies named MAIP-1, MAIP-2 and MAIP-3 were selected and were shown to react with different epitopes of high molecular weight proteins from the A. suum extract. All antibody molecules have kappa-type light chains but differ in heavy chain isotype. MAIP-1 is a mouse IgM, MAIP-2 is an IgA immunoglobulin and MAIP-3 is an IgG1 immunoglobulin and they recognize the antigen with affinity constants of 1.3 x 10(10 M-1, 7.1 x 10(9 M-1 and 3.8 x 10(7 M-1, respectively. The proteins recognized by these monoclonal antibodies (PAS-1, PAS-2 and PAS-3 were purified from the crude extract by affinity chromatography and injected with ovalbumin in BALB/c mice in order to determine their suppressive activity on heterologous antibody production. It was demonstrated that these three proteins are able to significantly suppress anti-ovalbumin antibody secretion, with PAS-1 being more efficient than the others.

  3. Regional immune responses with stage-specific antigen recognition profiles develop in lymph nodes of pigs following Ascaris suum larval migration

    DEFF Research Database (Denmark)

    Jungersen, Gregers; Eriksen, Lizzie; Nansen, P.;


    The early life-cycle of the pig round worm, Ascaris suum, involves well-defined larval development in the liver; lungs and finally the small intestine. Distinct regional immune responses to larval antigens of A. suum were observed in the draining lymph nodes of immunized and challenged pigs during...

  4. Full scale validation of helminth ova (Ascaris suum) inactivation by different sludge treatment processes

    Energy Technology Data Exchange (ETDEWEB)

    Paulsrud, B.; Gjerde, B.; Lundar, A.


    The Norwegian sewage sludge regulation requires disinfection (hygienisation) of all sludges for land application, and one of the criteria is that disinfected sludge should not contain viable helminth ova. All disinfection processes have to be designed and operated in order to comply with this criteria, and four processes employed in Norway (thermophilic aerobic pre-treatment, pre-pasteurisation, thermal vacuum drying in membrane filter presses and lime treatment) have been tested in full scale by inserting semipermeable bags of Ascaris suum eggs into the processes for certain limes. For lime treatment supplementary laboratory tests have been conducted. The paper presents the results of the experiments, and it could be concluded that all processes, except lime treatment, could be operated at less stringent time-temperature regimes than commonly experienced at Norwegian plants today. (author)

  5. Galloylated proanthocyanidins from shea (Vitellaria paradoxa) meal have potent anthelmintic activity against Ascaris suum. (United States)

    Ramsay, A; Williams, A R; Thamsborg, S M; Mueller-Harvey, I


    Proanthocyanidins (PA) from shea (Vitellaria paradoxa) meal were investigated by thiolytic degradation with benzyl mercaptan and the reaction products were analysed by high performance liquid chromatography-mass spectrometry. These PA were galloylated (≈40%), contained only B-type linkages and had a high proportion of prodelphinidins (>70%). The mean degree of polymerisation was 8 (i.e. average molecular size was 2384Da) and epigallocatechin gallate (EGCg) was the major flavan-3-ol subunit in PA. Shea meal also proved to be a potentially valuable source for extracting free flavan-3-ol-O-gallates, especially EGCg (575mg/kg meal), which is known for its health and anti-parasitic benefits. Proanthocyanidins were isolated and tested for bioactivity against Ascaris suum, which is an important parasite of pigs. Migration and motility tests revealed that these PA have potent activity against this parasitic nematode. PMID:26708339

  6. Direct anthelmintic effects of condensed tannins from diverse plant sources against Ascaris suum

    DEFF Research Database (Denmark)

    Williams, Andrew Richard; Fryganas, Christos; Ramsay, Aina;


    Ascaris suum is one of the most prevalent nematode parasites in pigs and causes significant economic losses, and also serves as a good model for A. lumbricoides, the large roundworm of humans that is ubiquitous in developing countries and causes malnutrition, stunted growth and compromises immunity...... to other pathogens. New treatment options for Ascaris infections are urgently needed, to reduce reliance on the limited number of synthetic anthelmintic drugs. In areas where Ascaris infections are common, ethno-pharmacological practices such as treatment with natural plant extracts are still widely...... condensed tannins against Ascaris and encourage further in vivo investigation to determine optimal strategies for the use of these plant compounds for the prevention and/or treatment of ascariosis....

  7. Anthelmintic effects of phytogenic feed additives in Ascaris suum inoculated pigs. (United States)

    van Krimpen, M M; Binnendijk, G P; Borgsteede, F H M; Gaasenbeek, C P H


    Two experiments were performed to determine the anthelmintic effect of some phytogenic feed additives on a mild infection of Ascaris suum in growing and finishing pigs. Usually, an infection of A. suum is controlled by using conventional synthetic drugs. Organic farmers, however, prefer a non-pharmaceutical approach to worm control. Therefore, phytotherapy could be an appropriate alternative. In the first experiment, a commercial available organic starter diet was supplemented with 3% of a herb mixture, adding 1% Thymus vulgaris, 1% Melissa officinalis and 1% Echinacea purpurea to the diet, or with 4% of a herb mixture, thereby adding the mentioned herbs plus 1% Camellia sinensis (black tea). A negative control group (no treatment) and a positive control group (treatment with conventional synthetic drug flubendazole) were included. In the second experiment, the anthelmintic properties against A. suum of three individual herbs, Carica papaya, Peumus boldus and Artemisia vulgaris, each in a dose of 1%, were tested. Pigs were infected with 1000 infective worm eggs each. Each experiment was performed with 32 individually housed growing pigs (8 replicates/treatment), which were monitored for 67 days. It was hypothesized that the herbs would block the cycles of the larvae, thereby preventing the development of adult worms. Therefore, phytogenic feed additives were not supplied during the whole experimental period, but only from the start until D39. Pigs were inoculated with infective worm eggs during five consecutive days (D17-D21). At D67 all pigs were dissected, whereafter livers were checked for the presence of white spots. Also numbers of worms in the small intestine were counted. In experiment 1, the numbers of worm-infected pigs were similar for both the herb supplemented (groups 3 and 4) and the unsupplemented (group 1) treatments (5-6 pigs of 8), while the treatment with flubendazole (group 2) resulted in 0 infected pigs. In experiment 2, herb addition (groups 2

  8. Assessing the zoonotic potential of Ascaris suum and Trichuris suis

    DEFF Research Database (Denmark)

    Nejsum, Peter; Betson, M.; Bendall, R. P.;


    The two geohelminths, Ascaris lumbricoides and Trichuris trichiura, infect more than a billion people worldwide but are only reported sporadically in the developed part of the world. In contrast, the closely related species A. suum and T. suis in pigs have a truly global distribution, with infected...... pigs found in most production systems. In areas where pigs and humans live in close proximity or where pig manure is used as fertilizer on vegetables for human consumption, there is a potential risk of cross-infections. We therefore review this relationship between Ascaris and Trichuris in the human...

  9. Potensi Serbuk Daun Kelor (Moringa oleifera) Sebagai Anthelmintik Terhadap Infeksi Ascaris suum dan Feed Supplement pada Babi


    Muhammad Ulqiya Syukron; I Made Damriyasa; Nyoman Adi Suratma


    Pig ascariasis is an intestinal parasitic disease caused by Ascaris suum. The economic losses in pig ascariasis are caused by a bad feed conversion ratio (FCR) and rejection of some organs after animal slaughtering. An anthelmintic utilization and farm management improvement are the common prevention action, however, recently the utilization of herbs as an athelmintic has been developed, one of them is Moringa oleifera leaves. Moringa oleifera leaves are also a potential for a sources of ani...

  10. N-glycans of the porcine nematode parasite Ascaris suum are modified with phosphorylcholine and core fucose residues


    Pöltl, Gerald; Kerner, Denise; Paschinger, Katharina; Wilson, Iain B. H.


    In recent years, the glycoconjugates of many parasitic nematodes have attracted interest due to their immunogenic and immunomodulatory nature. Previous studies with the porcine roundworm parasite Ascaris suum have focussed on its glycosphingolipids which were found, in part, to be modified by phosphorylcholine. Using mass spectrometry and Western blotting, we have now analysed the PNGase A-released N-glycans of adults of this species. The presence of hybrid, bi- and triantennary N-glycans, so...

  11. Cross-Reactions between Toxocara canis and Ascaris suum in the diagnosis of visceral larva migrans by western blotting technique

    Directory of Open Access Journals (Sweden)

    NUNES Cáris Maroni


    Full Text Available Visceral larva migrans (VLM is a clinical syndrome caused by infection of man by Toxocara spp, the common roundworm of dogs and cats. Tissue migration of larval stages causes illness specially in children. Because larvae are difficult to detect in tissues, diagnosis is mostly based on serology. After the introduction of the enzyme-linked immunosorbent assay (ELISA using the larval excretory-secretory antigen of T. canis (TES, the diagnosis specificity was greatly improved although cross-reactivity with other helminths are still being reported. In Brazil, diagnosis is routinely made after absorption of serum samples with Ascaris suum antigens, a nematode antigenicaly related with Ascaris lumbricoides which is a common intestinal nematode of children. In order to identify T. canis antigens that cross react to A. suum antigens we analyzed TES antigen by SDS-PAGE and Western blotting techniques. When we used serum samples from patients suspected of VLM and positive result by ELISA as well as a reference serum sample numerous bands were seen (molecular weight of 210-200 kDa, 116-97 kDa, 55-50 kDa and 35-29 kDa. Among these there is at least one band with molecular weight around 55-66 kDa that seem to be responsible for the cross-reactivity between T. canis e A. suum once it disappears when previous absorption of serum samples with A. suum antigens is performed

  12. Incidence of Ascaris suum-specific antibodies in Austrian patients with suspected larva migrans visceralis (VLM) syndrome. (United States)

    Schneider, Renate; Auer, Herbert


    The pig roundworm, Ascaris suum, is commonly found in domestic pigs all over the world. The transmission to humans takes place by ingestion of infective A. suum eggs present in soil because pig manure is widely used as fertilizer. The possible role of A. suum in the human visceral larva migrans (VLM) syndrome has been discussed controversially during past decades, even though various case reports, particularly from Japan document pulmonal, hepatic and even cerebral symptoms caused by migrating A. suum larvae after ingestion of infected row meat (liver) or contaminated vegetables. We examined 4481 sera by A. suum immunoblot (As-IB) and 5301 sera by Toxocara-ELISA from patients with symptoms associated with the VLM syndrome during three consecutive years (2012-2014). The incidence of A. suum-specific antibodies was 13.2 %, the incidence of T. canis specific antibodies 12.9 % and from a part of the As-IB positive sera (n = 417) additional Toxocara serology was performed to demonstrate the specificity of our tests. Only 56 out of the 417 (13.4 %) sera showed antibodies to both helminth species demonstrating that double infections exist. Interestingly the age distribution of the patients showed that 2.8 % of the Ascaris-positive patients were younger than 21 years, while in the Toxocara-positive group 13.4 % were <21 years. These results are in accordance with a Dutch study suspecting different ways of transmission as cause for this interesting age distribution. Due to the fact that large amounts of untreated pig manure are used as fertilizer and that the expulsion of adult A. suum worms causing intestinal ascariosis is extremely rare in Central European countries, the zoonotic potential of A. suum is considerably underestimated. We suggest that the performance of reliable immunoserological tests, in all industrialized countries where pigs are raised and their manure is used as fertilizer, could help to assess the actual potential of A. suum as causative agent of

  13. Potensi Serbuk Daun Kelor (Moringa oleifera Sebagai Anthelmintik Terhadap Infeksi Ascaris suum dan Feed Supplement pada Babi

    Directory of Open Access Journals (Sweden)

    Muhammad Ulqiya Syukron


    Full Text Available Pig ascariasis is an intestinal parasitic disease caused by Ascaris suum. The economic losses in pig ascariasis are caused by a bad feed conversion ratio (FCR and rejection of some organs after animal slaughtering. An anthelmintic utilization and farm management improvement are the common prevention action, however, recently the utilization of herbs as an athelmintic has been developed, one of them is Moringa oleifera leaves. Moringa oleifera leaves are also a potential for a sources of animal food because of their high nutrients. This intervention research aimed to examine the anthelmintic effect of Moringa oleifera leaves and its potency as feed supplement. Experimental design used was ccompletely randomized design split time (CRD Split Time with six treatments namely Moringa oleifera 5% and an infection of infective larvae of A. suum (1, Moringa oleifera 5% (2, positive control (3, Moringa oleifera 10% (4, Moringa oleifera 10% and infection of infective larvae of A. suum (5, and no treatment as negative control (6. Each treatment was imposed on four female landrace piglets aged 8 weeks and weighed around 11 kg. The results showed that Moringa oleifera 5% and 10% of the feed could inhibit the egg production of A.suum and had a significant effect (P<0.05 on weight gain of piglets. It can be concluded that Moringa oleifera leave have an anthelmintic effect to prevent the infection of A. suum and a potential for a feed supplement on pigs.

  14. Succinate-dependent energy generation and pyruvate dehydrogenase complex activity in isolated Ascaris suum mitochondria

    International Nuclear Information System (INIS)

    Body wall muscle from the parasitic nematode, Ascaris suum, contain unique anaerobic mitochondria that preferentially utilize fumarate and branched-chain enoyl CoA's as terminal electron acceptors instead of oxygen. While electron transport in these organelles is well characterized, the role of oxygen in succinate-dependent phosphorylation is still not clearly defined. Therefore, the present study was designed to more fully characterize succinate metabolism in these organelles as well as the in vitro regulation of a key mitochondrial enzyme, the pyruvate dehydrogenase complex (PDC). In the absence of added adenine nucleotides, incubations in succinate resulted in substantial elevations in intramitochrondrial ATP levels, but ATP/ADP ratios were considerably higher in incubations with malate. The stimulation of phosphorylation in aerobic incubations with succinate was rotenone sensitive and appears to be Site I dependent. Increase substrate level phosphorylation, coupled to propionate formation, or additional sites of electron-transport associated ATP synthesis were not significant. Under aerobic conditions, 14CO2 evolution from 1,4-[14C]succinate was stimulated and NADH/NAD+ ratios were elevated, but the formation of 14C propionate was unchanged

  15. Succinate-dependent energy generation and pyruvate dehydrogenase complex activity in isolated Ascaris suum mitochondria

    Energy Technology Data Exchange (ETDEWEB)

    Campbell, T.A.


    Body wall muscle from the parasitic nematode, Ascaris suum, contain unique anaerobic mitochondria that preferentially utilize fumarate and branched-chain enoyl CoA's as terminal electron acceptors instead of oxygen. While electron transport in these organelles is well characterized, the role of oxygen in succinate-dependent phosphorylation is still not clearly defined. Therefore, the present study was designed to more fully characterize succinate metabolism in these organelles as well as the in vitro regulation of a key mitochondrial enzyme, the pyruvate dehydrogenase complex (PDC). In the absence of added adenine nucleotides, incubations in succinate resulted in substantial elevations in intramitochrondrial ATP levels, but ATP/ADP ratios were considerably higher in incubations with malate. The stimulation of phosphorylation in aerobic incubations with succinate was rotenone sensitive and appears to be Site I dependent. Increase substrate level phosphorylation, coupled to propionate formation, or additional sites of electron-transport associated ATP synthesis were not significant. Under aerobic conditions, {sup 14}CO{sub 2} evolution from 1,4-({sup 14}C)succinate was stimulated and NADH/NAD{sup +} ratios were elevated, but the formation of {sup 14}C propionate was unchanged.

  16. Bioinformatic identification of cytochrome b5 homologues from the parasitic nematode Ascaris suum and the free-living nematode Caenorhabditis elegans highlights the crucial role of A. suum adult-specific secretory cytochrome b₅ in parasitic adaptation. (United States)

    Takamiya, Shinzaburo; Hashimoto, Muneaki; Mita, Toshihiro; Yokota, Takehiro; Nakajima, Yoshitaka; Yamakura, Fumiyuki; Sugio, Shigetoshi; Fujimura, Tsutomu; Ueno, Takashi; Yamasaki, Hiroshi


    We previously reported that adult Ascaris suum possesses NADH-metmyoglobin and NADH-methaemoglobin reductase systems that are located in the cells of the body wall and in the extracellular perienteric fluid, respectively, which helps them adapt to environmental hypoxia by recovering the differential functions of myoglobin and haemoglobin. A. suum cytochrome b5, an adult-specific secretory protein and an essential component of the NADH-metmyo (haemo) globin reductase system, has been extensively studied, and its unique nature has been determined. However, the relationship between A. suum cytochrome b5 and the canonical cytochrome b5 proteins, from the free-living nematode Caenorhabditis elegans is unclear. Here, we have characterised four cytochrome b5-like proteins from C. elegans (accession numbers: CAB01732, CCD68984, CAJ58492, and CAA98498) and three from A. suum (accession numbers: ADY48796, ADY46277, and ADY48338) and compared them with A. suum cytochrome b5 in silico. Bioinformatic and molecular analyses showed that CAA98498 from C. elegans is equivalent of A. suum cytochrome b5, which was not expressed as a mature mRNA. Further, the CAA98498 possessed no secretory signal peptide, which occurs in A. suum cytochrome b5 precursor. These results suggest that this free-living nematode does not need a haemoprotein such as the A. suum cytochrome b5 and highlight the crucial function of this A. suum adult-specific secretory cytochrome b5 in parasitic adaptation. PMID:26571414

  17. Experimental Ascaris suum infection in the pig: protective memory response after three immunizations and effect of intestinal adult worm population

    DEFF Research Database (Denmark)

    Jungersen, Gregers; Eriksen, Lis; Roepstorff, Allan; Lind, Peter; Meeusen, E.N.T.; Rasmussen, Tina; Nansen, P.


    The protective immune response to larval migration in pigs, with or without adult intestinal worm populations, 10 weeks after 3 weekly Ascaris suum inoculations, was studied in 45 pigs. Controlled adult worm populations were achieved by oral transfer of 10 adult worms to previously immunized pigs...... after anthelmintic drenching. A significant reduction in larval recovery from lungs on day 7, and small intestine on day 14, was observed in immunized pigs compared with previously uninfected control pigs after challenge inoculation. The strong anamnestic response to larval migration was characterized...... inoculation or on the immune response before or after challenge inoculation could be detected. These results indicate that a significant protective memory immune response to A. suum challenge inoculation can be induced in pigs, and that this protective immunity is not significantly modulated by the presence...

  18. Anthelmintic properties of traditional African and Caribbean medicinal plants: identification of extracts with potent activity against Ascaris suum in vitro

    Directory of Open Access Journals (Sweden)

    Williams Andrew R.


    Full Text Available Ascariasis affects more than 1 billion people worldwide, mainly in developing countries, causing substantial morbidity. Current treatments for Ascaris infection are based on mass drug administration (MDA with synthetic anthelmintic drugs such as albendazole, however continual re-infection and the threat of drug resistance mean that complementary treatment options would be highly valuable. Here, we screened ethanolic extracts from 29 medicinal plants used in Africa (Ghana and the Caribbean (US Virgin Islands for in vitro anthelmintic properties against Ascaris suum, a swine parasite that is very closely related to the human A. lumbricoides. A wide variety of activities were seen in the extracts, from negligible to potent. Extracts from Clausena anisata, Zanthoxylum zanthoxyloides and Punica granatum were identified as the most potent with EC50 values of 74, 97 and 164 μg/mL, respectively. Our results encourage further investigation of their use as complementary treatment options for ascariasis, alongside MDA.

  19. Crystallization of mitochondrial rhodoquinol-fumarate reductase from the parasitic nematode Ascaris suum with the specific inhibitor flutolanil

    International Nuclear Information System (INIS)

    Rhodoquinol-fumarate reductase is a key enzyme in the anaerobic respiratory chain of adult A. suum mitochondria. Its crystallization in the presence of a mixture of octaethyleneglycol monododecyl ether and n-dodecyl-β-d-maltopyranoside in a form suitable for X-ray structure analysis is reported. In adult Ascaris suum (roundworm) mitochondrial membrane-bound complex II acts as a rhodoquinol-fumarate reductase, which is the reverse reaction to that of mammalian complex II (succinate-ubiquinone reductase). The adult A. suum rhodoquinol-fumarate reductase was crystallized in the presence of octaethyleneglycol monododecyl ether and n-dodecyl-β-d-maltopyranoside in a 3:2 weight ratio. The crystals belonged to the orthorhombic space group P212121, with unit-cell parameters a = 123.75, b = 129.08, c = 221.12 Å, and diffracted to 2.8 Å resolution using synchrotron radiation. The presence of two molecules in the asymmetric unit (120 kDa × 2) gives a crystal volume per protein mass (VM) of 3.6 Å3 Da−1

  20. Optimization of the agar-gel method for isolation of migrating Ascaris suum larvae from the liver and lungs of pigs

    DEFF Research Database (Denmark)

    Saeed, I.; Roepstorff, A.; Rasmussen, T.; Hog, M.; Jungersen, Gregers


    Experiments on use of an agar-gel method for recovery of migrating Ascaris suum larvae from the liver and lungs of pigs were conducted to obtain fast standardized methods. Subsamples of blended tissues of pig liver and lungs were mixed with agar to a final concentration of 1% agar and the larvae ...

  1. A TGF-B homologue identified from Ascaris suum 4th stage larvae (L4): Evidence for development-related transcription and incomplete gene splicing (United States)

    Ascaris species represent the most prevalent parasitic worm infecting humans and swine worldwide. During the infection process, A. suum L4 establish in the jejunum and develop into adults. However, a large percentage of L4 spontaneously cure to the ileum at 14 to 21 days after inoculation (dpi), and...

  2. Survival of Ascaris suum and Ascaridia galli eggs in liquid manure at different ammonia concentrations and temperatures. (United States)

    Katakam, Kiran Kumar; Mejer, Helena; Dalsgaard, Anders; Kyvsgaard, Niels Christian; Thamsborg, Stig Milan


    Eggs of Ascaris suum from pigs are highly resistant and commonly used as a conservative indicator of pathogen inactivation during slurry storage. Eggs of Ascaridia galli, the poultry ascarid, are also known to be highly resistant but the suitability as an indicator of pathogen inactivation has never been tested. Pig slurry has to be stored for several months to inactivate pathogens but chemical treatment of slurry may reduce this time. The suitability of A. galli as an indicator of slurry sanitation was tested by comparing the survival of eggs of A. suum and A. galli in pig slurry. In addition, the effect of urea treatment on inactivation of ascarid eggs in relation to storage time was also tested. Nylon bags with 10,000 eggs of either species were placed in 200 ml plastic bottles containing either urea-treated (2%) or untreated pig slurry for up to 120 days at 20°C, 6 days at 30°C, 36h at 40°C or 2h at 50°C. At all the temperatures in both slurry types, A. galli eggs were inactivated at a significantly faster rate (Pgalli eggs at 20°C where no significant difference was detected. In untreated slurry, the levels of pH (6.33-9.08) and ammonia (0.01-1.74 mM) were lower (Pgalli eggs are more sensitive to unfavourable conditions compared to A. suum eggs. The use of A. galli eggs as hygiene indicator may thus be suitable to assess inactivation of pathogens that are more sensitive than A. galli eggs. Addition of urea may markedly reduce the storage time of slurry needed to inactivate A. suum and A. galli eggs. PMID:24893691

  3. [Serological demonstration of experimental round worm infections-Ascaris suum, Toxocara canis--in swine by means of the indirect immunofluorescence antibody test]. (United States)

    Buchwalder, R; Matthes, H F; Hiepe, T


    By means of indirect immunofluorescent antibody reaction (IFAR), using serum of experimentally infected pigs, various antigens were studied with regard to their usefulness for serological verification of prepatent Ascaris suum and Toxocara canis infections. Eggs, egg larvae, larvae received from livers, lungs and brains of experimentally infected white mice and sections of adult T. canis as well as eggs, egg larvae, liver larvae and sections of frozen adult A. suum proved to be not suitable for the reliable serum diagnosis of the infections. On the other hand, A. suum larvae, isolated from lungs of white mice or guinea pigs days after experimental infection, represent an antigen applicable to IFAR for the evidence of prepatent A. suum infections in pigs. The antigen, stored at -20 degree C, is durable without substantial impairment of its reactivity at least 7 months. PMID:7039425

  4. Expression of Ascaris suum malic enzyme in a mutant Escherichia coli allows production of succinic acid from glucose

    Energy Technology Data Exchange (ETDEWEB)

    Stols, L.; Donnelly, M.I. [Argonne National Lab., IL (United States); Kulkarni, G.; Harris, B.G. [Univ. of North Texas, Fort Worth, TX (United States)


    The malic enzyme gene of Ascaris suum was cloned into the vector pTRC99a in two forms encoding alternative amino-termini. The resulting plasmids, pMEA1 and pMEA2, were introduced into Escherichia coli NZN111, a strain that is unable to grow fermentatively because of inactivation of the genes encoding pyruvate dissimilation. Induction of pMEA1, which encodes the native animoterminus, gave better overexpression of malic enzyme, approx 12-fold compared to uninduced cells. Under the appropriate culture conditions, expression of malic enzyme allowed the fermentative dissimilation of glucose by NZN111. The major fermentation product formed in induced cultures was succinic acid.

  5. Effect of post-treatment conditions on the inactivation of helminth eggs (Ascaris suum) after the composting process. (United States)

    Darimani, Hamidatu S; Ito, Ryusei; Maiga, Ynoussa; Sou, Mariam; Funamizu, Naoyuki; Maiga, Amadou H


    Safe and appropriate disposal of human waste is a basic requirement for sanitation and protection of public health. For proper sanitation and nutrient recovery, it is necessary to ensure effective treatment methods to complete pathogen destruction in excreta prior to reuse. Composting toilets convert faeces to a reusable resource such as fertilizer or humus for organic agriculture. A composting toilet for rural Burkina Faso was created by modifying a commercial model available in Japan to improve hygiene and increase food production. The toilet has shown to result in a degraded final product, but its effectiveness for pathogen destruction was unclear due to low temperatures generated from the toilet. This study aimed to sanitize compost withdrawn from the composting toilet for food production by setting post-treatment conditions. The inactivation kinetics of Ascaris suum eggs, selected as an indicator for helminth eggs, was determined during post-treatment at different temperatures (30°C, 40°C, 50°C and 60°C) with varying moisture contents (MC) (50%, 60% and 70%). The treatment of compost in a possible additional post-treatment after the composting process was tried in the laboratory test. Inactivation of A. suum eggs was fast with greater than two log reductions achieved within 2 h for temperature 50°C and 50% MC and greater than three log reductions for temperature 60°C and 50% MC within 3 h. Statistical analysis showed the significant impact of temperature and moisture on the inactivation rates of A. suum eggs. The post-treatment can efficiently increase helminth eggs destruction prior to reuse. PMID:26370295

  6. Proanthocyanidins inhibit Ascaris suum glutathione-S-transferase activity and increase susceptibility of larvae to levamisole in vitro. (United States)

    Hansen, Tina V A; Fryganas, Christos; Acevedo, Nathalie; Caraballo, Luis; Thamsborg, Stig M; Mueller-Harvey, Irene; Williams, Andrew R


    Proanthocyanidins (PAC) are a class of plant secondary metabolites commonly found in the diet that have shown potential to control gastrointestinal nematode infections. The anti-parasitic mechanism(s) of PAC remain obscure, however the protein-binding properties of PAC suggest that disturbance of key enzyme functions may be a potential mode of action. Glutathione-S-transferases (GSTs) are essential for parasite detoxification and have been investigated as drug and vaccine targets. Here, we show that purified PAC strongly inhibit the activity of both recombinant and native GSTs from the parasitic nematode Ascaris suum. As GSTs are involved in detoxifying xenobiotic substances within the parasite, we hypothesised that this inhibition may render parasites hyper-susceptible to anthelmintic drugs. Migration inhibition assays with A. suum larvae demonstrated that the potency of levamisole (LEV) and ivermectin (IVM) were significantly increased in the presence of PAC purified from pine bark (4.6-fold and 3.2-fold reduction in IC50 value for LEV and IVM, respectively). Synergy analysis revealed that the relationship between PAC and LEV appeared to be synergistic in nature, suggesting a specific enhancement of LEV activity, whilst the relationship between PAC and IVM was additive rather than synergistic, suggesting independent actions. Our results demonstrate that these common dietary compounds may increase the efficacy of synthetic anthelmintic drugs in vitro, and also suggest one possible mechanism for their well-known anti-parasitic activity. PMID:27094225

  7. Characterization and expression of a spliced leader RNA in the parasitic nematode Ascaris lumbricoides var. suum.


    Nilsen, T W; Shambaugh, J; Denker, J.; Chubb, G; Faser, C; Putnam, L; Bennett, K


    The parasitic nematode Ascaris spp. contains a 22-nucleotide spliced-leader (SL) sequence identical to the trans-SL previously described in Caenorhabditis elegans and other nematodes. The SL comprises the first 22 nucleotides of a approximately 110-base RNA and is transcribed by RNA polymerase II. The SL RNA contains a trimethylguanosine cap and a consensus Sm binding site. Furthermore, the Ascaris SL RNA has the potential to adopt a secondary structure which is nearly identical to potential ...

  8. Employment of anaerobic reactors in real scale and polishing ponds for removal of eggs Ascaris suum of swine effluent

    Directory of Open Access Journals (Sweden)

    Ana Cristina Araujo Pinto


    Full Text Available The swine confinement farms and the improper disposal of their wastes carry result in contamination of water and soil. On many farms is common slurry application to soil as a means of fertilization, but without any control over the quality of the effluent being released. What is a parasite Ascaris suum from pigs can infect humans, but is not given due importance to the presence of this contaminant as soil and water. In this work the effluent of a pig was treated in a system composed of anaerobic baffled reactor (ABR and a UASB followed by polishing ponds for removal of helminthes eggs. The experiment was conducted at the Hélio Barbosa Experimental Farm pig in the city of Igarapé / MG. Values found in the influent of helminthes eggs in the range from 2891 to 88,848 eggs L-1, while the effluent showed absence of eggs, showing the high efficiency of the treatment system. While the sludge ponds, it showed high concentration of viable eggs ranged from 10.1% to 59.8%, not being in conformity with the requirements for reuse in agriculture.

  9. Modification of the ATP inhibitory site of the Ascaris suum phosphofructokinase results in the stabilization of an inactive T state

    Energy Technology Data Exchange (ETDEWEB)

    Rao, G.S.J.; Cook, P.F.; Harris, B.G. (Univ. of North Texas, Fort Worth (United States))


    Treatment of the Ascaris suum phosphofructokinase (PFK) with 2{prime},3{prime}-dialdehyde ATP (oATP) results in an enzyme form that is inactive. The conformational integrity of the active site, however, is preserved, suggesting that oATP modification locks the PFK into an inactive T state that cannot be activated. A rapid, irreversible first-order inactivation of the PFK is observed in the presence of oATP. The rate of inactivation is saturable and gives a K{sub oATP} of 1.07 {plus minus} 0.27 mM. Complete protection against inactivation is afforded by high concentrations of ATP. This desensitized enzyme incorporates only 0.2-0.3 mol of ({sup 3}H)oATP/subunit, suggesting that in te native enzyme inactivation perhaps results from the modification of the ATP inhibitory site rather than the catalytic site. Modification of an active-site thiol by 4,4{prime}-dithiodipyridine is prevented yb ATP before and after oATP treatment. Finally, gel filtration HPLC studies show that the oATP-modified enzyme retains its tetrameric state and neither the tryptophan fluorescence nor the circular dichroic spectra of the modified enzyme are affected by fructose 2,6-bisphosphate, suggesting that the enzyme is locked into a tetrameric inactive T state.

  10. Immunosuppressive PAS-1 is an excretory/secretory protein released by larval and adult worms of the ascarid nematode Ascaris suum. (United States)

    Antunes, M F P; Titz, T O; Batista, I F C; Marques-Porto, R; Oliveira, C F; Alves de Araujo, C A; Macedo-Soares, M F


    Helminths use several strategies to evade and/or modify the host immune response, including suppression or inactivation of the host antigen-specific response. Several helminth immunomodulatory molecules have been identified. Our studies have focused on immunosuppression induced by the roundworm Ascaris suum and an A. suum-derived protein named protein 1 from A. suum (PAS-1). Here we assessed whether PAS-1 is an excretory/secretory (E/S) protein and whether it can suppress lipopolysaccharide-induced inflammation. Larvae from infective eggs were cultured in unsupplemented Dulbecco's modified Eagle medium (DMEM) for 2 weeks. PAS-1 was then measured in the culture supernatants and in adult A. suum body fluid at different time points by enzyme-linked immunosorbent assay (ELISA) with the monoclonal antibody MAIP-1. Secreted PAS-1 was detected in both larval culture supernatant and adult body fluid. It suppressed lipopolysaccharide (LPS)-induced leucocyte migration and pro-inflammatory cytokine production, and stimulated interleukin (IL)-10 secretion, indicating that larval and adult secreted PAS-1 suppresses inflammation in this model. Moreover, the anti-inflammatory activity of PAS-1 was abolished by treatment with MAIP-1, a PAS-1-specific monoclonal antibody, confirming the crucial role of PAS-1 in suppressing LPS-induced inflammation. These findings demonstrate that PAS-1 is an E/S protein with anti-inflammatory properties likely to be attributable to IL-10 production. PMID:24703095

  11. Molecular evidence for sustained transmission of zoonotic Ascaris suum among zoo chimpanzees (Pan troglodytes)

    DEFF Research Database (Denmark)

    Nejsum, Peter; Bertelsen, Mads Frost; Betson, Martha;

    Chimpanzees in the Copenhagen Zoo frequently excrete ascarid worms onto the cage floor inspite of a regular anthelmintic treatment program. Previously it had been shown that the source of the infections was of pig origin. However, it was unknown whether the recurrence of the infection was due to...... reintroduction of eggs from an external source or to a sustained transmission cycle within the Zoo. We found that isolated eggs were able to embryonate into the infective stage and PCR-RFLP analysis on the ITS region amplified from single embryonated eggs suggest these to be Ascaris suum. In addition, sequence...... analysis of the cox1 gene (‘barcoding') on expelled worms followed by cluster analysis revealed that the chimpanzees are infected with pig A. suum which now, in spite of control efforts, has stabilized into a permanent transmission cycle in the Zoo's chimpanzee troop...

  12. Useable diffraction data from a multiple microdomain-containing crystal of Ascaris suum As-p18 fatty-acid-binding protein using a microfocus beamline

    International Nuclear Information System (INIS)

    As-p18, an unusual fatty-acid-binding protein from a parasitic nematode, was expressed in bacteria, purified and crystallized. The use of a microfocus beamline was essential for data collection. As-p18 is a fatty-acid-binding protein from the parasitic nematode Ascaris suum. Although it exhibits sequence similarity to mammalian intracellular fatty-acid-binding proteins, it contains features that are unique to nematodes. Crystals were obtained, but initial diffraction data analysis revealed that they were composed of a number of ‘microdomains’. Interpretable data could only be collected using a microfocus beamline with a beam size of 12 × 8 µm

  13. The Ascaris suum nicotinic receptor, ACR-16, as a drug target: Four novel negative allosteric modulators from virtual screening. (United States)

    Zheng, Fudan; Robertson, Alan P; Abongwa, Melanie; Yu, Edward W; Martin, Richard J


    Soil-transmitted helminth infections in humans and livestock cause significant debility, reduced productivity and economic losses globally. There are a limited number of effective anthelmintic drugs available for treating helminths infections, and their frequent use has led to the development of resistance in many parasite species. There is an urgent need for novel therapeutic drugs for treating these parasites. We have chosen the ACR-16 nicotinic acetylcholine receptor of Ascaris suum (Asu-ACR-16), as a drug target and have developed three-dimensional models of this transmembrane protein receptor to facilitate the search for new bioactive compounds. Using the human α7 nAChR chimeras and Torpedo marmorata nAChR for homology modeling, we defined orthosteric and allosteric binding sites on the Asu-ACR-16 receptor for virtual screening. We identified four ligands that bind to sites on Asu-ACR-16 and tested their activity using electrophysiological recording from Asu-ACR-16 receptors expressed in Xenopus oocytes. The four ligands were acetylcholine inhibitors (SB-277011-A, IC50, 3.12 ± 1.29 μM; (+)-butaclamol Cl, IC50, 9.85 ± 2.37 μM; fmoc-1, IC50, 10.00 ± 1.38 μM; fmoc-2, IC50, 16.67 ± 1.95 μM) that behaved like negative allosteric modulators. Our work illustrates a structure-based in silico screening method for seeking anthelmintic hits, which can then be tested electrophysiologically for further characterization. PMID:27054065

  14. Survival of Ascaris suum and Ascaridia galli eggs in liquid manure at different ammonia concentrations and temperatures

    DEFF Research Database (Denmark)

    Katakam, Kiran Kumar; Mejer, Helena; Dalsgaard, Anders; Kyvsgaard, Niels Christian; Thamsborg, Stig Milan

    Eggs of Ascaris suum from pigs are highly resistant and commonly used as a conservative indicator of pathogen inactivation during slurry storage. Eggs of Ascaridia galli, the poultry ascarid, are also known to be highly resistant but the suitability as an indicator of pathogen inactivation has...... never been tested. Pig slurry has to be stored for several months to inactivate pathogens but chemical treatment of slurry may reduce this time. The suitability of A. galli as an indicator of slurry sanitation was tested by comparing the survival of eggs of A. suum and A. galli in pig slurry. In...... at 40°C or 2h at 50°C. At all the temperatures in both slurry types, A. galli eggs were inactivated at a significantly faster rate (P<0.05) compared to A. suum eggs. For each 10°C raise in temperature from 20°C, T50 (time needed to inactivate 50% of eggs) for both types of eggs was reduced markedly...

  15. Regional immune responses with stage-specific antigen recognition profiles develop in lymph nodes of pigs following Ascaris suum larval migration. (United States)

    Jungersen, G; Eriksen, L; Nansen, P; Lind, P; Rasmussen, T; Meeusen, E N


    The early life-cycle of the pig round worm, Ascaris suum, involves well-defined larval development in the liver, lungs and finally the small intestine. Distinct regional immune responses to larval antigens of A. suum were observed in the draining lymph nodes of immunized and challenged pigs during larval migration. This was reflected in a transient enlargement of the stimulated lymph nodes, due to increases in numbers of B cells and CD4 T cells, and the production of A. suum-specific antibody by antibody secreting cell (ASC) cultures. Larval antigen recognition pattern of antibodies in serum, bile and draining lymph node ASC culture supernatant (ASC-probes) was examined by immunoblotting. This revealed distinct organ-specific recognition patterns of larval-specific antigens by the draining lymph nodes at different times after challenge. In particular, an early larval 42 kDa antigen was recognized specifically by ASC-probes of the liver lymph nodes at 7 but not 14 days postchallenge (pc) which was not detected in other lymph nodes, serum or bile of the same pig. Similarly, a late larval antigen of 34 kDa was uniquely detected by lung and jejunal ASC-probes at 14 days pc. These observations demonstrate how development of distinct regional immune responses in tissues with different antigen stimulation can be monitored with ASC-probes and flow cytometry. PMID:11298295

  16. High pressure processing treatment prevents embryonation of eggs of Trichuris vulpis and Ascaris suum and induces delay in development of eggs. (United States)

    Rosypal, Alexa C; Zajac, Anne M; Flick, George J; Bowman, Dwight D; Lindsay, David S


    High hydrostatic pressure processing (HPP) is an effective non-thermal treatment used to inactivate pathogens from a variety of food and food products. It has been extensively examined using prokaryotic organisms and protozoan's but has had limited study on metazoans. Treatment using HPP has been shown to be effective in inactivating nematode larvae in food and preventing embryonation of Ascaris suum eggs. We conducted experiments using eggs of the canine whipworm Trichuris vulpis collected from naturally infected dogs and A. suum eggs from naturally infected pigs. We observed a delay in development of eggs of T. vulpis in a preliminary experiment and conducted 2 experiments to test the hypothesis that appropriate HPP levels can induce a delay in embryonation of nematode eggs. In experiment 1, nonembryonated T. vulpis eggs in tap water were packaged in sealable bags and exposed to 138-600 megapascals (MPa; 1 MPa=10 atm=147 psi) for 60s in a commercial HPP unit. In a second experiment, nonembryonated eggs of A. suum were exposed to 138-600 MPa and treated for 60s in the same commercial HPP unit. Embyronation of T. vulpis eggs was delayed by 4 and 5 days for eggs treated with 207 and 241 MPa but eventually eggs developed and the numbers of embryonated eggs was similar to controls on day 55. Embryonation of T. vulpis eggs treated with 345 or 350 MPa was delayed by 9 days and never reached more than 5% of eggs embryonated. On day 55 post treatment, 95% of control nontreated T. vulpis eggs were embryonated, 100-65% of eggs treated with 138-276 MPa were embryonated, a maximum of 5% of eggs treated with 345-350 MPa were embryonated, and 0% of eggs treated with ≥ 400 MPa were embryonated. T. vulpis eggs treated with ≥ 400 MPa did not undergo cell division. Embryrnation of A. suum eggs was delayed by 4, 10, and 16 days for eggs treated with 207, 241, and 250MPa, respectively, compared to nontreated control eggs. A. suum eggs treated with 207 MPa eventually embryonated

  17. The nicotinic acetylcholine receptors of the parasitic nematode Ascaris suum: formation of two distinct drug targets by varying the relative expression levels of two subunits.

    Directory of Open Access Journals (Sweden)

    Sally M Williamson


    Full Text Available Parasitic nematodes are of medical and veterinary importance, adversely affecting human health and animal welfare. Ascaris suum is a gastrointestinal parasite of pigs; in addition to its veterinary significance it is a good model of the human parasite Ascaris lumbricoides, estimated to infect approximately 1.4 billion people globally. Anthelmintic drugs are essential to control nematode parasites, and nicotinic acetylcholine receptors (nAChRs on nerve and muscle are the targets of cholinergic anthelmintics such as levamisole and pyrantel. Previous genetic analyses of nematode nAChRs have been confined to Caenorhabditis elegans, which is phylogenetically distinct from Ascaris spp. and many other important parasites. Here we report the cloning and expression of two nAChR subunit cDNAs from A. suum. The subunits are very similar in sequence to C. elegans UNC-29 and UNC-38, are expressed on muscle cells and can be expressed robustly in Xenopus oocytes to form acetylcholine-, nicotine-, levamisole- and pyrantel-sensitive channels. We also demonstrate that changing the stoichiometry of the receptor by injecting different ratios of the subunit cRNAs can reproduce two of the three pharmacological subtypes of nAChR present in A. suum muscle cells. When the ratio was 5:1 (Asu-unc-38ratioAsu-unc-29, nicotine was a full agonist and levamisole was a partial agonist, and oocytes responded to oxantel, but not pyrantel. At the reverse ratio (1:5 Asu-unc-38ratioAsu-unc-29, levamisole was a full agonist and nicotine was a partial agonist, and the oocytes responded to pyrantel, but not oxantel. These results represent the first in vitro expression of any parasitic nicotinic receptor and show that their properties are substantially different from those of C. elegans. The results also show that changing the expression level of a single receptor subunit dramatically altered the efficacy of some anthelmintic drugs. In vitro expression of these subunits may permit the

  18. In situ hybridization of neuropeptide-encoding transcripts afp-1, afp-3, and afp-4 in neurons of the nematode Ascaris suum. (United States)

    Nanda, Jennifer Cho; Stretton, Antony O W


    The gene transcripts encoding both the AF8 and AF2 neuropeptides of the nematode Ascaris suum have been identified, cloned, and sequenced. The AF8 transcript (afp-3) encodes five identical copies of AF8; each peptide-encoding region is flanked by the appropriate dibasic or monobasic cleavage processing sites. The AF2 transcript (afp-4) encodes three identical copies of AF2 along with the appropriate cleavage sites. In contrast, the afp-1 transcript (Edison et al. [1997] Peptides 18:929-935) encodes six different AF peptides (AF3, 4, 10, 13, 14, 20) which all share a -PGVLRFamide C-terminus but have different N-terminal sequences. By using in situ hybridization, gene transcript expression patterns of afp-1, afp-3, and afp-4 (As-flp-18, As-flp-6, and As-flp-14, respectively, in the naming convention proposed by Blaxter et al. [1997] Parasitol Today 13:416-417) were determined in the adult A. suum anterior nervous system. Each gene transcript can be localized to a different subset of neurons. These subsets of neurons are different from the subsets of Caenorhabditis elegans neurons that were shown to express identical or similar peptides by the use of promoter GFP constructs (Kim and Li [2004] J Comp Neurol 475:540-550). PMID:20058230

  19. PAS-1, a protein affinity purified from Ascaris suum worms, maintains the ability to modulate the immune response to a bystander antigen. (United States)

    Oshiro, Telma M; Enobe, Cristina S; Araújo, Cláudia A; Macedo, Mahasti S; Macedo-Soares, Maria Fernanda


    Helminth infections and parasite components have potent immunomodulatory effects on a host's immune system. In the present study, we investigated the effect of PAS-1, a protein component of Ascaris suum adult worms recognized by a monoclonal antibody (MAIP-1), on humoral and cell-mediated responses to a bystander antigen (ovalbumin [OVA]). MAIP-1 recognized only one of the three polypeptide chains of PAS-1, but neutralized the suppressive effect of the whole worm extract on OVA-specific antibody production. PAS-1 inhibited antibody production against a T-cell-dependent, but not a T-cell-independent, antigen in a dose-dependent way. IgM, IgG1, IgG2b, and also IgE and anaphylactic IgG1 levels were downregulated. In addition, PAS-1 inhibited OVA-specific delayed type hypersensitivity reactions in the footpad of mice, showing a potent immunosuppressive activity on both Th1 and Th2 responses that seems to be mediated by the induction of large amounts of IL-10 and IL-4. Indeed, PAS-1-specific spleen cells secreted sevenfold more IL-10 and threefold more IL-4 than OVA-specific cells in response to in vitro restimulation with the respective antigens. In conclusion, we showed that PAS-1, a single protein component from A. suum, maintains all its immunosuppressive properties. PMID:16519731

  20. Mass Spectrometry of Single GABAergic Somatic Motorneurons Identifies a Novel Inhibitory Peptide, As-NLP-22, in the Nematode Ascaris suum (United States)

    Konop, Christopher J.; Knickelbine, Jennifer J.; Sygulla, Molly S.; Wruck, Colin D.; Vestling, Martha M.; Stretton, Antony O. W.


    Neuromodulators have become an increasingly important component of functional circuits, dramatically changing the properties of both neurons and synapses to affect behavior. To explore the role of neuropeptides in Ascaris suum behavior, we devised an improved method for cleanly dissecting single motorneuronal cell bodies from the many other cell processes and hypodermal tissue in the ventral nerve cord. We determined their peptide content using matrix-assisted laser desorption/ionization time-of-flight (MALDI-TOF) mass spectrometry (MS). The reduced complexity of the peptide mixture greatly aided the detection of peptides; peptide levels were sufficient to permit sequencing by tandem MS from single cells. Inhibitory motorneurons, known to be GABAergic, contain a novel neuropeptide, As-NLP-22 (SLASGRWGLRPamide). From this sequence and information from the A. suum expressed sequence tag (EST) database, we cloned the transcript ( As-nlp-22) and synthesized a riboprobe for in situ hybridization, which labeled the inhibitory motorneurons; this validates the integrity of the dissection method, showing that the peptides detected originate from the cells themselves and not from adhering processes from other cells (e.g., synaptic terminals). Synthetic As-NLP-22 has potent inhibitory activity on acetylcholine-induced muscle contraction as well as on basal muscle tone. Both of these effects are dose-dependent: the inhibitory effect on ACh contraction has an IC50 of 8.3 × 10-9 M. When injected into whole worms, As-NLP-22 produces a dose-dependent inhibition of locomotory movements and, at higher levels, complete paralysis. These experiments demonstrate the utility of MALDI TOF/TOF MS in identifying novel neuromodulators at the single-cell level.

  1. The PCome of Ascaris suum as a model system for intestinal nematodes: identification of phosphorylcholine-substituted proteins and first characterization of the PC-epitope structures. (United States)

    Timm, Thomas; Grabitzki, Julia; Severcan, Cinar; Muratoglu, Suzan; Ewald, Lisa; Yilmaz, Yavuz; Lochnit, Guenter


    In multicellular parasites (e.g., nematodes and protozoa), proteins and glycolipids have been found to be decorated with phosphorylcholine (PC). PC can provoke various effects on immune cells leading to an immunomodulation of the host's immune system. This immunomodulation allows long-term persistence but also prevents severe pathology due to downregulation of cellular immune responses. PC-containing antigens have been found to interfere with key proliferative signaling pathways in B and T cells, development of dendritic cells and macrophages, and mast cell degranulation. These effects contribute to the observed modulated cytokine levels and impairment of lymphocyte proliferation. In contrast to glycosphingolipids, little is known about the PC-epitopes of proteins. So far, only a limited number of PC-modified proteins from nematodes have been identified. In this project, PC-substituted proteins and glycolipids in Ascaris suum have been localized by immunohistochemistry in specific tissues of the body wall, intestine, and reproductive tract. Subsequently, we investigated the PCome of A. suum by 2D gel-based proteomics and detection by Western blotting using the PC-specific antibody TEPC-15. By peptide-mass-fingerprint matrix-assisted laser-desorption ionization time-of-flight mass spectrometry (MALDI-TOF-MS), we could identify 59 PC-substituted proteins, which are in involved multiple cellular processes. In addition to membrane proteins like vitellogenin-6, we found proteins with structural (e.g., tubulins) and metabolic (e.g., pyruvate dehydrogenase) functions or which can act in the defense against the host's immune response (e.g., serpins). Initial characterization of the PC-epitopes revealed a predominant linkage of PC to the proteins via N-glycans. Our data form the basis for more detailed investigations of the PC-epitope structures as a prerequisite for comprehensive understanding of the molecular mechanisms of immunomodulation. PMID:26728072

  2. Potentiation of IgE responses to third-party antigens mediated by Ascaris suum soluble products. (United States)

    Lee, T D; McGibbon, A


    A reductive approach was used to examine the potentiation of IgE responses by nematode infection. Ascaris homogenized extract, Ascaris pseudocoelomic (body) fluid (ABF) and purified Ascaris allergen (ABA) were tested for their ability to act as protein carriers and as mediators of potentiated IgE responses to third-party (ovalbumin; OVA) responses. All three nematode products were excellent protein carriers for the hapten dinitrophenol and showed significantly better activity in this respect than OVA. Neither ABF nor ABA enhanced the level of the IgE response to the third-party antigen but both prolonged the response markedly. ABF, but not ABA, induced high levels of total circulating IgE when given at the same time as OVA with alum. The data suggest that the enhancement and prolongation of IgE responses by nematodes may be two separate but related activities. PMID:8400897

  3. Decoding the Ascaris suum genome using massively parallel sequencing and advanced bioinformatic methods

    DEFF Research Database (Denmark)

    Jex, Aaron R.; Liu, Shiping; Li, Bo;


    Parasitic nematodes cause substantial morbidity and mortality in animals and people globally and major losses to food production annually. Ascaris is among the commonest geohelminths of swine and people worldwide, and causes major disease and socioeconomic losses, particularly in developing count...

  4. Localization of serotoni (5-hydroxytryptamine, 5-HT) with partial purification and characterization of a serotonin binding protein in the intestinal tissue of the nematode Ascaris suum

    International Nuclear Information System (INIS)

    An intracellular 5-HT binding protein (SBP) from intestinal tissue was partially purified and characterized. Binding of [3H] 5-HT to the protein appeared to be Fe+2-sensitive and maximal (20.8pmol/mg protein) at 5 x 10-4M Fe+2 and 10-7M [3H] 5-HT. There were two 5-HT binding sites present at optimum Fe+2 concentrations. The Bmax values of these sites were more sensitive to Fe+2 than Kd values. Sulfhydryl reducing agents, cation chelators, Fe+3, Ca+2 and antagonists of 5-HT uptake and storage inhibited binding of 5-HT to SBP. Gel exclusion chromatography indicated the presence of a 45Kda SBP that in 5 x 10-5M Fe+2 may form aggregates ranging in size from approximately 80 to >1000Kda. The data indicate these in vitro aggregates may correspond to the electron-opaque patches observed in situ. Ascaris suum may provide a model system to further elucidate the physiological role of analogous serotonin binding proteins that have been identified in mammalian systems

  5. Localization of serotoni (5-hydroxytryptamine, 5-HT) with partial purification and characterization of a serotonin binding protein in the intestinal tissue of the nematode Ascaris suum

    Energy Technology Data Exchange (ETDEWEB)

    Martin, R.E.


    An intracellular 5-HT binding protein (SBP) from intestinal tissue was partially purified and characterized. Binding of ({sup 3}H) 5-HT to the protein appeared to be Fe{sup +2}-sensitive and maximal (20.8pmol/mg protein) at 5 {times} 10{sup {minus}4}M Fe{sup +2} and 10{sup {minus}7}M ({sup 3}H) 5-HT. There were two 5-HT binding sites present at optimum Fe{sup +2} concentrations. The Bmax values of these sites were more sensitive to Fe{sup +2} than Kd values. Sulfhydryl reducing agents, cation chelators, Fe{sup +3}, Ca{sup +2} and antagonists of 5-HT uptake and storage inhibited binding of 5-HT to SBP. Gel exclusion chromatography indicated the presence of a 45Kda SBP that in 5 {times} 10{sup {minus}5}M Fe{sup +2} may form aggregates ranging in size from approximately 80 to >1000Kda. The data indicate these in vitro aggregates may correspond to the electron-opaque patches observed in situ. Ascaris suum may provide a model system to further elucidate the physiological role of analogous serotonin binding proteins that have been identified in mammalian systems.

  6. Optimization of the Agar-gel Method for Isolation of Migrating Ascaris suum Larvae From the Liver and Lungs of Pigs

    Directory of Open Access Journals (Sweden)

    Høg M


    Full Text Available Experiments on use of an agar-gel method for recovery of migrating Ascaris suum larvae from the liver and lungs of pigs were conducted to obtain fast standardized methods. Subsamples of blended tissues of pig liver and lungs were mixed with agar to a final concentration of 1% agar and the larvae allowed to migrate out of the agar-gel into 0.9% NaCl at 38°C. The results showed that within 3 h more than 88% of the recoverable larvae migrated out of the liver agar-gel and more than 83% of the obtained larvae migrated out of the lung agar-gel. The larvae were subsequently available in a very clean suspension which reduced the sample counting time. Blending the liver for 60 sec in a commercial blender showed significantly higher larvae recovery than blending for 30 sec. Addition of gentamycin to reduce bacterial growth during incubation, glucose to increase larval motility during migration or ice to increase sedimentation of migrated larvae did not influence larvae recovery significantly.

  7. Multiple Exposures to Ascaris suum Induce Tissue Injury and Mixed Th2/Th17 Immune Response in Mice. (United States)

    Nogueira, Denise Silva; Gazzinelli-Guimarães, Pedro Henrique; Barbosa, Fernando Sérgio; Resende, Nathália Maria; Silva, Caroline Cavalcanti; de Oliveira, Luciana Maria; Amorim, Chiara Cássia Oliveira; Oliveira, Fabrício Marcus Silva; Mattos, Matheus Silvério; Kraemer, Lucas Rocha; Caliari, Marcelo Vidigal; Gaze, Soraya; Bueno, Lilian Lacerda; Russo, Remo Castro; Fujiwara, Ricardo Toshio


    Ascaris spp. infection affects 800 million people worldwide, and half of the world population is currently at risk of infection. Recurrent reinfection in humans is mostly due to the simplicity of the parasite life cycle, but the impact of multiple exposures to the biology of the infection and the consequences to the host's homeostasis are poorly understood. In this context, single and multiple exposures in mice were performed in order to characterize the parasitological, histopathological, tissue functional and immunological aspects of experimental larval ascariasis. The most important findings revealed that reinfected mice presented a significant reduction of parasite burden in the lung and an increase in the cellularity in the bronchoalveolar lavage (BAL) associated with a robust granulocytic pulmonary inflammation, leading to a severe impairment of respiratory function. Moreover, the multiple exposures to Ascaris elicited an increased number of circulating inflammatory cells as well as production of higher levels of systemic cytokines, mainly IL-4, IL-5, IL-6, IL-10, IL-17A and TNF-α when compared to single-infected animals. Taken together, our results suggest the intense pulmonary inflammation associated with a polarized systemic Th2/Th17 immune response are crucial to control larval migration after multiple exposures to Ascaris. PMID:26814713

  8. Ascaris and ascariasis




    PUBLISHED Ascaris lumbricoides and Ascaris suum are widespread parasitic nematodes of humans and pigs respectively. Recent prevalence data suggests that approximately 1.2 billion people are infected. Adult worms exhibit an overdispersed frequency distribution in their hosts and individuals harbouring heavy burdens display associated morbidity. In this review, we describe the parasite, its distribution and measures undertaken to control infection.


    Institute of Scientific and Technical Information of China (English)

    彭卫东; 周宪民; 安德森; 肯尼迪


    @@ 在我国蛔虫感染遍布各地,受染人数达5亿多.而在多数农村流行区,生猪饲养十分普遍,人群和猪群的蛔虫感染往往并存,且人、猪接触密切.据作者在江西省新建县蔓湖村进行的一年纵向调查,当地人群蛔虫感染率和猪群蛔虫感染率比较接近(约60%-70%),土壤蛔虫卵污染普遍而严重,并长年稳定 ( Peng, W.D. et al. 1996 Ascaris, people and pigs in rural Jiangxi, China. Parasitology 113:547~557.). 因此这些地区人蛔虫和猪蛔虫交叉感染的机会是大量存在的.

  10. Localized Th1-, Th2-, T Regulatory Cell-, and Inflammation-Associated Hepatic and Pulmonary Immune Responses in Ascaris suum-Infected Swine Are Increased by Retinoic Acid▿ †


    Dawson, Harry; Solano-Aguilar, Gloria; Beal, Madeline; Beshah, Ethiopia; Vangimalla, Vandana; Jones, Eudora; Botero, Sebastian; Joseph F. Urban


    Pigs infected with Ascaris suum or controls were given 100 μg (low-dose) or 1,000 μg (high-dose) all-trans retinoic acid (ATRA)/kg body weight in corn oil or corn oil alone per os on days after inoculation (DAI) −1, +1, and +3 with infective eggs. Treatment with ATRA increased interleukin 4 (IL4) and IL12p70 in plasma of infected pigs at 7 DAI and augmented bronchoalveolar lavage (BAL) eosinophilia observed at 7 and 14 DAI. To explore potential molecular mechanisms underlying these observatio...

  11. Protonation mechanism and location of rate-determining steps for the Ascaris suum nicotinamide adenine dinucleotide-malic enzyme reaction from isotope effects and pH studies

    Energy Technology Data Exchange (ETDEWEB)

    Kiick, D.M.; Harris, B.G.; Cook, P.F.


    The pH dependence of the kinetic parameters and the primary deuterium isotope effects with nicotinamide adenine dinucleotide (NAD) and also thionicotinamide adenine dinucleotide (thio-NAD) as the nucleotide substrates were determined in order to obtain information about the chemical mechanism and location of rate-determining steps for the Ascaris suum NAD-malic enzyme reaction. The maximum velocity with thio-NAD as the nucleotide is pH-independent from pH 4.2 to 9.6, while with NAD, V decreases below a pK of 4.8. V/K for both nucleotides decreases below a pK of 5.6 and above a pK of 8.9. Both the tartronate pKi and V/Kmalate decrease below a pK of 4.8 and above a pK of 8.9. Oxalate is competitive vs. malate above pH 7 and noncompetitive below pH 7 with NAD as the nucleotide. The oxalate Kis increases from a constant value above a pK of 4.9 to another constant value above a pK of 6.7. The oxalate Kii also increases above a pK of 4.9, and this inhibition is enhanced by NADH. In the presence of thio-NAD the inhibition by oxalate is competitive vs. malate below pH 7. For thio-NAD, both DV and D(V/K) are pH-independent and equal to 1.7. With NAD as the nucleotide, DV decreases to 1.0 below a pK of 4.9, while D(V/KNAD) and D(V/Kmalate) are pH-independent. Above pH 7 the isotope effects on V and the V/K values for NAD and malate are equal to 1.45, the pH-independent value of DV above pH 7. Results indicate that substrates bind to only the correctly protonated form of the enzyme. Two enzyme groups are necessary for binding of substrates and catalysis. Both NAD and malate are released from the Michaelis complex at equal rates which are equal to the rate of NADH release from E-NADH above pH 7. Below pH 7 NADH release becomes more rate-determining as the pH decreases until at pH 4.0 it completely limits the overall rate of the reaction.

  12. Protonation mechanism and location of rate-determining steps for the Ascaris suum nicotinamide adenine dinucleotide-malic enzyme reaction from isotope effects and pH studies

    International Nuclear Information System (INIS)

    The pH dependence of the kinetic parameters and the primary deuterium isotope effects with nicotinamide adenine dinucleotide (NAD) and also thionicotinamide adenine dinucleotide (thio-NAD) as the nucleotide substrates were determined in order to obtain information about the chemical mechanism and location of rate-determining steps for the Ascaris suum NAD-malic enzyme reaction. The maximum velocity with thio-NAD as the nucleotide is pH-independent from pH 4.2 to 9.6, while with NAD, V decreases below a pK of 4.8. V/K for both nucleotides decreases below a pK of 5.6 and above a pK of 8.9. Both the tartronate pKi and V/Kmalate decrease below a pK of 4.8 and above a pK of 8.9. Oxalate is competitive vs. malate above pH 7 and noncompetitive below pH 7 with NAD as the nucleotide. The oxalate Kis increases from a constant value above a pK of 4.9 to another constant value above a pK of 6.7. The oxalate Kii also increases above a pK of 4.9, and this inhibition is enhanced by NADH. In the presence of thio-NAD the inhibition by oxalate is competitive vs. malate below pH 7. For thio-NAD, both DV and D(V/K) are pH-independent and equal to 1.7. With NAD as the nucleotide, DV decreases to 1.0 below a pK of 4.9, while D(V/KNAD) and D(V/Kmalate) are pH-independent. Above pH 7 the isotope effects on V and the V/K values for NAD and malate are equal to 1.45, the pH-independent value of DV above pH 7. Results indicate that substrates bind to only the correctly protonated form of the enzyme. Two enzyme groups are necessary for binding of substrates and catalysis. Both NAD and malate are released from the Michaelis complex at equal rates which are equal to the rate of NADH release from E-NADH above pH 7. Below pH 7 NADH release becomes more rate-determining as the pH decreases until at pH 4.0 it completely limits the overall rate of the reaction

  13. Effect of the injection of an extract of Ascaris suum on macrophage activation during the early phase of Mycobacterium bovis BCG infection in C57Bl/6 mice

    Directory of Open Access Journals (Sweden)

    Ferreira A.P.


    Full Text Available Injection of an Ascaris suum extract (Asc affects both the humoral and cellular immune responses to unrelated antigens when it is co-administered with these antigens. In the present study we evaluated the effect of Asc on macrophage activation in the early phase of Mycobacterium bovis BCG (Pasteur strain TMCC 1173 infection in C57Bl/6 mice. C57Bl/6 mice were injected intraperitoneally (ip with 0.1 mg BCG (BCG group or BCG plus 1 mg Asc (BCG + Asc group. The peritoneal exudates were obtained at 2, 7 and 14 days after infection. The numbers of IFN-g-secreting cells were assessed by the ELISPOT assay. Nitric oxide (NO production was measured by the Griess method and by the evaluation of NADPH diaphorase activity in the peritoneal exudates. The administration of Asc extract increased NADPH diaphorase activity (2 days: control = 0, BCG = 7%, BCG + Asc = 13%, and Asc = 4%; 7 days: control = 4, BCG = 13%, BCG + Asc = 21%, and Asc = 4.5% and TNF-a levels (mean ± SD; 2 days: control = 0, BCG = 169 ± 13, BCG + Asc = 202 ± 37, and Asc = 0; 7 days: control = 0, BCG = 545 ± 15.5, BCG + Asc = 2206 ± 160.6, and Asc = 126 ± 26; 14 days: control = 10 ± 1.45, BCG = 9 ± 1.15, BCG + Asc = 126 ± 18, and Asc = 880 ± 47.67 pg/ml in the early phase of BCG infection. Low levels of NO production were detected at 2 and 7 days after BCG infection, increasing at 14 days (mean ± SD; 2 days: control = 0, BCG = 3.7 ± 1.59, BCG + Asc = 0.82 ± 0.005, Asc = 0.48 ± 0.33; 7 days: control = 0, BCG = 2.78 ± 1.54, BCG + Asc = 3.07 ± 1.05, Asc = 0; 14 days: control = 0, BCG = 9.05 ± 0.53, BCG + Asc = 9.61 ± 0.81, Asc = 10.5 ± 0.2 (2 x 106 cells/ml. Furthermore, we also observed that Asc co-injection induced a decrease of BCG-colony-forming units (CFU in the spleens of BCG-infected mice during the first week of infection (mean ± SD; 2 days: BCG = 1.13 ± 0.07 and BCG + Asc = 0.798 ± 0.305; 7 days: BCG = 1.375 ± 0.194 and BCG + Asc = 0.548 ± 0.0226; 14 days: BCG

  14. Evaluation of a serodiagnostic test using Ascaris suum haemoglobin for the detection of roundworm infections in pig populations

    DEFF Research Database (Denmark)

    Vlaminck, Johnny; Nejsum, Peter; Vangroenweghe, Frédéric;


    novel indirect ELISA using the purified A. suum haemoglobin (AsHb) molecule as an antigen. Initial validation using sera from 190 pigs experimentally infected twice a week with A. suum and Trichuris suis (25 and 5 eggs kg(-1)day(-1) respectively) demonstrated that the AsHb ELISA is able to detect long....... suis infection was shown to be limited after analysing sera from pigs with an experimental T. suis mono-infection. Seroconversion was shown to occur from week 6 onwards in pigs receiving 100 A. suum eggs 5 times a week. Preliminary testing of the ELISA on six randomly selected farms confirmed the...... the tested samples were seropositive, while in 19.8% of the farms 80-100% of all pigs were seropositive. The results of this study suggest that the AsHb ELISA could provide pig farmers and veterinarians with an easier and more sensitive way to estimate the overall prevalence of A. suum on their farm....

  15. Modification of a thiol at the active site of the Ascaris suum NAD-malic enzyme results in changes in the rate-determining steps for oxidative decarboxylation of L-malate

    International Nuclear Information System (INIS)

    A thiol group at the malate-binding site of the NAD-malic enzyme from Ascaris suum has been modified to thiocyanate. The modified enzyme generally exhibits slight increases in KNAD and Kimetal and decreases in Vmax as the metal size increases from Mg2+ to Mn2+ to Cd2+, indicative of crowding in the site. The Kmalate value increases 10- to 30-fold, suggesting that malate does not bind optimally to the modified enzyme. Deuterium isotope effects on V and V/Kmalate increase with all three metal ions compared to the native enzyme concomitant with a decrease in the 13C isotope effect, suggesting a switch in the rate limitation of the hydride transfer and decarboxylation steps with hydride transfer becoming more rate limiting. The 13C effect decreases only slightly when obtained with deuterated malate, suggestive of the presence of a secondary 13C effect in the hydride transfer step, similar to data obtained with non-nicotinamide-containing dinucleotide substrates for the native enzyme (see the preceding paper in this issue). The native enzyme is inactivated in a time-dependent manner by Cd2+. This inactivation occurs whether the enzyme alone is present or whether the enzyme is turning over with Cd2+ as the divalent metal activator. Upon inactivation, only Cd2+ ions are bound at high stoichiometry to the enzyme, which eventually becomes denatured. Conversion of the active-site thiol to thiocyanate makes it more difficult to inactivate the enzyme by treatment with Cd2+

  16. Modification of a thiol at the active site of the Ascaris suum NAD-malic enzyme results in changes in the rate-determining steps for oxidative decarboxylation of L-malate

    Energy Technology Data Exchange (ETDEWEB)

    Gavva, S.R.; Harris, B.G.; Cook, P.F. (Texas Coll. of Osteopathic Medicine, Fort Worth (United States)); Weiss, P.M. (Univ. of Wisconsin, Madison (United States))


    A thiol group at the malate-binding site of the NAD-malic enzyme from Ascaris suum has been modified to thiocyanate. The modified enzyme generally exhibits slight increases in K{sub NAD} and K{sub i metal} and decreases in V{sub max} as the metal size increases from Mg{sup 2+} to Mn{sup 2+} to Cd{sup 2+}, indicative of crowding in the site. The K{sub malate} value increases 10- to 30-fold, suggesting that malate does not bind optimally to the modified enzyme. Deuterium isotope effects on V and V/K{sub malate} increase with all three metal ions compared to the native enzyme concomitant with a decrease in the {sup 13}C isotope effect, suggesting a switch in the rate limitation of the hydride transfer and decarboxylation steps with hydride transfer becoming more rate limiting. The {sup 13}C effect decreases only slightly when obtained with deuterated malate, suggestive of the presence of a secondary {sup 13}C effect in the hydride transfer step, similar to data obtained with non-nicotinamide-containing dinucleotide substrates for the native enzyme (see the preceding paper in this issue). The native enzyme is inactivated in a time-dependent manner by Cd{sup 2+}. This inactivation occurs whether the enzyme alone is present or whether the enzyme is turning over with Cd{sup 2+} as the divalent metal activator. Upon inactivation, only Cd{sup 2+} ions are bound at high stoichiometry to the enzyme, which eventually becomes denatured. Conversion of the active-site thiol to thiocyanate makes it more difficult to inactivate the enzyme by treatment with Cd{sup 2+}.

  17. 负载人蛔虫和猪蛔虫抗原树突状细胞影响T细胞亚群活性研究%Comparative analysis of T cell subsets response induced by DC fused with Ag of Ascaris lumbricoides and Ascaris suum

    Institute of Scientific and Technical Information of China (English)

    祝伟; 黄川; 黄艳琴; 胡银英; 戴志芳; 袁芳; 袁铿


    respectively by flow cytometry (FCM),ELISA and real time PCR.And the LCs were isolated from bone marrow cells cultured with granulocyte/macrophage colony-stimulating factor (GM-CSF) and IL-4 in vitro.The FCM results showed that DCs isolated from bone marrow cells were with high expression of kinds of surface molecules (CD86,85.5 %; CD83 38.24%; CD80,94 %).CD80 and CD83 declined after heing cultured with ascaris extract for 2 days and that of the groups fused separately with Ag of A.lumbricoides and A.suum was respectively higher and lower than the control group.ELISA showed the level of expression of TNF-α in each period of each experimental group was lower than the control group (P<0.05); IL-10 in each group increased over time,and the groups with ascaris antigen were higher than groups with same concentration of A.suum antigen (P< 0.05) in each time except the time point of 24 hours.The qPCR results showed that the levels of the groups with A.lumbricoides Ag were declined over time but significantly higher than the control groups and the groups with A.suum Ag in different time points (P<0.05).The differences between the groups with A.suum Ag and the control groups were not statistically significant (P>0.05).In conclusion,DC fused with the Ag of A.lumbricoides promoted a stronger Th2 type response and the expression of Foxp3 mRNA in vitro.

  18. Molecular epidemiology of ascariasis: a global perspective on the transmission dynamics of Ascaris in people and pigs.


    Betson, M.; Nejsum, P; Bendall, RP; Deb, RM; Stothard, JR


    Background.  The roundworm Ascaris lumbricoides infects 0.8 billion people worldwide, and Ascaris suum infects innumerable pigs across the globe. The extent of natural cross-transmission of Ascaris between pig and human hosts in different geographical settings is unknown, warranting investigation. Methods.  Adult Ascaris organisms were obtained from humans and pigs in Europe, Africa, Asia, and Latin America. Barcodes were assigned to 536 parasites on the basis of sequence analysis of the mito...

  19. Reduction of Ascaris transmission to pigs by cleaning the dunging area


    Vermeer, H. M.; Borgsteede, F.H.M.; Gaasenbeek, C.P.H.; Blanken, K.


    Ascaris suum is the most prevalent helminth on organic pig farms (Carstensen et al., 2002) and is transmitted mainly via the faeces. The use of anthelmintics does not fit in the organic principles and preventive measures are promoted. This project focused on assessing the efficacy of a cleaning protocol for the dunging area of pens on Ascaris s. transmission to pigs. In 4 batches with 8 identical pens for 15 pigs each (n=480 pigs) 6 pigs per pen were orally infected with Ascaris s. The other ...

  20. Feeding Probiotic Bacteria To Swine Enhances Immunity To Ascaris Suum (United States)

    Probiotic bacterial species are included in the diet to promote health. Probiotics purportedly protect the intestine against pathogenic microorganisms and can reduce inflammation; however, quantitative measurement of probiotic growth and related effects on intestinal function are often lacking. Asca...

  1. Serum antibody responses in pigs trickle-infected with Ascaris and Trichuris

    DEFF Research Database (Denmark)

    Kringel, Helene; Thamsborg, Stig Milan; Petersen, Heidi Huus;


    A humoral immune response following helminth infection in pigs is well documented. However, it has been difficult to confirm the existence of antibody mediated resistance against the large roundworm, Ascaris suum, and whipworm, Trichuris suis, in experimental settings by correlating worm burdens ...

  2. Community Rates of IgG4 Antibodies to Ascaris Haemoglobin Reflect Changes in Community Egg Loads Following Mass Drug Administration


    Vlaminck, Johnny; Supali, Taniawati; Geldhof, Peter; Cornelis H Hokke; Fischer, Peter U.; Weil, Gary J


    Background Conventional diagnostic methods for human ascariasis are based on the detection of Ascaris lumbricoides eggs in stool samples. However, studies of ascariasis in pigs have shown that the prevalence and the number of eggs detected in the stool do not correlate well with exposure of the herd to the parasite. On the other hand, an ELISA test measuring antibodies to Ascaris suum haemoglobin (AsHb) has been shown to be useful for estimating transmission intensity on pig farms. In this st...

  3. Localized Th1-, Th2-,and inflamation-associated hepatic and pulmonary immune responses in Ascaris-infected swine are increased by retinoic acid. (United States)

    Pigs infected with Ascaris suum were treated with all-trans retinoic acid (ATRA) on d–1, d+1, d+3 of infection. Control or infected pigs were given 100 (LD-ATRA) or 1,000 (HD-ATRA) µg/kg ATRA in corn oil, or corn oil alone, and sacrificed at 7 and 14 days after inoculation (DAI) with infective eggs...

  4. Phylogeographical studies of Ascaris spp. based on ribosomal and mitochondrial DNA sequences.

    Directory of Open Access Journals (Sweden)

    Serena Cavallero

    Full Text Available BACKGROUND: The taxonomic distinctiveness of Ascaris lumbricoides and A. suum, two of the world's most significant nematodes, still represents a much-debated scientific issue. Previous studies have described two different scenarios in transmission patterns, explained by two hypotheses: (1 separated host-specific transmission cycles in highly endemic regions, (2 a single pool of infection shared by humans and pigs in non-endemic regions. Recently, A. suum has been suggested as an important cause of human ascariasis in endemic areas such as China, where cross-infections and hybridization have also been reported. The main aims of the present study were to investigate the molecular epidemiology of human and pig Ascaris from non-endemic regions and, with reference to existing data, to infer the phylogenetic and phylogeographic relationships among the samples. METHODOLOGY: 151 Ascaris worms from pigs and humans were characterized using PCR-RFLP on nuclear ITS rDNA. Representative geographical sub-samples were also analysed by sequencing a portion of the mitochondrial cox1 gene, to infer the extent of variability at population level. Sequence data were compared to GenBank sequences from endemic and non-endemic regions. PRINCIPAL FINDINGS: No fixed differences between human and pig Ascaris were evident, with the exception of the Slovak population, which displays significant genetic differentiation. The RFLP analysis confirmed pig as a source of human infection in non-endemic regions and as a corridor for the promulgation of hybrid genotypes. Epidemiology and host-affiliation seem not to be relevant in shaping molecular variance. Phylogenetic and phylogeographical analyses described a complex scenario, involving multiple hosts, sporadic contact between forms and an ancestral taxon referable to A. suum. CONCLUSIONS/SIGNIFICANCE: These results suggest the existence of homogenizing gene flow between the two taxa, which appear to be variants of a single

  5. Type I-like intervening sequences are found in the rDNA of the nematode Ascaris lumbricoides.


    Neuhaus, H; Müller, F.; Etter, A; Tobler, H


    The intervening sequences in the large ribosomal RNA gene of Ascaris lumbricoides var. suum show many similarities to the type I insertions, previously found only in some insect species. They include structural features, but also a presumed transcriptional inactivity in vivo: No transcript of the rDNA intervening sequence in A. lumbricoides could be detected in Northern and dot blot hybridizations. However, the primary structure of the Pol I promoter region is well conserved in interrupted an...

  6. Ascaris suum infections in pigs born and raised on contaminated paddocks

    DEFF Research Database (Denmark)

    Mejer, Helena; Roepstorff, Allan Knud


    .p. by removing the sow. Paddock infection levels were estimated by regular examination of soil samples and in late June and late November using parasite naïve tracer pigs. Paddock contamination was high but eggs developed slowly resulting in a low initial transmission to the experimental pigs. By week 5...

  7. Development and survival of Ascaris suum eggs in deep litter of pigs

    DEFF Research Database (Denmark)

    Katakam, Kiran Kumar; Thamsborg, Stig Milan; Kyvsgaard, Niels Christian;


    pens on an organic farm in four seasons. There was some variation, but mean ammonia levels were generally very low (1·0-2·6 mm) and pH levels were moderate (8·04-8·88) in all three areas. Relatively, resting areas were characterized by overall moderate moisture (36%) and moderately high temperature (35......·7 °C) levels. The area contained few eggs (50 eggs g-1 DM) of which 17% were viable, and though only 4% were larvated and 0·7% appeared infective, it was more than in the other areas. Intermediate areas had moderate moisture (43%) and high temperature (43·6 °C) levels. There were many eggs (523 eggs g......-1 DM), but overall viability was very low (5%) and few eggs were larvated (0·004%) or even infective (0·002%). Latrines typically had high moisture (79%) and moderate temperature (30 °C) levels. The concentration of eggs was very high (1444 egg g-1 DM) and though 32% were viable, none had developed...

  8. [Sonographic imaging of Ascaris lumbricoides]. (United States)

    Barzilai, M; Khamaysi, N


    The round worm, Ascaris lumbricoides, is one of the largest of the parasites that infest the human bowel. The worms usually develop in the jejunum and can reach several thousand in number, causing bowel obstruction, volvulus, intussusception, appendicitis and even bowel perforation with penetration into the peritoneal cavity. They tend to invade the bile and pancreatic ducts and may cause acute cholecystitis and pancreatitis. Ascaris lumbricoides can be detected by sonography. This imaging modality can be helpful in diagnosing the presence of the worms and in evaluating response to treatment. We present an 18-month-old girl in whom bowel worms were detected by sonography. PMID:8940520

  9. Churg-Strauss vasculitis and ascaris infection.


    Chauhan, A.; Scott, D G; Neuberger, J; Gaston, J. S.; Bacon, P A


    A patient with Churg-Strauss vasculitis presenting with mononeuritis multiplex, who developed obstructive jaundice, is described. On investigation the jaundice proved to be due to ascaris infestation. As the immune abnormalities associated with ascaris infection are also typical of those seen in the Churg-Strauss syndrome it is speculated that the vasculitis occurred because of a failure to regulate the anti-ascaris immune response.

  10. Cytogenetic study of Ascaris trypsin inhibitor in cultured human lymphocytes with metabolic activation

    Indian Academy of Sciences (India)

    Joanna Blaszkowska; Wanda Bratkowska; Dobroslawa Lopaczynska; Tomasz Ferenc


    The trypsin inhibitor (ATI) isolated from gastrointestinal nematode Ascaris suum was tested in vitro for induction of chromosome aberrations and sister chromatid exchanges (SCE). Genotoxicity assessment of purified ATI was carried out on metaphase plates received from peripheral blood lymphocyte macroculture (48 h test of structural chromosome aberrations and 72 h test of SCE) with exogenous metabolic activation. ATI was tested in dose of 25, 50 and 100 μg per ml of culture. Kinetics of cell divisions were determined by the replication index (RI). The mitotic index (MI) was expressed as a number of metaphases per 1000 nuclei analysed. Analysis of chromosome aberrations showed that higher doses of ATI (50 and 100 /ml) significantly increased the frequency of chromosome aberrations (mainly of chromatid gaps and breaks) compared to the negative control. All concentrations of ATI caused a statistically significant reduction in the MI and RI. In comparison with the negative control, a significant increase in the SCE frequency was observed in all applied doses of ATI. Thus, in the presence of S9 activation, the Ascaris trypsin inhibitor showed potential clastogenic activity and inhibition of the dynamics of lymphocyte divisions.

  11. Characterization of ascaris from ecuador and zanzibar. (United States)

    Sparks, A M; Betson, M; Oviedo, G; Sandoval, C; Cooper, P J; Stothard, J R


    To shed light on the epidemiology of ascariasis in Ecuador and Zanzibar, 177 adult worms retrieved by chemo-expulsion from either people or pigs were collected, measured and subjected to polymerase chain reaction-restriction fragment length polymorphism (PCR-RFLP) analysis of the ribosomal internal transcribed spacer (ITS) region. Upon double digestion with RsaI and HaeIII, PCR-RFLP analysis revealed the presence of A. lumbricoides in people and A. suum in pigs in Ecuador. In contrast, while there are no pigs on Zanzibar, of the 56 worms obtained from people, one was genotyped as A. suum. No additional genetic variation was detected upon further PCR-RFLP analysis with several other restriction enzymes. Upon measurement, worm mass and length differed by location and by species, A. suum being lighter and longer. While there is no evidence to suggest zoonotic transmission in Ecuador, an enduring historical signature of previous zoonotic transmission remains on Zanzibar. PMID:26017334

  12. 人蛔虫和猪蛔虫差异的比较研究%Comparative Studies on the Difference Between Ascaris lumbricoides and Ascaris suum

    Institute of Scientific and Technical Information of China (English)

    翁培兰; 彭卫东



  13. Pancreatitis secondary to Ascaris Lumbricoides: A case series analysis


    Ab hameed Raina, Ghulam Nabi Yattoo, Feroz Ahmad Wani, Reyaz Ahmad Para, Khaild Hamid Changal, Arshed Hussain Parry


    Ascaris lumbricoides infestations are endemic in tropical countries. Ascaris lumbricoides is the second most common intestinal parasite world-wide and, although the infection can be asymptomatic, in some cases it can present with complications, such as acute pancreatitis. Pancreatitis secondary to ascaris is more common in females. We describe three cases who presented with Ascaris lumbricoides-induced acute pancreatitis and all of them were females and were diagnosed on ultrasonography. In t...

  14. Distribution of 3H-GABA uptake sites in the nematode Ascaris

    International Nuclear Information System (INIS)

    The distribution of uptake sites for the inhibitory neurotransmitter gamma-aminobutyric acid (GABA) in the nematode Ascaris suum was examined by autoradiography of 3H-GABA uptake. Single neural processes in both the ventral and dorsal nerve cords were labeled with 3H-GABA. Serial section analysis identified the cells of origin of these processes as the RMEV-like and RMED-like neurons. These cells belong to a set of four neurons in the nerve ring, all of which are labeled by 3H-GABA. 3H-GABA labeling of at least two other sets of cephalic neurons was seen. One of these pairs consists of medium-sized lateral ganglia neurons, located at the level of the amphid commissure bundle. A second pair is located in the lateral ganglia at the level of the deirid commissure bundle. The position and size of these lateral ganglia cells suggest that they are the GABA-immunoreactive lateral ganglia cells frequently seen in whole-mount immunocytochemical preparations. Four neuronal cell bodies located in the retrovesicular ganglion were also labeled with 3H-GABA. These cells, which are probably cholinergic excitatory motor neurons, do not contain detectable GABA-like immunoreactivity. Heavy labeling of muscle cells was also observed. The ventral and dorsal nerve cord inhibitory motor neurons, which are known to contain GABA-like immunoreactivity, were not labeled above background with 3H-GABA. Together with the experiments reported previously, these results define three classes of GABA-associated neurons in Ascaris: (1) neurons that contain endogenous GABA and possess a GABA uptake system; (2) neurons that contain endogenous GABA, but that either lack a GABA uptake system or possess a GABA uptake system of low activity; (3) neurons that possess a GABA uptake system, but that lack endogenous GABA

  15. Distribution of 3H-GABA uptake sites in the nematode Ascaris

    Energy Technology Data Exchange (ETDEWEB)

    Guastella, J.; Stretton, A.O. (University of Wisconsin, Madison (USA))


    The distribution of uptake sites for the inhibitory neurotransmitter gamma-aminobutyric acid (GABA) in the nematode Ascaris suum was examined by autoradiography of 3H-GABA uptake. Single neural processes in both the ventral and dorsal nerve cords were labeled with 3H-GABA. Serial section analysis identified the cells of origin of these processes as the RMEV-like and RMED-like neurons. These cells belong to a set of four neurons in the nerve ring, all of which are labeled by 3H-GABA. 3H-GABA labeling of at least two other sets of cephalic neurons was seen. One of these pairs consists of medium-sized lateral ganglia neurons, located at the level of the amphid commissure bundle. A second pair is located in the lateral ganglia at the level of the deirid commissure bundle. The position and size of these lateral ganglia cells suggest that they are the GABA-immunoreactive lateral ganglia cells frequently seen in whole-mount immunocytochemical preparations. Four neuronal cell bodies located in the retrovesicular ganglion were also labeled with 3H-GABA. These cells, which are probably cholinergic excitatory motor neurons, do not contain detectable GABA-like immunoreactivity. Heavy labeling of muscle cells was also observed. The ventral and dorsal nerve cord inhibitory motor neurons, which are known to contain GABA-like immunoreactivity, were not labeled above background with 3H-GABA. Together with the experiments reported previously, these results define three classes of GABA-associated neurons in Ascaris: (1) neurons that contain endogenous GABA and possess a GABA uptake system; (2) neurons that contain endogenous GABA, but that either lack a GABA uptake system or possess a GABA uptake system of low activity; (3) neurons that possess a GABA uptake system, but that lack endogenous GABA.

  16. Destruction of Ascaris ova by accelerated electron (United States)

    Capizzi, S.; Chevallier, A.; Schwartzbrod, J.


    We investigated the efficiency of radiation treatment to destroy Ascaris ova viability and found that no ova were viable after exposure to 0.75 kGy (D 90 at 0.39 kGy). Although the outer coat of the Ascaris ovum had a protective effect at low doses (0.20 kGy) no difference in ova viability was observed at 0.30 kGy. As the doses commonly used for sanitary treatment of wastewater are much higher, Ascaris ova should be effectively eliminated from sludge by the 10 kGy dose required by EPA regulations ( U.S. EPA, 1993 Federal Register 58, 9248-9415).

  17. Isotope partitioning for NAD-malic enzyme from Ascaris suum confirms a steady-state random kinetic mechanism

    Energy Technology Data Exchange (ETDEWEB)

    Chen, C.Y.; Harris, B.G.; Cook, P.F.


    Isotope partitioning studies beginning with E-(/sup 14/C)NAD, E-(/sup 14/C) malate, E-(/sup 14/C) NAD-Mg/sup 2 +/, and E-Mg-(/sup 14/C)malate suggest a steady-state random mechanism for the NAD-malic enzyme. Isotope trapping beginning with E-(/sup 14/C)NAD and with varying concentrations of Mg/sup 2 +/ and malate in the chase solution indicates that Mg/sup 2 +/ is added in rapid equilibrium and must be added prior to malate for productive ternary complex formation. Equal percentage trapping from E-(/sup 14/C)NAD-Mg and E-Mg-(/sup 14/C) malate indicates the mechanism is steady-state random with equal off-rates for NAD and malate from E-NAD-Mg-malate. The off-rates for both do not change significantly in the ternary E-Mg-malate and E-NAD-Mg complexes, nor does the off-rate change for NAD from E-NAD. No trapping of malate was obtained from E-(/sup 14/C) malate, suggesting that this complex is nonproductive. A quantitative analysis of the data allows an estimation of values for a number of the rate constants along the reaction pathway.

  18. Isotope partitioning for NAD-malic enzyme from Ascaris suum confirms a steady-state random kinetic mechanism

    International Nuclear Information System (INIS)

    Isotope partitioning studies beginning with E-[14C]NAD, E-[14C] malate, E-[14C] NAD-Mg2+, and E-Mg-[14C]malate suggest a steady-state random mechanism for the NAD-malic enzyme. Isotope trapping beginning with E-[14C]NAD and with varying concentrations of Mg2+ and malate in the chase solution indicates that Mg2+ is added in rapid equilibrium and must be added prior to malate for productive ternary complex formation. Equal percentage trapping from E-[14C]NAD-Mg and E-Mg-[14C] malate indicates the mechanism is steady-state random with equal off-rates for NAD and malate from E-NAD-Mg-malate. The off-rates for both do not change significantly in the ternary E-Mg-malate and E-NAD-Mg complexes, nor does the off-rate change for NAD from E-NAD. No trapping of malate was obtained from E-[14C] malate, suggesting that this complex is nonproductive. A quantitative analysis of the data allows an estimation of values for a number of the rate constants along the reaction pathway

  19. Advances in phylogenetic studies of Nematoda

    Institute of Scientific and Technical Information of China (English)


    Nematoda is a metazoan group with extremely high diversity only next to Insecta. Caenorhabditis elegans is now a favorable experimental model animal in modern developmental biology, genetics and genomics studies. However, the phylogeny of Nematoda and the phylogenetic position of the phylum within animal kingdom have long been in debate. Recent molecular phylogenetic studies gave great challenges to the traditional nematode classification. The new phylogenies not only placed the Nematoda in the Ecdysozoan and divided the phylum into five clades, but also provided new insights into animal molecular identification and phylogenetic biodiversity studies. The present paper reviews major progress and remaining problems in the current molecular phylogenetic studies of Nematoda, and prospects the developmental tendencies of this field.

  20. Small bowel Ascaris infestation: a diagnostic challenge. (United States)

    Khan, Muhammad Waqas; Ghauri, Sanniya Khan


    Ascariasis is a common infestation in developing countries where there is poor hygiene. A majority of the cases are asymptomatic, with a few cases presenting with mild abdominal pain and nutritional deficiencies in the long term. Here we present a case of a young boy who presented as a diagnostic dilemma, with signs of acute intestinal obstruction without any supporting radiological evidence. A barium study revealed the presence of low-burden Ascaris infestation that was managed medically. PMID:27175091

  1. Surgical complications of Ascaris lumbricoides in children


    Ramareddy, Raghu S.; Anand Alladi; O S Siddapa; Deepti, V; Tanveer Akthar; B Mamata


    Aim : To report the surgical complications of Ascaris lumbricoides infestation in children. Materials and Methods : This is a retrospective study and cases of intestinal ascariasis managed conservatively were excluded. Results : Sixteen children presented with Ascariasis sequelae, which included ileal volvulus (n=5), perforations (n=4), intussusception (n=1), biliary ascariasis (n-1) and impacted multiple worm boluses (n=5). Plain abdominal radiographs showed pneumoperitoneum (3), cigar bundl...



    Prashant U; Bhawana D; Pradip B; Narendra G.


    Intestinal intussusception caused by ascaris is uncommon. Abdominal ultrasound is generally done as a first imaging investigation for abdominal symptoms. This report described the ultrasound features in this rare case of adult intussusception due to entrapped ascaris, making a significant contribution to radiological knowledge in diagnosing the cause at the earliest for better management.

  3. Ascaris lumbricoides: an unusual aetiology of gastric perforation


    Gupta, Shahana; Kumar, Sanjeev; Satapathy, Ayusman; Ray, Udipta; Chatterjee, Souvik; Choudhury, Tamal Kanti


    Gastrointestinal (GI) infestation with Ascaris lumbricoides is common in the tropical countries, particularly in children. A wide range of clinical presentations are reported for GI ascariasis in both adults and children. We report a case of gastric perforation due to Ascaris, a rare presentation.

  4. Duplex quantitative real-time PCR assay for the detection and discrimination of the eggs of Toxocara canis and Toxocara cati (Nematoda, Ascaridoidea in soil and fecal samples

    Directory of Open Access Journals (Sweden)

    Durant Jean-Francois


    Full Text Available Abstract Background Toxocarosis is a zoonotic disease caused by Toxocara canis (T. canis and/or Toxocara cati (T. cati, two worldwide distributed roundworms which are parasites of canids and felids, respectively. Infections of humans occur through ingestion of embryonated eggs of T. canis or T. cati, when playing with soils contaminated with dogs or cats feces. Accordingly, the assessment of potential contamination of these areas with these roundworms eggs is paramount. Methods A duplex quantitative real-time PCR (2qPCR targeting the ribosomal RNA gene internal transcribed spacer (ITS2 has been developed and used for rapid and specific identification of T. canis and T. cati eggs in fecal and soil samples. The assay was set up on DNA samples extracted from 53 adult worms including T. canis, T. cati, T. leonina, Ascaris suum (A. suum and Parascaris equorum (P. equorum. The assay was used to assess the presence of T. cati eggs in several samples, including 12 clean soil samples spiked with eggs of either T. cati or A. suum, 10 actual soil samples randomly collected from playgrounds in Brussels, and fecal samples from cats, dogs, and other animals. 2qPCR results on dogs and cats fecal samples were compared with results from microscopic examination. Results 2qPCR assay allowed specific detection of T. canis and T. cati, whether adult worms, eggs spiked in soil or fecal samples. The 2qPCR limit of detection (LOD in spiked soil samples was 2 eggs per g of soil for a turnaround time of 3 hours. A perfect concordance was observed between 2qPCR assay and microscopic examination on dogs and cats feces. Conclusion The newly developed 2qPCR assay can be useful for high throughput prospective or retrospective detection of T.canis and/or T. cati eggs in fecal samples as well as in soil samples from playgrounds, parks and sandpits.

  5. Small bowel Ascaris infestation: a diagnostic challenge

    Directory of Open Access Journals (Sweden)

    Khan MW


    Full Text Available Muhammad Waqas Khan, Sanniya Khan Ghauri Section of Medicine, Department of Emergency Medicine, WHO Collaborating Centre for Emergency Medicine and Trauma Care, Aga Khan University Hospital, Karachi, Pakistan Abstract: Ascariasis is a common infestation in developing countries where there is poor hygiene. A majority of the cases are asymptomatic, with a few cases presenting with mild abdominal pain and nutritional deficiencies in the long term. Here we present a case of a young boy who presented as a diagnostic dilemma, with signs of acute intestinal obstruction without any supporting radiological evidence. A barium study revealed the presence of low-burden Ascaris infestation that was managed medically. Keywords: partial intestinal obstruction, gastro-intestinal helminthic infection, pediatric

  6. A quantitative assessment method for Ascaris eggs on hands

    DEFF Research Database (Denmark)

    Jeandron, Aurelie; Ensink, Jeroen H. J.; Thamsborg, Stig Milan;


    The importance of hands in the transmission of soil transmitted helminths, especially Ascaris and Trichuris infections, is under-researched. This is partly because of the absence of a reliable method to quantify the number of eggs on hands. Therefore, the aim of this study was to develop a method...... with Ascaris eggs and of their role in human infection. Follow-up studies are needed that validate the hand washing method under field conditions, e.g. including people of different age, lower levels of contamination and various levels of hand cleanliness....... to assess the number of Ascaris eggs on hands and determine the egg recovery rate of the method. Under laboratory conditions, hands were seeded with a known number of Ascaris eggs, air dried and washed in a plastic bag retaining the washing water, in order to determine recovery rates of eggs for four...

  7. Wandering ascaris coming out through the abdominal wall

    Directory of Open Access Journals (Sweden)

    Mohd L Wani


    Full Text Available A rare case of ascaris coming out through the anterior abdominal wall is reported here. A 40-year-old female had undergone dilatation and curettage by a quack. On the second day she presented with presented with features of peritonitis. She was explored. Resection anastomosis of the ileum was done for multiple perforations of the ileum. Patient developed a fistula in the anterior abdominal wall which was draining bile-colored fluid. On the 12 th postoperative day a 10-cm-long worm was seen coming out through the fistulous tract which was found to be Ascaris lumbricoids. Ascaris lumbricoids can lead to many complications ranging from worm colic to intestinal obstruction, volvulus, peritonitis, pancreatitis, cholangiohepatitis, liver abscess and many more. Worm has been reported to come out through mouth, nostrils, abdominal drains, T-tubes etc. But ascaris coming out through the anterior abdominal wall is very rare hence reported here.

  8. Laryngeal spasm after general anaesthesia due to Ascaris Lumbricoides


    Finsnes, K D


    Postoperative upper airway obstruction during recovery from general anaesthesia may have several causes. This is a report of a young girl who developed laryngeal spasm as a result of an ectopic roundworm Ascaris lumbricoides.

  9. Mammalian metallopeptidase inhibition at the defense barrier of Ascaris parasite


    Sanglas, Laura; Aviles, Francesc X.; Huber, Robert; Gomis-Rüth, F. Xavier; Arolas, Joan L.


    Roundworms of the genus Ascaris are common parasites of the human gastrointestinal tract. A battery of selective inhibitors protects them from host enzymes and the immune system. Here, a metallocarboxypeptidase (MCP) inhibitor, ACI, was identified in protein extracts from Ascaris by intensity-fading MALDI-TOF mass spectrometry. The 67-residue amino acid sequence of ACI showed no significant homology with any known protein. Heterologous overexpression and purification of ACI rendered a functio...

  10. Liver abscess caused by Ascaris lumbricoides: case report


    PINILLA Análida Elizabeth; LÓPEZ Myriam Consuelo; Orlando RICAURTE; CASTILLO Blanca; Murcia, Martha Isabel; Nicholls, Rubén Santiago; Duque, Sofía; Orozco, Luis Carlos


    A case is reported of a woman who lived in a rural area with a chronic illness that consisted of weight loss and abdominal pain in the epigastrium and upper right quadrant. The initial diagnosis was a mass in the liver, which was later, demonstrated, both by direct and histological examination, to be an abscess caused by Ascaris lumbricoides. Eggs of Ascaris lumbricoides and abundant Charcot-Leyden Crystals were found.

  11. Esophageal space-occupying lesion caused by Ascaris lumbricoides


    Zheng, Ping-Ping; Wang, Bing-Yuan; Wang, Fei; Ao, Ran; Wang, Ying(School of Physics, Shandong University, Jinan, 250100, PR China)


    Ascaris lumbricoides is the largest intestinal nematode parasite of man, which can lead to various complications because of its mobility. As the esophagus is not normal habitat of Ascaris, the report of esophageal ascariasis is rare. An old female presented with dysphagia after an intake of several red bean buns and haw jellies. The barium meal examination revealed a spherical defect in the lower esophagus. Esophageal bezoar or esophageal carcinoma was considered at the beginning. The patient...

  12. Tube within Tube: Ascaris in Bowel and Biliary-Tract


    Goyal, Ankur; Gamanagatti, Shivanand; Sriram, Jaganathan


    Ascaris lumbricoides is one of the most common human helminthic diseases worldwide. On ultrasound, it is seen as linear non-shadowing echogenic structures with target appearance in cross section, and the live worm may show writhing movements in real time. On barium meal follow through, it appears as radiolucent tubular filling defects within the bowel lumen. Though not sensitive, direct real-time visualization of Ascaris on ultrasound is quick, non-invasive, and definitive.

  13. The Dynamics of Ascaris lumbricoides Infections. (United States)

    Fowler, A C; Déirdre Hollingsworth, T


    The Anderson-May model of human parasite infections and specifically that for the intestinal worm Ascaris lumbricoides is reconsidered, with a view to deriving the observed characteristic negative binomial distribution which is frequently found in human communities. The means to obtaining this result lies in reformulating the continuous Anderson-May model as a stochastic process involving two essential populations, the density of mature worms in the gut, and the density of mature eggs in the environment. The resulting partial differential equation for the generating function of the joint probability distribution of eggs and worms can be partially solved in the appropriate limit where the worm lifetime is much greater than that of the mature eggs in the environment. Allowing for a mean field nonlinearity, and for egg immigration from neighbouring communities, a negative binomial worm distribution can be predicted, whose parameters are determined by those in the continuous Anderson-May model; this result assumes no variability in predisposition to the infection. PMID:27066982

  14. Medical image of the week: ascaris lumbridoies

    Directory of Open Access Journals (Sweden)

    Wong C


    Full Text Available No abstract available. Article truncated at 150 words. A 25 year-old man was admitted to the ICU with acute renal failure and acute respiratory failure from fluid overload after attempting to cross the border. The patient was successfully extubated after five days of mechanical ventilation and renal replacement therapy. Following extubation, the patient had a bowel movement and passed a 23cm adult Ascaris lumbricoides. He was treated with a single dose of albendazole 400 mg. Ascariasis is a very common helminthic infection, particularly in pediatric populations, and affects mostly the gastrointestinal tract. When infective eggs are swallowed by the host, larvae hatch in the GI tract. The larvae invade the GI mucosa and then are brought into the lungs via portal circulation. The larvae can then move up the tracheobronchial tree and then are swallowed into the GI tract where the mature worms form (1. While our patient had a simple gastrointestinal infection, several pulmonary complications of ascariasis ...

  15. GABA localization in the nematode Ascaris

    International Nuclear Information System (INIS)

    A histochemical approach was used to examine the distribution of GABA-associated neurons in the nematode Ascaris, an organism whose small number of morphologically simple neurons make it an excellent preparation for analyzing neuronal phenotypes. Two GABAergic markers were examined: GABA-like immunoreactivity (GLIR), a marker for endogenous stores of GABA; and [3H]-GABA uptake, a marker for GABA uptake sites. Strong GLIR was present in the cell bodies, neurites and commissures of dorsal and ventral inhibitory motorneurons present in this region. Strong GLIR was also present in the cell bodies and processes of the four RME neurons in the nerve ring and in several other ganglionic neurons. Staining was absent in excitatory motorneurons, in ventral cord interneurons and in muscle cells and hypodermis. GABA uptake sites were found in single neural processes in both the ventral and dorsal nerve cords. [3H]-GABA labeling was also observed in the other two RME cells and several other cephalic neurons. Four putative cholinergic excitatory motorneurons in the retrovesicular ganglion (RVG) were heavily labeled. Ventral and dorsal nerve cord inhibitory motorneurons did not take up [3H]-GABA. Labeling of the ventral cord excitatory motorneuron somata and cell bodies was at or slightly above background. Heavy labeling of muscle cells was also observed

  16. GABA localization in the nematode Ascaris

    Energy Technology Data Exchange (ETDEWEB)

    Guastella, J.


    A histochemical approach was used to examine the distribution of GABA-associated neurons in the nematode Ascaris, an organism whose small number of morphologically simple neurons make it an excellent preparation for analyzing neuronal phenotypes. Two GABAergic markers were examined: GABA-like immunoreactivity (GLIR), a marker for endogenous stores of GABA; and ({sup 3}H)-GABA uptake, a marker for GABA uptake sites. Strong GLIR was present in the cell bodies, neurites and commissures of dorsal and ventral inhibitory motorneurons present in this region. Strong GLIR was also present in the cell bodies and processes of the four RME neurons in the nerve ring and in several other ganglionic neurons. Staining was absent in excitatory motorneurons, in ventral cord interneurons and in muscle cells and hypodermis. GABA uptake sites were found in single neural processes in both the ventral and dorsal nerve cords. ({sup 3}H)-GABA labeling was also observed in the other two RME cells and several other cephalic neurons. Four putative cholinergic excitatory motorneurons in the retrovesicular ganglion (RVG) were heavily labeled. Ventral and dorsal nerve cord inhibitory motorneurons did not take up ({sup 3}H)-GABA. Labeling of the ventral cord excitatory motorneuron somata and cell bodies was at or slightly above background. Heavy labeling of muscle cells was also observed.

  17. Serum malondialdehyde level in patients infected with Ascaris lumbricoides

    Institute of Scientific and Technical Information of China (English)

    Eser Kilic; Süleyman Yazar; Recep Saraymen; Hatice Ozbilge


    AIM:The aim of the study was to investigate the changes of serum malondialdehyde level, I.e; the oxidative stress hypothesis in patients infected with Ascaris lumbricoides.METHODS: Serum malondialdehyde activity was measured in 43 patients who were positive for intestinal parasite of Ascaris lumbricoides. Scores were obtained for the positives and their age-and sex-matched 60 Ascaris lumbricoides negative healthy controls.RESULTS: The difference between malondialdehyde levels of patients infected with Ascaris lumbricoides and control group was statistically significant both for females (P<0.05)and for males (P<0.05). In the patient and control groups,no correlation was found between age and malondialdehyde levels (P>0.05) both in females and in males. In addition,no significant correlation could be found between malondialdehyde levels of both females and males for patients and control groups (P>0.05).CONCLUSION: Malondialdehyde levels clearly increase in patients infected with Ascaris lumbricoides.

  18. Paleoparasitological report on Ascaris aDNA from an ancient East Asian sample

    Directory of Open Access Journals (Sweden)

    Chang Seok Oh


    Full Text Available In this study, Ascaris DNA was extracted and sequenced from a medieval archaeological sample in Korea. While Ascaris eggs were confirmed to be of human origin by archaeological evidence, it was not possible to pinpoint the exact species due to close genetic relationships among them. Despite this shortcoming, this is the first Ascaris ancient DNA (aDNA report from a medieval Asian country and thus will expand the scope of Ascaris aDNA research.

  19. Paleoparasitological report on Ascaris aDNA from an ancient East Asian sample


    Chang Seok Oh; Min Seo; Nam Jin Lim; Sang Jun Lee; Eun-Joo Lee; Soong Deok Lee; Dong Hoon Shin


    In this study, Ascaris DNA was extracted and sequenced from a medieval archaeological sample in Korea. While Ascaris eggs were confirmed to be of human origin by archaeological evidence, it was not possible to pinpoint the exact species due to close genetic relationships among them. Despite this shortcoming, this is the first Ascaris ancient DNA (aDNA) report from a medieval Asian country and thus will expand the scope of Ascaris aDNA research.

  20. Developing a method for quantification of Ascaris eggs on hands

    DEFF Research Database (Denmark)

    Jeandron, Aurelie; Ensink, Jeroen J. H.; Thamsborg, Stig Milan;

    In transmission of soil transmitted helminths, especially with Ascaris and Trichuris infections, the importance of hands is unclear and very limited literature exists. This is partly because of the absence of a reliable method to quantify the number of helminth eggs on hands. The aim of this study...... was to develop a method to assess the number of Ascaris eggs on hands and determine the egg recovery rate of the method. Under laboratory conditions, hands were contaminated with app. 1000 Ascaris eggs, air dried and washed in a plastic bag retaining the washing water, in order to determine recovery rates...... of eggs for two different detergents (cationic [benzethonium chloride 0.1%], anionic [7X 1% - quadrafos, glycol ether, and dioctyl sulfoccinate sodium salt]) and de-ionized water used as control. The highest recovery rate (95.6%) was achieved with a hand rinse performed with 7X 1%. Washing hands...

  1. Liver abscess caused by Ascaris lumbricoides: case report Absceso hepático por Ascaris lumbricoides: reporte de un caso


    PINILLA Análida Elizabeth; LÓPEZ Myriam Consuelo; Orlando RICAURTE; CASTILLO Blanca; Murcia, Martha Isabel; Nicholls, Rubén Santiago; Duque, Sofía; Orozco, Luis Carlos


    A case is reported of a woman who lived in a rural area with a chronic illness that consisted of weight loss and abdominal pain in the epigastrium and upper right quadrant. The initial diagnosis was a mass in the liver, which was later, demonstrated, both by direct and histological examination, to be an abscess caused by Ascaris lumbricoides. Eggs of Ascaris lumbricoides and abundant Charcot-Leyden Crystals were found.Se presenta el caso de una mujer que vivía en zona rural con una enfermedad...

  2. Optimization of the agar-gel method for isolation of migrating Ascaris suum larvae from the liver and lungs of pigs

    DEFF Research Database (Denmark)

    Saeed, I.; Roepstorff, A.; Rasmussen, T.;


    clean suspension which reduced the sample counting time. Blending the liver for 60 sec in a commercial blender showed significantly higher larvae recovery than blending for 30 sec. Addition of gentamycin to reduce bacterial growth during incubation, glucose to increase larval motility during migration...

  3. Genetic diversity of Ascaris in southwestern Uganda

    DEFF Research Database (Denmark)

    Betson, Martha; Nejsum, Peter; Llewellyn-Hughes, Julia;


    Despite the common occurrence of ascariasis in southwestern Uganda, helminth control in the region has been limited. To gain further insights into the genetic diversity of Ascaris in this area, a parasitological survey in mothers (n=41) and children (n=74) living in two villages, Habutobere and M...

  4. Esophageal space-occupying lesion caused by Ascaris lumbricoides

    Institute of Scientific and Technical Information of China (English)

    Ping-Ping Zheng; Bing-Yuan Wang; Fei Wang; Ran Ao; Ying Wang


    Ascaris lumbricoides is the largest intestinal nematode parasite of man,which can lead to various complications because of its mobility.As the esophagus is not normal habitat of Ascaris,the report of esophageal ascariasis is rare.An old female presented with dysphagia after an intake of several red bean buns and haw jellies.The barium meal examination revealed a spherical defect in the lower esophagus.Esophageal bezoar or esophageal carcinoma was considered at the beginning.The patient fasted,and received fluid replacement treatment as well as some oral drugs such as proton pump inhibitor and sodium bicarbonate.Then upper gastrointestinal endoscopy was done to further confirm the diagnosis and found a live Ascaris lumbricoides in the gastric antrum and two in the duodenal bulb.The conclusive diagnosis was ascariasis.The esophageal space-occupying lesion might be the entangled worm bolus.Anthelmitnic treatment with mebendazole improved patient's clinical manifestations along with normalization of the radiological findings during a 2-wk follow-up.Authors report herein this rare case of Ascaris lumbricoides in the esophagus,emphasizing the importance of awareness of this parasitic infection as it often presents with different and unspecific symptoms.

  5. Analysis of the accuracy and precision of the McMaster method in detection of the eggs of Toxocara and Trichuris species (Nematoda) in dog faeces. (United States)

    Kochanowski, Maciej; Dabrowska, Joanna; Karamon, Jacek; Cencek, Tomasz; Osiński, Zbigniew


    The aim of this study was to determine the accuracy and precision of McMaster method with Raynaud's modification in the detection of the eggs of the nematodes Toxocara canis (Werner, 1782) and Trichuris ovis (Abildgaard, 1795) in faeces of dogs. Four variants of McMaster method were used for counting: in one grid, two grids, the whole McMaster chamber and flotation in the tube. One hundred sixty samples were prepared from dog faeces (20 repetitions for each egg quantity) containing 15, 25, 50, 100, 150, 200, 250 and 300 eggs of T. canis and T. ovis in 1 g of faeces. To compare the influence of kind of faeces on the results, samples of dog faeces were enriched at the same levels with the eggs of another nematode, Ascaris suum Goeze, 1782. In addition, 160 samples of pig faeces were prepared and enriched only with A. suum eggs in the same way. The highest limit of detection (the lowest level of eggs that were detected in at least 50% of repetitions) in all McMaster chamber variants were obtained for T. canis eggs (25-250 eggs/g faeces). In the variant with flotation in the tube, the highest limit of detection was obtained for T. ovis eggs (100 eggs/g). The best results of the limit of detection, sensitivity and the lowest coefficients of variation were obtained with the use of the whole McMaster chamber variant. There was no significant impact of properties of faeces on the obtained results. Multiplication factors for the whole chamber were calculated on the basis of the transformed equation of the regression line, illustrating the relationship between the number of detected eggs and that of the eggs added to the'sample. Multiplication factors calculated for T. canis and T. ovis eggs were higher than those expected using McMaster method with Raynaud modification. PMID:23951934

  6. Ascaris lumbricoides and Ascaris suum represent the same species based on sequence analysis of mitochondrial nad5 gene%人蛔虫和猪蛔虫线粒体nad5基因的序列分析

    Institute of Scientific and Technical Information of China (English)

    吴昌义; 林瑞庆; 朱艳平; 刘国华


    以采自中国不同地方的人蛔虫与猪蛔虫为研究对象,PCR扩增其线粒体烟酰胺脱氢酶亚基V基因(nad5)的部分序列(pnad5)并进行序列测定,应用ClustalX 1.81程序对序列进行比对.结果显示:所获得的pnad5序列长度一致,均为556 bp;人蛔虫和猪蛔虫的pnad5序列差异仅为0.0%~2.6%,本研究结果支持人蛔虫与猪蛔虫是同一个种的结论.



    Brmež, Mirjana; Varga, Ivana; Benković-Lačić, Teuta; Lončarić, Zdenko


    Zajednica nematoda proučavana je prilikom uzgoja feferona pod utjecajem gnojidbe Zn i P. Cilj ovog istraživanja bio je utvrditi promjene zajednice nematoda u tlu pod utjecajem aplikacije P, Zn i njihove kombinacije (P+Zn). Analiza zajednice nematoda u istraživanju uključila je ispitivanja promjene ukupnoga broja nematoda i ukupnoga broja rodova te analizu trofičkih grupa. Uznemirenost zajednice utvrđena je pomoću indeksa uznemirenja: MI, MI 2–5 i PPI, te odnosa PPI/MI, a raznolikost zajednice...

  8. Ultrasonographic findings of ascaris in the small bowel: A case report

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Hyun Cheol; Shin, Hyeong Cheol; Kim, Hyung Hwan; Bae, Won Kyung; Kim, Il Young [Cheonan Hospital, Soonchunhyang University college of Medicine, Cheonan (Korea, Republic of); Park, Seong Jin [Bucheon Hospital, Soonchunhyang University college of Medicine, Bucheon (Korea, Republic of); Choi, Jin Soo [Keimyung University college of Medicine, Taegu (Korea, Republic of)


    Ascariasis is one of the most common helminthic disease worldwide and evoked variable clinical manifestations by the migration of worm in the alimentary and biliary tract. The ultrasonographic detection of ascaris in the small bowel is relatively difficult, and no report on the ultrasonographic findings have been published in Korea. On abdominal ultrasonography, ascaris is seen as an intraluminal tubular structure with 4 linear echogenic stripes and movement. We report a case of ascaris in the small bowel detected by abdominal ultrasonography.

  9. Ultrasonographic findings of ascaris in the small bowel: A case report

    International Nuclear Information System (INIS)

    Ascariasis is one of the most common helminthic disease worldwide and evoked variable clinical manifestations by the migration of worm in the alimentary and biliary tract. The ultrasonographic detection of ascaris in the small bowel is relatively difficult, and no report on the ultrasonographic findings have been published in Korea. On abdominal ultrasonography, ascaris is seen as an intraluminal tubular structure with 4 linear echogenic stripes and movement. We report a case of ascaris in the small bowel detected by abdominal ultrasonography.

  10. Internal Transcribed Spacer 1 (ITS1) based sequence typing reveals phylogenetically distinct Ascaris population


    Koushik Das; Punam Chowdhury; Sandipan Ganguly


    Taxonomic differentiation among morphologically identical Ascaris species is a debatable scientific issue in the context of Ascariasis epidemiology. To explain the disease epidemiology and also the taxonomic position of different Ascaris species, genome information of infecting strains from endemic areas throughout the world is certainly crucial. Ascaris population from human has been genetically characterized based on the widely used genetic marker, internal transcribed spacer1 (ITS1). Along...

  11. Ascaris lumbricoides: To Expect the Unexpected during a Routine Colonoscopy


    Kalyan Kanneganti; Makker, Jasbir S.; Prospere Remy


    Ascaris lumbricoides is a common nematode infecting humans worldwide with increased prevalence in tropical and subtropical areas of less developed countries. Recently, it has been estimated that over one billion individuals are infected with ascariasis worldwide with 7% in USA. Although most of these cases are due to increasing immigration and travel outside America it is worth recognizing that prevalence of ascariasis is high in southeastern parts of USA due to their temperate climate. Infec...

  12. Diagnosis of Ascaris lumbricoides infection using capsule endoscopy


    Yamashita, Eduardo Tomohissa; Takahashi, Wagner; Kuwashima, Daniel Yuiti; Langoni, Tiago Ribeiro; Costa-Genzini, Adriana


    Ascaris lumbricoides (A. lumbricoides) is the most common intestinal roundworm parasite, infecting approximately one quarter of the world’s population. Infection can lead to various complications because it can spread along the gastrointestinal tract. Although A. lumbricoides infection is a serious healthcare issue in developing countries, it now also has a worldwide distribution as a result of increased immigration and travel. Intestinal obstruction is the most common complication of A. lumb...

  13. New records of Ascaridia platyceri (Nematoda) in parrots (Psittaciformes)

    Czech Academy of Sciences Publication Activity Database

    Kajerová, V.; Baruš, Vlastimil; Literák, I.


    Roč. 49, č. 7 (2004), s. 237-241. ISSN 0375-8427 R&D Projects: GA ČR GA524/03/0061 Institutional research plan: CEZ:AV0Z6093917 Keywords : ascarids * morphology * Nematoda Subject RIV: EG - Zoology Impact factor: 0.790, year: 2004

  14. Dicty_cDB: VHD771 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available pfkccnlyhqsim*sth*c*rgsplklsi isii--- Frame C: SNNSSYNAKDDDDDEPGSSGNDIQKILGKERLGRILSS... (bits) Value N ED460729 |ED460729.1 AUAC-aao05g05.g1 Ascaris suum whole genome shotgun library (PMAJ_4GSS) Ascaris... suum genomic, genomic survey sequence. 50 0.069 1 ED450392 |ED450392.1 AUAC-aan56c12.g1 Ascaris suum... whole genome shotgun library (PMAJ_4 GSS) Ascaris suum genomic, genomic survey sequence. 50 0.069 1 ED39324...2 |ED393242.1 AUAC-aai25f10.g1 Ascaris suum whole genome shotgun library (PMAJ_4 GSS) Ascaris

  15. Rare cause of intestinal obstruction, Ascaris lumbricoides infestation: two case reports


    Yetim, Ibrahim; Ozkan, Orhan Veli; Semerci, Ersan; Abanoz, Recep


    Ascaris lumbricoides is common resident of intestine especially low socioeconomic areas in the world. Complication of Ascaris lumbricoides has been reported include obstruction of the small intestine, intestinal volvulus and intussusception. We report two children with severe sequelae of intestinal obstruction.

  16. Inactivation of ascaris lumbricoides eggs by heat, radiation, and thermoradiation

    International Nuclear Information System (INIS)

    It is desirable to eliminate the public health hazards associated with land application of municipal sewage sludge as a fertilizer or soil conditioner. This report describes experimentation to determine the effects of heat, radiation, and thermoradiation on the suppression of embryonation of Ascaris lumbricoides ova, a parasite commonly found in sewage sludge. Heat effects were observed at a minimum temperature of 510C and radiation effects at doses in excess of 15 krads of radiation. Thermoradiation at 470C suppressed embryonation at less than half the total dose required by radiation alone. (U.S.)

  17. First Case of Ascaris lumbricoides Infestation Complicated with Hemophagocytic Lymphohistiocytosis. (United States)

    Bayhan, Gülsüm İclal; Çenesiz, Funda; Tanır, Gönül; Taylan Özkan, Ayşegül; Çınar, Gökçe


    Ascariasis is a common soil-transmitted helminth infestation worldwide. Ascaris lumbricoides infestation is generally asymptomatic or cause nonspecific signs and symptoms. We report a 5-year-old male with hemophagocytic lymphohistiocytosis associated with A. lumbricoides infestation. The presented patient recovered completely after defecating an A. lumbricoides following intravenous immunoglobulin (IVIG) and mebendazole treatment. We wanted to emphasize that because helminth infestation is easily overlooked, the diagnosis of ascariasis should be considered in patients who live in endemic areas and treated timely to prevent severe complications. PMID:26081893

  18. Wandering ascaris coming out through the abdominal wall


    Wani, Mohd L; Rather, Ajaz A.; Parray, Fazl Q; Ahangar, Abdul G.; Bijli, Akram H.; Ifat Irshad; Nayeem-Ul-Hassan; Khan, Tahir S.


    A rare case of ascaris coming out through the anterior abdominal wall is reported here. A 40-year-old female had undergone dilatation and curettage by a quack. On the second day she presented with presented with features of peritonitis. She was explored. Resection anastomosis of the ileum was done for multiple perforations of the ileum. Patient developed a fistula in the anterior abdominal wall which was draining bile-colored fluid. On the 12 th postoperative day a 10-cm-long worm was seen co...

  19. Accelerated larvae development of Ascaris lumbricoides eggs with ultraviolet radiation

    International Nuclear Information System (INIS)

    In order to investigate the effect of UV radiation on the development of Ascaris lumbricoides larvae, eggs were exposed to increasing UV doses. Filtered wastewater from the secondary effluent taken from the Damascus wastewater treatment plant (DWTP) was used as irradiation and incubation medium. The progressive and accelerated embryonation stages were microscopically observed and the percentages of completely developed larvae were determined weekly. Results indicated that the UV radiation accelerated the development of larvae with increasing UV dose. Preliminary information about the relationship between the UV radiation dose and rate of embryonation is also presented

  20. Accelerated larvae development of Ascaris lumbricoides eggs with ultraviolet radiation (United States)

    Aladawi, M. A.; Albarodi, H.; Hammoudeh, A.; Shamma, M.; Sharabi, N.


    In order to investigate the effect of UV radiation on the development of Ascaris lumbricoides larvae, eggs were exposed to increasing UV doses. Filtered wastewater from the secondary effluent taken from the Damascus wastewater treatment plant (DWTP) was used as irradiation and incubation medium. The progressive and accelerated embryonation stages were microscopically observed and the percentages of completely developed larvae were determined weekly. Results indicated that the UV radiation accelerated the development of larvae with increasing UV dose. Preliminary information about the relationship between the UV radiation dose and rate of embryonation is also presented.

  1. Accelerated larvae development of Ascaris lumbricoides eggs with ultraviolet radiation

    Energy Technology Data Exchange (ETDEWEB)

    Aladawi, M.A. [Syrian Atomic Energy Commission, Radiation Technology Department, P.O. Box 6091, Damascus (Syrian Arab Republic)]. E-mail:; Albarodi, H. [Syrian Atomic Energy Commission, Radiation Technology Department, P.O. Box 6091, Damascus (Syrian Arab Republic); Hammoudeh, A. [Syrian Atomic Energy Commission, Radiation Technology Department, P.O. Box 6091, Damascus (Syrian Arab Republic); Shamma, M. [Syrian Atomic Energy Commission, Radiation Technology Department, P.O. Box 6091, Damascus (Syrian Arab Republic); Sharabi, N. [Syrian Atomic Energy Commission, Radiation Technology Department, P.O. Box 6091, Damascus (Syrian Arab Republic)


    In order to investigate the effect of UV radiation on the development of Ascaris lumbricoides larvae, eggs were exposed to increasing UV doses. Filtered wastewater from the secondary effluent taken from the Damascus wastewater treatment plant (DWTP) was used as irradiation and incubation medium. The progressive and accelerated embryonation stages were microscopically observed and the percentages of completely developed larvae were determined weekly. Results indicated that the UV radiation accelerated the development of larvae with increasing UV dose. Preliminary information about the relationship between the UV radiation dose and rate of embryonation is also presented.

  2. Ultrasonographic appearance of Ascaris lumbricoides in the small bowel. (United States)

    Mahmood, T; Mansoor, N; Quraishy, S; Ilyas, M; Hussain, S


    Roundworm infestation, one of the most common helminthic diseases worldwide, is caused by Ascaris lumbricoides, one of the largest parasites that infests the human bowel. A lumbricoides is virtually universal at some stage of childhood in semitropical and tropical regions. This study describes our experience with the ultrasonographic appearance of intestinal ascariasis in 84 patients, 2.5 to 42 years of age, examined over 2 years beginning October 1997. The patients' conditions ranged from acute intestinal obstruction to no clinical features pertaining to obstruction. Ultrasonographic examination was performed with an Echocee power Doppler real-time unit with a variable-frequency 3.7-MHz convex, 7.5-MHz linear probe. In longitudinal section the Ascaris worm presented as a linear intraluminal mass with 3 or 4 linear echogenic interfaces; in the cross section, it was round, sometimes appearing as a "target" sign. Some worms also showed serpentine movements. Sonographic examination of the patients in the left lateral decubitus position after ingestion of water improved detection and visualization of the worms in some cases. It is concluded that A lumbricoides in the small bowel has a sonographic appearance that can be recognized by the wary observer. PMID:11270532

  3. Ancient Mitochondrial DNA Analyses of Ascaris Eggs Discovered in Coprolites from Joseon Tomb


    Oh, Chang Seok; Seo, Min; Hong, Jong Ha; Chai, Jong-Yil; Oh, Seung Whan; Park, Jun Bum; Shin, Dong Hoon


    Analysis of ancient DNA (aDNA) extracted from Ascaris is very important for understanding the phylogenetic lineage of the parasite species. When aDNAs obtained from a Joseon tomb (SN2-19-1) coprolite in which Ascaris eggs were identified were amplified with primers for cytochrome b (cyt b) and 18S small subunit ribosomal RNA (18S rRNA) gene, the outcome exhibited Ascaris specific amplicon bands. By cloning, sequencing, and analysis of the amplified DNA, we obtained information valuable for co...

  4. Evidence for in utero sensitization to Ascaris lumbricoides in newborns of mothers with ascariasis


    Guadalupe, Irene; Mitre, Edward; Benitez, Susana; Martha E Chico; Nutman, Thomas B.; Cooper, Philip J.


    Human infections with Ascaris lumbricoides may have important effects on allergy and susceptibility to infectious diseases that start in early life. To investigate if sensitization to Ascaris occurs in utero, we measured IFN-γ and IL-4 responses in Ascaris antigen-stimulated cord blood of newborns of infected and non-infected mothers using flow cytometry. There was evidence of elevated frequencies of IFN-γ and IL-4-expressing CD4+ T cells in newborns of infected mothers compared to those of n...

  5. Radioimmunoassay for Ascaris specific protein and its clinical approach to gastro-intestinal diseases

    International Nuclear Information System (INIS)

    In this study, we developed a reliable radioimmunoassay (RIA) method for Ascaris specific protein (ASP) and measured the serum levels in control subjects average; 5.94 +- 5.94 ng/ml) and in patients with Ascaris and a variety of gastrointestinal diseases. In all Ascaris carriers, very high concentration of ASP (average; 151.4 ng/ml) was observed. 12 out of 38 patients with ulcerative colitis showed significantly high serum levels of ASP. The high titer of ASP and the presence of antibody to ASP, previously described, may suggest the close relationship between ASP and ulcerative colitis. RIA for ASP, also provides simple method for screening the patients with Ascaris and hence may open the new field in parasitology. (author)

  6. Detection and quantification of viable Ascaris sp. and other helminth eggs in sewage sludge. (United States)

    Bastos, Veridiana Karmann; Cutolo, Silvana Audra; Doria, Maria do Carmo Oliveira; Razzolini, Maria Tereza Pepe


    Some epidemiologic studies conducted in developing countries demonstrated a high incidence of enteroparasites, Ascaris sp. being the most prevalent. Therefore, the use of sewage sludge in agriculture may pose risks to human health. In order to protect public health, a Brazilian regulation has established standards regarding its use in rural areas. The objective of this study was to quantify Ascaris sp. and other helminth eggs in sewage sludge from five wastewater treatment plants from a dense metropolitan region, and also to check compliance with the law. The analysis was carried according to USEPA 2003 . A rich parasitological fauna was found, with a prevalence of the eggs of Ascaris sp. (9.55%). The samples analyzed presented a large variety of helminth eggs, and Ascaris sp. proved to be the most prevalent which put in evidence that its application poses public health concerns. PMID:23072414

  7. Ascaris worm in the intercostal drainage bag: inadvertent intercostal tube insertion into jejunum: a case report


    Mehta Harshad; Mistry Jitendra H; Mohite Prashant N; Patra BS


    Abstract Inadvertent insertion of the intercostal tube into abdomen is not rare. It can present by different ways. In the present case an Ascaris worm crept into the intercostal drainage bag to reveal the false passage of the tube.

  8. The Half-life of Ascaris lumbricoides Prevalence in Japanese School Children


    Wang,Da-Hong; Wang, Bing-Ling; Takaki, Jiro; Ito, Takehiko; Kurosawa,Carmen Miwa; Takigawa,Tomoko; Ogino, Keiki


    In the present study, we examined the dynamic of school-health-based parasite control and the related socio-economic influences. This is an ecological study based on data from 46 prefectures in Japan. The exponential decay of Ascaris lumbricoides prevalence was calculated by iterative least-squares method. Pearsonʼs correlation and multiple linear regression model analysis were performed to assess the associations between the prevalence of Ascaris lumbricoides in Japanese school children...

  9. Ascaris lumbricoides-Induced Acute Pancreatitis: Diagnosis during EUS for a Suspected Small Pancreatic Tumor


    Benedetto Mangiavillano; Silvia Carrara; Maria Chiara Petrone; Paolo Giorgio Arcidiacono; Pier Alberto Testoni


    Context Ascaris lumbricoides is the second most common intestinal parasite world-wide and, although the infection can be asymptomatic, in some cases it can present with complications, such as acute pancreatitis. Case report We describe the case of a 37- year-old man, with a history of travelling in Eastern countries who presented with Ascaris lumbricoides-induced acute pancreatitis mimicking a small pancreatic cancer, diagnosed during an upper EUS. The endoscopy revealeda roundworm floating i...

  10. Ascaris and hookworm transmission in preschool children in rural Panama: role of subsistence agricultural activities. (United States)

    Krause, Rachel J; Koski, Kristine G; Pons, Emérita; Sinisterra, Odalis; Scott, Marilyn E


    This longitudinal study explored whether aspects of subsistence agriculture were associated with presence and intensity of Ascaris and hookworm in preschool children in rural Panama. Questionnaires were used to collect data on household socio-demographics, child exposure to agriculture and household agricultural practices. Stool samples were collected from children (6 months-5 years) at 3 time points, with albendazole administered after each to clear infections, resulting in 1 baseline and 2 reinfection measures. A novel Agricultural Activity Index (AAI) was developed using principal components analysis to measure the intensity of household agricultural practices. Zero-inflated negative binomial regression models revealed baseline hookworm egg counts were higher if children went to the agricultural plot and if the plot was smaller. Baseline and reinfection Ascaris egg counts were higher if children went to the plot and households had higher AAI, and higher at baseline if the plot was smaller. Caregiver time in the plot was negatively associated with baseline Ascaris egg counts, but positively associated with baseline hookworm and Ascaris reinfection egg counts. Children who spent more time playing around the home were less likely to be infected with Ascaris at baseline. We conclude that preschool child exposure to subsistence agriculture increased Ascaris and hookworm intensity. PMID:27000494

  11. Obstrução nasolacrimal em criança: Ascaris lumbricoides como uma causa incomum Nasolacrimal obstruction in a child: Ascaris lumbricoides as an unusual cause


    Ernesto Helder Palma Araújo; Sérgio Schneider Guimarães


    Este artigo descreve um caso incomum de obstrução de vias lacrimais por Ascaris lumbricoides em uma criança de 1 ano de idade e faz um breve relato de outros casos semelhantes na literatura, enfatizando a necessidade de se pensar em helmintíase como provável causa de obstrução lacrimal em crianças desnutridas que moram em áreas de alta prevalência de parasitose intestinal.This article describes an unusual case of an obstruction of the tear ducts caused by Ascaris lumbricoides in an one-year-o...

  12. The IgE response to Ascaris molecular components is associated with clinical indicators of asthma severity


    Buendía, Emiro; Zakzuk, Josefina; Mercado, Dilia; Alvarez, Alvaro; Caraballo, Luis


    Background Asthma is a common chronic disease worldwide and Ascaris lumbricoides infection (ascariasis) is frequent in tropical regions. However, the effect of ascariasis on asthma severity has not been sufficiently explored. We sought to evaluate the influence of the IgE immune response to Ascaris extract and purified house dust mites (HDM) and Ascaris allergens on indicators of asthma severity in patients living in the tropics. Methods Asthmatic patients from Cartagena, Colombia were recrui...

  13. Presensitization to Ascaris antigens promotes induction of mite-specific IgE upon mite antigen inhalation in mice


    Mayu Suzuki; Mutsuko Hara; Saori Ichikawa; Seiji Kamijo; Takuya Nakazawa; Hideki Hatanaka; Kazuo Akiyama; Hideoki Ogawa; Ko Okumura; Toshiro Takai


    Background: Patients with house dust mite (HDM) allergy or Ascariasis produce serum IgE specific to the antigens of HDM or nematode Ascaris, respectively. Although human IgE cross-reactivity has been reported between HDM and Ascaris antigens, it remains unclear whether it contributes to the pathogenesis of allergic diseases. We herein investigated the induction of cross-reactive antibodies and T cells in mice and effects of airway exposure to HDM antigens after preimmunization with Ascaris an...

  14. Ascaris lumbricoides: reinfection in children bearing an established worm burden

    Directory of Open Access Journals (Sweden)

    Fausto E. Lima Pereira


    Full Text Available To clarify the existance of reinfection in children bearing an established Ascaris lumbricoides infection, the authors evaluated the weight and the length of worms collected from ten cases of ascaridiasis. The worm burden was greater than 27 worms in nine cases. In seven cases the weight and the length of worms showed little variation, with unimodal distribution of values, suggesting that all the worms in each case belong to the same population, originated from a single brood infection or from successive infections over small time intervals. In three cases there was great variation in worm size indicated by the different values for the means and medians and by the high values for the standard deviation and coefficient of variation. In these three cases there was a bimodal distribution of worm's size suggesting the coexistance of two distinct populations: one, less numerous, composed of mature worms and the other, more numerous, composed ofimmature worms, in two cases, and two distinct populations of immature worms in one case. The existance of worms in different stages of maturation indicates that the less mature population was acquired when the mature worms were established in the gut. These results indicate that the reinfection with Ascaris in children bearing an established infection is not rare and resistance induced by a preexisting infection is not the rule.Para tentar esclarecer a existência de reinfecção em crianças portadoras de ascaridíase já estabelecida, foram avaliados o peso e o comprimento dos vermes colhidos em 10 casosde ascaridíase, em nove dos quais a carga parasitária foi maior do que 27 vermes. Em sete casos o peso e o comprimento dos vermes apresentaram pouca variação, com distribuição unimodal dos valores, sugerindo assim pertencerem todos a uma mesma população originada de uma única infecção ou de infecções repetidas com intervalos muito curtos. Em três casos, o peso e o comprimento dos vermes

  15. Molecular paleoparasitological diagnosis of Ascaris sp. from coprolites: new scenery of ascariasis in pre-Colombian South America times

    Directory of Open Access Journals (Sweden)

    Daniela Leles


    Full Text Available Paleoparasitological studies using microscopy showed that Ascarisand Trichuris trichiura are the human intestinal parasites most found in archaeological sites. However, in pre-Columbian South American archaeological sites, Ascaris is rare. In this work we standardized a molecular methodology for Ascaris diagnosis directly from ancient DNA retrieved from coprolites. Using cythochrome b gene (142 bp target, ancient DNA sequences were retrieved from South American samples, negative by microscopy. Moreover, the methodology applied was sensitive enough to detect ancient DNA extracted from 30 Ascaris eggs from an European coprolite. These results revealed a new scenery for the paleodistribution of Ascaris in South America.

  16. Gamma radiation effects in Ascaris sp. eggs in the treated and untreated sewage; Efeitos da irradiacao gama em ovos de Ascaris sp. presentes em esgoto bruto e tratado

    Energy Technology Data Exchange (ETDEWEB)

    Bastos, Gloria S.M.; Chernicharo, Carlos A.L.; Zerbini, Adriana M. [Minas Gerais Univ., Belo Horizonte, MG (Brazil). Dept. de Engenharia Sanitaria e Ambiental]. E-mail:; Grossi, Pablo A.; Corres, Ricardo F. [Centro de Desenvolvimento de Tecnologia Nuclear (CDTN), Belo Horizonte, MG (Brazil)


    This work evaluated the efficiency of domestic sewage disinfection. The sewage was treated in UASB reactor (upflow anaerobic sludge blanket), and the influent and affluent disinfection was promoted by gamma irradiation. To test the efficiency of disinfection, Ascaris eggs viability was analyzed undo microscopic observation in samples before and after the irradiation. The Ascaris sp. eggs were recovered from human's faeces and inoculated into sewage samples. The viability of Ascaris sp. eggs was analyzed after exposure to 0.5 KGy, 1.0 KGy, 2.5 KGy, 5.0 KGy e 10 KGy. In addition, suspended solids were analyzed in order to verify the effect of solids content to the irradiation efficiency. Preliminary results indicated that for doses lower than 1.5 KGy, the efficiency of inactivation in the affluent was higher than the influent. It was also observed that doses above of 2.5 KGy had inactivated practically 100% of eggs of Ascaris sp. in the treated and untreated sewage samples. These results suggest that gamma irradiation can be used as an efficient technique to disinfect domestic sewage. (author)

  17. Electronic structures of Ascaris trypsin inhibitor in solution (United States)

    Zheng, Haoping


    The electronic structures of Ascaris trypsin inhibitor in solution are obtained by the first-principles, all-electron, ab initio calculation using the self-consistent cluster-embedding (SCCE) method. The inhibitor, made up of 62 amino acid residues with 912 atoms, has two three-dimensional solution structures: 1ata and 1atb. The calculated ground-state energy of structure 1atb is lower than that of structure 1ata by 6.12 eV. The active sites are determined and explained: only structure 1atb has a N terminal at residue ARG+31. This shows that the structure 1atb is the stable and active form of the inhibitor, which is in agreement with the experimental results. The calculation reveals that some parts of the inhibitor can be easily changed while the inhibitor’s biological activity may be kept. This kind of information may be helpful in fighting viruses such as AIDS, SARS, and flu, since these viruses have higher variability. The calculation offers an independent theoretical estimate of the precision of structure determination.

  18. Pseudoobstrucción intestinal por Ascaris lumbricoides

    Directory of Open Access Journals (Sweden)

    Alessio Garro Donini


    Full Text Available La ascariosis es una geohelmintosis, ya que el agente causal requiere de la tierra para que se forme la fase infectiva para el hombre, que en este caso la fase es el huevo larvado conteniendo la larva de segundo estadio. Es una infección producida por el nematodo Ascaris lumbricoides, uno de los parásitos descritos desde la antigüedad (Becerril, 2008. Esta parasitosis tiene gran importancia epidemiológica, pues las zonas donde se presenta con mayor frecuencia son las de gran pobreza; aquellas donde la gente acostumbra a defecar a ras del suelo, pues no tiene el recurso económico necesario para construir baños, ni dispone de agua potable. Esta parasitosis afecta a 25 a 35% de la población mundial (Biagi, 2004 (Becerril, 2008. Generalmente los pacientes infectados por este nematodo cursan asintómaticos, pero en caso contrario la sintomatología dependerá de la fase del ciclo vital en la que el parásito se encuentre pudiendo existir síntomas pulmonares o gastrointestinales, incluso en ciertas poblaciones como la pediátrica podría incluso ocasionar la muerte por múltiples mecanismos dentro de los cuales se incluyen la migración errática y/o la obstrucción intestinal (MS., 1996

  19. Internal Transcribed Spacer 1 (ITS1 based sequence typing reveals phylogenetically distinct Ascaris population

    Directory of Open Access Journals (Sweden)

    Koushik Das


    Full Text Available Taxonomic differentiation among morphologically identical Ascaris species is a debatable scientific issue in the context of Ascariasis epidemiology. To explain the disease epidemiology and also the taxonomic position of different Ascaris species, genome information of infecting strains from endemic areas throughout the world is certainly crucial. Ascaris population from human has been genetically characterized based on the widely used genetic marker, internal transcribed spacer1 (ITS1. Along with previously reported and prevalent genotype G1, 8 new sequence variants of ITS1 have been identified. Genotype G1 was significantly present among female patients aged between 10 to 15 years. Intragenic linkage disequilibrium (LD analysis at target locus within our study population has identified an incomplete LD value with potential recombination events. A separate cluster of Indian isolates with high bootstrap value indicate their distinct phylogenetic position in comparison to the global Ascaris population. Genetic shuffling through recombination could be a possible reason for high population diversity and frequent emergence of new sequence variants, identified in present and other previous studies. This study explores the genetic organization of Indian Ascaris population for the first time which certainly includes some fundamental information on the molecular epidemiology of Ascariasis.

  20. Internal Transcribed Spacer 1 (ITS1) based sequence typing reveals phylogenetically distinct Ascaris population. (United States)

    Das, Koushik; Chowdhury, Punam; Ganguly, Sandipan


    Taxonomic differentiation among morphologically identical Ascaris species is a debatable scientific issue in the context of Ascariasis epidemiology. To explain the disease epidemiology and also the taxonomic position of different Ascaris species, genome information of infecting strains from endemic areas throughout the world is certainly crucial. Ascaris population from human has been genetically characterized based on the widely used genetic marker, internal transcribed spacer1 (ITS1). Along with previously reported and prevalent genotype G1, 8 new sequence variants of ITS1 have been identified. Genotype G1 was significantly present among female patients aged between 10 to 15 years. Intragenic linkage disequilibrium (LD) analysis at target locus within our study population has identified an incomplete LD value with potential recombination events. A separate cluster of Indian isolates with high bootstrap value indicate their distinct phylogenetic position in comparison to the global Ascaris population. Genetic shuffling through recombination could be a possible reason for high population diversity and frequent emergence of new sequence variants, identified in present and other previous studies. This study explores the genetic organization of Indian Ascaris population for the first time which certainly includes some fundamental information on the molecular epidemiology of Ascariasis. PMID:26504510

  1. Design and testing of fish drier system utilizing geothermal energy resource in Ie Suum, Aceh Besar (United States)

    Mubarak, Amir Zaki; Maulana, M. Ilham; Syuhada, Ahmad


    In an effort to increase the value of fish produced by the community in Krueng Raya Sub-district, it has been designed and tested a fish drier system utilizing geothermal energy resource in IeSuum Village, Krueng Raya Sub-district, Aceh Besar District. The geothermal energy is in the form of hot water with the temperature range is between 86 and 86.4 °C. Based on the design consideration, it is used a terraced rack type drier system. The drier system consists of a heat exchanger, drying chamber, and a blower to blow the air. Hot water from the geothermal source is passed into the heat exchanger to increase the air temperature outside it. The air is then blown into the drying chamber. Based on the design analysis is obtained that to dry 200 kg of fish in 24 hour, it is required a drying chamber with 1m long, 1 m width and 0.4 m high, the temperature of hot water entering the exchanger is 80 °C and the temperature of the air entering the drying chamber is maintained at 60°C. The average time required to dry fish till 10% of water level is 18-20 jam. The research is then continued by developing and testing the drying system with three layer rack to put in the fish. From the experimental result is obtained that the average water temperature flows out of the chamber is in the range of 76-78 °C and the temperature in the chamber is in the range of 57-62 °C. In addition, the weight of the fish, which initially is 20 kg, becomes12 kg in average after 18 hours drying process.

  2. SjAPI, the first functionally characterized Ascaris-type protease inhibitor from animal venoms.

    Directory of Open Access Journals (Sweden)

    Zongyun Chen

    Full Text Available BACKGROUND: Serine protease inhibitors act as modulators of serine proteases, playing important roles in protecting animal toxin peptides from degradation. However, all known serine protease inhibitors discovered thus far from animal venom belong to the Kunitz-type subfamily, and whether there are other novel types of protease inhibitors in animal venom remains unclear. PRINCIPAL FINDINGS: Here, by screening scorpion venom gland cDNA libraries, we identified the first Ascaris-type animal toxin family, which contains four members: Scorpiops jendeki Ascaris-type protease inhibitor (SjAPI, Scorpiops jendeki Ascaris-type protease inhibitor 2 (SjAPI-2, Chaerilus tricostatus Ascaris-type protease inhibitor (CtAPI, and Buthus martensii Ascaris-type protease inhibitor (BmAPI. The detailed characterization of Ascaris-type peptide SjAPI from the venom gland of scorpion Scorpiops jendeki was carried out. The mature peptide of SjAPI contains 64 residues and possesses a classical Ascaris-type cysteine framework reticulated by five disulfide bridges, different from all known protease inhibitors from venomous animals. Enzyme and inhibitor reaction kinetics experiments showed that recombinant SjAPI was a dual function peptide with α-chymotrypsin- and elastase-inhibiting properties. Recombinant SjAPI inhibited α-chymotrypsin with a Ki of 97.1 nM and elastase with a Ki of 3.7 μM, respectively. Bioinformatics analyses and chimera experiments indicated that SjAPI contained the unique short side chain functional residues "AAV" and might be a useful template to produce new serine protease inhibitors. CONCLUSIONS/SIGNIFICANCE: To our knowledge, SjAPI is the first functionally characterized animal toxin peptide with an Ascaris-type fold. The structural and functional diversity of animal toxins with protease-inhibiting properties suggested that bioactive peptides from animal venom glands might be a new source of protease inhibitors, which will accelerate the

  3. Specific IgE Anti-Ascaris in Brazilian Children and Adolescents


    Emanuel S. Sarinho; Medeiros, Décio; Silva, Almerinda; Rizzo, José Ângelo


    From an article published by our group by Medeiros et al, we discuss and review the literature on the role of serum specific anti-ascaris IgE in patients with respiratory allergies living in countries where helminthic infestations are common. Medeiros et al conducted a study using 101 patients aged 12 to 21 years with respiratory allergy. Median IgE level was 660 IU/mL. Serum specific anti-ascaris IgE was positive in 73% (74/101) of the individuals, but parasitological stool examination yield...

  4. Occurrence of Tetrameres confusa (Nematoda, Tetrameridae) in Ara ararauna (Psittacidae) Ocorrência de Tetrameres confusa (Nematoda, Tetrameridae) em Ara ararauna (Psittacidae)


    R.J. Silva; T.C.G. Oliveira-Sequeira; C.C. Gurgel


    Relata-se a ocorrência de Tetrameres confusa Travassos 1917 (= T. americana (Cram, 1927) Baylis, 1929) (Nematoda, Tetrameridae) em um novo hospedeiro, Ara ararauna Linnaeus, 1758 (Aves, Psittacidae). Este é o primeiro registro da ocorrência do nematódeo em psitacídeos no Brasil.

  5. Modelagem geoestatística da infecção por Ascaris lumbricoides Geostatistical modeling of Ascaris lumbricoides infection

    Directory of Open Access Journals (Sweden)

    Bruno de Paula Menezes Drumond Fortes


    Full Text Available O estudo tem por objetivo modelar a distribuição espacial da ocorrência de ascaríase, utilizando mapas de risco mediante técnicas de geoprocessamento e análise geoestatística. Com base no banco de dados do PAISQUA, foram selecionados 19 setores censitários do Rio de Janeiro. Foram amostradas e georreferenciadas, no centróide de seu respectivo domicílio, 1.550 crianças com idade de 1 a 9 anos. Mapas de risco de Ascaris lumbricoides foram gerados usando krigagem indicadora. Com base na validação cruzada, os valores estimados foram comparados aos observados por intermédio da curva ROC. Um modelo de semivariograma isotrópico esférico com alcance de 30m e efeito pepita de 50% foi empregado na krigagem ordinária indicadora para a construção de um mapa de probabilidade de infecção por A. lumbricoides. A acurácia global, mensurada por meio da área sob a curva ROC, mostrou-se significativa. O uso da krigagem ordinária indicadora permitiu a modelagem de mapas de risco valendo-se da amostra de uma variável indicadora. O emprego das técnicas de análise estatística espacial mostrou-se adequado na predição da ocorrência do fenômeno, não ficando restrita a delimitações político-administrativas da região.The following study intends to model the spatial distribution of ascariasis, through the use of geoprocessing and geostatistic analysis. The database used in the study was taken from the PAISQUA project, including a coproparasitologic and domiciliary survey, conducted in 19 selected census tracts of Rio de Janeiro State, Brazil, randomly selecting a group of 1,550 children aged 1 to 9 years old plotting them in their respective domicile's centroids. Risk maps of Ascaris lumbricoides were generated by indicator kriging. The estimated and observed values from the cross-validation were compared using a ROC curve. An isotropic spherical semivariogram model with a range of 30m and nugget effect of 50% was employed in ordinary

  6. Ascaris worm in the intercostal drainage bag: inadvertent intercostal tube insertion into jejunum: a case report

    Directory of Open Access Journals (Sweden)

    Mehta Harshad


    Full Text Available Abstract Inadvertent insertion of the intercostal tube into abdomen is not rare. It can present by different ways. In the present case an Ascaris worm crept into the intercostal drainage bag to reveal the false passage of the tube.

  7. Massive Infestation of the biliary duct for Ascaris lumbricoides: case report

    International Nuclear Information System (INIS)

    We present a case of a woman who arrived with acute cholangitis symptomatology, and was diagnosed preoperatively by ultrasound as biliary ascariasis. During surgery, we extracted 32 worms of Ascaris lumbricoides from the Gallbladder and the common bile duct. Clinical outcome was successful, with out retention of worms

  8. Gamma radiation effects in Ascaris sp. eggs in the treated and untreated sewage

    International Nuclear Information System (INIS)

    This work evaluated the efficiency of domestic sewage disinfection. The sewage was treated in UASB reactor (upflow anaerobic sludge blanket), and the influent and affluent disinfection was promoted by gamma irradiation. To test the efficiency of disinfection, Ascaris eggs viability was analyzed undo microscopic observation in samples before and after the irradiation. The Ascaris sp. eggs were recovered from human's faeces and inoculated into sewage samples. The viability of Ascaris sp. eggs was analyzed after exposure to 0.5 KGy, 1.0 KGy, 2.5 KGy, 5.0 KGy e 10 KGy. In addition, suspended solids were analyzed in order to verify the effect of solids content to the irradiation efficiency. Preliminary results indicated that for doses lower than 1.5 KGy, the efficiency of inactivation in the affluent was higher than the influent. It was also observed that doses above of 2.5 KGy had inactivated practically 100% of eggs of Ascaris sp. in the treated and untreated sewage samples. These results suggest that gamma irradiation can be used as an efficient technique to disinfect domestic sewage. (author)

  9. Enumeration of viable and non-viable larvated Ascaris eggs with quantitative PCR (United States)

    Aims: The goal of the study was to further develop an incubation-qPCR method for quantifying viable Ascaris eggs. The specific objectives were to characterize the detection limit and number of template copies per egg, determine the specificity of the method, and test the method w...

  10. Successful Elimination of Ascaris lumbricoides from the Gallbladder by Conservative Medical Therapy


    Misra, Manish Kumar; Singh, Sarabjeet; Bhagat, Tripta Sethi


    Migration of Ascaris lumbricoides into the gallbladder is rare, unlike ascariasis of the bile duct and when it does occur, treatment is generally by endoscopic or surgical extraction. We describe a case of the successful treatment of gallbladder ascariasis with conservative therapy.

  11. Lista preliminar dos Nematoda, Annelida e Chordata terrestres dos Açores


    Paulo A V Borges


    Apresenta-se uma lista preliminar dos Filos Nematoda, Annelida e Chordata terrestres dos Açores. Com base na recente lista de espécies animais terrestres da Europa, projecto “Fauna Europaea” (, listam-se 80 espécies de nemátodos e 21 espécies de anelídeos terrestres. As cerca de 49 espécies de vertebrados (Chordata) listados correspondem às espécies que se reproduzem nos Açores. ABSTRACT: A preliminary list of the Phyla Nematoda, Annelida and Chordata was compiled. ...

  12. A Proteomic Investigation of Hepatic Resistance to Ascaris in a Murine Model. (United States)

    Deslyper, Gwendoline; Colgan, Thomas J; Cooper, Andrew J R; Holland, Celia V; Carolan, James C


    The helminth Ascaris causes ascariasis in both humans and pigs. Humans, especially children, experience significant morbidity including respiratory complications, growth deficits and intestinal obstruction. Given that 800 million people worldwide are infected by Ascaris, this represents a significant global public health concern. The severity of the symptoms and associated morbidity are related to the parasite burden and not all hosts are infected equally. While the pathology of the disease has been extensively examined, our understanding of the molecular mechanisms underlying resistance and susceptibility to this nematode infection is poor. In order to investigate host differences associated with heavy and light parasite burden, an experimental murine model was developed utilising Ascaris-susceptible and -resistant mice strains, C57BL/6J and CBA/Ca, respectively, which experience differential burdens of migratory Ascaris larvae in the host lungs. Previous studies identified the liver as the site where this difference in susceptibility occurs. Using a label free quantitative proteomic approach, we analysed the hepatic proteomes of day four post infection C57BL/6J and CBA/Ca mice with and without Ascaris infection to identify proteins changes potentially linked to both resistance and susceptibility amongst the two strains, respectively. Over 3000 proteins were identified in total and clear intrinsic differences were elucidated between the two strains. These included a higher abundance of mitochondrial proteins, particularly those associated with the oxidative phosphorylation pathway and reactive oxygen species (ROS) production in the relatively resistant CBA/Ca mice. We hypothesise that the increased ROS levels associated with higher levels of mitochondrial activity results in a highly oxidative cellular environment that has a dramatic effect on the nematode's ability to successfully sustain a parasitic association with its resistant host. Under infection, both

  13. Presensitization to Ascaris antigens promotes induction of mite-specific IgE upon mite antigen inhalation in mice

    Directory of Open Access Journals (Sweden)

    Mayu Suzuki


    Conclusions: We demonstrated that the immunization of naïve mice with Ascaris antigens induced production of antibodies and differentiation of Th2 cells, which were cross-reactive to HDM antigens, and accelerated induction of serum HDM-specific IgE upon subsequent airway exposure to HDM antigens in mice. These results suggest that sensitization to HDM towards IgE-mediated allergic diseases is faster in individuals with a previous history of Ascaris infection than in those without presensitization to Ascaris.

  14. Massive infestation by Ascaris lumbricoides of the biliary tract: report of a successfully treated case Infestação maciça por Ascaris lumbricoides nas vias biliares: relato de um caso tratado com sucesso


    Dahir Ramos de Andrade Júnior; José Abi Karam; Maria do Patrocínio Tenório Nunes Warth; Alexandre Frederico de Marca; José Jukemura; Marcel Cerqueira Cesar Machado; Antonino dos Santos Rocha


    This is a report of a 25 years old black woman from the city of São Paulo, Brazil, who developed acute obstructive cholangitis of Ascaris lumbricoides with septicemia and multiple hepatic abscesses. The patient had sickle cell trait and normal delivery 3 months ago. Massive infestation of the biliary tract by Ascaris lumbricoides was diagnosed by abdominal ultrasonography and endoscopic retrograde cholangiography. Sixty worms were removed from the common bile duct and hepatic abscesses were d...

  15. Perbandingan Kadar IL-5 dan Jumlah Eosinofil Antara Anak dan Orang Dewasa yang Terinfeksi Ascaris Lumbricoides

    Directory of Open Access Journals (Sweden)

    Darmadi ,


    Full Text Available Abstrak Ascaris lumbricoides pada umumnya menginfeksi anak, tetapi juga dapat terjadi pada orang dewasa. Respon imun hospes terhadap infeksi cacing dimulai dengan teraktifasinya Th2 dengan peningkatan yang signifikan dari IL-4, IL-5, IL-9, IL-10 dan IL-13. IL-5 yang terbentuk merangsang perkembangan dan aktivasi eosinofil. Tujuan penelitian ini adalah mengetahui perbandingan kadar IL-5 dan jumlah eosinofil antara anak dan orang dewasa yang terinfeksi oleh Ascaris lumbricoides. Telah dilakukan penelitian secara cross sectional terhadap 16 orang anak dan 16 orang dewasa yang terinfeksi Ascaris lumbricoides. Spesimen darah dan serum anak dan orang dewasa diperiksa IL-5 metode ELISA dan jumlah eosinofil metode mikroskopis. Data dianalisis dengan uji t independent dengan hasil statistik bermakna bila p<0,05. Didapatkan rerata kadar IL-5 anak 5,90±3,61 pg/ml dan 4,10±1,98 pg/ml rerata kadar IL-5 pada orang dewasa dengan nilai p=0,092 (p>0,05, sedangkan rerata jumlah eosinofil anak 14,56±7,77% dan 8,81±4,65% rerata jumlah eosinofil orang dewasa dengan nilai p=0,018 (p<0,05. Kadar IL-5 tidak berbeda signifikan antara anak dan orang dewasa, sebaliknya jumlah eosinofil terdapat perbedaan yang signifikan antara anak dan orang dewasa. Kesimpulan hasil penelitian ini ialah jumlah eosinofil anak lebih tinggi dari pada jumlah eosinofil orang dewasa yang terinfeksi Ascaris lumbricoides. Kata kunci: IL-5, jumlah eosinofil, anak, orang dewasa, infeksi Ascaris lumbricoides Abstract The infection of Ascaris lumbricides common infect children, but it also can be occurred to adult. The immune’s host respond to the worm infection begin from the activation of Th2 by the significant increasing from IL-4, IL-5, IL-9 and IL-13. IL-5 which formed stimulate the development and eosinofil’s activation. The objective of this study was to know the comparison IL-5 degree with the total of eosinofil between the child and adult who is infected by Ascaris lumbricides. The

  16. An emerging example of tritrophic coevolution between flies (Diptera: Fergusoninidae) and nematodes (Nematoda: Neotylenchidae) on Myrtaceae host plants (United States)

    A unique obligate mutualism occurs between species of Fergusonina Malloch flies (Diptera: Fergusoninidae) and nematodes of the genus Fergusobia Currie (Nematoda: Neotylenchidae). These mutualists together form different types of galls on Myrtaceae, mainly in Australia. The galling association appear...

  17. Molecular paleoparasitological diagnosis of Ascaris sp. from coprolites: new scenery of ascariasis in pre-Colombian South America times


    Daniela Leles; Adauto Araújo; Luiz Fernando Ferreira; Ana Carolina Paulo Vicente; Alena Mayo Iñiguez


    Paleoparasitological studies using microscopy showed that Ascarisand Trichuris trichiura are the human intestinal parasites most found in archaeological sites. However, in pre-Columbian South American archaeological sites, Ascaris is rare. In this work we standardized a molecular methodology for Ascaris diagnosis directly from ancient DNA retrieved from coprolites. Using cythochrome b gene (142 bp) target, ancient DNA sequences were retrieved from South American samples, negative by microscop...

  18. Screening for Anthelminthic Activities from Extracts of Zanthoxylum Zanthoxyloides, Neocarya Macrophylla and Celosia Laxa Against Ascaris Infection in Rabbits


    B B Barnabas; Mann, A.; T S Ogunrinola; P E Anyanwu


    Summary: Extracts of Celosia laxa, Neocarya macrophylla and Zanthoxylum zanthoxyloides leaves were screened for anthelminthic activities on Ascaris lumbricoides. Celosia laxa appeared to be more potent against A. lumbricoides with rapid recovery of weight while Z. zanthoxyloides has the lowest potency. The effects of these plant extracts on Ascaris lumbricoides suggest that they could serve as an alternative source of anthelminthic agent. Industrial relevance: Infectious diseases pose serio...

  19. Recurrent episodes of upper airway blockage associated with Ascaris lumbricoides causing cardiopulmonary arrest in a young patient


    Husain, Shahid Javed; Zubairi, Ali Bin Sarwar; Sultan, Nabeel; Beg, Muhammad Asim; Mehraj, Vikram


    Ascaris lumbricoides (AL) is one of the most common helminthic infections of humans, affecting mainly children and malnourished individuals residing in developing countries. It is estimated the 25% of the world’s population is infected with this nematode. Infection occurs via ingestion of water and food contaminated by Ascaris eggs, causing asymptomatic infection to disease with abdominal pain, vomiting, constipation and faecal passage of worms. The present report concerns an unusual case in ...

  20. Fauna of soil nematodes (Nematoda) in coal post-mining sites in Illinois, USA

    Czech Academy of Sciences Publication Activity Database

    Háněl, Ladislav


    Roč. 77, č. 2 (2013), s. 103-112. ISSN 1211-376X R&D Projects: GA MŠk ME08019 Institutional research plan: CEZ:AV0Z60660521 Institutional support: RVO:60077344 Keywords : soil zoology * ecology * Nematoda * species and generic richness * faunal similarity Subject RIV: EH - Ecology, Behaviour

  1. Nematoda (hlístice, volně žijící)

    Czech Academy of Sciences Publication Activity Database

    Háněl, Ladislav

    Praha : Agentura ochrany přírody a krajiny České republiky, 2005 - (Farkač, J.; Král, D.; Škorpík, M.), s. 57-59 ISBN 80-86064-96-4 Institutional research plan: CEZ:AV0Z60660521 Keywords : free-living Nematoda * Czech Republic Subject RIV: EH - Ecology, Behaviour

  2. Gastromermis kolleonis n. sp. (Nematoda: Mermithidae), a Parasite of Midges (Chironomus sp. Chironomidae) from Argentina


    de Doucet, Maria M. A.; Poinar, George O.


    Gastromermis kolleonis n. sp. (Nematoda: Mermithidae) is described from the Arroyo Saldan River in Córdoba, Argentina. This species parasitizes midges of the genus Chironomus (Chironomidae: Diptera). It is distinguished from other members of the genus by the presence of six longitudinal chords, vulval flaps, degree of ventral displacement of the mouth, and size and shape of the spicule and amphids.

  3. Redescription of Dracunculus globocephalus Mackin, 1927 (Nematoda: Dracunculidae), a parasite of the snapping turtle, Chelydra serpentina

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Little, M. D.


    Roč. 51, č. 4 (2004), s. 339-345. ISSN 0015-5683 R&D Projects: GA ČR GA524/03/0061 Institutional research plan: CEZ:AV0Z6022909 Keywords : Nematoda * Dracunculoidea * taxonomy Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.837, year: 2004

  4. Structure of the cephalic end of Ascarophis mexicana (Nematoda: Cystidicolidae), as revealed by SEM

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; González-Solís, D.


    Roč. 54, č. 2 (2007), s. 155-156. ISSN 0015-5683 R&D Projects: GA ČR(CZ) GA524/06/0170; GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Nematoda * Ascarophis * fish Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.000, year: 2007

  5. Observations on the distribution and biology of Huffmanela huffmani (Nematoda: Trichosomoididae)

    Czech Academy of Sciences Publication Activity Database

    Cox, M. K.; Huffman, D. G.; Moravec, František


    Roč. 51, č. 1 (2004), s. 50-54. ISSN 0015-5683 R&D Projects: GA AV ČR IAA6022201 Institutional research plan: CEZ:AV0Z6022909 Keywords : Nematoda * Trichosomoididae * Huffmanela Subject RIV: EA - Cell Biology Impact factor: 0.837, year: 2004

  6. Larval Spirurida (Nematoda) from the crab Macrophthalmus hirtipes in New Zealand

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Fredensborg, B. L.; Latham, A. D. M.; Poulin, R.


    Roč. 50, č. 2 (2003), s. 109-114. ISSN 0015-5683 R&D Projects: GA AV ČR IAA6022201 Institutional research plan: CEZ:AV0Z6022909 Keywords : Nematoda * Ascarophis * larval Acuariidae Subject RIV: EA - Cell Biology Impact factor: 0.469, year: 2003

  7. Morphometric and molecular characterization of Parapharyngodon echinatus (Nematoda, Pharyngodonidae) from the Senegal gecko ( Tarentola parvicarinata )

    Czech Academy of Sciences Publication Activity Database

    Mašová, Š.; Baruš, Vlastimil; Hodová, I.; Matějusová, I.; Koubek, Petr; Koubková, B.


    Roč. 53, č. 3 (2008), s. 274-283. ISSN 1230-2821 R&D Projects: GA AV ČR IAA6093404 Institutional research plan: CEZ:AV0Z60930519 Keywords : Nematoda * Senegal gecko * West Africa Subject RIV: EG - Zoology Impact factor: 0.748, year: 2008

  8. 21 CFR 520.1242d - Levamisole resinate. (United States)


    ... (Ascaris suum), nodular worms (Oesophagostomum spp.), lungworms (Metastrongylus spp.), intestinal threadworms (Strongyloides ransomi), and swine kidney worms (Stephanurus dentatum). (3) Limitations. For...

  9. Determination the lethal dose of ascaris lumbricoides ova by gamma irradiation

    CERN Document Server

    Shamma, M A; Sharabi, N


    The lethal gamma irradiation dose of ascaris lumbricoides which collected from Damascus Sewage water Plant was determined. Ascaris lumbricoides ova were treated with several gamma irradiation doses with (0.1, 0.2, 0.3, 0.4,...and 1.5 KGy). No morphological changes were observed on the eggs when directly examined microscopically after irradiation. However after two weeks of incubation at 37 degree centigrade the cell contents of the eggs which irradiated with 0.5 KGy and beyond were fragmented and scattered in the whole eggs and no larvae were observed after eight weeks of incubation. It is concluded that the dose 0.5 my be considered as the dose of choice if sewage water is to be treated by gamma rays.

  10. Determination the lethal dose of ascaris lumbricoides ova by gamma irradiation

    International Nuclear Information System (INIS)

    The lethal gamma irradiation dose of ascaris lumbricoides which collected from Damascus Sewage water Plant was determined. Ascaris lumbricoides ova were treated with several gamma irradiation doses with (0.1, 0.2, 0.3, 0.4,...and 1.5 KGy). No morphological changes were observed on the eggs when directly examined microscopically after irradiation. However after two weeks of incubation at 37 degree centigrade the cell contents of the eggs which irradiated with 0.5 KGy and beyond were fragmented and scattered in the whole eggs and no larvae were observed after eight weeks of incubation. It is concluded that the dose 0.5 my be considered as the dose of choice if sewage water is to be treated by gamma rays. (author)

  11. Density-dependent effects on the weight of female Ascaris lumbricoides infections of humans and its impact on patterns of egg production


    Basáñez María-Gloria; Anderson Roy M; Hall Andrew; Walker Martin


    Abstract Background Ascaris lumbricoides exhibits density-dependent egg production, a process which has a marked impact on both the transmission dynamics and the stability of the parasite population. Evidence suggests that the egg production of female Ascaris is also associated with the size of the worm. If worm size is mediated by density-dependent processes then the size of female worms may have a causal impact upon patterns of Ascaris egg production. Results We analyse data collected from ...

  12. Molecular characterization of Thelastomatoidea (Nematoda: Oxyurida) from cockroaches in Australia. (United States)

    Jex, A R; Hu, M; Rose, H A; Schneider, M; Cribb, T H; Gasser, R B


    A molecular approach was used to genetically characterize 5 species (Aoruroides queenslandensis, Blattophila sphaerolaima, Cordonicola gibsoni, Desmicola ornata and Leidynemella fusiformis) belonging to the superfamily Thelastomatoidea (Nematoda: Oxyurida), a group of pinworms that parasitizes terrestrial arthropods. The D3 domain of the large subunit of nuclear ribosomal RNA (LSU) was sequenced for individual specimens, and the analysis of the sequence data allowed the genetic relationships of the 5 species to be studied. The sequence variation in the D3 domain within individual species (0-1.8%) was significantly less than the differences among species (4.3-12.4%). Phylogenetic analyses, using maximum parsimony, maximum likelihood, and neighbour-joining, tree-building methods, established relationships among the 5 species of Thelastomatoidea and Oxyuris equi (a species of the order Oxyurida). The molecular approach employed provides the prospect for developing DNA tools for the specific identification of the Thelastomatoidea, irrespective of developmental stage and sex, as a basis for systematic, ecological and/or population genetic investigations of members within this superfamily. PMID:16563200

  13. IgE cross-reactivity between house dust mite allergens and Ascaris lumbricoides antigens


    Valmonte, Gardette R.; Cauyan, Gil A.; Ramos, John Donnie A.


    Background Common antigens between intestinal parasites and environmental allergens may play a role in the modulation of allergic immune responses. There is a growing interest in investigating cross-reactivity between common helminths and dust mites affecting humans, particularly in the tropics. Objective This study examined the cross-reactivity between the human roundworm Ascaris lumbricoides (Al) and three house dust mite (HDM) species. Methods Specific serum IgE levels to HDM species Blomi...

  14. Genes on chromosomes 1 and 13 have significant effects on Ascaris infection


    Williams-Blangero, Sarah; Vandeberg, John L; Subedi, Janardan; Aivaliotis, Mary Jo; Rai, Dev Raj; Upadhayay, Ram Prasad; Jha, Bharat; Blangero, John


    Nematode parasites show a characteristic aggregated distribution among hosts. This observation has important implications for pathogenesis, immunology, and control of these infections, but the relative roles of environment and genetics in determining these patterns have remained uncertain. This paper presents the results of the first genome scan for susceptibility to infection with roundworm (Ascaris lumbricoides). Data on 375 genetic markers were generated for each of 44...

  15. The morphological changes of Ascaris lumbricoides ova in sewage sludge water treated by gamma irradiation

    International Nuclear Information System (INIS)

    Untreated wastewater sampled from Damascus sewage water treatment plant containing nematode Ascaris lumbricoides ova were treated using gamma irradiation (doses between 1.5 and 8 kGy), immediately after irradiation the morphological and developmental status of eggs was examined microscopically. Major morphological changes of the contents of the eggs were detected. These eggs were incubated for 8 weeks, after this period no larvae 'inside the eggs' were observed. Thus the morphological changes can be used as a viable parameter

  16. The morphological changes of ascaris lumbricoides ova in sewage sludge water treated by gamma irradiation

    International Nuclear Information System (INIS)

    Untreated wastewater sampled from Damascus sewage water treatment plant containing nematode Ascaris lumbricoides ova were treated using gamma irradiation (doses between 1.5 and 8 kGy), immediately after irradiation the morphological and developmental status of eggs were examined microscopically. Major morphological changes of the contents of the eggs were detected. These eggs were incubated for 8 weeks, after this period no larvae, inside the eggs, were observed. Thus the morphological changes can be used as a viable parameter. (author)

  17. SjAPI, the First Functionally Characterized Ascaris-Type Protease Inhibitor from Animal Venoms


    Chen, Zongyun; Wang, Bin; Hu, Jun; Yang, Weishan; Cao,Zhijian; Zhuo, Renxi; Li, Wenxin; Wu, Yingliang


    Background Serine protease inhibitors act as modulators of serine proteases, playing important roles in protecting animal toxin peptides from degradation. However, all known serine protease inhibitors discovered thus far from animal venom belong to the Kunitz-type subfamily, and whether there are other novel types of protease inhibitors in animal venom remains unclear. Principal Findings Here, by screening scorpion venom gland cDNA libraries, we identified the first Ascaris-type animal toxin ...

  18. New Allergens of Relevance in Tropical Regions: The Impact of Ascaris lumbricoides Infections


    Caraballo, Luis; Acevedo, Nathalie


    One of the many aspects of the relationships between parasite infections and allergic diseases is the possibility that allergens from parasites enhance the TH2 responses, especially IgE production, in allergic diseases such as asthma. In this review we discuss about the allergenic composition of the nematode Ascaris lumbricoides and their potential impact on allergy sensitization and asthma pathogenesis and prevalence in populations living in the tropics and naturally exposed to both, mite al...

  19. Serologic evidence that Ascaris and Toxoplasma infections impact inflammatory responses to Helicobacter pylori in Colombians


    Ek, Courtney; Whary, Mark T.; Ihrig, Melanie; Bravo, Luis E.; Correa, Pelayo; Fox, James G.


    Background: Helicobacter pylori-infected children from coastal Tumaco, Colombia, have more parasitism, and adults have lower gastric cancer risk compared with high-altitude Pasto/Tuquerres residents. Because helminth and Toxoplasma gondii infections alter helicobacter gastritis in rodent models, we determined whether seropositivity to Ascaris lumbricoides or T. gondii was associated with Th2-IgG1 or Th1-IgG2 responses to H. pylori. Methods: Sera (240) from the two populations were evaluate...

  20. Proteomic and Immunochemical Characterization of Glutathione Transferase as a New Allergen of the Nematode Ascaris lumbricoides


    Nathalie Acevedo; Jens Mohr; Josefina Zakzuk; Martin Samonig; Peter Briza; Anja Erler; Anna Pomés; Huber, Christian G.; Fatima Ferreira; Luis Caraballo


    Helminth infections and allergy have evolutionary and clinical links. Infection with the nematode Ascaris lumbricoides induces IgE against several molecules including invertebrate pan-allergens. These antibodies influence the pathogenesis and diagnosis of allergy; therefore, studying parasitic and non-parasitic allergens is essential to understand both helminth immunity and allergy. Glutathione transferases (GSTs) from cockroach and house dust mites are clinically relevant allergens and compa...

  1. A Community Based Survey of the Burden of Ascaris Lumbricoides in Enugu


    Chijioke, IR; Ilechukwu, GC; Ilechukwu, GCA; Okafor, CI; Ekejindu, IM; Sridhar, MKC


    Background: Intestinal helminthiasis is common in our environment and antihelminthic drugs are specie specific. Thus, need to identify and characterize the species cannot be overemphasized. Objective: To determine the prevalence of Ascaris Lumbricoides in Enugu Metropolis. Methods: A cross-sectional survey of 361 subjects in Enugu metropolis was carried out in this study. A single stool sample was collected for examination from the subjects, using appropriately labelled clean specimen contain...

  2. Management of biliary Ascaris lumbricoides in Kabul, Afghanistan: crossroads of advancing technology


    Manning, Richard Gerard; Tani, Mohammad Kamal


    The case is presented of the successful removal of a dead Ascaris lumbricoides from the right hepatic duct of a middle aged woman from a rural province in Afghanistan. The case was started laparoscopically, but converted to an open procedure because of difficulty identifying the anatomic landmarks required to safely perform laparoscopic cholecystectomy. After worm removal, the common bile duct (CBD) was reconstructed with a Roux-en-Y hepaticojejunostomy. The patient was discharged on postoper...

  3. The morphological changes of Ascaris lumbricoides ova in sewage sludge water treated by gamma irradiation (United States)

    Shamma, M.; Al-Adawi, M. A.


    Untreated wastewater sampled from Damascus sewage water treatment plant containing nematode Ascaris lumbricoides ova were treated using gamma irradiation (doses between 1.5 and 8 kGy), immediately after irradiation the morphological and developmental status of eggs was examined microscopically. Major morphological changes of the contents of the eggs were detected. These eggs were incubated for 8 weeks, after this period no larvae "inside the eggs" were observed. Thus the morphological changes can be used as a viable parameter.

  4. Effect of Ascaris lumbricoides infection on T helper cell type 2 in rural Egyptian children


    Shalaby NM


    Naglaa M Shalaby,1 Nehad M Shalaby2 1Department of Parasitology, Faculty of Medicine, 2Mansoura University Children Hospital, Mansoura University, Mansoura, Egypt Abstract: Ascaris lumbricoides is a neglected parasite that induces changes in host immune response. This study is conducted to define the serum levels of tumor necrosis factor alpha (TNF-α), interleukin-4 (IL-4), and interleukin-5 (IL-5) in some Egyptian children and their relations to intensity of infection, age, and asc...

  5. Individual Predisposition, Household Clustering and Risk Factors for Human Infection with Ascaris lumbricoides: New Epidemiological Insights


    Walker, Martin; Hall, Andrew; Basáñez, María-Gloria


    Background Much of our current understanding of the epidemiology of Ascaris lumbricoides infections in humans has been acquired by analyzing worm count data. These data are collected by treating infected individuals with anthelmintics so that worms are expelled intact from the gastrointestinal tract. Analysis of such data established that individuals are predisposed to infection with few or many worms and members of the same household tend to harbor similar numbers of worms. These effects, kn...

  6. The Half-life of Ascaris lumbricoides Prevalence in Japanese School Children

    Directory of Open Access Journals (Sweden)



    Full Text Available In the present study, we examined the dynamic of school-health-based parasite control and the related socio-economic influences. This is an ecological study based on data from 46 prefectures in Japan. The exponential decay of Ascaris lumbricoides prevalence was calculated by iterative least-squares method. Pearsonʼs correlation and multiple linear regression model analysis were performed to assess the associations between the prevalence of Ascaris lumbricoides in Japanese school children and socio-economic variables such as the prefecture income per capita, the percentage of primary industry, the population density per 1 km2, the diffusion rate of population under water supply, and the percentage of upper secondary school enrollment. The results indicated that the parasite carrier rate was higher in younger students. The half-life of Ascaris lumbricoides prevalence was approximately 3 years with significant variation among prefectures. Multiple regression analyses showed that the decrease of infection in elementary and lower secondary school children had a significant positive association with primary industry and a significant negative association with prefecture income per capita. The school-health-based parasite intervention differs by prefecture and has changed over time according to the respective prefectural stage of economic development.

  7. Checklist of the phyla Platyhelminthes, Xenacoelomorpha, Nematoda, Acanthocephala, Myxozoa, Tardigrada, Cephalorhyncha, Nemertea, Echiura, Brachiopoda, Phoronida, Chaetognatha, and Chordata (Tunicata, Cephalochordata, and Hemichordata) from the coasts of Turkey


    ÇINAR, Melih Ertan


    In this paper, the current status of the species diversity of 13 phyla, namely Platyhelminthes, Xenacoelomorpha, Nematoda, Acanthocephala, Myxozoa, Tardigrada, Cephalorhyncha, Nemertea, Echiura, Brachiopoda, Phoronida, Chaetognatha, and Chordata (invertebrates, only Tunicata, Cephalochordata, and Hemichordata) along the coasts of Turkey is reviewed. Platyhelminthes was represented by 186 species, Chordata by 64 species, Nemertea by 26 species, Nematoda by 20 species, Xenacoelomorpha by 11 spe...

  8. Granulomatous peritonitis due to Ascaris lumbricoides. Case report Granulomatosis peritoneal por Ascaris lumbricoides.Presentación de un caso

    Directory of Open Access Journals (Sweden)

    Carlos Aguirre Muñoz


    the underdeveloped countries. It is related to conditions of poverty, malnutrition and poor hygiene. According to the complex life cycle of the parasite, several and different intestinal and extraintestinal complications can arise, including peritonitis. Appropriate treatment and preventive measures are very important factors to avoid deaths caused by this disease.

    We report the case of a 3 year-old girl, coming from a rural area of Colombia, who presented peritonitis by Ascaris lumbricoides, preceded by persistent diarrhea, pain and abdominal mass. She was incidentally diagnosed by means of laparotomy and peritoneal biopsy, because an intestinal lymphoma was suspected.

  1. Modelagem geoestatística da infecção por Ascaris lumbricoides


    Bruno de Paula Menezes Drumond Fortes; Luis Iván Ortiz Valencia; Simone do Vale Ribeiro; Roberto de Andrade Medronho


    O estudo tem por objetivo modelar a distribuição espacial da ocorrência de ascaríase, utilizando mapas de risco mediante técnicas de geoprocessamento e análise geoestatística. Com base no banco de dados do PAISQUA, foram selecionados 19 setores censitários do Rio de Janeiro. Foram amostradas e georreferenciadas, no centróide de seu respectivo domicílio, 1.550 crianças com idade de 1 a 9 anos. Mapas de risco de Ascaris lumbricoides foram gerados usando krigagem indicadora. Com base na validaçã...

  2. The morphological changes of Ascaris lumbricoides ova in sewage sludge water treated by gamma irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Shamma, M. E-mail:; Al-Adawi, M.A


    Untreated wastewater sampled from Damascus sewage water treatment plant containing nematode Ascaris lumbricoides ova were treated using gamma irradiation (doses between 1.5 and 8 kGy), immediately after irradiation the morphological and developmental status of eggs was examined microscopically. Major morphological changes of the contents of the eggs were detected. These eggs were incubated for 8 weeks, after this period no larvae 'inside the eggs' were observed. Thus the morphological changes can be used as a viable parameter.

  3. Complete Mitochondrial Genomes of Chimpanzee- and Gibbon-Derived Ascaris Isolated from a Zoological Garden in Southwest China


    Yue Xie; Lili Niu; Bo Zhao; Qiang Wang; Xiang Nong; Lin Chen; Xuan Zhou; Xiaobin Gu; Shuxian Wang; Xuerong Peng; Guangyou Yang


    Roundworms (Ascaridida: Nematoda), one of the most common soil-transmitted helminths (STHs), can cause ascariasis in various hosts worldwide, ranging from wild to domestic animals and humans. Despite the veterinary and health importance of the Ascaridida species, little or no attention has been paid to roundworms infecting wild animals including non-human primates due to the current taxon sampling and survey bias in this order. Importantly, there has been considerable controversy over the yea...

  4. Possible Approach for Serodiagnosis of Ascariasis by Evaluation of Immunoglobulin G4 Response Using Ascaris lumbricoides Somatic Antigen


    Bhattacharyya, Tanusree; Santra, Amal; Majumder, Debendra N. Guha; Chatterjee, Bishnu P.


    Somatic antigen of Ascaris lumbricoides was purified to homogeneity (molecular mass, 34 kDa) by ammonium sulfate fractionation and successive chromatographic procedures, namely, gel permeation, ion exchange, and high-performance gel permeation liquid chromatographies. The antigen showed strong binding with immunoglobulin G (IgG) in Ascaris-infested patients and was cross-reactive with IgE and IgG in patients infested with other nematodes. It reacted specifically with IgG4 (P < 0.001) in 63 As...

  5. Helmint eggs elimination performance during lammelar settling and sand filters in Beniel WWTP (Murcia, Spain)

    International Nuclear Information System (INIS)

    With this study, it was observed Ascaris suum eggs elimination yield of tertiary treatment in Beniel wastewater treatment plant (WWTP) in Murcia Region (Spain). It was inoculated a sample of Ascaris suum eggs in the treatment in maximum flow conditions and it was calculated the retention yield of the lamellar settling and sand filters. (Author) 3 refs.

  6. Helmint eggs elimination performance during lammelar settling and sand filters in Beniel WWTP (Murcia, Spain); Rendimiento en la eliminacion de huevos de helminto en la decantacion lamelar y filtracion por arena en la EDAR de Beniel (Murcia)

    Energy Technology Data Exchange (ETDEWEB)

    Simon Andreu, P. J.; Cardin Mifsut, C.; Pacheco Ballarin, S.; Martinez Muro, M. A.; Vicente Gonzalez, J. A.; Llosar Llacer, C.


    With this study, it was observed Ascaris suum eggs elimination yield of tertiary treatment in Beniel wastewater treatment plant (WWTP) in Murcia Region (Spain). It was inoculated a sample of Ascaris suum eggs in the treatment in maximum flow conditions and it was calculated the retention yield of the lamellar settling and sand filters. (Author) 3 refs.

  7. The effect of γ-aminobutyric acid on the input conductance and membrane potential of Ascaris muscle


    Martin, R. J.


    1 Twin intracellular recordings were made from the bag region of Ascaris muscle in order to make conductance measurements. The preparation was bathed in a cool (22°C) Ringer solution to abolish the large spontaneous depolarizing potentials and to improve stability for recording.

  8. Proteomic and immunochemical characterization of glutathione transferase as a new allergen of the nematode Ascaris lumbricoides.

    Directory of Open Access Journals (Sweden)

    Nathalie Acevedo

    Full Text Available Helminth infections and allergy have evolutionary and clinical links. Infection with the nematode Ascaris lumbricoides induces IgE against several molecules including invertebrate pan-allergens. These antibodies influence the pathogenesis and diagnosis of allergy; therefore, studying parasitic and non-parasitic allergens is essential to understand both helminth immunity and allergy. Glutathione transferases (GSTs from cockroach and house dust mites are clinically relevant allergens and comparative studies between them and the GST from A. lumbricoides (GSTA are necessary to evaluate their allergenicity. We sought to analyze the allergenic potential of GSTA in connection with the IgE response to non-parasitic GSTs. IgE to purified GSTs from Ascaris (nGSTA and rGSTA, house dust mites (rDer p 8, nBlo t 8 and rBlo t 8, and cockroach (rBla g 5 was measured by ELISA in subjects from Cartagena, Colombia. Also, multidimensional proteomic approaches were used to study the extract of A. lumbricoides and investigate the existence of GST isoforms. We found that among asthmatics, the strength of IgE levels to GSTA was significantly higher than to mite and cockroach GSTs, and there was a strong positive correlation between IgE levels to these molecules. Specific IgE to GSTA was found in 13.2% of controls and 19.5% of asthmatics. In addition nGSTA induced wheal and flare in skin of sensitized asthmatics indicating that it might be of clinical relevance for some patients. Frequency and IgE levels to GSTA were higher in childhood and declined with age. At least six GST isoforms in A. lumbricoides bind human IgE. Four isoforms were the most abundant and several amino acid substitutions were found, mainly on the N-terminal domain. In conclusion, a new allergenic component of Ascaris has been discovered; it could have clinical impact in allergic patients and influence the diagnosis of mite and cockroach allergy in tropical environments.

  9. Redescription of Parapharyngodon micipsae (Seurat 1917) (Nematoda Pharyngodonidae) from the new host Tarentola parvicarinata Joger 1980 (Squamata Gekkonidae)

    Czech Academy of Sciences Publication Activity Database

    Mašová, Š.; Baruš, Vlastimil; Hodová, I.; Koubek, Petr; Koubková, B.


    Roč. 22, č. 2 (2009), s. 243-255. ISSN 0394-6975 R&D Projects: GA AV ČR IAA6093404 Institutional research plan: CEZ:AV0Z60930519 Keywords : parasite * Nematoda * gecko * Senegal * West Africa Subject RIV: EG - Zoology Impact factor: 0.706, year: 2009

  10. Capillariid nematodes (Nematoda: Capillariidae) parasitic in the common cormorant (Phalacrocorax carbo), with redescription of Baruscapillaria carbonis (Dubinin et Dubinina, 1940)

    Czech Academy of Sciences Publication Activity Database

    Frantová, Denisa


    Roč. 48, č. 3 (2001), s. 225-230. ISSN 0015-5683 R&D Projects: GA AV ČR KSK2022601 Institutional research plan: CEZ:AV0Z6022909 Keywords : Nematoda * Capillariidae * Baruscapillaria * Phalacrocorax carbo Subject RIV: EG - Zoology Impact factor: 0.557, year: 2001

  11. Sludge hygienization: Helminth eggs destruction by lime treatment Ascaris eggs as model

    Energy Technology Data Exchange (ETDEWEB)

    Banas, S.; Schwartzbrod, J. [Lab. de Chimie Physique et Microbiologie de l' Environnement, Nancy (France); Remy, M. [Lhoist, on behalf of the European Lime Assoication (EuLA), Bruessel (Germany); Boehm, R. [Univ. Hohenheim, Stuttgart (Germany); Verfuerden, M. [Fels-Werke GmbH, im Namen des Bundesverbandes der Deutschen Kalkindustrie (BVK), Koeln (Germany)


    Most pathogens in the raw sewage are concentrated into the sewage sludge. They can be separated into four categories: viruses, bacteria, protozoa and larger parasites such as human roundworms, tapeworms and liver flukes. Such micro-organisms can cause disease in humans, the transmission occurring in several ways e.g. by inhaling sludge aerosols or dust, by eating vegetables or fruits contaminated by sludge, drinking water contaminated by run-off or by eating meat from livestock infected by grazing pastures fertilised with sludge. The presence of helminth eggs in urban sludge may constitute a sanitary risk when used as agricultural fertiliser. To avoid any contamination, the efficiency of a certain number of sludge hygienization processes must be tested. One of these involves decontamination with quicklime. The Ascaris egg inactivation by liming with lime milk, slaked lime and quicklime is studied in a series of sludges coming from slaughterhouses. (orig.)

  12. Aspectos imunológicos na infecção por Ascaris lumbricoides


    Vaz, Ana Catarina Rodrigues Lopes


    Dissertação para obtenção do grau de Mestre no Instituto Superior de Ciências da Saúde Egas Moniz Ascaris lumbricoides é um parasita, geo-helminta, a sua prevalência é maior em zonas quentes e húmidas, em que as condições de saneamento e higiene são precárias. É o principal responsável por parasitoses intestinais, principalmente em crianças, manifestando-se por náuseas, vómitos e dor abdominal. Em casos mais graves pode causar défice no desenvolvimento físico e cognitivo. O sistema imun...

  13. Distribuição espacial da infecção por Ascaris lumbricoides


    Campos Mônica Rodrigues; Valencia Luis Iván Ortiz; Fortes Bruno de Paula Menezes Drumond; Braga Ricardo Cerqueira Campos; Medronho Roberto de Andrade


    OBJETIVO: Estimar áreas de risco para a ocorrência de carga parasitária produzida pelo Ascaris lumbricoides, por meio da utilização de técnicas de geoprocessamento e análise geoestatística. MÉTODOS: Foram selecionados 19 setores censitários para a realização do inquérito copro-parasitológico e domiciliar na localidade de Parque Fluminense, no município de Duque de Caxias, RJ. Foram amostradas e plotadas no centróide de seu respectivo domicílio 1.664 crianças com idade entre 1 e 9 anos. As téc...

  14. Eosinophilic cholecystitis along with pericarditis caused by Ascaris lumbricoides: A case report

    Institute of Scientific and Technical Information of China (English)

    Kosuke Kaji; Mitsuteru Kitade; Hideto Kawaratani; Masahito Uemura; Junichi Yamao; Masao Fujimoto; Akira Mitoro; Masahisa Toyohara; Motoyuki Yoshida; Hiroshi Fukui; Hitoshi Yoshiji; Masahide Yoshikawa; Masaharu Yamazaki; Yasuhide Ikenaka; Ryuichi Noguchi; Masayoshi Sawai; Masatoshi Ishikawa; Tsuyoshi Mashitani


    Although the etiology of eosinophilic cholecystitis is still obscure, the postulated causes include allergies,parasites, hypereosinophilic syndrome, and eosinophilic gastroenteritis. It is sometimes accompanied by several complications, but a simultaneous onset with pericarditis is very rares. A 28-year-old woman complained of acute right hypocondrial pain and dyspnea associated with systemic eruption. Several imaging modalities revealed acute cholecystitis and pericarditis with massive pericardial effusion. A marked peripheral blood eosinophilia was observed, and the eruption was diagnosed as urticaria. Her serum had a high titer of antibody against Ascaris lumbricoides. Treatment with albendazole drastically improved all clinical manifestations along with normalization of the imaging features and eosinophilia. We report herein a rare case of simultaneous onset of acute cholecystitis and pericarditis associated with a marked eosinophilia caused by parasitic infection.

  15. New species of Parapharyngodon (Nematoda: Pharyngodonidae) in Rhinella marina (Anura: Bufonidae) from Grenada, West Indies (United States)

    Bursey, Charles; Drake, Michael; Cole, Rebecca; Sterner, Mauritz, III; Pinckney, Rhonda; Zieger, Ulrike


    Parapharyngodon grenadaensis n. sp. (Nematoda: Pharyngodonidae) from the large intestine of the cane toad, Rhinella marina, is described and illustrated. Parapharyngodon grenadaensis n. sp. is the 48th species assigned to the genus and the 16th species from the Neotropical region. It differs from other species in the genus by possessing 4 pairs of caudal papillae, an echinate anterior cloacal lip, and a blunt spicule of 67–104 μm. This is only the second report of R. marina harboring a species of Parapharyngodon.

  16. Cosmocercoides himalayanus sp. nov. (Nematoda, Cosmocercidae) in Duttaphrynus himalayanus (Amphibia, Anura) from Dehradun (Uttarakhand), India. (United States)

    Rizvi, Anjum N; Bursey, Charles R


    Cosmocercoides himalayanus sp. nov. (Nematoda, Cosmocercidae) from the large intestine of Duttaphrynus himalayanus (Amphibia, Anura) from Dehradun, India is described and illustrated. Cosmocercoides himalayanus sp. nov. represents the 21st species assigned to the genus and the 9th species from the Oriental biogeographical region. Cosmocercoides himalayanus sp. nov. differs from the previously described Oriental species in number and position of rosette papillae; it is the only species possessing 24 or more rosette papillae to have 4 postcloacal papillae. In addition, a list of species assigned to Cosmocercoides is provided; however, C. fotedari Arya, 1992 is removed from the genus and until further study is considered a species inquirenda. PMID:24570052

  17. A new species of Thelastomathidae (Nematoda a parasite of Neocurtilla claraziana Saussure (Orthoptera, Gryllotalpidae in Argentina

    Directory of Open Access Journals (Sweden)

    Camino Nora B


    Full Text Available Gryllophila cephalobulata n. sp. (Nematoda, Thelastomatidae a parasite of the mole cricket Neocurtilla claraziana (Orthoptera, Gryllotalpidae isolated in Buenos Aires Province, is described and illustrated. It is characterized by cuticle annulated all along the length of the body; the first ring has 4 lobules, the second one has 14 lobules, the others rings are simple, the stoma is short and has 4 small teeth, the genital papillae are arranged in 5 pairs, of which 3 pairs are preanal and 2 pairs are postanal. The tail appendage of the male is long and filiform.

  18. Radiographic plain film and CT findings in lipoid pneumonia in infants following aspiration of mineral oil used in the treatment of partial small bowel obstruction by Ascaris lumbricoides

    International Nuclear Information System (INIS)

    Four children developed lipoid pneumonia following ingestion of mineral oil for the treatment of partial small bowel obstruction by Ascaris lumbricoides whorl. CT of the chest showed negative Hounsfield numbers which may prove useful in diagnosis. (orig.)

  19. Radiographic plain film and CT findings in lipoid pneumonia in infants following aspiration of mineral oil used in the treatment of partial small bowel obstruction by Ascaris lumbricoides

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, G.A. de; Del Caro, S.R.; Bender Lamego, C.M.; Mercon de Vargas, P.R.; Vervloet, V.E.C.


    Four children developed lipoid pneumonia following ingestion of mineral oil for the treatment of partial small bowel obstruction by Ascaris lumbricoides whorl. CT of the chest showed negative Hounsfield numbers which may prove useful in diagnosis.

  20. Unexpected variation in neuroanatomy among diverse nematode species

    Directory of Open Access Journals (Sweden)

    Ziduan eHan


    Full Text Available Nematodes are considered excellent models for understanding fundamental aspects of neuron function. However, nematodes are less frequently used as models for examining the evolution of nervous systems. While the habitats and behaviors of nematodes are diverse, the neuroanatomy of nematodes is often considered highly conserved. A small number of nematode species greatly influences our understanding of nematode neurobiology. The free-living species Caenorhabditis elegans and, to a lesser extent, the mammalian gastrointestinal parasite Ascaris suum are, historically, the primary sources of knowledge regarding nematode neurobiology. Despite differences in size and habitat, C. elegans and Ascaris suum share a surprisingly similar neuroanatomy. Here, we examined species across several clades in the phylum Nematoda and show that there is a surprising degree of neuroanatomical variation both within and among nematode clades when compared to C. elegans and Ascaris. We found variation in the numbers of neurons in the ventral nerve cord and dye-filling pattern of sensory neurons. For example, we found that Pristionchus pacificus, a bacterial feeding species used for comparative developmental research, had 20% fewer ventral cord neurons compared to C. elegans. Steinernema carpocapse, an insect-parasitic nematode capable of jumping behavior, had 40% more ventral cord neurons than C. elegans. Interestingly, the non-jumping congeneric nematode, S. glaseri showed an identical number of ventral cord neurons as S. carpocapsae. There was also variability in the timing of neurodevelopment of the ventral cord with two of five species that hatch as second-stage juveniles showing delayed neurodevelopment. We also found unexpected variation in the dye-filling of sensory neurons among examined species. Again, sensory neuron dye-filling pattern did not strictly correlate with phylogeny. Our results demonstrate that variation in nematode neuroanatomy is more prevalent

  1. Hubungan Infeksi Ascaris lumbricoides Terhadap Hasil Uji Tusuk Kulit (Skin Prick Test) dengan Alergen dari Cacing Ascaris pada Anak Sekolah Dasar Negeri 047/XI Koto Baru yang Memiliki Riwayat Atopi di Kecamatan Pesisir Bukit Kota Sungai Penuh Provinsi Jambi


    Rachman, Faisal


    Infectious diseases, intestinal worms that are transmitted through the soil (Soil-transmitted helminthiasis) is a common infection that involves many people in the world. Estimates suggests Ascaris lumbricoides infects over one billion people. The number of most worm infections apply to sub-Saharan Africa, the Americas, China and East Asia. Prevalence of asthma and other atopic diseases in children has increased worldwide in recent years, but the reason behind the increase in prevalence is un...

  2. Ascaris lumbricoides causing infarction of the mesenteric lymph nodes and intestinal gangrene in a child: a case report


    Bhutia, Kincho Lhasong; Dey, Subhajeet; Singh, Varun; Gupta, Amlan


    Ascaris lumbricoides or round worm infestation is quite common in the developing world. It affects all age groups but is more common in children. Most of the cases remain asymptomatic. The usual presentation is an intestinal obstruction. The physicians should be aware of this condition and consider it in the differential diagnosis when faced with such a case. The rare fatal complications include bleeding, perforation and gangrene.

  3. Multiparasitic Infection (Hydatid Cyst of the Spleen and Ascaris Lumbricoides Infestation) Mimicking an Acute Surgical Abdomen – Case Report


    Molnar Călin; Vizitiu Alexandru; Deak Karoly; Russu Cristian; Tudor Adrian; Suciu Bogdan; Stolnicu Simona; Hulub Marius; Molnar Claudiu


    Hydatid cyst involving the spleen is a rare clinical condition (0.5-4%). We report a case of multi-parasitic infection in a 62 year old female (hydatid cyst and ascaris lumbricoides infestation), confirmed during surgery. The purpose of the paper is to emphasize on the rare association of the two parasitic infections, affecting two different organs (spleen and jejunum). The combined symptomatology of the two parasites could mimic an acute surgical abdomen.



    F. Maleky; Massoud, J.


    Purification of parasitic antigens is a major activity in immunoparasitology because of its application in immunodiagnosis, vaccination analysis of immunopathology, preparation of monocolomal antibody and finding out the cross reactive antigens versus specific antigens of a parasite. In this survey F2 ultrafiltration excretory secretory antigens of Ascaris lumbricoides and Toxocara cati were separated by gel chromatography on sephacryl S-200 into several antigenic and non antigenic fractions....

  5. Ascaris lumbricoides causing infarction of the mesenteric lymph nodes and intestinal gangrene in a child: a case report. (United States)

    Bhutia, Kincho Lhasong; Dey, Subhajeet; Singh, Varun; Gupta, Amlan


    Ascaris lumbricoides or round worm infestation is quite common in the developing world. It affects all age groups but is more common in children. Most of the cases remain asymptomatic. The usual presentation is an intestinal obstruction. The physicians should be aware of this condition and consider it in the differential diagnosis when faced with such a case. The rare fatal complications include bleeding, perforation and gangrene. PMID:21698086

  6. Screening for Anthelminthic Activities from Extracts of Zanthoxylum Zanthoxyloides, Neocarya Macrophylla and Celosia Laxa Against Ascaris Infection in Rabbits

    Directory of Open Access Journals (Sweden)

    B B Barnabas


    Full Text Available Summary: Extracts of Celosia laxa, Neocarya macrophylla and Zanthoxylum zanthoxyloides leaves were screened for anthelminthic activities on Ascaris lumbricoides. Celosia laxa appeared to be more potent against A. lumbricoides with rapid recovery of weight while Z. zanthoxyloides has the lowest potency. The effects of these plant extracts on Ascaris lumbricoides suggest that they could serve as an alternative source of anthelminthic agent. Industrial relevance: Infectious diseases pose serious challenges to global health care delivery. Moreoever, in developing countries, the cost of orthodox medication is out of reach of the common man, especially those in rural areas. This is coupled with the adulterated drugs and emergences of drug resistant strains have led to an intensive search for natural products of higher plants, which are biologically active against parasitic infections. Many plants are used locally in traditional medicine to treat parasitic infections. Nigeria offers a rich floral diversity that are used traditionally to treat worm infections. Nigerian medicinal plants (Celosia laxa, Neocarya macrophylla, Zanthoxylum zanthoxyloides used commonly used in Bida, Niger State, Nigeria for the treatment of worm infections were screened for anthelminthic activity. The extracts exhibited varying degree of anthelminthic activities against Ascaris lumbricoides. The extract of C. laxa display potent anthelminthic property. The extract of C. laxa with pronounced activity against A. lumbricoides may contain metabolites that have pharmacologically active principles with promising anthelminthic properties. This indicates the medical potential of C. laxa in the treatment of helminthiasis.

  7. Effect of Ascaris lumbricoides infection on T helper cell type 2 in rural Egyptian children

    Directory of Open Access Journals (Sweden)

    Shalaby NM


    Full Text Available Naglaa M Shalaby,1 Nehad M Shalaby2 1Department of Parasitology, Faculty of Medicine, 2Mansoura University Children Hospital, Mansoura University, Mansoura, Egypt Abstract: Ascaris lumbricoides is a neglected parasite that induces changes in host immune response. This study is conducted to define the serum levels of tumor necrosis factor alpha (TNF-α, interleukin-4 (IL-4, and interleukin-5 (IL-5 in some Egyptian children and their relations to intensity of infection, age, and ascariasis symptoms. Stool samples were examined using formol-ether concentration and Kato-Katz thick smear techniques. Sera of 60 A. lumbricoides-infected children and 20 controls were tested by enzyme-linked immunosorbent assay. The mean sera concentrations of TNF-α, IL-4, and IL-5 were 7.41±2.5 pg/mL, 107.60±18.3 pg/mL, and 389.52±28.0 pg/mL, respectively. The controls had mean serum TNF-α 7.10±2.4 pg/mL, IL-4 25.49±2.6 pg/mL, and IL-5 88.76±22.7 pg/mL. The difference in the concentration of sera cytokines was statistically significant for IL-4 and IL-5 (P<0.01 between A. lumbricoides-infected children and controls. The intensity of infection correlated positively with IL-4 and IL-5 at r=0.959 and r=0.919, respectively. The concentrations of IL-4 and IL-5 correlated positively with the age at r=0.845 and r=0.934, respectively. Asthma and gastrointestinal tract upsets were correlated positively with IL-4 and IL-5. These data indicate that A. lumbricoides infection in our locality is associated with significantly high levels of IL-4 and IL-5.Keywords: Ascaris lumbricoides, children, rural, Egypt, IL-4, IL-5, TNF-α


    Directory of Open Access Journals (Sweden)

    Pinardi Hadidjaja


    Full Text Available An introduction of integrated management system for human excreta was carried out in the village of Cirimekar, Cibinong subdistrict, West Java The purpose of this study is to gain the readiness and motivation of the population in that village to participate and benefit the product of this system for fish farming and the growth of water hyacinth (Eichornia crassipes. The study was performed integratedly between several aspects namely the socio-economica, tech­nical, medical, biologicatas well as environmental, and this involved the establishment of the profile of the community, stool, sludge, effluent and fish examinations In this paper only the Viability of Ascaris lumbricoides eggs is discussed. The digestion tank seemed to work as expected, resulted in the de­generation of 423%. A lumbricoides eggs found in the tank as well as in the experimental ponds It was most probable that the death of the A. lumbricoides eggs was due to aerobic decomposition which took place in the tank giving rise to an increase of temperature which would enhance the death of the eggs

  9. Successful treatment of lipoid pneumonia associated with bowel obstruction by Ascaris lumbricoides. (United States)

    Azevedo Sias, Selma; Oliveira Caetano, Regina; Dutra Comarella, Júlia; de Oliveira, Elen; Santos Ferreira, Angela; Quirico-Santos, Thereza


    Partial bowel obstruction is a serious complication of ascariasis infestation generally treated with mineral oil. This prospective study aimed to evaluate the efficacy of multiple bronchoalveolar lavages (BAL) as a therapeutic strategy for reducing lung inflammation of lipoid pneumonia associated with ascariasis. The study included five children (mean age 25 months) with partial small-bowel obstruction by Ascaris lumbricoides, who underwent diagnostic bronchoalveolar lavage for assessment of refractory pneumonia. Routine biochemical, microbiological and cytological analysis were carried out in the BAL. Protein, lactate dehydrogenase and tumor necrosis factor-alpha (TNF-α) cytokine levels were determined in the serum before and after treatment. At admission, children consistently had respiratory symptoms, altered hematological function, increased immunoglobulin E serum level and peripheral blood eosinophilia. Chest tomography showed consolidation with air bronchogram (4/4), ground-glass infiltration (3/4) and decreased attenuation in the consolidation areas (2/4). Presence of marked pleocytosis with Sudan positive foamy alveolar macrophages, high protein and lactate dehydrogenase levels in the BAL indicated presence of mixed alveolitis. One child with extensive consolidation and air bronchogram in both lungs died before treatment. Multiple bronchoalveolar lavages efficiently removed alveolar oil deposits, restored BAL cellularity, improved clinical symptoms, radiological parameters and further reduced inflammatory reaction evidenced by marked decrease of the inflammatory cytokine, TNF-α. This study presents a therapeutic strategy for management of lung complications caused by mineral oil administration to treat intestinal bowel obstruction associated with ascariasis. PMID:20026557

  10. Cystoopsis atractostei n. sp. (Nematoda: Cystoopsidae) from the subcutaneous tissue of the tropical gar, Atractosteus tropicus (Pisces), in Mexico

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Salgado-Maldonado, G.


    Roč. 89, č. 1 (2003), s. 137-140. ISSN 0022-3395 R&D Projects: GA AV ČR IAA6022201 Grant ostatní: CONACyT(MX) 400355-5-27668N Institutional research plan: CEZ:AV0Z6022909 Keywords : Nematoda * Cystoopsidae * parasites of fishes Subject RIV: EA - Cell Biology Impact factor: 1.137, year: 2003

  11. [Presence of a new Trichostrongyloidea (Nematoda) Nochtia (Nochtia) atelerixi n. sp. in an Erinacoidea (Insectivora) in Togo]. (United States)

    Quentin, J C; Durette-Desset, M C


    Nochtia (Nochtia) atelerixi n. sp. (Nematoda, Trichostrongyloidea) of Ethiopian Erinacoidea. - Nochtia (Nochtia) atelerixi n. sp. is found in the intestine of the hedgehog Atelerix albiventris in Togo. It is distinguished from the two other congeneric species parasite of asiatic Primates, N. (N.) nochti Travassos et Vogelsang, 1929 and N. (N.) tani Le Van Hoa, 1966, mainly by the highest number of cuticular crests and spicules with six tips. PMID:6926936

  12. Taxonomic investigations on the species of Tylenchida (Nematoda) in sunflower (Helianthus annuus L.) fields in Marmara Region


    Kepenekçi, İ.


    In this study, plant parasitic species of Tylenchida (Nematoda) in the sunflower (Helianthus annuus L.) fields in Marmara Region (Edirne, Kırklareli and Tekirdağ) were examined considering their two main aspects, namely faunistic and taxonomic. In 2000, during the summer months (Jun, July, August), when adult Tylenchida species were more abundant, soil and plant root samples were taken, from these samples, nematodes were extracted, prepared and the ones belonging to Tylenchida were mea...

  13. SjAPI-2 is the first member of a new neurotoxin family with Ascaris-type fold and KCNQ1 inhibitory activity. (United States)

    Chen, Jing; Zhang, Chuangeng; Yang, Weishan; Cao, Zhijian; Li, Wenxin; Chen, Zongyun; Wu, Yingliang


    Peptides with Ascaris-type fold are a new kind of toxins founded from venomous animals recently. Functionally, these unique toxin peptides had been identified as potent protease inhibitors, which was similar to other known Ascaris-type peptides from non-venomous animals. Whether Ascaris-type peptides from venom animals have neurotoxin activities remains unclear. Here, a scorpion toxin SjAPI-2 with Ascaris-type fold was characterized to have a neurotoxin activity, which can selectively inhibit KCNQ1 potassium channel. SjAPI-2 had 62 amino acid residues, including 10 cysteine residues. Charged residue analyses showed that two acidic residues of SjAPI-2 were regionally distributed, and 10 basic residues were distributed widely throughout the whole peptide, which was similar to classical potassium channel toxins. Pharmacological studies confirmed that SjAPI-2 was a selective KCNQ1 potassium channel inhibitor with weak effects on other potassium channels, such as Kv1.1, Kv1.2, Kv1.3, SKCa2, SKCa3, and IKCa channels. Concentration-dependent studies showed that SjAPI-2 inhibited the KCNQ1 potassium channel with an IC50 of 771.5±169.9 nM. To the best of our knowledge, SjAPI-2 is the first neurotoxin with a unique Ascaris-type fold, providing novel insights into the divergent evolution of neurotoxins from venomous animals. PMID:26014142

  14. On a new species of Aplectana (Nematoda, Cosmocercidae) from Kulti, Burdwan, West Bengal, India. (United States)

    Sou, Sujan K; Sow, Kanchan K; Nandi, Anadi P


    During routine survey for amphibian nematodes from coalfield areas of West Bengal, India 7 male and 12 female nematodes were recovered from the rectum of one out of three Duttaphrynus melanostictus (Schneider, 1899) examined for helminth infection from Kulti, Burdwan. On examination the recovered nematodes were found to belong to a new species of the genus Aplectana (Nematoda: Cosmocercidae) and the name Aplectana duttaphryni sp. nov. is proposed for them. This species is most similar to those species which possess gubernaculum but differs from all by distribution pattern of caudal papillae. Aplectana duttaphryni sp. nov. represents 49(th) species assigned to the genus, but only the 4(th) species reported from Oriental realm and second from India. PMID:25236282

  15. Ancylostoma (Ancylostoma buckleyi (Nematoda: Ancylostomatidae: new wild host and distribution expansion

    Directory of Open Access Journals (Sweden)

    Nathalia Paula Scioscia


    Full Text Available Abstract Here we report the occurrence of Ancylostoma (Ancylostoma buckleyi (Le Roux and Biocca, 1957 (Nematoda: Ancylostomatidae in the small intestine of Pampas foxes (Lycalopex gymnocercus (Mammalia: Canidae. This fox is the most abundant native carnivore in southern South America, where it inhabits grasslands, open woodlands and areas highly modified by extensive ranching and agricultural activities. Material from 80 foxes in rural areas of southern Buenos Aires province, Argentina was examined. The intestinal tracts were carefully removed from each carcass and subsequently isolated by ligatures (pylorus and rectum. Examination of the intestinal content was performed using the sedimentation and counting technique. Four foxes (5% were found to be parasitized with adult specimens of A. buckleyi. This is the first report of Ancylostoma (A. buckleyi in Argentina and adds L. gymnocercus as new host of this nematode species.

  16. Ancylostoma (Ancylostoma) buckleyi (Nematoda: Ancylostomatidae): new wild host and distribution expansion. (United States)

    Scioscia, Nathalia Paula; Beldomenico, Pablo Martín; Denegri, Guillermo María


    Here we report the occurrence of Ancylostoma (Ancylostoma) buckleyi (Le Roux and Biocca, 1957) (Nematoda: Ancylostomatidae) in the small intestine of Pampas foxes (Lycalopex gymnocercus) (Mammalia: Canidae). This fox is the most abundant native carnivore in southern South America, where it inhabits grasslands, open woodlands and areas highly modified by extensive ranching and agricultural activities. Material from 80 foxes in rural areas of southern Buenos Aires province, Argentina was examined. The intestinal tracts were carefully removed from each carcass and subsequently isolated by ligatures (pylorus and rectum). Examination of the intestinal content was performed using the sedimentation and counting technique. Four foxes (5%) were found to be parasitized with adult specimens of A. buckleyi. This is the first report of Ancylostoma (A.) buckleyi in Argentina and adds L. gymnocercus as new host of this nematode species. PMID:27334825

  17. Atividade de detergentes e desinfetantes sobre a evolução dos ovos de Ascaris lumbricoides Effects of detergents and disinfectants on the development of Ascaris lumbricoides eggs


    Cristiano Lara Massara; Rafaela Salgado Ferreira; Luiz Dias de Andrade; Henrique Leonardo Guerra; Omar dos Santos Carvalho


    A infecção por Ascaris lumbricoides decorre da ingestão de ovos embrionados deste parasita, o que justifica a pesquisa de substâncias que tenham efeito deletério sobre estes ovos. Nosso objetivo foi estudar a ação de 16 produtos detergentes e desinfetantes, de uso doméstico e laboratorial, sobre a embriogênese deste helminto. Crianças portadoras desta infecção foram tratadas com levamisol e os vermes fêmeas expelidos foram recolhidos e dissecados, para obtenção dos ovos intra-uterinos. Os ovo...

  18. Estrategia de Ascaris lumbricoides y Trichuris trichiura para la contaminación del medio ambiente, en una zona endemica Strategy of Ascaris lumbricoides and Trichuris trichiura for the environment contamination in an endemic area


    Gustavo Morales; Luz Arelis Pino


    La distribución de frecuencias del número de huevos por gramo de heces tanto de Ascaris lumbricoides como de Trichuris trichiura en humanos infestados en una zona endémica se corresponde con una ley binomial negativa y la disposición espacial de dichos huevos en la materia fecal, resultó ser en agregados, independientemente de que los hospedadores sean mayores o menores de 15 años. Estos resultados nos indican que solamente unos pocos hospedadores son los responsables de la mayor contaminació...

  19. New species of Bakeria (Nematoda; Strongylida; Molineidae), new species of Falcaustra (Nematoda; Ascaridida; Kathlaniidae) and other helminths in Cnemaspis mcguirei (Sauria; Gekkonidae) from Peninsular Malaysia. (United States)

    Bursey, Charles R; Goldberg, Stephen R; Grismer, L Lee


    Two new nematode species, Bakeria schadi sp. nov. and Falcaustra malaysiaia sp. nov. from the gastrointestinal tract of McGuire's rock gecko, Cnemaspis mcguirei (Sauria: Gekkonidae) collected in Peninsular Malaysia are described. The two species now assigned to Bakeria are separated on the bases of male bursa type and location of the excretory pore: type II in B. schadi sp. nov. and type I in B. bakeri; location of excretory pore, anterior to nerve ring in B. schadi sp. nov. and posterior to nerve ring in B. bakeri. Falcaustra malaysiaia sp. nov. is most similar to F. chabaudi, F. concinnae, F. condorcanquii, F. barbi, F. dubia, and F. tchadi in that these 7 species possess 1 pseudosucker, 1 median papilla plus 10 pairs caudal papillae, and spicules with lengths between 1 and 2 mm. F. barbi and F. tchadi lack adcloacal papillae; the remaining 5 species possess 1 pair of adcloacal papillae. Falcaustra chabaudi is known from Nearctic salamanders; F. concinnae from Nearctic turtles; F. condorcanquii from Neotropical frogs, F. dubia from Oriental frogs, and F. malaysiaia sp. nov. from Oriental geckos. Two additional species of Nematoda were found, Cosmocerca ornata and Meteterakis singaporensis. Cnemaspis mcguirei represents a new host record for Cosmocerca ornata and Meteterakis singaporensis. PMID:25236275

  20. Modelagem geoestatística da infecção por Ascaris lumbricoides

    Directory of Open Access Journals (Sweden)

    Fortes Bruno de Paula Menezes Drumond


    Full Text Available O estudo tem por objetivo modelar a distribuição espacial da ocorrência de ascaríase, utilizando mapas de risco mediante técnicas de geoprocessamento e análise geoestatística. Com base no banco de dados do PAISQUA, foram selecionados 19 setores censitários do Rio de Janeiro. Foram amostradas e georreferenciadas, no centróide de seu respectivo domicílio, 1.550 crianças com idade de 1 a 9 anos. Mapas de risco de Ascaris lumbricoides foram gerados usando krigagem indicadora. Com base na validação cruzada, os valores estimados foram comparados aos observados por intermédio da curva ROC. Um modelo de semivariograma isotrópico esférico com alcance de 30m e efeito pepita de 50% foi empregado na krigagem ordinária indicadora para a construção de um mapa de probabilidade de infecção por A. lumbricoides. A acurácia global, mensurada por meio da área sob a curva ROC, mostrou-se significativa. O uso da krigagem ordinária indicadora permitiu a modelagem de mapas de risco valendo-se da amostra de uma variável indicadora. O emprego das técnicas de análise estatística espacial mostrou-se adequado na predição da ocorrência do fenômeno, não ficando restrita a delimitações político-administrativas da região.

  1. Effect of Ascaris lumbricoides infection on T helper cell type 2 in rural Egyptian children. (United States)

    Shalaby, Naglaa M; Shalaby, Nehad M


    Ascaris lumbricoides is a neglected parasite that induces changes in host immune response. This study is conducted to define the serum levels of tumor necrosis factor alpha (TNF-α), interleukin-4 (IL-4), and interleukin-5 (IL-5) in some Egyptian children and their relations to intensity of infection, age, and ascariasis symptoms. Stool samples were examined using formol-ether concentration and Kato-Katz thick smear techniques. Sera of 60 A. lumbricoides-infected children and 20 controls were tested by enzyme-linked immunosorbent assay. The mean sera concentrations of TNF-α, IL-4, and IL-5 were 7.41±2.5 pg/mL, 107.60±18.3 pg/mL, and 389.52±28.0 pg/mL, respectively. The controls had mean serum TNF-α 7.10±2.4 pg/mL, IL-4 25.49±2.6 pg/mL, and IL-5 88.76±22.7 pg/mL. The difference in the concentration of sera cytokines was statistically significant for IL-4 and IL-5 (Plumbricoides-infected children and controls. The intensity of infection correlated positively with IL-4 and IL-5 at r=0.959 and r=0.919, respectively. The concentrations of IL-4 and IL-5 correlated positively with the age at r=0.845 and r=0.934, respectively. Asthma and gastrointestinal tract upsets were correlated positively with IL-4 and IL-5. These data indicate that A. lumbricoides infection in our locality is associated with significantly high levels of IL-4 and IL-5. PMID:27022269

  2. Intensity of reinfection with Ascaris lumbricoides and its implications for parasite control. (United States)

    Hall, A; Anwar, K S; Tomkins, A M


    Intestinal helminths are among the most common and widespread of human infections. Because it is typical to find that most worms are aggregated in a few potential hosts it has been suggested that some individuals are predisposed to heavy infections and that morbidity could be controlled by the treatment of heavily infected individuals only. We have studied the prevalence and intensity of reinfection with the intestinal nematode Ascaris lumbricoides among people living in Dhaka, Bangladesh. 880 people were treated with pyrantel pamoate three times at six month intervals, and on each occasion they collected all their stools for 48 h after treatment. Worms expelled by each subject were counted and weighed. The prevalence of infection at round 1 of treatment was 89% and the mean burden was 18.5 worms. Reinfection was rapid and at rounds 2 and 3 the prevalence was 82% and 80%, respectively, with mean burdens of 14.0 and 11.5 worms. The intensity of reinfection was not random: more subjects than expected became heavily reinfected (greater than or equal to 15 worms) and more subjects than expected remained lightly infected (less than or equal to 14 worms) (p less than 0.001). Worms were highly aggregated at each round of treatment but although just over 10% of all subjects were heavily infected at each and every round of treatment, over 60% of all subjects were heavily infected at least once. The findings show that some individuals seem to be susceptible to heavy infection whereas others are not, that deworming has a greater effect on the intensity of infection than on the prevalence, and that mass chemotherapy is likely to be a more effective means to control morbidity than is selective treatment of heavily infected individuals only. PMID:1349668

  3. Individual predisposition, household clustering and risk factors for human infection with Ascaris lumbricoides: new epidemiological insights.

    Directory of Open Access Journals (Sweden)

    Martin Walker

    Full Text Available BACKGROUND: Much of our current understanding of the epidemiology of Ascaris lumbricoides infections in humans has been acquired by analyzing worm count data. These data are collected by treating infected individuals with anthelmintics so that worms are expelled intact from the gastrointestinal tract. Analysis of such data established that individuals are predisposed to infection with few or many worms and members of the same household tend to harbor similar numbers of worms. These effects, known respectively as individual predisposition and household clustering, are considered characteristic of the epidemiology of ascariasis. The mechanisms behind these phenomena, however, remain unclear. In particular, the impact of heterogeneous individual exposures to infectious stages has not been thoroughly explored. METHODOLOGY/PRINCIPAL FINDINGS: Bayesian methods were used to fit a three-level hierarchical statistical model to A. lumbricoides worm counts derived from a three-round chemo-expulsion study carried out in Dhaka, Bangladesh. The effects of individual predisposition, household clustering and household covariates of the numbers of worms per host (worm burden were considered simultaneously. Individual predisposition was found to be of limited epidemiological significance once household clustering had been accounted for. The degree of intra-household variability among worm burdens was found to be reduced by approximately 58% when household covariates were included in the model. Covariates relating to decreased affluence and quality of housing construction were associated with a statistically significant increase in worm burden. CONCLUSIONS/SIGNIFICANCE: Heterogeneities in the exposure of individuals to infectious eggs have an important role in the epidemiology of A. lumbricoides infection. The household covariates identified as being associated with worm burden provide valuable insights into the source of these heterogeneities although above all

  4. Atividade de detergentes e desinfetantes sobre a evolução dos ovos de Ascaris lumbricoides


    Massara Cristiano Lara; Ferreira Rafaela Salgado; Andrade Luiz Dias de; Guerra Henrique Leonardo; Carvalho Omar dos Santos


    A infecção por Ascaris lumbricoides decorre da ingestão de ovos embrionados deste parasita, o que justifica a pesquisa de substâncias que tenham efeito deletério sobre estes ovos. Nosso objetivo foi estudar a ação de 16 produtos detergentes e desinfetantes, de uso doméstico e laboratorial, sobre a embriogênese deste helminto. Crianças portadoras desta infecção foram tratadas com levamisol e os vermes fêmeas expelidos foram recolhidos e dissecados, para obtenção dos ovos intra-uterinos. Os ovo...



    Lisawati Sutanto; Rizal Subahar


    Fecal contamination is a serious environmental problem at Angke River Jakarta. A cross-sectional study was conducted during April-June 2007 and the aim of the study is to assess the water quality of Angke River by detection of Ascaris lumbricoides eggs and the protozoan cysts. A total 24 L water of Angke River was collected from 8 sampling locations consisted of Kembangan/Duri Kosambi (upper reaches of river), Pesing Polgar (lower reaches of river), Teluk Gong (lower reaches of river), Pantai...

  6. ZAPA, (Z)-3-[(aminoiminomethyl)thio]-2-propenoic acid hydrochloride, a potent agonist at GABA-receptors on the Ascaris muscle cell.


    Holden-Dye, L.; Walker, R. J.


    This study is the first report of a compound which is equal in efficacy to gamma-aminobutyric acid (GABA) at the nematode Ascaris muscle GABA-receptor. The GABA-receptor at the Ascaris muscle cell which mediates a membrane hyperpolarization and muscle relaxation has eluded classification. The structure-activity profile of this receptor is not typical of GABAA or GABAB-receptors. Here we report that the isothiouronium compound ZAPA is as potent as GABA at this receptor. This finding has import...

  7. The strength of the antibody response to the nematode Ascaris lumbricoides inversely correlates with levels of B-Cell Activating Factor (BAFF)


    Bornacelly, Adriana; Mercado, Dilia; Acevedo, Nathalie; Caraballo, Luis


    Background B-Cell Activating Factor (BAFF) is a cytokine regulating antibody production. Polymorphisms in the gene encoding BAFF were associated with the antibody response to Ascaris but not to mite allergens. In the present study we evaluated the relationship between BAFF and specific antibodies against Ascaris and mites in 448 controls and 448 asthmatics. Soluble BAFF was measured by ELISA and BAFF mRNA by qPCR. Surface expression of BAFF and its receptor (BAFF-R) was analyzed by flow cytom...

  8. Estrategia de Ascaris lumbricoides y Trichuris trichiura para la contaminación del medio ambiente, en una zona endemica Strategy of Ascaris lumbricoides and Trichuris trichiura for the environment contamination in an endemic area

    Directory of Open Access Journals (Sweden)

    Gustavo Morales


    Full Text Available La distribución de frecuencias del número de huevos por gramo de heces tanto de Ascaris lumbricoides como de Trichuris trichiura en humanos infestados en una zona endémica se corresponde con una ley binomial negativa y la disposición espacial de dichos huevos en la materia fecal, resultó ser en agregados, independientemente de que los hospedadores sean mayores o menores de 15 años. Estos resultados nos indican que solamente unos pocos hospedadores son los responsables de la mayor contaminación del medio ambiente y que esos individuos no pertenecen a ningún grupo etario en particular.The distribution of frequences of the number per grame of Ascaris lumbricoides and Trichuris trichiura in the faeces of naturally infected human in endemic areas, were found following a negative binomial distribution and an overdispersal pattern, independently of the ages of hosts. These results show, that only few hosts, independently of their ages, are involved in the higher environment contamination.

  9. Unexpected Variation in Neuroanatomy among Diverse Nematode Species (United States)

    Han, Ziduan; Boas, Stephanie; Schroeder, Nathan E.


    Nematodes are considered excellent models for understanding fundamental aspects of neuron function. However, nematodes are less frequently used as models for examining the evolution of nervous systems. While the habitats and behaviors of nematodes are diverse, the neuroanatomy of nematodes is often considered highly conserved. A small number of nematode species greatly influences our understanding of nematode neurobiology. The free-living species Caenorhabditis elegans and, to a lesser extent, the mammalian gastrointestinal parasite Ascaris suum are, historically, the primary sources of knowledge regarding nematode neurobiology. Despite differences in size and habitat, C. elegans and A. suum share a surprisingly similar neuroanatomy. Here, we examined species across several clades in the phylum Nematoda and show that there is a surprising degree of neuroanatomical variation both within and among nematode clades when compared to C. elegans and Ascaris. We found variation in the numbers of neurons in the ventral nerve cord and dye-filling pattern of sensory neurons. For example, we found that Pristionchus pacificus, a bacterial feeding species used for comparative developmental research had 20% fewer ventral cord neurons compared to C. elegans. Steinernema carpocapsae, an insect-parasitic nematode capable of jumping behavior, had 40% more ventral cord neurons than C. elegans. Interestingly, the non-jumping congeneric nematode, S. glaseri showed an identical number of ventral cord neurons as S. carpocapsae. There was also variability in the timing of neurodevelopment of the ventral cord with two of five species that hatch as second-stage juveniles showing delayed neurodevelopment. We also found unexpected variation in the dye-filling of sensory neurons among examined species. Again, sensory neuron dye-filling pattern did not strictly correlate with phylogeny. Our results demonstrate that variation in nematode neuroanatomy is more prevalent than previously assumed and

  10. Unexpected Variation in Neuroanatomy among Diverse Nematode Species. (United States)

    Han, Ziduan; Boas, Stephanie; Schroeder, Nathan E


    Nematodes are considered excellent models for understanding fundamental aspects of neuron function. However, nematodes are less frequently used as models for examining the evolution of nervous systems. While the habitats and behaviors of nematodes are diverse, the neuroanatomy of nematodes is often considered highly conserved. A small number of nematode species greatly influences our understanding of nematode neurobiology. The free-living species Caenorhabditis elegans and, to a lesser extent, the mammalian gastrointestinal parasite Ascaris suum are, historically, the primary sources of knowledge regarding nematode neurobiology. Despite differences in size and habitat, C. elegans and A. suum share a surprisingly similar neuroanatomy. Here, we examined species across several clades in the phylum Nematoda and show that there is a surprising degree of neuroanatomical variation both within and among nematode clades when compared to C. elegans and Ascaris. We found variation in the numbers of neurons in the ventral nerve cord and dye-filling pattern of sensory neurons. For example, we found that Pristionchus pacificus, a bacterial feeding species used for comparative developmental research had 20% fewer ventral cord neurons compared to C. elegans. Steinernema carpocapsae, an insect-parasitic nematode capable of jumping behavior, had 40% more ventral cord neurons than C. elegans. Interestingly, the non-jumping congeneric nematode, S. glaseri showed an identical number of ventral cord neurons as S. carpocapsae. There was also variability in the timing of neurodevelopment of the ventral cord with two of five species that hatch as second-stage juveniles showing delayed neurodevelopment. We also found unexpected variation in the dye-filling of sensory neurons among examined species. Again, sensory neuron dye-filling pattern did not strictly correlate with phylogeny. Our results demonstrate that variation in nematode neuroanatomy is more prevalent than previously assumed and

  11. Serum cytokines profiles in Nigerian children withAscaris lumbricoides infection

    Institute of Scientific and Technical Information of China (English)

    Irior Dominic Osagie; Abu Maliki


    Objective:To investigate the cytokines profile in the serum of some Nigerian children with Ascaris lumbricoides (A. lumbricoides) infection and relations between the intensity of infection, age and the concentration of these cytokines.Methods: Feacal samples from consenting children were examined using formol ether concentration techniques and Kato-Katz thick smear technique. Sera of 96 children comprising 76A. lumbricoides infection and 20 controls were subjected to enzymes-linked immunosorbent assay.Results: The mean sera concentration of tumor necrosis factor alpha (TNF-α), interleukin-4 (IL-4), interleukin-5 (IL-5), interleukin-10 (IL-10) were (16.7±7.6) pg/mL, (4.6±0.8)pg/mL, (391.6±52.0) pg/mL and (181.2±30.4) pg/mL, respectively. The control subjects had the following mean serum cytokines: TNF-α(2.9±1.8) pg/m, IL-4 (4.0±0.1) pg/mL, IL-5 (125.1±50.1) pg/mL, IL-10 (74.5±54.2) pg/mL, respectively. The difference between the sera cytokines concentration of theA. lumbricoides infected children and their controls were statistically significant for TNF-α, IL- 5 and IL-10(χ2= 9.99,P< 0.05;χ2 = 137.24,P < 0.05;χ2 = 44.30,P < 0.05, respectively). The intensity of infection correlated positively with TNF-α, and IL-5 (r = 0.93 and 0.98, respectively) while IL-4 and IL- 10 correlated negatively with the intensity of infection (r = -0.62 and 0.99, respectively). TNF-α, IL-4 and IL-5 correlated positively with age (r = 0.19, 0.33 and 0. 66, respectively). The mean cytokines between those with mild and moderate infections were statistically significant for TNF-α, IL-5 and IL-10 (χ2 = 3.60, 4.52 and 5.30, respectively). The ratio of TNF-α: IL-10 was 0.092.Conclusions: Elevated IL-5, IL-10 and TNF-α found in the sera of the volunteers with Ascariasis implicates these cytokines as key mediators in the host responses toA. lumbriocoides infection in our studied area.

  12. A comparison of the efficacy of single doses of albendazole, ivermectin, and diethylcarbamazine alone or in combinations against Ascaris and Trichuris spp.


    Belizario, V. Y.; Amarillo, M. E.; de Leon, W. U.; de los Reyes, A. E.; Bugayong, M. G.; Macatangay, B. J. C.


    OBJECTIVE: To determine the efficacy of single doses of albendazole, ivermectin and diethylcarbamazine, and of the combinations albendazole + ivermectin and albendazole + diethylcarbamazine against common intestinal helminthiases caused by Ascaris and Trichuris spp. METHODS: In a randomized, placebo-controlled trial, infected children were randomly assigned to treatment with albendazole + placebo, ivermectin + placebo, diethylcarbamazine + placebo, albendazole + ivermectin, or albendazole + d...

  13. The nematode Diplotridena henryi (Nematoda : Diplotriaenoidea) as the possible cause of subcutaneous emphysema and respiratory insufficiency in a great tit (Parus major)

    Czech Academy of Sciences Publication Activity Database

    Literák, I.; Baruš, Vlastimil; Hauptmanová, K.; Halouzka, R.


    Roč. 40, č. 1 (2003), s. 23-25. ISSN 0440-6605 Institutional research plan: CEZ:AV0Z6093917 Keywords : Parus major * Nematoda * respiratory insufficiency Subject RIV: EG - Zoology Impact factor: 0.474, year: 2003

  14. An annotated list of parasites (Isopoda, Copepoda, Monogenea, Digenea, Cestoda and Nematoda) collected in groupers (Serranidae, Epinephelinae) in New Caledonia emphasizes parasite biodiversity in coral reef fish

    Czech Academy of Sciences Publication Activity Database

    Justine, J.-L.; Beveridge, I.; Boxshall, G.A.; Bray, R. A.; Moravec, František; Trilles, J.-P.; Whittington, I.D.


    Roč. 57, č. 4 (2010), s. 237-262. ISSN 0015-5683 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Isopoda * Copepoda * Monogenea * Digenea * Cestoda * Nematoda * Serranidae * Epinephelinae * parasite biodiversity * coral reef * New Caledonia Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.533, year: 2010

  15. Evolutionary relationships of Spirurina (Nematoda: Chromadorea: Rhabditida) with special emphasis on dracunculoid nematodes inferred from SSU rRNA gene sequences

    Czech Academy of Sciences Publication Activity Database

    Wijová, Martina; Moravec, František; Horák, Aleš; Lukeš, Julius


    Roč. 36, č. 9 (2006), s. 1067-1075. ISSN 0020-7519 R&D Projects: GA ČR(CZ) GA524/06/0170 Institutional research plan: CEZ:AV0Z60220518 Keywords : Nematoda * Spirurina * SSU rRNA gene sequences Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 3.337, year: 2006

  16. A new species of Biacantha (Nematoda: Molineidae), a parasite of the common vampire bat from the Yungas, Argentina. (United States)

    Oviedo, Mirna C; Ramallo, Geraldine; Claps, Lucía E; Miotti, M Daniela


    A new species of Biacantha Wolfgang, 1954 (Nematoda: Molineidae), is described from the common vampire bat, Desmodus rotundus Geoffroy and St. Hilaire, 1810, from northwest Argentina. Biacantha normaliae n. sp. Oviedo, Ramallo, and Claps, is characterized by the disposition and number of ridges of the synlophe, the excretory pore located on a knob, 2 lateral processes on the tail of females, the male caudal bursa morphology, and lack of gubernaculum. This is the first species of nematode described in a vampire bat from Argentina. PMID:22924934

  17. A new species of Spauligodon (Nematoda; Oxyuroidea; Pharyngodonide) and other Helminths in Ptychozoon Kuhli (Squamata: Gekkonidae) from East Malaysia. (United States)

    Bursey, Charles R; Goldberg, Stephen R; Lee Grismer, L


    Spauligodon geckonis sp. nov. from the intestines of Ptychozoon kuhli (Gekkonidae) from East Malaysia is described and illustrated. Spauligodon geckonis sp. nov. represents the 52nd species assigned to the genus and the third species from the Oriental Region. The new species is separated from congeners by the unique combination of aspinose filamentous tail and spicule in the male and spinose filamentous tail and fusiform, two knobbed eggs in the female. Gravid individuals 3 species of Nematoda, Meteterakis singaporensis, Physalopteroides grismeri, and Skrjabinelazia machidai, as well as larvae assignable to the Ascaridae were also found. PMID:27078659

  18. Pseudascarophis brasiliensis sp. nov. (Nematoda: Cystidicolidae parasitic in the Bermuda chub Kyphosus sectatrix (Perciformes: Kyphosidae from southeastern Brazil

    Directory of Open Access Journals (Sweden)

    Felipe Bisaggio Pereira


    Full Text Available A new species of Pseudascarophis (Nematoda: Cystidicolidae found in the stomach of Kyphosus sectatrix (Linnaeus (Kyphosidae, off Rio de Janeiro, Brazil, is described. The new species can be differentiated from the other congeners by the presence of lateral alae, distinct but inconspicuous cephalic papillae at the anterior end, three pairs of precloacal and one pair of adcloacal papillae in males, egg morphology and morphometry of glandular oesophagus and spicules. Pseudascarophis tropica is transferred to Ascarophis as Ascarophis tropica (Solov'eva comb. n. due to its ambiguous diagnosis.

  19. 21 CFR 558.315 - Levamisole hydrochloride (equivalent). (United States)


    .... Treatment of the following gastrointestinal worms and lung worm infections; stomach worms (Haemonchus, Trichostrongylus, Ostertagia), intestinal worms (Trichostrongylus Cooperia, Nematodirus, Bunostomum.... Treatment of the following nematode infections: large roundworms (Ascaris suum), nodular...

  20. 21 CFR 520.1242f - Levamisole hydrochloride gel. (United States)


    ... effective against the following nematode infections: Stomach worms (Haemonchus, Trichostrongylus, Ostertagia), intestinal worms (Trichostrongylus, Cooperia, Nematodirus, Bunostomum, Oesophagostomum), and lungworms... with the following nematodes: Large roundworms (Ascaris suum), nodular worms (Oesophagostomum...

  1. First description of Onchocerca jakutensis (Nematoda: Filarioidea) in red deer (Cervus elaphus) in Switzerland. (United States)

    Bosch, Felix; Manzanell, Ralph; Mathis, Alexander


    Twenty-seven species of the genus Onchocerca (Nematoda; Filarioidea) can cause a vector-borne parasitic disease called onchocercosis. Most Onchocerca species infect wild and domestic ungulates or the dog, and one species causes river blindness in humans mainly in tropical Africa. The European red deer (Cervus e. elaphus) is host to four species, which are transmitted by blackflies (simuliids) or biting midges (ceratopogonids). Two species, Onchocerca flexuosa and Onchocerca jakutensis, produce subcutaneous nodules, whereas Onchocerca skrjabini and Onchocerca garmsi live free in the hypodermal serous membranes. During the hunting season, September 2013, red deer (n = 25), roe deer (Capreolus c. capreolus, n = 6) and chamois (Rupicapra r. rupicapra, n = 7), all shot in the Grisons Region (Switzerland) were investigated for the presence of subcutaneous nodules which were enzymatically digested, and the contained Onchocerca worms were identified to species by light and scanning electron microscopy as well as by PCR/sequencing. In addition, microfilariae from skin samples were collected and genetically characterized. Neither nodules nor microfilariae were discovered in the roe deer and chamois. Adult worms were found in 24% of red deer, and all of them were identified as O. jakutensis. Two morphologically different microfilariae were obtained from five red deer, and genetic analysis of a skin sample of one red deer indicated the presence of another Onchocerca species. This is the first report of O. jakutensis in Switzerland with a prevalence in red deer similar to that in neighbouring Germany. PMID:27617204

  2. Revision of Desmodorinae and Spiriniinae (Nematoda: Desmodoridae with redescription of eight known species

    Directory of Open Access Journals (Sweden)

    Maickel Armenteros


    Full Text Available The taxonomy of the family Desmodoridae (Nematoda: Desmodorida is partially revised based on morphology. The diagnoses of the Desmodoridae and the subfamilies Desmodorinae and Spiriniinae are emended to accommodate re-analyzed morphological features. Eight known species are redescribed and the implication of the new findings for the taxonomy of the group is discussed. Amphispira and Metadesmodora are confirmed as genera inquirendae. Alaimonema and Sigmophoranema, and their corresponding type species, are proposed as inquirendae due to poor descriptions of the type material. The other three species of Sigmophoranema are transferred to the genus Onyx because they bear the diagnostic features of this group: spear-like dorsal tooth and s-shape precloacal supplements. Echinodesmodora, Paradesmodora and Stygodesmodora are transferred to the Spiriniinae based on the absence of a head capsule and on the amphidial fovea being surrounded by cuticle striation. Paradesmodora toreutes is transferred to the genus Acanthopharyngoides as A. toreutes comb. nov. The genus Onepunema does not fit in the family Desmodoridae because of diorchic males; thus, it is regarded as taxon incertae sedis. Lists of valid genera for the two subfamilies are provided. A dichotomic key for the identification of the 14 genera within the Spiriinae is provided.

  3. Xiphinema bernardi n. sp. (Nematoda: Longidoridae) from the Great Smoky Mountain National Park. (United States)

    Robbins, R T; Bae, Chang-Hwan; Ye, Weimin; Pedram, Majid


    In October 1985 during a survey of fauna of the Great Smoky Mountains National Park, Ernest Bernard recovered a limited number of specimens of a non-described species of Xiphinema (Nematoda: Longidoridae) and sent them to the senior author. The species is distinct from other species by its large size and having Z-organs in the genital tract. During July 2006, Dr. Bernard's survey crew took samples in the area where the species was first found and was successful in finding it again. Without Dr. Bernard's efforts, this species could not have been described and thus the new species is named X. bernardi n. sp. in his honor. Several female and juvenile specimens of the new species were recovered in a sample from a mixed forest of maple, hemlock, and silverbell. It is distinct from all others in Xiphinema group 4 species (with Z-organs) by having a longer total stylet length, 259.8 to 284.2 μm vs code for X. bernardi n. sp. is A4-B1-C6-D56-E56-F(4)5-G4-H2-I34-J5-K?-L1. Molecular approaches using the internal transcribed spacer 1 sequences of nuclear ribosomal DNA suggested that X. bakeri and X. diversicaudatum are the most closely related species from the species examined. PMID:22661783

  4. Severity of atopic dermatitis and Ascaris lumbricoides infection: an evaluation of CCR4+ and CXCR3+ helper T cell frequency

    Directory of Open Access Journals (Sweden)

    Maria Teresa Nascimento Silva


    Full Text Available INTRODUCTION: Ascaris lumbricoides-infected patients present lower prevalence of severe atopic dermatitis. METHODS: Peripheral blood of infected children with atopic dermatitis was assessed by flow cytometry of the frequency of Th1 and Th2 cells through the expression of CXCR3 and CCR4 chemokine receptors, respectively. RESULTS: Helminth-free patients with atopic dermatitis presented a high frequency of CCR4+Th2 cells. Parasitized patients with atopic dermatitis showed a lower frequency of CXCR3+Th1 cells compared to infected individuals only. CONCLUSIONS: Ascariasis modifies the blood traffic of Th2 cells in atopic dermatitis patients, while the allergic disease down-regulates the traffic of Th1 cells in parasitized patients.

  5. Crystallization and preliminary crystallographic studies of a cysteine protease inhibitor from the human nematode parasite Ascaris lumbricoides

    International Nuclear Information System (INIS)

    A recombinant cysteine protease inhibitor from the human nematode parasite A. lumbricoides has been overexpressed in E. coli, purified and crystallized. Diffraction data were collected to 2.1 Å resolution. The cysteine protease inhibitor from Ascaris lumbricoides, a roundworm that lives in the human intestine, may be involved in the suppression of human immune responses. Here, the molecular cloning, protein expression and purification, preliminary crystallization and crystallographic characterization of the cysteine protease inhibitor from A. lumbricoides are reported. The rod-shaped crystal belonged to space group C2, with unit-cell parameters a = 99.40, b = 37.52, c = 62.92 Å, β = 118.26°. The crystal diffracted to 2.1 Å resolution and contained two molecules in the asymmetric unit

  6. Utilização da jejunostomia para extração endoscópica de Ascaris lumbricoides da via biliar principal em paciente com doença de Caroli Use of visiting jejunostomy loopfor extracting Ascaris lumbricoides in the common bile ducts in patients with Caroli diseases


    Leonardo Fernandes Valentim; Ary Pires de Souza; Edison Iglesias Vidal; José Geraldo Menezes; Patrícia Gomes Bittencourt Valentim


    Grumbach-Auvert disease represents a type of Obstructive Disease of the Intrahepatic Biliary Tree. We presents a case report of a patient with hepatic abscess caused by Ascaris which ascended into hepatic parenquima through hepaticojejunostomy, resolved by endoscopic extraction of it after the jejunostomy of permanent access was opened.

  7. Utilização da jejunostomia para extração endoscópica de Ascaris lumbricoides da via biliar principal em paciente com doença de Caroli Use of visiting jejunostomy loopfor extracting Ascaris lumbricoides in the common bile ducts in patients with Caroli diseases

    Directory of Open Access Journals (Sweden)

    Leonardo Fernandes Valentim


    Full Text Available Grumbach-Auvert disease represents a type of Obstructive Disease of the Intrahepatic Biliary Tree. We presents a case report of a patient with hepatic abscess caused by Ascaris which ascended into hepatic parenquima through hepaticojejunostomy, resolved by endoscopic extraction of it after the jejunostomy of permanent access was opened.

  8. Ascaris lumbricoides Infection Following School-Based Deworming in Western Kenya: Assessing the Role of Pupils' School and Home Water, Sanitation, and Hygiene Exposures


    Garn, JV; Mwandawiro, CS; Nikolay, B.; Drews-Botsch, CD; Kihara, JH; Brooker, SJ; Simiyu, EW; Okoyo, C; Freeman, MC


    Water, sanitation, and hygiene (WaSH) technologies and behaviors can prevent infection by soil-transmitted helminth species independently, but may also interact in complex ways. However, these interactions are poorly understood. The purpose of this study was to characterize how school and home WaSH exposures were associated with Ascaris lumbricoides infection and to identify relevant interactions between separate WaSH technologies and behaviors. A study was conducted among 4,404 children atte...

  9. 81 Dose Response Relationship Between Ascaris Sensitisation and Atopy and Bronchial Hyper-Responsiveness but not Allergic Diseases in Black South Africans


    Levin, Michael; Muloiwah, Rudzani; Le Souëf, Peter; Motalah, Cassim


    Background The relationship between sensitisation to helminths and atopy, bronchial-hyperresponsiveness and allergic diseases may differ depending on many factors, including the genes of the population studied. We sought to examine this relationship in an African cohort. Methods Urban Xhosa children were tested for ascaris IgE levels, bronchial hyper-responsiveness (BHR) by methacholine challenge, atopic sensitisation (skin tests to aeroallergens) and allergic disease (asthma, eczema and rhin...

  10. Ascaris lumbricoides Infection and Its Relation to Environmental Factors in the Mbeya Region of Tanzania, a Cross-Sectional, Population-Based Study


    Steffen Andreas Schüle; Petra Clowes; Inge Kroidl; Kowuor, Dickens O.; Anthony Nsojo; Chacha Mangu; Helene Riess; Christof Geldmacher; Rüdiger Paul Laubender; Seif Mhina; Leonard Maboko; Thomas Löscher; Michael Hoelscher; Elmar Saathoff


    BACKGROUND: With one quarter of the world population infected, the intestinal nematode Ascaris lumbricoides is one of the most common infectious agents, especially in the tropics and sub-tropics. Infection is caused by oral intake of eggs and can cause respiratory and gastrointestinal problems. To identify high risk areas for intervention, it is necessary to understand the effects of climatic, environmental and socio-demographic conditions on A. lumbricoides infection. METHODOLOGY: Cross-sect...

  11. Perbedaan Kadar Interferon Gamma dan Interleukin-10 pada Orang Dewasa Terinfeksi Ascaris Lumbricoides dengan Tidak Terinfeksi yang Diinduksi Vaksin Bacille Calmette-Guerin


    Weni Mulyani; Nuzulia Irawati; Netti Suharti


    AbstrakKecacingan merupakan penyakit yang masih banyak di negara berkembang. Penyakit ini dapat menimbulkan gangguan gizi, pertumbuhan dan penurunan produktifitas kerja. Infeksi cacing dapat menimbulkan penurunan respon terhadap antigen sebagai akibat modified Th2 response. Vaksin BCG merupakan antigen yang dikenal sebagai penginduksi respon sel Th1. Tujuan penelitian ini adalah menentukan perbedaan kadar IFN-γ dan IL-10 antara orang dewasa terinfeksi Ascaris lumbricoides dan tidak terinfeksi...

  12. Perbedaan Kadar Interferon Gamma dan Interleukin-10 pada Orang Dewasa Terinfeksi Ascaris Lumbricoides dengan Tidak Terinfeksi yang Diinduksi Vaksin Bacille Calmette-Guerin


    weni Mulyani; Nuzulia Irawati; Netti Suharti


    Abstrak Kecacingan merupakan penyakit yang masih banyak di negara berkembang. Infeksi cacing dapat menimbulkan penurunan respon terhadap antigen yang terjadi akibat modified Th2 response. Vaksin BCG merupakan antigen yang dikenal sebagai penginduksi respon sel Th1. Tujuan penelitian ini adalah untuk mengetahui perbedaan kadar IFN-γdan IL-10 pada orang dewasa terinfeksi Ascaris lumbricoides dengan tidak terinfeksi yang diinduksi vaksi BCG.Penelitian dilakukan di Kelurahan Muara Fajar Kecamatan...

  13. Hubungan Infeksi Cacing Ascaris Lumbricoides Dengan Indeks Massa Tubuh Pada Siswa Perempuan SD Salsabila Kecamatan Medan Marelan Kota Medan Tahun 2014


    Simbolon, Christiani


    Cacing gelang (Ascaris lumbricoides) merupakan salah satu penyebab infeksi dengan prevalensi mencapai 60-90% di Indonesia. Cacing ini dapat mengambil sumber karbohidrat dan protein di usus sebelum diserap tubuh. Infeksi cacing banyak diderita anak sekolah dasar, yaitu sekitar 40-60%. Metode yang digunakan untuk penelitian ini adalah observasional analitik dengan studi cross-sectional. Sampel diambil dengan metode consecutive sampling pada siswa perempuan kelas I sampai kelas VI SD Salsabil...

  14. Follow-up of Ascaris lumbricoides and Trichuris trichiura infections in children living in a community treated with ivermectin at 3-monthly intervals


    Ranque, S.; Chippaux, Jean-Philippe; Garcia, A.; Boussinesq, Michel


    Ivermectin treatment was administered every 3 months over a 1-year period (April 1993-April 1994) to the whole eligible population of a village in South Cameroon where both #Ascaris lumbricoides$ and #Trichuris trichiura$ were hyper-endemic. A parasitological stool examination was performed before each treatment. Thirty children, aged 5-15 years, were not only found egg-positive for #A. lumbricoides$ and/or #T. trichiura$ before the first treatment but were also each treated and examined in e...

  15. Atividade de detergentes e desinfetantes sobre a evolução dos ovos de Ascaris lumbricoides Effects of detergents and disinfectants on the development of Ascaris lumbricoides eggs

    Directory of Open Access Journals (Sweden)

    Cristiano Lara Massara


    Full Text Available A infecção por Ascaris lumbricoides decorre da ingestão de ovos embrionados deste parasita, o que justifica a pesquisa de substâncias que tenham efeito deletério sobre estes ovos. Nosso objetivo foi estudar a ação de 16 produtos detergentes e desinfetantes, de uso doméstico e laboratorial, sobre a embriogênese deste helminto. Crianças portadoras desta infecção foram tratadas com levamisol e os vermes fêmeas expelidos foram recolhidos e dissecados, para obtenção dos ovos intra-uterinos. Os ovos foram postos em contato com os produtos em diversas diluições e tempos, lavados e incubados a 28ºC, por 20 dias, para teste da viabilidade e determinação da porcentagem de embrionamento. Apenas um produto inibiu completamente o embrionamento dos ovos, em todos os tempos e diluições testados. Cinco produtos inibiram o embrionamento dos ovos em mais de 50%, seis inibiram o embrionamento em menos de 50% e três não tiveram efeito sobre o embrionamento dos ovos. Por outro lado, com um produto observou-se aumento da porcentagem de embrionamento dos ovos em relação aos controles.Ascaris lumbricoides infection is acquired via ingestion of embryonated eggs of the parasite, thus justifying the search for ovicidal compounds. We studied the effect of 16 household and laboratory detergents and disinfectants on the embryogenesis of this helminth. Children carrying this infection were treated with levamisole. Eliminated female worms were collected and dissected to obtain eggs from the uteri. The eggs were placed in contact with various products at different dilutions and for various periods of time. After washing, eggs were incubated at 28ºC for 20 days, for viability tests and to determine the embryonation rate. Only one product completely inhibited the embryonation of eggs at every dilution and for every time period tested. Five products inhibited more than 50% of embryonation, while six inhibited less than 50%. Three products showed no

  16. Ascaridíase das vias urinárias: um caso de penetração de Ascaris lumbricoides através do rim

    Directory of Open Access Journals (Sweden)

    Mario Caymmi Gomes


    Full Text Available Uma criança de 2 anos com desnutrição grave e infestação intestinal maciça por Ascaris lumbricoides, apresentou como complicação, documentada em necrópsia, a migração de vermes adultos para a cavidade peritonial e penetração aberrante de dois parasitos através do rim esquerdo. Os Ascaris ficaram alojados no sistema pielo-ureteral, determinando grave infecção purulenta e obstrução ureteral. Esta complicação demonstra a capacidade agressiva de vermes erráticos na cavidade peritonial, com possibilidade de perfurar mesmo uma víscera sólida. São comentados os fatores que facilitaram a migração dos vermes por aqueles órgãos.The author reports an autopsy case of a two year old child with massive intestinal ascariasis and malnutrition, presenting the migration of two adult Ascaris lumbricoides through the left kidney into the pyelo-ureteral system. As a result she developed acute pyelonephritis and ureteral obstruction. Previously the worms left the intestine into the peritoneal cavity (lesser sac through a duodenal cleft. Factors contributing to the migration of the roundworms by those pathways are discussed.

  17. Phylogenetic relationships of some spirurine nematodes (Nematoda: Chromadorea: Rhabditida: Spirurina) parasitic in fishes inferred from SSU rRNA gene sequences

    Czech Academy of Sciences Publication Activity Database

    Černotíková, Eva; Horák, Aleš; Moravec, František


    Roč. 58, č. 2 (2011), s. 135-148. ISSN 0015-5683 R&D Projects: GA ČR(CZ) GA524/06/0170; GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Nematoda * Spirurina * SSU rRNA * phylogeny * taxonomy Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.812, year: 2011

  18. A preliminary survey of soil nematodes (Nematoda) in inverse gorges in the České Švýcarsko National Park (Czech Republic)

    Czech Academy of Sciences Publication Activity Database

    Háněl, Ladislav


    Roč. 74, - (2010), s. 39-48. ISSN 1211-376X. [Central European Workshop on Soil Zoology /10./. České Budějovice, 21.04.2009-24.04.2009] Grant ostatní: EEA Financial Mechanism(BE) CZ0048 Institutional research plan: CEZ:AV0Z60660521 Keywords : soil zoology * ecology * Nematoda Subject RIV: EH - Ecology, Behaviour

  19. A new genus and species of philometrid (Nematoda) from the subcutaneous tissue of the crevalle jack, Caranx hippos (Osteichthyes), from the southern Gulf of Mexico

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Montoya-Mendoza, J.; Salgado-Maldonado, G.


    Roč. 96, č. 6 (2008), s. 1346-1350. ISSN 0022-3395 R&D Projects: GA ČR(CZ) GA524/06/0170; GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Nematoda * Philometridae * Caranx * Caranginema * Gulf of Mexico Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.165, year: 2008

  20. Hlístice (Nematoda) u papoušků chovaných v České republice

    Czech Academy of Sciences Publication Activity Database

    Kajerová, V.; Baruš, Vlastimil; Literák, I.

    Košice : Univerzita veterinárskeho lekárstva v Košiciach, 2004 - (Kočišová, A.; Levkutová, M.), s. 185-188 ISBN 80-8077-007-7. [Infekčné a parazitárne choroby zvierat. Košice (SK), 09.09.2004-10.09.2004] Institutional research plan: CEZ:AV0Z6093917 Keywords : Nematoda * parrots Subject RIV: EG - Zoology

  1. [Spirocamallanus hilarii (Nematoda, Camallanidae) fresh water fishes parasite from the dam of Termas de Río Hondo, Santiago del Estero, Argentina]. (United States)

    Ramallo, G


    Spirocamallanus hilarii (Nematoda, Camallanidae) is cited parasitizing five fresh water fish species: Salminus maxillosus Leporinus obtusidens, Hoplias malabaricus malabaricus, Oligosarcus jenynsii and Pimelodus albicans, captured in Termas de Río Hondo pond, province of Santiago del Estero, Argentina. Morphologic and morphometric parasitological studies were done. The specimens described were drawned and photographed. In addition, the following parasitic infection indexes were calculated: Prevalence 26.5%, Mean 6.6 and Maximum Intensity 27. PMID:9640682

  2. Spatiotemporal analysis of population genetic structure in Geomonhystera disjuncta (Nematoda, Monhysteridae) reveals high levels of molecular diversity


    Derycke, S.; Backeljau, T.; Vlaeminck, C.; Vierstraete, A.; Vanfleteren, J.; Vincx, M.; T. Moens


    Species identification in the phylum Nematoda is complicated due to the paucity of easily obtainable diagnostic morphological features. Furthermore, the cosmopolitan distribution of several species despite low dispersal abilities makes cryptic diversity potentially substantial within this phylum. We conducted a population genetic survey in the marine nematode Geomonhystera disjuncta in Belgium and The Netherlands in two seasons. The mitochondrial cytochrome oxidase c subunit 1 (COI) gene was ...

  3. Hexamermis paranaense new species (Nematoda, Mermithidae: a parasite of Diloboderus abderus (Coleoptera, Scarabaeidae in Argentina Hexamermis paranaense sp. nov. (Nematoda, Mermithidae: parasito de Diloboderus abderus (Coleoptera, Scarabaeidae en Argentina

    Directory of Open Access Journals (Sweden)

    María Fernanda Achinelly


    Full Text Available A new species, Hexamermis paranaense n. sp. (Nematoda, Mermithidae, a parasite of larvae of Diloboderus abderus Sturm, 1826 (Coleoptera, Scarabaeidae is described and illustrated. This new species is characterized by amphids small, amphidial opening pocket-shaped, the anterior portion of the vagina muscularized and slightly protruding with a descending branch forming a loop before joining the uterus, and three rows of genital papillae: the ventrolateral divided in two rows with eight papillae in the outer row and with six papillae in the inner one; the ventral row with four pairs and one single preanal papillae, and with two pairs, a triplete, one pair, a single and one pair postanal papillae.Una nueva especie, Hexamermis paranaense sp. nov. (Nematoda, Mermithidae, parásito de larvas del gusano blanco, Diloboderus abderus Sturm, 1826 (Coleoptera, Scarabaeidae, se describe e ilustra. Esta nueva especie se caracteriza por poseer anfidos pequeños, con la apertura en forma de bolsillo, parte anterior de la vagina muscular, con una rama que desciende y forma un lazo antes de la conexión al útero, tres hileras de papilas genitales: la hilera de posición ventro-lateral dividida en dos hileras con ocho papilas en la hilera externa y con seis papilas en la interna; la hilera ventral con una papila, seguida de cuatro pares, todas en posición preanal y dos pares, interrumpidos por tres papilas, seguida de un par, una simple, y un par, todas de posición postanal.

  4. Atividade de detergentes e desinfetantes sobre a evolução dos ovos de Ascaris lumbricoides

    Directory of Open Access Journals (Sweden)

    Cristiano Lara Massara


    Full Text Available A infecção por Ascaris lumbricoides decorre da ingestão de ovos embrionados deste parasita, o que justifica a pesquisa de substâncias que tenham efeito deletério sobre estes ovos. Nosso objetivo foi estudar a ação de 16 produtos detergentes e desinfetantes, de uso doméstico e laboratorial, sobre a embriogênese deste helminto. Crianças portadoras desta infecção foram tratadas com levamisol e os vermes fêmeas expelidos foram recolhidos e dissecados, para obtenção dos ovos intra-uterinos. Os ovos foram postos em contato com os produtos em diversas diluições e tempos, lavados e incubados a 28ºC, por 20 dias, para teste da viabilidade e determinação da porcentagem de embrionamento. Apenas um produto inibiu completamente o embrionamento dos ovos, em todos os tempos e diluições testados. Cinco produtos inibiram o embrionamento dos ovos em mais de 50%, seis inibiram o embrionamento em menos de 50% e três não tiveram efeito sobre o embrionamento dos ovos. Por outro lado, com um produto observou-se aumento da porcentagem de embrionamento dos ovos em relação aos controles.

  5. Atividade de detergentes e desinfetantes sobre a evolução dos ovos de Ascaris lumbricoides

    Directory of Open Access Journals (Sweden)

    Massara Cristiano Lara


    Full Text Available A infecção por Ascaris lumbricoides decorre da ingestão de ovos embrionados deste parasita, o que justifica a pesquisa de substâncias que tenham efeito deletério sobre estes ovos. Nosso objetivo foi estudar a ação de 16 produtos detergentes e desinfetantes, de uso doméstico e laboratorial, sobre a embriogênese deste helminto. Crianças portadoras desta infecção foram tratadas com levamisol e os vermes fêmeas expelidos foram recolhidos e dissecados, para obtenção dos ovos intra-uterinos. Os ovos foram postos em contato com os produtos em diversas diluições e tempos, lavados e incubados a 28masculineC, por 20 dias, para teste da viabilidade e determinação da porcentagem de embrionamento. Apenas um produto inibiu completamente o embrionamento dos ovos, em todos os tempos e diluições testados. Cinco produtos inibiram o embrionamento dos ovos em mais de 50%, seis inibiram o embrionamento em menos de 50% e três não tiveram efeito sobre o embrionamento dos ovos. Por outro lado, com um produto observou-se aumento da porcentagem de embrionamento dos ovos em relação aos controles.

  6. Infection by Ascaris lumbricoides and bronchial hyper reactivity: an outstanding association in Venezuelan school children from endemic areas. (United States)

    Hagel, I; Cabrera, M; Hurtado, M A; Sanchez, P; Puccio, F; Di Prisco, M C; Palenque, M


    Asthma and other respiratory diseases have increased in the last years among Venezuelan children from helminthic endemic areas where the infection by Ascaris lumbricoides has been associated to bronchial airway inflammation in parasitized individuals. The aim of this work was to investigate the possible associations between the development of bronchial hyper reactivity and the immune response against A. lumbricoides in urban and rural children. We evaluated 470 school children from rural and urban communities. Pulmonary function tests were performed and >or=20% PC(20) changes were considered as a positive diagnostic of bronchial hyper reactivity. The prevalence and intensity of A. lumbricoides infection was determined by faecal examination. Specific serum IgE levels using a modified ELISA and skin prick tests against A. lumbricoides and the common allergen Dermatophagoides pteronyssinus were done. The number of circulating lymphocyte sub populations was determined by flow cytometry analysis. In rural children, bronchial hyper reactivity was associated with increased specific levels of anti-A. lumbricoides IgE (pallergen (p=0.003) and to an increase in the number of CD3+CD8+ (presponse against A. lumbricoides infection may be involved in the development of bronchial hyper reactivity among rural children from endemic areas and also that improved hygienic conditions in the urban environment is associated with increased responses to airborne allergens. PMID:17698018

  7. Effect of electron beam irradiation on bacterial and Ascaris ova loads and volatile organic compounds in municipal sewage sludge (United States)

    Engohang-Ndong, Jean; Uribe, R. M.; Gregory, Roger; Gangoda, Mahinda; Nickelsen, Mike G.; Loar, Philip


    Wastewater treatment plants produce large amounts of biosolids that can be utilized for land applications. However, prior to their use, these biosolids must be treated to eliminate risks of infections and to reduce upsetting odors. In this study, microbiological and chemical analyzes were performed before and after treatment of sewage sludge with 3 MeV of an electron beam accelerator in a pilot processing plant. Thus, we determined that dose 4.5 kGy was required to reduce fecal coliform counts to safe levels for land applications of sludge while, 14.5 kGy was necessary to decrease Ascaris ova counts to safe levels. Furthermore, at low doses, electron beam irradiation showed little effect on the concentrations of volatile organic compounds, while some increase were recorded at high doses. The concentration of dimethyl sulfide was reduced by 50-70% at irradiation doses of 25.7 kGy and 30.7 kGy respectively. By contrast, electron beam irradiation increased dimethyl disulfide concentrations. We also showed that electron beam treatment was less energy-consuming with shorter processing times than conventional techniques used to decontaminate sludge. Hence opening new avenues for large urban agglomerations to save money and time when treating biosolids for land application.

  8. New species of Oswaldofilaria (Nematoda; Filarioidea; Onchocercidae) and other helminths in Acanthosaura cardamomensis (Sauria; Agamidae) from Indochina Peninsula. (United States)

    Bursey, Charles R; Goldberg, Stephen R; Grismer, Lee L


    Oswaldofilaria acanthosauri sp. nov. from the body cavity of the Cardamom Mountain horned agamid, Acanthosaura cardamomensis (Sauria: Agamidae), collected in Pursat Province, Cambodia is described. Of the 14 species assigned to Oswaldofilaria, O. acanthosauri sp. nov. is most similar to those species with spicular ratio of less than 2, namely, O. brevicaudata and O. chlamydosauri. Oswaldofilaria acanthosauri sp. nov. is easily separated from these 2 species in that O. brevicaudata is a South American species and in O. chlamydosauri the distal ends of the spicules are pointed not blunt. Mature individuals of 2 additional species of Nematoda, Meteterakis singaporensis and Orneoascaris sandoshami, as well as larvae assignable to Ascariidae were found. Acanthosaura cardamomensis represents a new host record for Meteterakis singaporensis, Orneoascaris sandoshami and Ascariidae (larvae). PMID:26204027

  9. Further description of Aspidodera raillieti (Nematoda: Aspidoderidae) from Didelphis marsupialis (Mammalia: Didelphidae) by light and scanning electron microscopy. (United States)

    Chagas-Moutinho, V A; Oliveira-Menezes, A; Cárdenas, M Q; Lanfredi, R M


    Nematodes of the family Aspidoderidae (Nematoda: Heterakoidea) Freitas 1956 are widely distributed from Americas. The species of the genus Aspidodera Railliet and Henry 1912 are parasites of mammals of the orders Edentata, Marsupialia, and Rodentia. In the present work, Aspidodera raillieti (L. Travassos, Mem Inst Oswaldo Cruz 5(3):271-318, 1913), collected from the large intestine of Didelphis marsupialis (Mammalia: Didelphidae) from Valle del Cauca, Colombia, is redescribed. The association of light and scanning electron microscopy (SEM) allowed a detailed analysis of the morphology and ultrastructure of this nematode. Some taxonomic features, such as cephalic region, topography of the cuticle, sucker, spicules, posterior end of males, localization of vulva, the anus, and posterior end of females were observed. Important structures such as amphid, details of cephalic region, phasmid, and number and localization of caudal papillae are documented by SEM, for the first time adding characters to identify this species. Colombia is a new geographical record for A. raillieti. PMID:17622560

  10. Syphacia (Syphacia) maxomyos sp. n. (Nematoda: Oxyuridae) from Maxomys spp. (Rodentia: Muridae) from Sulawesi and Sumatra, Indonesia. (United States)

    Dewi, Kartika; Hasegawa, Hideo; Fitriana, Yuli Sulistya; Asakawa, Mitsuhiko


    The present report describes Syphacia (Syphacia) maxomyos sp. n. (Nematoda: Oxyuridae) from two species of spiny rats, Maxomys musschenbroekii from Sulawesi and M. whiteheadi from Sumatra. It is characterized by a cephalic plate extending laterally with dorsoventral constriction and stumpy eggs with an operculum rim reaching pole. It is readily distinguishable by the former feature from all of hitherto known representatives of this genus in Indonesia, but it resembles parasites in Murini and Hydromyni rodents in continental Asia and Sahul. This is the first Syphacia species distributed in both the Sunda Shelf and Sulawesi with the exception of Syphacia muris, a cosmopolitan pinworm found in rodents of the of genus Rattus. It is surmised that S. maxomyos is specific to Maxomys and that it was introduced to Sulawesi by dispersal of some Maxomys from the Sunda Shelf. PMID:26062434

  11. Morphological variation of the corona radiata in Oesophagostomum dentatum, O-quadrispinulatum, and O-radiatum (Nematoda: Strongyloidea)

    DEFF Research Database (Denmark)

    Neuhaus, B.; Bresciani, J.; Christensen, C.M.;


    The anterior end of 76 adult and of several juvenile Oesaphagostomum dentatum, of 75 adult O. quadrispinulatum, and of 70 adult O. radiatum (Strongylida, Nematoda) was investigated by scanning electron and light microscopy. Both an external and an internal ring of buccal leaves (corona radiata...... externa and interna) are present in O. dentatum and O. quadrispinulatum, whereas a single ring of buccal leaves occurs in O. radiatum. Remnants of external buccal leaves indicate that the single ring of leaves found in the latter species is homologous to the corona radiata interna of O. dentatum and O....... quadrispinulatum. The number of buccal leaves of the corona radiata varies remarkably in adults of all 3 species. There are 9-12 external leaves in O. dentatum, 9-11 external leaves in O. quadrispinulatum, and 30-40 internal leaves in O. radiatum. Nine leaves are most common in both O. dentatum and O...

  12. In vitro larvicidal activity of geraniol and citronellal against Contracaecum sp (Nematoda: Anisakidae

    Directory of Open Access Journals (Sweden)

    L.A. Barros


    Full Text Available Human infection with fish parasites can result from the ingestion of incompletely cooked or raw fish, giving origin to parasitic diseases such as anisakiasis, caused by parasites of the Anisakidae family. The present study assessed the in vitro larvicidal effect of two monoterpene compounds, geraniol and citronellal, against Contracaecum sp (Nematoda: Anisakidae. Four hundred live larvae of Contracaecum sp obtained from "traíra" fish (Hoplias malabaricus, Bloch, 1974 were analyzed on 40 Petri dishes (10 larvae each with the compounds to be tested. The final concentrations tested for each compound were 250, 125, 62.5, and 31.2 µg/mL and the evaluation was carried out at five different times (2, 4, 8, 24, and 48 h. The larvicidal action of geraniol and citronellal was statistically superior (P < 0.005 to the control (1% ethanol at concentrations of 250 and 31.2 µg/mL (geraniol and 250, 125, and 62.5 μg/mL (citronellal. However, no larvicidal activity was observed at concentrations of 125 and 62.5 µg/mL for geraniol and 31.2 µg/mL for citronellal. When the larvicidal action of geraniol was compared to that of citronellal, the former was found to be statistically superior (P < 0.05 to the latter at concentrations of 250 and 31.2 μg/mL. On the other hand, citronellal was statistically superior (P < 0.005 to geraniol at concentrations of 125 and 62.5 μg/mL. The larval mortality rate in terms of time (hours was higher for geraniol with the passing of time at the 250 μg/mL concentration. At this concentration (in 48 h the best larvicidal effect was observed with 90% lethality. The larvae were considered to be dead using no motility and loss of structural integrity as parameters. The data indicate that natural terpene compounds should be more explored for antihelminthic activity and can be useful for other studies about anisakiasis treatment.

  13. [Anti-tumor effect of the whole worm extract of Ascaris lumbricoides on Lewis lung carcinoma in mice]. (United States)

    Yang, Xiao-Jun; Yang, Jun-Ping; Huang, Yan-Qin; Liang, Hua; Yuan, Keng


    Forty-five C57BL/6 mice were randomly divided into five groups (A-E). Group B and D served as the control group of A and C. Each mouse of group A was intraperitoneally injected with 0.1 ml whole worm extract of Ascaris lumbricoides every other day, and 10 days later injected with 0.1 ml Lewis lung carcinoma (LLC) cells at right axillary subcutaneously region. Mice of group B were injected with normal saline and then developed tumor model. Each mouse of group C was injected with 0.1 ml LLC cells, and two days later, injected with 0.1 ml whole worm extract of A. lumbricoides every other day for 5 times. After the tumor model developed, mice in group D were injected with normal saline. Group E was the negative control group. Time intervals between implantation and active growth and tumor weight were recorded. Tumor inhibition rate was calculated. The average time interval between tumor implantation and measurable tumor growth for groups A, B, C and D was (7.0 +/-1.1), (6.0 +/- 0.7), (9.0 +/- 1.2) and (7.0 +/- 0.9) days. Tumor weight of [(338.9 +/- 282.2) mg] (P inhibition rate group A [(722.2 +/- 413.5) mg] was heavier than that of group B was the highest in group C (33.3%). Tumor weight of group C [(237.8 +/- 101.8) mg] was lighter than that of group D [(356.7 +/- 176.9) mg] (P < 0.05). The results indicated that the tumor formation is affected by the whole worm extract of A. lumbricoides which may have an inhibitory effect on tumour growth. PMID:24818416

  14. Effect of electron beam irradiation on bacterial and Ascaris ova loads and volatile organic compounds in municipal sewage sludge

    International Nuclear Information System (INIS)

    Wastewater treatment plants produce large amounts of biosolids that can be utilized for land applications. However, prior to their use, these biosolids must be treated to eliminate risks of infections and to reduce upsetting odors. In this study, microbiological and chemical analyzes were performed before and after treatment of sewage sludge with 3 MeV of an electron beam accelerator in a pilot processing plant. Thus, we determined that dose 4.5 kGy was required to reduce fecal coliform counts to safe levels for land applications of sludge while, 14.5 kGy was necessary to decrease Ascaris ova counts to safe levels. Furthermore, at low doses, electron beam irradiation showed little effect on the concentrations of volatile organic compounds, while some increase were recorded at high doses. The concentration of dimethyl sulfide was reduced by 50–70% at irradiation doses of 25.7 kGy and 30.7 kGy respectively. By contrast, electron beam irradiation increased dimethyl disulfide concentrations. We also showed that electron beam treatment was less energy-consuming with shorter processing times than conventional techniques used to decontaminate sludge. Hence opening new avenues for large urban agglomerations to save money and time when treating biosolids for land application. - Highlights: • Use of electron beam irradiation for the treatment of municipal sewage sludge. • Irradiation at 4.5 kGy is required to eliminate risks of bacterial infection. • Irradiation at 14.5 kGy is required to eliminate risks of helminth infection. • Electron beam technology is not effective for controlling volatile organic compounds. • Electron beam treatment of sludge is less expensive than traditional techniques


    Directory of Open Access Journals (Sweden)



    Full Text Available Infestation of soil and night-soil with the eggs or larvae of soil-transmitted helminthes is very important factor in the transmission of these infections. The effect of various temperatures and different chemicals on the development of larva inside the eggs of Ascaris, which is the most resistant eggs or larvae of helminthes, or destruction of developed larvae inside the eggs has been evaluated by infecting white mice or by direct observations. In eggs with developed larva, temperature of 600C for one hour kills all larvae while in lower temperature, 40% or more larvae are still alive. In a temperature of 600C for 15 and 20 minutes no larvae is found in the liver of mice. Of levamisole, thiabendazole, mebendazole, sodium-nitrite and calcium superphophate, thiabendazole and mebendazole have higher effect in destruction of eggs. In eggs with undeveloped larva, it was shown that in a temperature of 600C for 15 minutes or more, development of larva does not take place, while in lower temperature development of larva in some eggs takes place. In a temperature of 700C for 10 minutes no development of larva has been observed. Evaluation of the effect of levamisole, thiabendazole, mebendazole, urea, iodine and potassium dichromate has shown that mebendazole with a concentration of 1/100,000 or more inhibit the development of larvae. Other chemicals have some effects on the development of larvae. Results of previous investigations have shown that although many chemicals are effective in the laboratory conditions, they are not very effective when used in the field. Therefore, more studies on this subject in the field are necessary, in order to find application of this control method.

  16. Trickle or clumped infection process? A stochastic model for the infection process of the parasitic roundworm of humans, Ascaris lumbricoides. (United States)

    Walker, Martin; Hall, Andrew; Basáñez, María-Gloria


    The importance of the mode of acquisition of infectious stages of directly-transmitted parasitic helminths has been acknowledged in population dynamics models; hosts may acquire eggs/larvae singly in a "trickle" type manner or in "clumps". Such models have shown that the mode of acquisition influences the distribution and dynamics of parasite loads, the stability of host-parasite systems and the rate of emergence of anthelmintic resistance, yet very few field studies have allowed these questions to be explored with empirical data. We have analysed individual worm weight data for the parasitic roundworm of humans, Ascaris lumbricoides, collected from a three-round chemo-expulsion study in Dhaka, Bangladesh, with the aim of discerning whether a trickle or a clumped infection process predominates. We found that hosts tend to harbour female worms of a similar weight, indicative of a clumped infection process, but acknowledged that unmeasured host heterogeneities (random effects) could not be completely excluded as a cause. Here, we complement our previous statistical analyses using a stochastic infection model to simulate sizes of individual A. lumbricoides infecting a population of humans. We use the intraclass correlation coefficient (ICC) as a quantitative measure of similarity among simulated worm sizes and explore the behaviour of this statistic under assumptions corresponding to trickle or clumped infections and unmeasured host heterogeneities. We confirm that both mechanisms are capable of generating aggregates of similar-sized worms, but that the particular pattern of ICCs described pre- and post-anthelmintic treatment in the data is more consistent with aggregation generated by clumped infections than by host heterogeneities alone. This provides support to the notion that worms may be acquired in clumps. We discuss our results in terms of the population biology of A. lumbricoides and highlight the significance of our modelling approach for the study of the

  17. Prevalência e intensidade de infecção por Ascaris lumbricoides em amostra populacional urbana (São Paulo, SP)


    Cláudio Santos Ferreira; Marcelo Urbano Ferreira; Marcos Roberto Nogueira


    Pesquisaram-se ovos de Ascaris lumbricoides em amostras fecais de 407 moradores (8,87% do total) de uma favela da cidade de São Paulo. Realizaram-se exames qualitativos (sedimentação por gravidade) e quantitativos (técnica de Kato & Miura adaptada a contagens). Discutem-se aspectos diferenciais da epidemiologia da ascaríase em áreas urbanas e rurais, com base em dados deste estudo e da literatura. Salienta-se a importância, em epidemiologia, da quantificação de exames de fezes.Prevalence and ...

  18. Improved determination of macroscopic parasite preparations using S10 modified plastination procedure

    Directory of Open Access Journals (Sweden)

    Elena Atanaskova


    Full Text Available Macroscopic preparations of parasites fixed in formaldehyde or alcohol don’t fulfill in complete the requests for education, as well as their determination, mainly because of the toxic fumes and not enough visible structure of fixed parasite. Using the modified С10 plastination method, parasites from three different phylum were prepared: Plathelminthes: Class Cestoda (Dipilidum caninum, Moniezia spp and larvae from T.Echinococcus granulosus - Echinococcus unilocularis, larvae from T. pisiformis - Cysticercus pisiformis, , larvae from T. hidatigena - Cysticercus tenuicollis, Phylum Nemathelminthes, Class Nematoda, (Ascaris suum, Macracanthorhynchus hirudinaceus, Diro filaria immitis, Phylum Arthropoda, Class Arachnida (tick from the Ixodidae family and Class Insecta (Gasterophilus intestinalis, Hypoderma bovis. The aim of this study was conserving the parasites in native condition with plastination method and improved determination according to their visible morphologic structure. Parasites were previously kept in 10% formaldehyde. Prepared parasites were dry, chemical free, not toxic and safe for the environment, flexible and with detained form and structure. There was a variation in the natural colors in some of the parasites, as a result from long-time formalin fixation. Preparations made with this method are permanent educative material which enables improved study of parasite’s structure.

  19. Distribution of trophic groups of soil nematodes (Nematoda) and soil food web condition in inverse gorges in the České Švýcarsko National Park (Czech Republic)

    Czech Academy of Sciences Publication Activity Database

    Háněl, Ladislav


    Roč. 77, č. 2 (2013), s. 87-101. ISSN 1211-376X Grant ostatní: EEA Financial Mechanism(NO) CZ0048 Institutional research plan: CEZ:AV0Z60660521 Institutional support: RVO:60077344 Keywords : soil zoology * ecology * Nematoda * trophic group * Bohemian Switzerland National Park Subject RIV: EH - Ecology, Behaviour

  20. Stenurus globicephalae Baylis et Daubney, 1925 (Nematoda: Pseudaliidae) from a False Killer Whale, Pseudorca crassidens (Cetacea: Delphinidae), Stranded on the Coast of Uruguay


    María Inés Zylber; Gabriela Failla; Alfredo Le Bas


    Stenurus globicephalae Baylis et Daubney, 1925 (Nematoda: Pseudaliidae) was found in the cranial air sinuses of a false killer whale, Pseudorca crassidens (Owen), stranded on the coast of Uruguay in 1999. Although this species has been reported once in P. crassidens from the North Atlantic, this is the first record for South America. A total of 920 specimens were obtained, of which 663 were females (body length: 4.34 ± 0.45 cm) and 257 were males (2.99 ± 0.18 cm). Morphometric details are pre...

  1. New evidence on a cold case: trophic transmission, distribution and host-specificity in Hedruris spinigera (Nematoda: Hedruridae). (United States)

    Luque, José L; Vieira, Fabiano M; Herrmann, Kristin; King, Tania M; Poulin, Robert; Lagrue, Clément


    The life cycle of Hedruris spinigera Baylis, 1931 (Nematoda: Hedruridae) is determined here with the first formal identification of the parasite's intermediate host: the crustacean amphipod Paracorophium excavatum Thomson. Adult H. spinigera are redescribed from specimens collected from the stomach of fishes, Retropinna retropinna (Richardson) and Aldrichettaforsteri (Valenciennes), from Lake Waihola, New Zealand. Immature adults of the parasite collected from intermediate hosts (P. excavatum) are also described for the first time. The prevalence, abundance and intensity of infection of H. spinigera in several fish species are quantified along with the occurrence of P. excavatum, the parasite's intermediate host, in fish stomach contents. Although H. spinigera's transmission mode (trophic transmission) and fish diet potentially expose all fish species to infection, some level of host specificity must exist as parasite prevalence, abundance and intensity of infection vary greatly between potential definitive host species. We suggest here that the anatomy of the fish digestive tract and especially that of the stomach plays an important role in host suitability for H. spinigera. While P. excavatum is the only intermediate host in Lake Waihola, H. spinigera was found in six different fish species: Aldrichetta forsteri, Galaxias maculatus (Jenyns), Retropinna retropinna, Rhombosolea retiaria Hutton, Perca fluviatilis Linnaeus and Salmo trutta Linnaeus; although typical hedrurid attachment and mating positions were observed only in R. retropinna and A. forsteri. The limited distribution of H. spinigera is most likely due to that of its different host species (intermediate and definitive), all inhabitants of coastal fresh and brackish waters. PMID:20941914

  2. Mitochondrial cytochrome c oxidase subunit 1 (cox1) gene sequence of Spirocerca lupi (Nematoda, Spirurida): avenues for potential implications. (United States)

    Traversa, Donato; Costanzo, Francesca; Iorio, Raffaella; Aroch, Itamar; Lavy, Eran


    Canine spirocercosis is a life-threatening parasitosis caused by Spirocerca lupi (Nematoda, Spirurida) that is presently emerging in several countries. This study characterised an informative region within the mitochondrial (mtDNA) gene encoding for the cytochrome c oxidase subunit 1 (cox1) of S. lupi by Polymerase Chain Reaction (PCR)-coupled sequencing. Specimens from five different countries in Europe, Asia and Africa were examined and two different sequence variants of cox1 (i.e. haplotypes) were determined, displaying nucleotidic variation at 6 of 689 positions. All of these positions were invariable among all the parasite individuals from Europe (haplotype 1) and among the African and Asian individuals (haplotype 2), but differed between Europe and Asia/Africa. The S. lupi cox1 sequences were consistent with those of other common Spirurida previously reported at both nucleotidic and phylogenetic levels. This study provides molecular information essential for identification of the nematode, irrespective of its life cycle stage. Crucial implications for the specific molecular diagnosis of clinical spirocercosis and investigation of the evolution, population genetics, ecology and epidemiology of S. lupi are discussed. PMID:17428608

  3. Observação in vitro da ação dos isolados fúngicos Duddingtonia flagrans, Monacrosporium thaumasium e Verticillium chlamydosporium sobre ovos de Ascaris lumbricoides (Lineu, 1758) In vitro observation of the action of isolates of the fungi Duddingtonia flagrans, Monacrosporium thaumasium and Verticillium chlamydosporium on the eggs of Ascaris lumbricoides (Linnaeus, 1758)


    Fábio R. Braga; Jackson V. Araújo; Artur K. Campos; Rogério O. Carvalho; André R. Silva; Alexandre O. Tavela; Alessandro S. Maciel


    Observou-se a ação in vitro dos fungos nematófagos Duddingtonia flagrans, Monacrosporium thaumasium e Verticillium chlamydosporium sobre ovos de Ascaris lumbricoides. Após sete, dez e quatorze dias de interação, o fungo promissor a ser utilizado no controle biológico de Asaris lumbricoides foi o Verticillium chlamydosporium (26-30%). Os outros fungos não foram satisfatórios.The in vitro action of the nematophagous fungi Duddingtonia flagrans, Monacrosporium thaumasium and Verticillium chlamyd...

  4. Prevalence and intensity of infections of Ascaris lumbricoides and Trichuris trichiura and associated socio-demographic variables in four rural Honduran communities

    Directory of Open Access Journals (Sweden)

    Smith HM


    Full Text Available Between January and March 1998, a cross-sectional survey was carried out in four rural communities in Honduras, Central America. We examined the prevalence and intensity of Ascaris lumbricoides and Trichuris trichiura infections among 240 fecal specimens, and the association between selected socio-demographic variables and infection for 62 households. The overall prevalence of A. lumbricoides and T. trichiura was 45% (95% CI 39.0-51.9 and 38% (95% CI 31.8-44.4 respectively. The most intense infections for Ascaris and Trichuris were found in children aged 2-12 years old. By univariate analysis variables associated with infections of A. lumbricoides were: number of children 2-5 years old (p=0.001, level of formal education of respondents (p=0.01, reported site of defecation of children in households (p=0.02, households with children who had a recent history of diarrhea (p=0.002, and the location of households (p=0.03. Variables associated with both A. lumbricoides and T. trichiura infection included: number of children 6-14 years old (p=0.01, p=0.04, respectively, ownership of a latrine (p=0.04, p=0.03, respectively and coinfection with either helminth (p=0.001, p=0.001, respectively. By multivariate analysis the number of children 2-5 years living in the household, (p=0.01, odds ratio (OR=22.2, children with a recent history of diarrhea (p=0.0, OR=39.8, and infection of household members with T. trichiura (p=0.02, OR=16.0 were associated with A. lumbricoides infection. The number of children 6-14 years old in the household was associated with both A. lumbricoides and T. trichiura infection (p=0.04, p=0.01, OR=19.2, OR=5.2, respectively.

  5. Effect of mini-sprinkler irrigation system on Heterorhabditis baujardi LPP7 (Nematoda: Heterorhabditidae infective juvenile Efeito do sistema de irrigação por microaspersão em juvenis infectantes de Heterorhabditis baujardi LPP7 (Nematoda: Heterorhabditidae

    Directory of Open Access Journals (Sweden)

    Juan Carlos Lara


    Full Text Available Entomopathogenic nematodes (EPNs are currently being used as successful biological control agents of soil-dwelling insect pests. Previous field and greenhouse studies demonstrated that application techniques and non-biotic factors (temperature and pressure have a significant effect on EPNs efficacy. The objective of this study was to evaluate the influence of an irrigation spray application system on the viability, infectivity and host search capability of Heterorhabditis baujardi LPP7 (Nematoda: Heterorhabditidae infective juveniles (IJ. Two assays were proposed. Their viability was evaluated under the microscope after the IJ passed through the irrigation system. Infectivity on Galleria mellonella larvae, and host search capability, as evidenced by larval mortality, were evaluated in containers (Experiment 1. In the field (Experiment 2, mortality of G. mellonella larvae was evaluated under different nematode concentrations (0, 100,000, 300,000 and 500,000 IJ per tree. No differences were recorded on the viability, infectivity and host search capability of the IJ in Experiment 1. In Experiment 2, differences were recorded among the different concentrations used (p Nematóides entomopatogênicos (NEPs vêm sendo usados com sucesso como agentes do controle biológico de pragas de solo. Estudos anteriores mostraram que técnicas de aplicação e fatores abióticos (temperatura e pressão afetam a eficiência dos NEPs em testes de campo e casa-de-vegetação. O objetivo deste trabalho foi avaliar a influência de condições geradas por um sistema de irrigação por microaspersão, na viabilidade, infectividade e na capacidade de busca de hospedeiros nos juvenis infectantes (JI de Heterorhabditis baujardi LPP7 (Nematoda: Heterorhabditidae. Dois experimentos foram propostos. A viabilidade dos juvenis infectantes (JI foi avaliada no microscópio imediatamente após sua passagem pelo sistema de irrigação. A infectividade e a capacidade de busca pelo

  6. A new species of Potoroxyuris (Nematoda: Oxyuridae) from the woylie Bettongia penicillata (Marsupialia: Potoroidae) from southwestern Australia. (United States)

    Hobbs, Russell P; Elliot, Aileen D


    Potoroxyuris keninupensis n.sp. (Nematoda: Oxyuridae) is described based on specimens recovered from the caecum and colon of two woylies, Bettongia penicillata (Marsupialia: Potoroidae) from Western Australia. Only one other species of Potoroxyuris has been described previously, Potoroxyuris potoroo (Johnston and Mawson, 1939) Mawson, 1964, from Potorous tridactylus. The new species is most easily differentiated from P. potoroo by the shape of the pharyngeal lobes. The pharyngeal lobes of P. keninupensis n. sp. are widest at the base while those of P. potoroo are widest at the tip. The genus Potoroxyuris most closely resembles Macropoxyuris based especially on structures of the caudal end of males. The other three genera of oxyurids known to infect Australian marsupials have longer caudal alae, and more caudal papillae than these two genera. The genus Potoroxyuris has previously been defined by the characteristic that the pharyngeal lobes protrude through the oral opening. However, the pharyngeal lobes of P. keninupensis n. sp. do not quite protrude, so the definition of the genus should be modified as follows. The genus Potoroxyuris can be easily differentiated from Macropoxyuris by the following differences in the morphology of the buccal cavity. The pharyngeal lobes of Potoroxyuris almost reach the oral opening, or protrude beyond it, whereas those of Macropoxyuris only reach to about the anterior third of the buccal cavity. The buccal cavity of Potoroxyuris is poorly cuticularized compared to Macropoxyuris and other genera of oxyurids known from Australian marsupials, and does not contain inter-radial lamellae. PMID:27437181

  7. Deep subsurface mine stalactites trap endemic fissure fluid Archaea, Bacteria and Nematoda possibly originating from ancient (inland seas.

    Directory of Open Access Journals (Sweden)

    Gaetan eBorgonie


    Full Text Available Stalactites (CaCO3 and salt from water seeps are frequently encountered in ceilings of mine tunnels whenever they intersect water-bearing faults or fractures. To determine whether stalactites could be mineralized traps for indigenous fracture water microorganisms, we analyzed stalactites collected from three different mines ranging in depth from 1.3 to 3.1 km. During sampling in Beatrix gold mine (1.4 km beneath the surface, central South Africa, CaCO3 stalactites growing on the mine tunnel ceiling were collected and discovered, in two cases, to contain a living obligate brackish water/marine nematode species, Monhystrella parvella. After sterilization of the outer surface, mineral layers were physically removed from the outside to the interior, the DNA extracted. Based upon 16S and 18S rRNA gene sequencing, Archaea, Bacteria and Eukarya in different combinations were detected for each layer. . Using CT scan and electron microscopy the inner structure of CaCO3 and salt stalactites were analyzed. CaCO3 stalactites show a complex pattern of lamellae carrying bacterially precipitated mineral structures. Nematoda were clearly identified between these layers confirming that bacteria and nematodes live inside the stalactites and not only in the central straw. Salt stalactites exhibit a more uniform internal structure. Surprisingly, several Bacteria showing highest sequence identities to marine Bacteria were identified. This, together with the observation that the nematode M. parvella recovered from Beatrix gold mine stalactite can only survive in a salty environment makes the origin of the deep subsurface colonization enigmatic. The possibility of a Permian origin is discussed. Our results indicate stalactites are suitable for biodiversity recovery and act as natural traps for microorganisms in the fissure water long after the water that formed the stalactite stopped flowing.

  8. Redescription, systematic status and molecular characterisation of Multicaecum heterotis Petter, Vassiliadès et Marchand, 1979 (Nematoda: Heterocheilidae), an intestinal parasite of Heterotis niloticus (Osteichthyes: Arapaimidae) in Africa

    Czech Academy of Sciences Publication Activity Database

    Mašová, Š.; Moravec, František; Baruš, V.; Seifertová, M.


    Roč. 57, č. 4 (2010), s. 280-288. ISSN 0015-5683 R&D Projects: GA MŠk LC522 Grant ostatní: GA ČR(CZ) GD526/09/H025 Institutional research plan: CEZ:AV0Z60220518 Keywords : Nematoda * Brevimulticaecum * Multicaecum * Senegal * Sudan * Africa * Heterotis * barcoding * 18S rDNA sequences * ITS2 sequences Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.533, year: 2010

  9. Research on the immune mechanisms of Ascaris lumbricoides infection over the past decade%近10年似蚯蚓线虫感染的免疫机制研究

    Institute of Scientific and Technical Information of China (English)

    王敏; 张冬丽


    本文从固有免疫、适应性免疫及疫苗研究等几方面论述似蚯蚓线虫(蛔虫)感染的免疫学研究新进展.%This paper describes recent advances in the induction of innate immunity and acquired immunity against Ascaris lumbricoides and it also discusses the development of vaccines.





    Сенсибилизация белковым соматическим продуктом из тканей аскарид в суточной дозе 50 мкг/г массы тела крыс на стадии раннего органогенеза эмбрионов (5-8 дни беременности) сопровождается эмбриотоксическим эффектом, который характеризуется достоверным ростом постимплантационной гибели в 4,98 раза, а также уменьшением средней массы эмбрионов и их краниокаудального размера в 1,42-1,44 раза. Белковый соматический продукт из тканей аскарид обладает выраженными генотоксическим и цитотоксическим эф...

  11. A review of Gongylonema spp. (Nematoda: Gongylonematidae) in North American rodents with description of a new species from the cotton rat, Sigmodon hispidus (Mammalia: Cricetidae). (United States)

    Kinsella, John M; Robles, Maria Del Rosario; Preisser, Whitney C


    Gongylonema archboldi n. sp. (Nematoda: Gongylonematidae) is described from tunnels in the gastric mucosa of the stomach of the cotton rat (Sigmodon hispidus) from Highlands County, Florida, U.S.A. Measurements are also given for specimens from cotton mice (Peromyscus gossypinus), oldfield mice (Peromyscus polionotus), Florida mice (Podomys floridanus), and golden mice (Ochrotomys nuttalli) from the same locality. Additional specimens were collected from the cotton rat and the rice rat (Oryzomys palustris) from Berry Island, San Patricio County, Texas. The new species is differentiated from congeners by a combination of the following characters: length of the left spicule, length and shape of the gubernaculum, distribution of cuticular bosses, length of esophagus, and distance of the vulva from the posterior end. The status of the genus Gongylonema in North American rodents is reviewed. PMID:27394819

  12. Dicty_cDB: SHF635 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VKRIKELLFSLYLPIFNCFEA FLLNTNEKALIENLLWL*ki Frame B: sfssnsiniyicsftstnttnisilpnnnnnntgchnkfriinei**icdii...fggpgqsfggpgqsfgpkpiasggfgstaipfggpgqsfggsgykwwl w*hcsiiwrsktnhnwkqwfw*ycciiwrtrstiwrighkwwfwiinttinssfskfiwn wr*icc*nstis... pieces. 44 0.13 2 BM278816 |BM278816.1 As_tgz_67G12_SKPL Ascaris suum adult male testis... germinal zone from Alan Scott Ascaris suum cDNA clone As_tgz_67G12 5', mRNA sequence. 36 0.48 2 CT18...4508 |pid:none) Plasmodium falciparum strain 3D7,... 35 4.8 AM263198_928( AM263198 |pid:none) Listeri

  13. 蛔虫重度流行区人群化疗策略的研究%Research on chemotherapy strategy for population in heavy epidemic areas with ascaris iumbricoides

    Institute of Scientific and Technical Information of China (English)

    谢峰; 陈红根; 曾小军; 林丹丹; 姜唯声; Jong-YilChai


    Objective To evaluate the effect of different chemotherapy strategies for Ascaris lumbricoides. Methods Four chemotherapy strategies with Albendazole,which were mass chemotherapy once a year,mass chemotherapy once in two years,se-lective chemotherapy once a year and selective chemotherapy twice a year,were carried out in four control villages,respectively. The effects of strategies on infection control of Ascaris lumbricoides were observed continuously for 4 years ,and compared with the dada of a control village. Results The average positive rate of Ascaris lumbricoides was 44.37%(4850/10931) in 5 pilot villages in 2001. The infection rate of Ascaris lumbricoides was decreased maximally,from 45.2%in 2001 to 6.3%in 2005 with the reduction of 86.1% in villages where the strategy of mass chemotherapy once a year was implemented. Conclusion The strategy of mass chemotherapy once a year has the best effect on infection control of Ascaris lumbricoides.%目的:评价不同化疗措施控制蛔虫的效果。方法在4个控制村用阿苯哒唑分别进行1年1次全民化疗、2年1次全民化疗、1年1次选择性化疗和1年2次选择性化疗措施后,连续4年观察其对控制居民蛔虫的效果,并和对照村进行比较。结果2001年5个试点村蛔虫平均阳性率为44.37%(4850/10931),采取每1次/年全民化疗人群蛔虫感染率下降最大,由2001年的45.2%下降到2004年的6.3%,降幅为86.1%。结论1次/年全民化疗策略对于控制蛔虫感染的效果佳。

  14. Aspects of the life history of Muspicea borreli (Nematoda: Muspiceidae, parasite of the house mouse (Mus domesticus in Australia

    Directory of Open Access Journals (Sweden)

    Spratt D.M.


    Full Text Available Prevalence of Muspicea borreli (Nematoda infection in wild populations of Mus domesticus in forests in southeastern New South Wales and in rural Canberra, Australia was variable, relatively low and the parasite occurred predominantly in male mice. Experimental infection of BALB/c mice occurred only via subcutaneous inoculation but was achieved using i adults containing embryonating eggs, ii adults containing active larvae and iii active larvae dissected from the uterus of female worms. Experimental infection was not established using adults containing unembryonated eggs and was not established via intraperitoneal, percutaneous nor oral routes. Evidence indicates that larvae develop to the infective stage in the uterus of the adult worm, suggests that an obligate developmental phase on the host skin does not occur and that autoinfection is possible. Experimental infection predominated in males; females rarely became infected. When male BALB/c mice were inoculated subcutaneously with M. borreli, immediately paired with an uninoculated female and permitted to breed for 90 days, infection was found in male and female offspring only of the second and subsequent litters or in the breeding female partner. Transmission to the young occurred within 21 days of birth and fifth-stage M. borreli were found in offspring of the second and subsequent litters only after 35 or more days. However, when a male was inoculated but mating delayed for 23 days, infection was found in progeny of the first and second litters. The life cycle is direct and the prepatent period in BALB/c mice is estimated at 50-60 days. The precise mode of transmission of the parasite in breeding pairs of mice was not determined but larvae remained active for approximately an hour in balanced saline solutions (pH = 7.2 and in human saliva but died under conditions emulating free-living (tap water pH = 7.1 and stomach (pepsin solution pH = 2 environments. Transmission was not effected by

  15. Ascaris lumbricoides Infection Following School-Based Deworming in Western Kenya: Assessing the Role of Pupils' School and Home Water, Sanitation, and Hygiene Exposures. (United States)

    Garn, Joshua V; Mwandawiro, Charles S; Nikolay, Birgit; Drews-Botsch, Carolyn D; Kihara, Jimmy H; Brooker, Simon J; Simiyu, Elses W; Okoyo, Collins; Freeman, Matthew C


    Water, sanitation, and hygiene (WaSH) technologies and behaviors can prevent infection by soil-transmitted helminth species independently, but may also interact in complex ways. However, these interactions are poorly understood. The purpose of this study was to characterize how school and home WaSH exposures were associated with Ascaris lumbricoides infection and to identify relevant interactions between separate WaSH technologies and behaviors. A study was conducted among 4,404 children attending 51 primary schools in western Kenya. We used multivariable mixed effects logistic regression to characterize how various WaSH exposures were associated with A. lumbricoides infection after annual school-based deworming. Few WaSH behaviors and technologies were independently associated with A. lumbricoides infection. However, by considering relevant interdependencies between variables, important associations were elucidated. The association between handwashing and A. lumbricoides depended largely upon the pupils' access to an improved water source. Among pupils who had access to improved water sources, A. lumbricoides prevalence was lower for those who handwashed both at school and home compared with neither place (odds ratio: 0.38, 95% confidence interval: 0.18-0.83; P = 0.01). This study contributes to a further understanding of the impact of WaSH on A. lumbricoides infection and shows the importance of accounting for interactions between WaSH technologies and behaviors. PMID:26903608

  16. Toxic effect of Ascaris lumbricoides body fluid on intestinal epithelial cells%人蛔虫体腔液对人肠上皮细胞的毒性作用

    Institute of Scientific and Technical Information of China (English)

    翁培兰; 袁铿; 彭卫东; 周宪民


    目的探讨人蛔虫体腔液(Ascaris bodyfluid,ABF)对人肠上皮细胞株(HCT-8)的毒性作用及作用浓度和时间的关系.方法以体外细胞培养方法观察ABF对HCT-8细胞的毒性作用,比较不同浓度ABF作用下不同时间HCT-8细胞的死亡率和形态结构.结果HE染色显示,当ABF浓度为800μg/ml时,HCT-8细胞的毒性作用最大,除浓度为12.5μg/ml的实验组,各实验组(25~8μg/ml)的毒性均高于对照组.结论ABF对HCT-8细胞所产生毒性作用在一定程度上表现出浓度和作用时间的依赖关系,并诱导细胞凋亡的发生.

  17. Evolution of ascariasis in humans and pigs: a multi-disciplinary approach


    Loreille Odile; Bouchet Françoise


    The nematode parasite Ascaris lumbricoides infects the digestive tracts of over 1.4 billion people worldwide, and its sister species, Ascaris suum, has infected a countless number of domesticated and feral pigs. It is generally thought that the putative ancestor to these worms infected either humans or pigs, but with the advent of domestication, they had ample opportunity to jump to a new host and subsequently specialize and evolve into a new species. While nuclear DNA markers decisively sepa...

  18. Dicty_cDB: SHF132 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available niyicsftstnttnisilpnnnn nntgchnkfriinei**icdii**yfnw**inlsrrfn*k*i*kiick*s**fkie*fif tl*kgi*k*t...ome. 38 0.34 6 BM278816 |BM278816.1 As_tgz_67G12_SKPL Ascaris suum adult male testis germinal zone from Alan Scott Ascaris...KQHSFSNDIKFKQEWNRFSNNMFDGFNWSNV FI--- ---wwfw*yxsiigrtrsiiwrsrsiirsktnckwwfw*ycytiwrtrsiiwrigykwwl w*hcsiiwrsktnhnwkqwfw*yccii...wrtrstiwrighkwwfwiinttinssfskfiwn wr*icc*nstislypc*wfcpsclkhicnsnwfiqqyptfskkystkygw**cikr...vmiqn*iiyiy ivkrylkvnqpplnyqm*mvsivlwdsmqnnihfqmisslnkngidlviiclmvsigpmy l--- ---GGFGST

  19. Current status of the efficacy and effectiveness of albendazole and mebendazole for the treatment ofAscaris lumbricoides in North-Western Indonesia

    Institute of Scientific and Technical Information of China (English)

    Inke Nadia Diniyanti Lubis; Syahril Pasaribu; Chairuddin Panusunan Lubis


    Objective:To investigate the efficacy and effectiveness of albendazole and mebendazole in the treatment ofAscaris lumbricoides (A. lumbricoides) in theNorth-WesternIndonesia.Methods:229 primary school children who were positive forA. lumbricoides in their stool were recruited in the study.123 children received single-dose of400 mg albendazole and106 children received single-dose500 mg of mebendazole.After1 week, their stools were examined for the cure rate (CR) and egg reduction rate(ERR).Egg culture was also performed and observation was made on week-1, -3, -4.Results:have shown a non-significant difference inCR96.7%vs.100%; and ERR of99.3%vs.100.0% for albendazole and mebendazole groups respectively(P>0.05).In-vitro egg culture has shown trends of decrease in the percentage of the unfertilized eggs and in≥2 cell eggs in both treatment groups(P<0.05).The embryonated eggs from the albendazole groups has shown an increase from7.3% on week-1 to13.8% on week-4, whilst the mebendazole group has shown a constant increase during the whole4 weeks of culture from7.5% to28.3%(P<0.01). Conclusions:No evidence of drug resistance is noted so far from the area ofNorth-Western part ofIndonesia.In addition, although both drugs showed incomplete ovicidal effects, single-dose albendazole is better than mebendazole in sterilizingA. lumbricoideseggs.

  20. Parasitismo por Ascaris lumbricoides em crianças menores de dois anos: estudo populacional em comunidade do Estado do Rio de Janeiro

    Directory of Open Access Journals (Sweden)

    Costa-Macedo Lêda Maria da


    Full Text Available A prevalência e a intensidade da infecção por Ascaris lumbricoides foram analisadas mediante um estudo transversal em crianças residentes no Município de Duque de Caxias, no Estado do Rio de Janeiro, entre julho e dezembro de 1997. A população do estudo foi constituída por crianças com menos de dois anos de idade e as mães das crianças menores de um ano. As amostras fecais foram recolhidas nos domicílios em frascos contendo solução conservadora de MIF e processadas por meio das técnicas de MIFC e Kato-Katz. As prevalências de infecção por A. lumbricoides observadas foram 3,3% (I.C. 95% 1,0 - 7,8 para os menores de um ano, 30,7% (I.C. 95% 25,4 - 36,4 para as crianças com um ano de idade e 42,3% (I.C. 95% 33,0 - 51,9 para as mães. Infecção com carga parasitária moderada/pesada foi observada em cerca de 38% das crianças com um ano de idade e 36,0% das mães. Estes resultados demonstram a importância da ascariose já no primeiro ano de vida e indicam a necessidade de aprofundamento na investigação desta parasitose na população materno-infantil.

  1. El grado de agregación de Ascaris lumbricoides según grupos de edad, después de una intervención antihelmíntica de masas


    Agustín Ruíz; Guadalupe Ocampo; Araceli Soto; José, Marco V.


    Objetivo. Describir la heterogeneidad de la reinfección por Ascaris lumbricoides según grupos de edad, en distintos intervalos, después de un primer tratamiento antihelmíntico masivo. Material y métodos. A partir de datos de la prevalencia e intensidad de la infección por A. lumbricoides obtenidos en un estudio epidemiológico de ascariasis, realizado en Coatzacoalcos, Veracruz, México, se deriva el grado de agregación por medio del método de máxima verosimilitud, asumiendo una distribución bi...

  2. Comparative studies on Pb and Cd levels in parasites of terrestrial and aquatic animals

    Energy Technology Data Exchange (ETDEWEB)

    Sures, B.; Taraschewski, H. [Univ. Karlsruhe (Germany). Zoologisches Institut-Okologie


    Several fish parasites (Acanthocephala, Cestoda, Nematoda) and organs of their respective intermediate and final hosts were analyzed for heavy metals by electrothermal atomic absorption spectrometry (ET-AAS). Pb and Cd were also quantified in the liver fluke Fasciola hepatica as well as in different organs of the large intestinal roundworm Ascaris suum. The levels of these heavy metals in the parasites were compared to those of muscle, liver, kidney and intestine of the respective definitive hosts cattle and swine obtained from a slaughter house. Most parasites accumulated significantly higher levels of metals than their final hosts. This was most conspicuous in acanthocephalans which contained up to 3 {times} 10{sup 3} fold more lead than the muscle of their fish hosts and up to 1.1 {times} 10{sup 4} more lead than the water surrounding the fish. In these helminths cadmium was enriched up to 400 fold compared to the muscle of the fish and up to 2.7 {times} 10{sup 4} compared to the water. In contrast to the accumulation capacity of adult acanthocephalans their larvae contained about 30 to 180 times less Pb and Cd. Thus, the predominant accumulation of both metals appears in the adult worms. The cestodes of fish and the liver flukes of cattle accumulated the metals up to 200 fold compared to the muscle of their hosts. The nematodes did not contain higher levels of the metals than their hosts. Thus, parasites, especially acanthocephalans, seem to be sensitive bioindicators of Pb and Cd in their environments.

  3. Experimental destruction of Ascarid ova in sewage sludge by accelerated electron irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Horak, Petr (Charles Univ., Prague (Czech Republic). Dept. of Parasitology)


    Aerobically-treated sewage sludge containing eggs of the nematode Ascaris suum was processed using accelerated electrons. After 8 weeks of incubation the morphological and developmental status of eggs was determined. Inhibition of development and the destruction of nematode embryos within eggs were observed at doses over 1.1 kGy. (author).

  4. Experimental destruction of Ascarid ova in sewage sludge by accelerated electron irradiation

    International Nuclear Information System (INIS)

    Aerobically-treated sewage sludge containing eggs of the nematode Ascaris suum was processed using accelerated electrons. After 8 weeks of incubation the morphological and developmental status of eggs was determined. Inhibition of development and the destruction of nematode embryos within eggs were observed at doses over 1.1 kGy. (author)

  5. Helminth Egg Removal Capacity of UASB Reactors under Subtropical Conditions

    NARCIS (Netherlands)

    Yaya-Beas, R.E.; Ayala-Limaylla, C.; Kujawa-Roeleveld, K.; Van Lier, J.B.; Zeeman, G.


    This research was conducted to study the anaerobic sludge filtration capacity regarding helminth egg removal in upflow anaerobic sludge blanket (UASB) reactors. Two 25 L lab-scale UASB reactors were operated at an ambient temperature which varied between 17.1 and 28.6 °C. Ascaris suum egg was select

  6. Ocho diferentes especies de parásitos gastrointestinales fueron identificadas en cerdos de traspatio en El Municipio de El Sauce - León. Nicaragua (Eight different species gastrointestinal parasites were identified in free roaming pigs in EL Sauce - Leon. Nicaragua

    Directory of Open Access Journals (Sweden)

    Luz A. Luna


    Full Text Available Este trabajo se realizó con cerdos criados en traspatio en el municipio de El Sauce, Departamento de León, Nicaragua En el primer estudio se determinó la prevalencia de Parásitos Gastrointestinales (PGI en 60 cerdos de patio sacrificados en matadero. Se identificaron 6 tipos de especies de parásitos gastrointestinales: Macrachantorinchus hirudinaceu, Oesophagustomun spp, Áscaris suum, Trichuris suis e Hyostrongylus rubidus, siendo este ultimo el de mayor prevalencia. Se determinó la prevalencia de PGI en heces de cerdos en dos grupos de edades. Se identificaron los helmintos Ascaris suum, Hyostrongylus, rubidus, Strongiloides ransomi, Oesophagostomun spp, y Trichuris suis. Los protozoos encontrados fueron Isospora suis y Eimeria sp. Con una mayor frecuencia se encontró Ascaris suum (42.86% e Hyostrongylus (39.80%, en el grupo mayor de seis meses, en el grupos menor de seis meses los más frecuentes eran Áscaris suum (48.98% y Trichuris (45.92%. La intensidad de infestación de H. rubidus fue significativamente más alto en grupo de cerdos mayores de seis y T. suis e Isospora suis tuvieron diferencia significativa en el grupo menor de seis meses. En resumen identificamos ocho especies de parásitos gastrointestinales en los cerdos de traspatio, que son de importancia económica. This work was done with free roaming pigs in El Sauce, Department of Leon, Nicaragua. In the first studies the prevalence of gastrointestinal parasites were found in 60 pigs in the slaughterhouse where there was 6 types of gastrointestinal parasites identified: Macrachantorinchus hirudinaceus, Oesophagostomun spp, Ascaris suum, Trichuris suis, Hyostrongylus rubidus, the last one with the biggest prevalence. Later the prevalence of gastrointestinal parasites in feces was found in two groups with different age, where the helminths Ascaris suum, Hyostrongylus rubidus, Strongyloides ransomi, Oesophagostomun spp, and Trichuris suis were identified. The protozoo that

  7. Description of two free-living nematode species of Halomonhystera disjuncta complex (Nematoda: Monhysterida) from two peculiar habitats in the sea (United States)

    Tchesunov, Alexei V.; Portnova, Daria A.; van Campenhout, Jelle


    Morphological descriptions of two Halomonhystera species (Nematoda, Monhysterida) are presented ( Halomonhystera hermesi and Halomonhystera socialis). Halomonhystera hermesi sp. n. occurs in a dense monospecific and homogeneous population on bacterial mats in the Håkon Mosby mud volcano in the Barents Sea at a depth of 1,280 m. The species is an endemic lineage distinctly separated from other shallow-water cryptotaxa of the Halomonhystera disjucta species complex on the base of the mitochondrial gene cytochrome oxidase subunit I (genetic divergence 19.6-23.8 %) and nuclear genetic markers, and on the base of morphometrics by Van Campenhout et al. (2014). H. socialis (Bütschli 1874) is redescribed on the basis of White Sea specimens. This species dwells in mass on the detached kelp accumulation in the upper sublittoral. H. socialis is differentiated from other species of the Halomonhystera disjuncta complex morphometrically by a larger body size and by genetic divergence in nuclear markers. The genus Halomonhystera Andrássy 2006 is redefined, and its morphospecies list is reviewed. Species H. bathislandica (Riemann 1995) comb. n., H. fisheri (Zekely et al. 2006) comb. n., H. islandica (De Coninck 1943) comb. n. and H. vandoverae (Zekely et al. 2006) comb. n. are transferred to Halomonhystera from Thalassomonhystera; H. paradisjuncta (de Coninck 1943) comb. n., H. rotundicapitata (Filipjev 1922) comb. n. and H. taurica (Tsalolikhin 2007) comb. n. transferred to Halomonhystera from Geomonhystera. Halomonhystera ambiguoides (Bütschli 1874) is considered as species inquirenda because of incompleteness of its diagnosis.

  8. Stenurus globicephalae Baylis et Daubney, 1925 (Nematoda: Pseudaliidae from a False Killer Whale, Pseudorca crassidens (Cetacea: Delphinidae, Stranded on the Coast of Uruguay

    Directory of Open Access Journals (Sweden)

    Zylber María Inés


    Full Text Available Stenurus globicephalae Baylis et Daubney, 1925 (Nematoda: Pseudaliidae was found in the cranial air sinuses of a false killer whale, Pseudorca crassidens (Owen, stranded on the coast of Uruguay in 1999. Although this species has been reported once in P. crassidens from the North Atlantic, this is the first record for South America. A total of 920 specimens were obtained, of which 663 were females (body length: 4.34 ± 0.45 cm and 257 were males (2.99 ± 0.18 cm. Morphometric details are presented for S. globicephalae in this host, which do not show significant differences from those parasitizing Globicephala melas (Traill, but are distinct from those parasitizing Peponocephala electra (Gray. The host's skull revealed loss of osseous mass with the disappearance of the left zygomatic arch, and the left jaw had three osseous fenestrations in the region related to the organ of acoustic reception. These lesions support the hypothesis that this infection, known as stenurosis, was related to the stranding.

  9. [Spermiogenesis and the function of the vaginal sac in Ichthyocephalus anadenoboli. n. sp. (Rhigonematidae; Nematoda), a parasite of Anadenobolus politus (Porat) (Rhinocricidae; Diplopoda) in Guadeloupe]. (United States)

    van Waerebeke, D; Adamson, M L; Kermarrec, A


    Ichthyocephalus anadenoboli n. sp. ( Rhigonematidae ; Nematoda) from Anadenobolus politus ( Porat ) ( Rhinocricidae ; Diplopoda ) from Guadeloupe is described. The new species most closely resembles I. egleri since both sexes are of approximately the same size and the spicules are markedly unequal; it is distinguished in having a much longer right spicule, by the form of the extremity of the left spicule and by the presence of a vaginal sac opening into the vagina at its junction with the uteri. In addition certain aspects of spermiogenesis in the new species are studied. Maturation of spermatids occurs in two phases, one in the testis and seminal receptacle of males, the second in the vaginal sac in females. The second phase involves profound changes in form as well as nuclear transformation. It is suggested that the vaginal sac observed in certain species of Rhigonema as well as the " bourse copulatrice " of certain Tetrameres spp. and Maupasina weissi , like that of Ichthyocephalus anadenoboli , are specialized to accommodate the final stages of spermiogenesis. PMID:6547037

  10. Two gonad-infecting species of Philometra (Nematoda: Philometridae) from groupers (Serranidae) off Tunisia, with a key to Philometra species infecting serranid gonads. (United States)

    Moravec, František; Chaabane, Amira; Justine, Jean-Lou; Neifar, Lassad


    Based on light and scanning electron microscopical studies of nematode specimens (males and mature females) collected from the ovary of groupers (Serranidae, Perciformes) in the Mediterranean Sea off Tunisia (near Tunis and Sfax), two gonad-infecting species of Philometra Costa, 1845 (Nematoda, Philometridae) are reported: Philometra inexpectata n. sp. from the mottled grouper Mycteroperca rubra and P. jordanoi (López-Neyra, 1951) from the dusky grouper Epinephelus marginatus. Identification of both fish species was confirmed by molecular barcoding. The new species is mainly characterized by the length of equally long spicules (147-165 μm), the gubernaculum (63-93 μm long) bearing at the tip two dorsolateral lamellar parts separated from each other by a smooth median field, a V-shaped mound on the male caudal extremity, the presence of a pair of large caudal papillae located posterior to the cloaca and by the body length of the males (1.97-2.43 mm). Philometra inexpectata n. sp. is the fifth known gonad-infecting philometrid species parasitizing serranid fishes in the Mediterranean region. The males of P. jordanoi were examined by scanning electron microscopy for the first time; this detailed study revealed some new taxonomically important morphological features, such as the number and arrangement of cephalic and caudal papillae, presence of amphids and phasmids and mainly the lamellate structures at the posterior end of the gubernaculum. A key to gonad-infecting species of Philometra parasitic in serranid fishes is provided. PMID:26956219

  11. Effect of cleaning /disinfection strategies on helminth infections in finishing pigs


    Vermeer, Herman M.; Borgsteede, Fred H.M.; Gaasenbeek, Cor P.H.; Blanken, Klaas


    Ascaris suum is the most prevalent helminth on organic pig farms (Carstensen et al., 2002) and is transmitted mainly via the faeces. The use of anthelmintics does not fit in the organic principles and preventive measures are promoted. This project focused on assessing the efficacy of a cleaning protocol for the dunging area of pens on Ascaris s. transmission to pigs. In 4 batches with 8 identical pens for 15 pigs each (n=480 pigs) 6 pigs per pen were orally infected with Ascari...

  12. From the twig tips to the deeper branches

    DEFF Research Database (Denmark)

    Betson, Martha; Nejsum, Peter; Stothard, J. Russell


    Ascaris lumbricoides and Ascaris suum continues. From an applied perspective, however, molecular markers help to "tag" and "track" worms during their transmission cycle(s), providing new insights into host range, as well as methods for assessing parasite population dynamics through time and contingent...... upon disease control. While useful in determining dynamics at the tips of the evolutionary tree, these molecular tools also provide insights into deeper evolutionary branches. Although Ascaris is found throughout the globe, molecular analysis of worms retrieved from sub-Saharan Africa point towards a...

  13. Colecistite aguda por ascaris lumbricoides Acute cholecystites for ascaris lumbricoides

    Directory of Open Access Journals (Sweden)

    Amauri Clemente da Rocha


    Full Text Available Biliary’s ascariasis is the most often ectopic site of this helminthiasis, but invasion of the worms into the gallbladder is quite rare. The autors report a case of a patient with clinical symptoms, compatible with cholecystitis induced by the worm, as shown by ultrasonography. Treatament was cholecystectomy and antihelmintic drug therapy with a good outcome.

  14. Colecistite aguda por ascaris lumbricoides Acute cholecystites for ascaris lumbricoides


    Amauri Clemente da Rocha; Severino Lourenço da Silva Júnior; Rodrigo Fernando Lourenço de Amorim


    Biliary’s ascariasis is the most often ectopic site of this helminthiasis, but invasion of the worms into the gallbladder is quite rare. The autors report a case of a patient with clinical symptoms, compatible with cholecystitis induced by the worm, as shown by ultrasonography. Treatament was cholecystectomy and antihelmintic drug therapy with a good outcome.

  15. Description and prevalence of Thynnascaris sp. larvae Dollfus, 1933 (Nematoda: Anisakidae in Plagioscion squamosissimus Heckel, 1840 from Volta Grande Reservoir, State of Minas Gerais, Brazil Descrição e prevalência de larvas de Thynnascaris sp. Dollfus, 1933 (Nematoda: Anisakidae em Plagioscion squamosissimus Heckel, 1840 proveniente do reservatório de Volta Grande, estado de Minas Gerais, Brasil

    Directory of Open Access Journals (Sweden)



    Full Text Available The present work studied helminth parasites of freshwater "corvina" Plagioscion squamosissimus from Volta Grande Reservoir, MG, Brazil. Sixty eight fishes with averages of 25.2 cm length and 180.9 g weight were collected with net, bimonthly from December 1995 thru December 1996. Parasites were carefully removed from their cysts that were present in the intestinal mesentery. Specimens were fixed in AFA 65°C and preserved in alcohol 70% with 5% of glicerine. In camera lucida 21 nematodes were drawned after clarification with acetic acid or Amann lactophenol. Nematode larvae were identified as Thynnascaris sp. (Nematoda: Anisakidae. From examined fishes 30 out of 68 presented nematode larvae with a prevalence of 44.1%. The average number of parasites per host was 0.0 to 13.8 and mean intensity of 0.0 to 16.0. Statistical analysis according to Fisher's Exact Test showed that these infections were dependent on the pluviosity and air temperatureO presente trabalho teve por objetivo o estudo da helmintofauna da corvina de água doce Plagioscion squamosissimus, do reservatório de Volta Grande, MG, Brasil. Foram colhidos 68 peixes com comprimento médio de 25,2 cm e peso médio de 180,9 g, com rede de espera, bimestralmente no período de dezembro de 1995 a dezembro de 1996. Os parasitos foram cuidadosamente retirados de seus cistos que estavam aderidos ao mesentério intestinal. Os espécimes foram fixados em AFA a 65°C e conservados em álcool 70°GL contendo 5% de glicerina. Após diafanização com ácido acético ou lactofenol de Amann, 21 nematóides foram desenhados em câmara clara. As larvas foram identificadas como Thynnascaris sp. (Nematoda: Anisakidae. Das 68 corvinas examinadas, 30 estavam infectadas por esses parasitos com uma prevalência de 44,1%. O número médio de parasitos por hospedeiro foi de 0 a 13,8 e a intensidade média, de 0 a 16. A análise estatística, de acordo com o Teste Exato de Fisher, mostrou que a sazonalidade foi

  16. Haematological alterations of Leporinus macrocephalus (Osteichtyes: Anostomidae naturally infected by Goezia leporini (Nematoda: Anisakidae in fish pond Alterações hematológicas em Leporinus macrocephalus (Osteichtyes: Anostomidae infectado naturalmente por Goezia leporini (Nematoda: Anisakidae em viveiro de piscicultura

    Directory of Open Access Journals (Sweden)

    M.L. Martins


    Full Text Available The effect of Goezia leporini Martins & Yoshitoshi, 2003 (Nematoda: Anisakidae infection on the haematological characteristics of cultivated Leporinus macrocephalus (Osteichthyes:Anostomidae was studied. Paleness of gills, kidneys, liver and heart, black spots on the kidney and accumulation of fluid in the visceral cavity, stomach and intestines were observed. Gall bladder content had pale and translucent aspect. Strong and slight positive correlations between number of nematodes and fish weight were estimated within the 0-100g and 100-200g fish weight group, respectively. Blood smears from infected fish showed variation in erythrocyte size (anisocytosis and shape (poikilocytosis, and also dividing erythrocytes. No significant alteration (P>0.05 was shown as to erythrocyte, leukocyte count, haemoglobin concentration and thrombocyte and monocyte percentage. Parasite infection provoked significant reduction (PEstudou-se efeito da infecção por Goezia leporini Martins & Yoshitoshi, 2003 (Nematoda: Anisakidae sobre as características hematológicas de Leporinus macrocephalus (Osteichthyes:Anostomidae cultivado. Palidez das brânquias, rins, fígado e coração, pontos negros nos rins e acúmulo de líquido na cavidade visceral, estômago e intestinos foram observados. O conteúdo da vesícula biliar tinha aparência pálida e translúcida. Observaram-se alta e moderada correlações positivas entre número de nematóides e peso do peixe estimadas dentro dos grupos de peixe de 0-100g e 100-200g, respectivamente. As extensões sangüíneas revelaram variações no tamanho (anisocitose e forma (poiquilocitose dos eritrócitos, bem como eritrócitos em divisão. Não houve alteração (P>0,05 na contagem total de eritrócitos, de leucócitos, na taxa de hemoglobina e nos percentuais de trombócitos e monócitos. A infecção provocou redução (P<0,05 no percentual de hematócrito, no volume corpuscular médio, na concentração de hemoglobina

  17. A new heligmonellid (Nematoda) from Sylvilagus floridanus (Leporidae) in Costa Rica, with some comments on species of Paraheligmonella Durette-Desset, 1971. (United States)

    Digiani, María Celina; Carreño, Ramón A; Durette-Desset, Marie-Claude


    Paraheligmonella kinsellai n. sp. (Nematoda: Heligmonellidae: Heligmonellinae) is described from the small intestine of a cottontail rabbit Sylvilagus floridanus (Allen, 1890) (Leporidae) from Costa Rica. The new species is similar to P. romerolagi (Gibbons and Kumar, 1980), parasitic in Romerolagus diazi from Mexico and to P. lamothei Digiani, Carreño, and Durette-Desset, 2008, parasitic in Sylvilagus floridanus from Costa Rica, by the characters of the synlophe at mid-body, i.e., 14 cuticular ridges and a single axis of orientation inclined at 30 degrees to the sagittal axis in both sexes. The males of the new species are distinguished from those of P. romerolagi by a caudal bursa that is not bell-shaped, a bursal pattern of type 2-3 with a tendency to 2-2-1, and a genital cone that is not hypertrophied. They are also distinguished from the males of P. lamothei by having the same bursal pattern in both lobes (in P. lamothei the pattern is 2-2-1 on the right lobe and 2-3, with a tendency to 2-2-1, on the left lobe), rays 3 are much longer than rays 2, rays 2 and 3 diverging more proximally, and rays 8 are longer than the dorsal ray. The females of the new species also differ from those of P. lamothei by the shape of the posterior extremity (long and strongly curved vs. short and nearly straight) and by the synlophe at the ovejector level (ridge no. 1' hypertrophied and remaining ridges reduced vs. ventral ridges hypertrophied and dorso-lateral ridges reduced). PMID:19071967

  18. Two new species of Philometra Costa, 1845 (Nematoda: Philometridae) from Mycteroperca spp. (Serranidae) in the North-West Atlantic and northern Gulf of Mexico, USA. (United States)

    Moravec, František; Bakenhaster, Micah D; Adams, Douglas H


    Based on light and scanning electron microscopical studies, two new species of Philometra Costa, 1845 (Nematoda: Philometridae) are described from two species of Mycteroperca Gill (Serranidae), marine perciform fishes, in coastal waters off Florida, USA: Philometra deburonae n. sp. from the inner side of operculum of the yellowfin grouper Mycteroperca venenosa (L.) and P. incognita n. sp. from the ovary of the gag M. microlepis (Goode & Bean). Philometra deburonae n. sp. is mainly characterised by the body length of males (1.90-2.38 mm), the length of the spicules (78-84 µm) and gubernaculum (54 µm) and the presence of small outer cephalic papillae, a pair of fairly large caudal projections and the oesophageal gland extending anteriorly beyond the nerve-ring in subgravid females. Philometra incognita n. sp. is distinguished by the caudal mound consisting of two lateral reniform parts widely separated dorsally from each other, the absence of a pair of large papillae situated posteriorly to the cloaca, the shape and structure of the distal end of the gubernaculum plus the lengths of the spicules (117-141 µm) and gubernaculum (60-81 µm) in the male, the absence of caudal projections and the comparatively large larvae in the uterus (660-675 µm long) of the gravid female, as well as, the body length of both males (2.45-3.11 mm) and gravid females (120-180 mm). The present descriptions of an additional two new philometrids increases the number of recorded nominal species of Philometra parasitising groupers (Serranidae) in the Gulf of Mexico to nine. PMID:27221001

  19. Molecular genetic conspecificity of Spiculopteragia houdemeri (Schwartz, 1926) and S. andreevae (Dróżdż, 1965) (Nematoda: Ostertagiinae) from wild ruminants in Japan. (United States)

    Sultan, K; Omar, M; Makouloutou, P; Kaneshiro, Y; Saita, E; Yokoyama, M; Suzuki, K; Hosoi, E; Sato, H


    Male dimorphism of the subfamily Ostertagiinae (Nematoda: Trichostrongylidae) is a well-known phenomenon, and two or more morphotypes of a single species have previously been described as different species. Two Spiculopteragia spp., S. houdemeri (syn. S. yamashitai) and S. andreevae (syn. Rinadia andreevae) recorded in Asian cervids and wild bovids, are considered to represent major and minor morphs of S. houdemeri, respectively, based solely on their co-occurrence in the same host individual along with monomorphic females. In this study, males of morph houdemeri ( = S. houdemeri) and morph andreevae ( = S. andreevae) as well as females with three different vulval ornamentations were collected from sika deer (Cervus nippon) and Japanese serows (Capricornis crispus) distributed on the mainland of Japan. Morphologically characterized worms were subjected to molecular genetic analyses based on the internal transcribed spacer region of the ribosomal RNA gene and a partial region of the cytochrome c oxidase subunit I gene of mitochondrial DNA. Of 181 collected sika deer, 177 (97.8%) and 73 (40.3%) deer harboured males of morphs houdemeri and andreevae, respectively. Worm numbers of the former morph were found to range between 1 and 444 per individual, whereas only 1-25 worms per individual were detected for the latter morph. Five out of six serows harboured 47-71 or 2-9 males of morphs houdemeri and andreevae per individual, respectively. Females with one or two vulval flaps were predominant, but there was a substantial presence of flapless females in both host species. All the morphs of male and female adults had an identical genetic background, thus directly confirming the morphological polymorphism of S. houdemeri. PMID:23168162

  20. Preparation and Identification of a Human Single Chain Fv Antibody Against Ascaris lumbricoides%抗蛔虫人源单链抗体库的构建及鉴定

    Institute of Scientific and Technical Information of China (English)

    何光志; 田维毅; 高英; 王平; 王文佳; 奚锦; 俞琦; 王乾宇; 黄高


    Objective To construct humanize phage antibody library against Ascaris lumbricoides and to screen specificity scFv to Ascaris lumbricoides. Methods Total RNA was abstracted from peripheral blood lympho-cytes of 20 persons, and was used to amplify VH and VL gene by RT-PCR. The amplified VH and VL genes were spliced to form scFv gene which was cloned into pCANTAB-SE phagemid, and the constructed recombinant phage-mid was transformed to E. Coli TC1 to construct human natural single-chain antibody library from which positive clones were screened. Results A primary library of 1.5 × 106 and a second library of 1.2 × 106 were constructed. Conclusion This study was to provide us the basis for radionuclide imaging and therapy for ascariasis.%目的:构建抗蛔虫人源单链抗体库,从中筛选建抗蛔虫人源特异性单链抗体.方法:分离10个患蛔虫病人的淋巴细胞,提取总RNA反转录为cDNA,PCR扩增人抗体重链(VH)和轻链(VL)可变区基因,采用SOE-PCR法将VH和VL片段随机拼接成scFv片段,并克隆入噬菌粒载体pCANTAB5E中,构建噬菌体单链抗体库.结果:初级库库容量为1.8×106,在大肠杆菌TG1中重组后得到1.6×106的次级抗体库.结论:本研究成功构建抗蛔虫人源单链抗体库,拟在为蛔虫病的预防、诊断、治疗奠定基础.

  1. Molecular epidemiology of ascariasis

    DEFF Research Database (Denmark)

    Betson, Martha; Nejsum, Peter; Bendall, Richard P.;


    BACKGROUND: The roundworm Ascaris lumbricoides infects 0.8 billion people worldwide, and Ascaris suum infects innumerable pigs across the globe. The extent of natural cross-transmission of Ascaris between pig and human hosts in different geographical settings is unknown, warranting investigation....... METHODS: Adult Ascaris organisms were obtained from humans and pigs in Europe, Africa, Asia, and Latin America. Barcodes were assigned to 536 parasites on the basis of sequence analysis of the mitochondrial cytochrome c oxidase I gene. Genotyping of 410 worms was also conducted using a panel of...... microsatellite markers. Phylogenetic, population genetic, and Bayesian assignment methods were used for analysis. RESULTS: There was marked genetic segregation between worms originating from human hosts and those originating from pig hosts. However, human Ascaris infections in Europe were of pig origin, and...

  2. Larvas de simulídeos (Diptera, Simuliidae do centro oeste, sudeste e sul do Brasil, parasitadas por microsporídeos (Protozoa e mermitídeos (Nematoda Simulids larvae (Diptera, Simuliidae from middle western, southeastern and southern Brazil, with microsporids (Protozoa and mermithids (Nematoda parasites

    Directory of Open Access Journals (Sweden)

    Carmen Ambrós Ginarte


    Full Text Available A survey of simulid larval parasites was carried out in different localities of the states of Mato Grosso, Minas Gerais, São Paulo, Paraná, Santa Catarina and Rio Grande do Sul, Brazil, from February 1996 to May 1998. Prevalences for the microsporidian Polydispyrenia simulii Lutz & Splendore, 1908 were found in Morungaba and Leme, São Paulo, ranging from around 0.7 to 66.7%, depending mainly on the host simulid species. Microsporidiosis was registered in localities of São Paulo, Paraná, Santa Catarina and Rio Grande do Sul. Parasitism by Isomermis sp. (Nematoda, Mermithidae was found in Simulium larvae from Serra do Japi, ranging from 0.8 to 45.8%, depending on the simulid species and the larval microhabitat in the stream, whether a cemented ramp in a lake outlet or the natural stream bed. Parasitism by mermithids was also found in ten localities. Mycoses caused by Coelomycidium sp. were for the first time recorded for larvae of Simulium (Chirostilbia pertinax Kollar, 1832.

  3. Halophilanema prolata n. gen., n. sp. (Nematoda: Allantonematidae, a parasite of the intertidal bug, Saldula laticollis (Reuter(Hemiptera: Saldidae on the Oregon coast

    Directory of Open Access Journals (Sweden)

    Poinar George O


    Full Text Available Abstract Background It is rare to find terrestrial nematode lineages parasitizing arthropods inhabiting the intertidal or littoral zone of the oceans. During an ecological study along the Oregon dunes, an allantonematid nematode (Tylenchomorpha: Allantonematidae was discovered parasitizing the intertidal shore bug, Saldula laticollis (Reuter(Hemiptera: Saldidae. This shore bug is adapted to an intertidal environment and can survive short periods of submergence during high tides. The present study describes the nematode parasite and discusses aspects of its development, ecology and evolution. Methods Adults and last instar nymphs of S. laticollis (Hemiptera: Saldidae were collected from the high intertidal zone among clumps of Juncus L. (Juncaceae plants at Waldport, Oregon on October 3, 2011. The bugs were dissected in 1% saline solution and the nematodes killed in 1% Ringers solution and immediately fixed in 5% formalin (at 20°C. Third stage juveniles removed from infected hosts were maintained in 1% saline solution until they matured to the adult stage, molted and mated. Results Halophilanema prolata n. gen., n. sp. (Nematoda: Allantonematidae is described from last instar nymphs and adults of the intertidal bug, Saldula laticollis on the Oregon coast. The new genus can be distinguished from other genera in the Allantonematidae by a stylet lacking basal knobs in both sexes, an excretory pore located behind the nerve ring, ribbed spicules, a gubernaculum, the absence of a bursa and the elongate-tubular shape of the ovoviviparous parasitic females. Studies of the organogenesis of Halophilanema showed development to third stage juveniles in the uterus of parasitic females. Maturation to the free-living adults and mating occurred in the environment. The incidence of infection of S. laticollis ranged from 0% to 85% depending on the microhabitat in the intertidal zone. Conclusions Based on the habitat and morphological characters, it is proposed

  4. Anthelmintic activity of chicory (Cichorium intybus): in vitro effects on swine nematodes and relationship to sesquiterpene lactone composition

    DEFF Research Database (Denmark)

    Williams, Andrew; Pena-Espinoza, Miguel Angel; Boas, Ulrik;


    Chicory is a perennial crop that has been investigated as a forage source for outdoor-reared ruminants and pigs, and has been reported to have anthelmintic properties. Here, we investigated in vitro anthelmintic effects of forage chicory-extracts against the highly prevalent swine parasites Ascaris...... suum and Oesophagostomum dentatum. Methanol extracts were prepared and purified from two different cultivars of chicory (Spadona and Puna II). Marked differences were observed between the anthelmintic activity of extracts from the two cultivars. Spadona extracts had potent activity against A. suum...... anthelmintic activity of forage chicory towards swine nematodes. Our results indicate a significant anthelmintic effect, which may possibly be related to SL composition....

  5. Possible presence of common tyvelose-containing glycans in Trichinella L1 larvae and embryonated eggs of several nematodes

    Directory of Open Access Journals (Sweden)

    Dea-Ayuela M.A.


    Full Text Available A monoclonal antibody (mAb US4 recognising an epitope containing tyvelose within the T. spiralis L-1 muscle larvae (TSL-1 antigens was tested in western-blot against various antigenic preparations from different stages of the following nematodes: T. spiralis (L1,adult, T. muris (egg, L1, L3, adult, Ascaris suum (egg, adult, Toxocara canis (egg, adult, Anisakis simplex (L3 and Haemochus contortus (egg. Positive reaction was present in antigen preparations from L1 larvae of T. spiralis and T. muris and from embryonated eggs of T. muris, A. suum, T. canis and H. conlortus.

  6. The presence of serum anti-Ascaris lumbricoides IgE antibodies and of Trichuris trichiura infection are risk factors for wheezing and/or atopy in preschool-aged Brazilian children

    Directory of Open Access Journals (Sweden)

    Alcântara-Neves Neuza M


    Full Text Available Abstract Background The elucidation of factors that trigger the development of transient wheezing in early childhood may be an important step toward understanding the pathogenesis of asthma and other allergic diseases later in life. Transient wheezing has been mainly attributed to viral infections, although sensitisation to aeroallergens and food allergens may occur at an early age. In developing countries, intestinal helminthic infections have also been associated with allergy or atopy-related disorders. Objective The aim of this study was to explore the association of Trichuris trichiura and Ascaris lumbricoides infections with wheezing and atopy in early childhood. Study design A cross-sectional study using a Portuguese-language ISAAC phase I questionnaire, adapted for preschool-aged children, nested in a cohort study of childhood diarrhoea, was conducted on 682 children. Two faecal samples per child were examined for the presence of intestinal helminthic infection. IgE antibodies against three allergenic preparations (Dermatophagoides pteronyssinus, Blomia tropicalis and common child food, as well as against A. lumbricoides antigens, were measured in a sub-sample of these children, whose parents allowed the procedure. Atopy was defined by the presence of levels of serum IgE antibodies ≥0.35 kU/L against at least one of the three tested allergenic preparations. Results Active T. trichiura infection but not A. lumbricoides infection was positively associated with wheezing in the total studied children population [adjusted OR = 2.60; CI = 1.54;4.38] and in the atopic children sub-population [adjusted OR = 3.07; CI = 1.00;9.43]. The association with atopy was also positive and statistically significant only in the brute analysis [OR = 2.13; CI = 1.03;4.40]. Anti-A. lumbricoides IgE antibodies, but not current A. lumbricoides infection, were positively associated with wheezing in atopic children [adjusted OR = 2.01; CI = 1.00;4.50] and in non

  7. Investigation on contamination of Ascaris lumbricoides eggs in the different soil of three counties in Ganso Province%甘肃省三县土壤中人蛔虫卵污染状况调查

    Institute of Scientific and Technical Information of China (English)

    李凡; 杨成明; 陈生邦; 杨俊克; 令晓兰; 华红玲


    目的 了解甘肃省农村居民生活环境中人蛔虫卵污染的现状. 方法 分别采集武山县、凉州区、岷县3个调查点10~20户居民4类环境中的土壤,应用饱和硝酸钠漂浮镜检法检查土样中人蛔虫卵,计算土壤样品的蛔虫卵阳性检出率,并对3地居民蛔虫感染率进行分析比较. 结果 土壤中人蛔虫卵总检出率为28%,菜园、厕所周边、庭院、厨房土壤的人蛔虫卵检出率依次为30%、36%、30%和16%. 结论 调查点环境蛔虫卵污染严重,应采取措施改善环境卫生,减少居民感染蛔虫.%Objective To investigate the different soil contamination of Ascaris lumbricoides eggs at liv-ing environments in rural areas. Methods Wushan County, Liangzhou District and Min County were select-ed as 3 pilots for investigation. Ten samples of soil including 4 different environments from Min County and 20 samples from the others were randomly collected. A. lumbricoides eggs in the different soil were floated with sat-urated nitrate and counted by microscopy. Positive rate of A. lumbricoides eggs in the soils was then calculated and A. lumbricoides infection rates of inhabitants at 3 pilots were compared and analysed. Results The over-all positive rate of A. lumbricoides eggs in the soils was 28%, and among them the rates at the vegetable gar-dens, lavatory surroundings, courtyards in the countryside and kitchens were 30% ,36% ,30% and 16%, re-spectively. Conclusion The pilots were badly contaminated by A. lumbricoides eggs. Measures should be taken to improve the living environments and decrease the infection rate of Ascaris in the residents.

  8. Dicty_cDB: Contig-U13956-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U13956-1 no gap 865 3 4313689 4312825 MINUS 3 3 U13956 0 1 0 0 1 0 0 0 0 1 0 0 0 0 Show C ... ( CB014250 ) As_tgz_76F05_SKPL Ascaris suum adult male ... testis ... 44 2e-04 2 ( BQ833965 ) Al_am_01C08_T3 ... Ascaris lumbricoides adult male ... wh... 50 3e-04 2 ( BM278178 ) As_tgz_54C02_SKPL As ...

  9. Dicty_cDB: SHL716 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 38 |pid:none) Takifugu rubripes cosmid 124A22 Md... 242 6e-64 AY582533_1( AY582533 |pid:none) Canis familiaris multidrug resis...lgplerlqhfqv kn*qlisiqii*rmqe--- ---n*ycrw*y*iqeftfllsnqt***rf*rlhfnftiwyyhcigw**www*inmsiii...afleasl*lynlvlplhwlvivvvvnqhvyhyyk dsiiqswvksssmvii*ri*mfvildislv*lvknqlysvvqlp...2e-14 4 ED213436 |ED213436.1 AUAC-aaz56c09.b1 Ascaris suum whole genome shotgun library (PMAJ_4 GSS) Ascaris...ta... 238 1e-62 DQ068953_1( DQ068953 |pid:none) Canis lupus familiaris

  10. Dicty_cDB: VHC211 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ftrtsw*sw*srcmfpkscrfk*lc*n*ct*wrik**ilkeiqccsisqstisittqs e*ilsck*nsfh*c*nqrcfwsiiq*fw--- ---INSIQFEKDDDTNH...s EST, clone MPMGp1173D192Q, 5' end. 38 6e-04 2 DR174755 |DR174755.1 HR0003_N01:A Triphysaria versicolor (parasi...74741 |DR174741.1 HR0003_M08:A Triphysaria versicolor (parasitic plant) root-tip, host reverse SSH librar...color (parasitic plant) root-tip, host reverse SSH library Triphysaria versicolor cD...88983 |ED188983.1 AUAC-aav62e08.g1 Ascaris suum whole genome shotgun library (PMAJ_4 GSS) Ascaris

  11. New records of philometrids (Nematoda: Philometridae) from marine fishes off Iraq, with the erection of two new species and the first description of the male of Philometroides eleutheronemae Moravec & Manoharan, 2013. (United States)

    Moravec, František; Ali, Atheer H; Abed, Jasim M; Shaker, Sara J


    Based on light and scanning electron microscopical studies, the following five species of philometrid nematodes (Nematoda: Philometridae) are described from marine fishes from off Basrah, southern Iraq (Arabian Gulf): Philometra iraqiensis n. sp. (females) from the abdominal cavity and ovary of the Klunzinger's mullet Liza klunzingeri (Day) (Mugiliformes: Mugilidae), P. megalaspidis n. sp. (females) from the ovary of the torpedo scad Megalaspis cordyla (Linnaeus) (Perciformes: Carangidae), Philometra sp. 1 (females) from the ovary of the greater lizardfish Saurida tumbil (Bloch) (Aulopiformes: Synodontidae), Philometra sp. 2 (females) from the ovary of the bartail flathead Platycephalus indicus (Linnaeus) (Scorpaeniformes: Platycephalidae) and Philometroides eleutheronemae Moravec & Manoharan, 2013 (male and females) from the ovary of the fourfinger threadfin Eleutheronema tetradactylum (Shaw) (Perciformes: Polynemidae). The new species are characterised mainly by the body length, the length and structure of the oesophagus and caudal end and by the family of their fish hosts. The male and the gravid female of P. eleutheronemae are described for the first time; the finding of this species in Iraqi waters represents the first record of this nematode in the region of the Arabian (=Persian) Gulf. PMID:26790678

  12. Dicty_cDB: AFO713 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFO713 (Link to dictyBase) - - - Contig-U10734-1 AFO713P (Link to Original ... RT1 Zarlenga v1 Ascaris suum cDNA 5' similar to SW:ERP 5_CAEEL Q11067 PROBABLE PROTEIN DISULFIDE ISOMERASE ... PROTEIN DISULFIDE ISOMERASE A4 PRECURSOR (PROTEIN ERP -72) (ERP 72), mRNA sequence. 60 5e-05 1 BU791776 |S ...

  13. Dicty_cDB: AFJ720 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFJ720 (Link to dictyBase) - - - Contig-U10734-1 AFJ720Z (Link to Original ... RT1 Zarlenga v1 Ascaris suum cDNA 5' similar to SW:ERP 5_CAEEL Q11067 PROBABLE PROTEIN DISULFIDE ISOMERASE ... PROTEIN DISULFIDE ISOMERASE A4 PRECURSOR (PROTEIN ERP -72) (ERP 72), mRNA sequence. 60 4e-05 1 dna update ...

  14. Dicty_cDB: AFJ593 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFJ593 (Link to dictyBase) - - - Contig-U10734-1 AFJ593P (Link to Original ... RT1 Zarlenga v1 Ascaris suum cDNA 5' similar to SW:ERP 5_CAEEL Q11067 PROBABLE PROTEIN DISULFIDE ISOMERASE ... PROTEIN DISULFIDE ISOMERASE A4 PRECURSOR (PROTEIN ERP -72) (ERP 72), mRNA sequence. 60 3e-05 1 BM595365 |B ...

  15. Dicty_cDB: AFN587 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFN587 (Link to dictyBase) - - - Contig-U10734-1 AFN587P (Link to Original ... RT1 Zarlenga v1 Ascaris suum cDNA 5' similar to SW:ERP 5_CAEEL Q11067 PROBABLE PROTEIN DISULFIDE ISOMERASE ... PROTEIN DISULFIDE ISOMERASE A4 PRECURSOR (PROTEIN ERP -72) (ERP 72), mRNA sequence. 60 5e-05 1 BU791776 |S ...

  16. Dicty_cDB: AFN855 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFN855 (Link to dictyBase) - - - Contig-U10734-1 AFN855Z (Link to Original ... RT1 Zarlenga v1 Ascaris suum cDNA 5' similar to SW:ERP 5_CAEEL Q11067 PROBABLE PROTEIN DISULFIDE ISOMERASE ... PROTEIN DISULFIDE ISOMERASE A4 PRECURSOR (PROTEIN ERP -72) (ERP 72), mRNA sequence. 60 4e-05 1 dna update ...

  17. Dicty_cDB: AFO479 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFO479 (Link to dictyBase) - - - Contig-U10734-1 AFO479Z (Link to Original ... RT1 Zarlenga v1 Ascaris suum cDNA 5' similar to SW:ERP 5_CAEEL Q11067 PROBABLE PROTEIN DISULFIDE ISOMERASE ... PROTEIN DISULFIDE ISOMERASE A4 PRECURSOR (PROTEIN ERP -72) (ERP 72), mRNA sequence. 60 4e-05 1 dna update ...

  18. Dicty_cDB: AFJ810 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFJ810 (Link to dictyBase) - - - Contig-U10734-1 AFJ810Z (Link to Original ... RT1 Zarlenga v1 Ascaris suum cDNA 5' similar to SW:ERP 5_CAEEL Q11067 PROBABLE PROTEIN DISULFIDE ISOMERASE ... PROTEIN DISULFIDE ISOMERASE A4 PRECURSOR (PROTEIN ERP -72) (ERP 72), mRNA sequence. 60 4e-05 1 dna update ...

  19. Dicty_cDB: AFJ864 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFJ864 (Link to dictyBase) - - - Contig-U10734-1 AFJ864Z (Link to Original ... RT1 Zarlenga v1 Ascaris suum cDNA 5' similar to SW:ERP 5_CAEEL Q11067 PROBABLE PROTEIN DISULFIDE ISOMERASE ... PROTEIN DISULFIDE ISOMERASE A4 PRECURSOR (PROTEIN ERP -72) (ERP 72), mRNA sequence. 60 4e-05 1 dna update ...

  20. Dicty_cDB: AFJ656 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFJ656 (Link to dictyBase) - - - Contig-U10734-1 AFJ656Z (Link to Original ... RT1 Zarlenga v1 Ascaris suum cDNA 5' similar to SW:ERP 5_CAEEL Q11067 PROBABLE PROTEIN DISULFIDE ISOMERASE ... PROTEIN DISULFIDE ISOMERASE A4 PRECURSOR (PROTEIN ERP -72) (ERP 72), mRNA sequence. 60 3e-05 1 BU791776 |S ...

  1. Dicty_cDB: AFN712 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFN712 (Link to dictyBase) - - - Contig-U10734-1 AFN712Z (Link to Original ... RT1 Zarlenga v1 Ascaris suum cDNA 5' similar to SW:ERP 5_CAEEL Q11067 PROBABLE PROTEIN DISULFIDE ISOMERASE ... PROTEIN DISULFIDE ISOMERASE A4 PRECURSOR (PROTEIN ERP -72) (ERP 72), mRNA sequence. 60 4e-05 1 dna update ...

  2. Dicty_cDB: AFK381 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFK381 (Link to dictyBase) - - - Contig-U10734-1 AFK381Z (Link to Original ... RT1 Zarlenga v1 Ascaris suum cDNA 5' similar to SW:ERP 5_CAEEL Q11067 PROBABLE PROTEIN DISULFIDE ISOMERASE ... PROTEIN DISULFIDE ISOMERASE A4 PRECURSOR (PROTEIN ERP -72) (ERP 72), mRNA sequence. 60 4e-05 1 dna update ...

  3. Dicty_cDB: AFK136 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFK136 (Link to dictyBase) - - - Contig-U10734-1 AFK136Z (Link to Original ... RT1 Zarlenga v1 Ascaris suum cDNA 5' similar to SW:ERP 5_CAEEL Q11067 PROBABLE PROTEIN DISULFIDE ISOMERASE ... PROTEIN DISULFIDE ISOMERASE A4 PRECURSOR (PROTEIN ERP -72) (ERP 72), mRNA sequence. 60 4e-05 1 dna update ...

  4. Dicty_cDB: AFO247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFO247 (Link to dictyBase) - - - Contig-U10734-1 AFO247Z (Link to Original ... RT1 Zarlenga v1 Ascaris suum cDNA 5' similar to SW:ERP 5_CAEEL Q11067 PROBABLE PROTEIN DISULFIDE ISOMERASE ... PROTEIN DISULFIDE ISOMERASE A4 PRECURSOR (PROTEIN ERP -72) (ERP 72), mRNA sequence. 60 4e-05 1 dna update ...

  5. Dicty_cDB: AFN894 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFN894 (Link to dictyBase) - - - Contig-U10734-1 AFN894P (Link to Original ... RT1 Zarlenga v1 Ascaris suum cDNA 5' similar to SW:ERP 5_CAEEL Q11067 PROBABLE PROTEIN DISULFIDE ISOMERASE ... PROTEIN DISULFIDE ISOMERASE A4 PRECURSOR (PROTEIN ERP -72) (ERP 72), mRNA sequence. 60 5e-05 1 dna update ...

  6. Dicty_cDB: AFJ752 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFJ752 (Link to dictyBase) - - - Contig-U10734-1 AFJ752Z (Link to Original ... RT1 Zarlenga v1 Ascaris suum cDNA 5' similar to SW:ERP 5_CAEEL Q11067 PROBABLE PROTEIN DISULFIDE ISOMERASE ... PROTEIN DISULFIDE ISOMERASE A4 PRECURSOR (PROTEIN ERP -72) (ERP 72), mRNA sequence. 60 3e-05 1 dna update ...

  7. Dicty_cDB: AFO474 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFO474 (Link to dictyBase) - - - Contig-U10734-1 AFO474Z (Link to Original ... RT1 Zarlenga v1 Ascaris suum cDNA 5' similar to SW:ERP 5_CAEEL Q11067 PROBABLE PROTEIN DISULFIDE ISOMERASE ... PROTEIN DISULFIDE ISOMERASE A4 PRECURSOR (PROTEIN ERP -72) (ERP 72), mRNA sequence. 60 4e-05 1 dna update ...

  8. Dicty_cDB: AFO351 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFO351 (Link to dictyBase) - - - Contig-U10734-1 AFO351Z (Link to Original ... RT1 Zarlenga v1 Ascaris suum cDNA 5' similar to SW:ERP 5_CAEEL Q11067 PROBABLE PROTEIN DISULFIDE ISOMERASE ... PROTEIN DISULFIDE ISOMERASE A4 PRECURSOR (PROTEIN ERP -72) (ERP 72), mRNA sequence. 60 4e-05 1 BU791776 |S ...

  9. Dicty_cDB: AFO212 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFO212 (Link to dictyBase) - - - Contig-U10734-1 AFO212Z (Link to Original ... RT1 Zarlenga v1 Ascaris suum cDNA 5' similar to SW:ERP 5_CAEEL Q11067 PROBABLE PROTEIN DISULFIDE ISOMERASE ... PROTEIN DISULFIDE ISOMERASE A4 PRECURSOR (PROTEIN ERP -72) (ERP 72), mRNA sequence. 60 4e-05 1 dna update ...

  10. Dicty_cDB: AFK261 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFK261 (Link to dictyBase) - - - Contig-U10734-1 AFK261Z (Link to Original ... RT1 Zarlenga v1 Ascaris suum cDNA 5' similar to SW:ERP 5_CAEEL Q11067 PROBABLE PROTEIN DISULFIDE ISOMERASE ... PROTEIN DISULFIDE ISOMERASE A4 PRECURSOR (PROTEIN ERP -72) (ERP 72), mRNA sequence. 60 3e-05 1 dna update ...

  11. Dicty_cDB: AFO715 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFO715 (Link to dictyBase) - - - - AFO715P (Link to Original site) AFO715F ... RT1 Zarlenga v1 Ascaris suum cDNA 5' similar to SW:ERP 5_CAEEL Q11067 PROBABLE PROTEIN DISULFIDE ISOMERASE ... PROTEIN DISULFIDE ISOMERASE A4 PRECURSOR (PROTEIN ERP -72) (ERP 72), mRNA sequence. 60 5e-05 1 dna update ...

  12. Dicty_cDB: AFO429 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFO429 (Link to dictyBase) - - - Contig-U10734-1 AFO429Z (Link to Original ... RT1 Zarlenga v1 Ascaris suum cDNA 5' similar to SW:ERP 5_CAEEL Q11067 PROBABLE PROTEIN DISULFIDE ISOMERASE ... PROTEIN DISULFIDE ISOMERASE A4 PRECURSOR (PROTEIN ERP -72) (ERP 72), mRNA sequence. 60 4e-05 1 dna update ...

  13. Glucogeno sintasa en helmintos parasitos: inhibicion por benzimidazoles


    H. Gomez-Banqueri; M. A. Garcia Ruiz; M. Monteoliva; Sanchez-Moreno, M.


    Se ha determinado el effecto inhibidor sobre la actividad Glucogeno sintetasa (E.C.2.41.11) por parte de cuatro antihelminticos: Albendazol, Mebendazol, Parbendazol y Tiabendazol. Observandose que en todos los casos, es el Parbendazol quien ha demostrado un mayor poder inhibidor sobre la glucógeno sintetasa de Ascaris suum, Fasciola hepatica y Moniezia expansa. El Tiabendazol es el anti-helmintico que menor efecto inhibidor ha presentado sobre la enzima en los tres parasitos objeto de nuestro...

  14. Anthelmintic activity of trans-cinnamaldehyde and A- and B-type proanthocyanidins derived from cinnamon (Cinnamomum verum)


    Williams, Andrew R.; Aina Ramsay; Hansen, Tina V. A.; Ropiak, Honorata M; Helena Mejer; Peter Nejsum; Irene Mueller-Harvey; Thamsborg, Stig M.


    Cinnamon (Cinnamomum verum) has been shown to have anti-inflammatory and antimicrobial properties, but effects on parasitic worms of the intestine have not been investigated. Here, extracts of cinnamon bark were shown to have potent in vitro anthelmintic properties against the swine nematode Ascaris suum. Analysis of the extract revealed high concentrations of proanthocyanidins (PAC) and trans-cinnamaldehyde (CA). The PAC were subjected to thiolysis and HPLC-MS analysis which demonstrated tha...

  15. The effect of a diet with fructan-rich chicory roots on intestinal helminths and microbiota with special focus on Bifidobacteria and Campylobacter in piglets around weaning


    Jensen, Annette Nygaard; Mejer, Helena; Mølbak, Lars; Langkjær, Maria; Jensen, Tim Kaare; Angen, Øystein; Martinussen, Torben; Klitgaard, Kirstine; Baggesen, Dorte Lau; Thamsborg, Stig Milan; Roepstorff, Allan


    The restrictions on the use of antibiotic and anthelmintic treatments in organic pig farming necessitate alternative non-medical control strategies. Therefore, the antibiotic and parasite-reducing effect of a fructan-rich (prebiotic) diet of dried chicory was investigated in free-ranging piglets. Approximately half of 67 piglets from 9 litters were experimentally infected with Ascaris suum and Trichuris suis in the suckling period (1 to 7 weeks of age) and 58 of the piglets were challenged da...

  16. Antibacterial Activity of Recombinant Pig Intestinal Parasite Cecropin P4 Peptide Secreted from Pichia pastoris


    Song, Ki-Duk; Lee, Woon-Kyu


    Cecropins (Cec) are antibacterial peptides and their expression is induced in a pig intestinal parasite Ascaris suum by bacterial infection. To explore the usefulness of its activity as an antibiotic, CecP4 cDNA was prepared and cloned into the pPICZ B expression vector and followed by the integration into AOX1 locus in Pichia pastoris. The supernatants from cell culture were collected after methanol induction and concentrated for the test of antimicrobial activity. The recombinant P. patoris...

  17. Relative ovicidal effect of soil microfungi on thick-shelled eggs of animal-parasitic nematodes


    Thapa, Sundar; Meyling, Nicolai V.; Katakam, Kiran Kumar; Thamsborg, Stig Milan; Mejer, Helena


    Thick-shelled eggs of animal-parasitic ascarid nematodes can survive and remain infective in the environment for years. The present study was conducted to assess the effect of two species of soil microfungi (Pochonia chlamydosporia and Purpureocillium lilacinum) on the development and survival of eggs (all of faecal origin) of three ascarid species, Ascaridia galli (chicken roundworm), Toxocara canis (canine roundworm) and Ascaris suum (pig roundworm), in vitro. Ascarid eggs were embryonated ...

  18. Evaluation of soil microfungi as biological control agents against ascarid eggs


    Sundar, Thapa; Meyling, Nicolai V.; Katakam, Kiran Kumar; Thamsborg, Stig Milan; Mejer, Helena


    Thick-shelled ascarid eggs have been reported to remain infective in the environment for several years, thus posing a prolonged risk of infection to animals and/or humans. The following in vitro study was therefore conducted to evaluate the negative impact of two species of naturally occuring soil microfungi (Pochonia chlamydosporia and Paecilomyces lilacinus), on the viability of Ascaridia galli, Toxocara canis and Ascaris suum eggs. Approximately 150 fresh eggs of individual ascarid species...

  19. Ovicidal effect of microfungi on thick-shelled eggs of naimal-parasitic nematodes - an in vitro study


    Thapa, Sundar


    Thick-shelled eggs of animal-parasitic nematodes are known to survive and remain infective for long periods in contaminated soil. Therefore, the eggs accumulate over time in soil and increase the risk of transmission to their hosts. The present study was conducted to investigate if nematematophagous microfungi Pochonia chlamydosporia (biotype 10) and Paecilomyces lilacinus (strain 251) can reduce the viability of thick-shelled eggs of Ascaris suum, Ascaridia galli, Toxocara canis and Trichuri...

  20. Evaluation of soil microfungi as biological control agents against eggs of animal parasitic nematodes


    Thapa, Sundar; Meyling, Nicolai V.; Katakam, Kiran Kumar; Thamsborg, Stig Milan; Mejer, Helena


    Thick-shelled eggs of ascarid nematodes have been reported to remain infective in the environment for several years, thus posing a prolonged risk of infection to animal livestock and/or humans. An in vitro study was therefore conducted to evaluate the negative impact of two species of soil microfungi, Pochonia chlamydosporia and Purpureocillium lilacinum (syn. Paecilomyces lilacinus), on the viability of Ascaridia galli, Toxocara canis and Ascaris suum eggs. Approximately 150 fresh eggs of in...

  1. Survival rates of parasite eggs in sludge during aerobic and anaerobic digestion.


    Black, M I; Scarpino, P V; O'Donnell, C.J.; Meyer, K B; Jones, J V; Kaneshiro, E S


    The effects of mesothermic anaerobic or aerobic sludge digestion on survival of eggs from the roundworms Ascaris suum, toxocara canis, Trichuris vulpis, and Trichuris suis and from the rat tapeworm Hymenolepis diminuta were studied. Destruction of eggs throughout a 15-day treatment period, as well as their viabilities after reisolation, was analyzed. The laboratory model digesters used in this study were maintained at a 15-day retention schedule, partially simulating a continuously operating ...

  2. Paleoparasitological remains revealed by seven historic contexts from "Place d'Armes", Namur, Belgium


    Gino Chaves da Rocha; Stephanie Harter- Lailheugue; Matthieu Le Bailly; Adauto Araújo; Luiz Fernando Ferreira; Nicolau Maués da Serra-Freire; Françoise Bouchet


    Human occupation for several centuries was recorded in the archaeological layers of "Place d'Armes", Namur, Belgium. Preventive archaeological excavations were carried out between 1996/1997 and seven historical strata were observed, from Gallo-Roman period up to Modern Times. Soil samples from cesspools, latrines, and structures-like were studied and revealed intestinal parasite eggs in the different archaeological contexts. Ascaris lumbricoides, A. suum, Trichuris trichiura, T. suis. Taenia ...

  3. 蛔虫提取物对小鼠Lewis肺癌细胞的细胞毒性作用%Cytotoxic action of a whole worm extract of Ascaris lumbricoides on LLC

    Institute of Scientific and Technical Information of China (English)

    杨小军; 彭卫东; 徐友妹; 袁铿


    目的 探讨蛔虫提取物对小鼠Lewis肺癌细胞(LLC)的细胞毒作用. 方法 选用8种浓度的蛔虫提取物诱导小鼠Lewis肺癌细胞.分别在诱导后24、48、72 h采用四氮唑盐酶还原法(MTT)测A492值,计算细胞存活率和抑制率.结果 不同浓度的蛔虫提取物分别作用LLC细胞24、48和72 h,对LLC细胞的增殖均有明显的抑制作用,呈剂量依赖.且以48 h抑制作用最强,之后随着作用时间的延长,BEAL对肿瘤细胞的抑制作用降低. 结论 蛔虫提取物对小鼠Lewis肺癌细胞具有细胞毒性作用,能够诱导LLC细胞发生凋亡.%Objective To investigate the cytotoxic action of a whole worm extract of Ascaris lumbricoides (BEAL) on a lewis lung carcinoma cell (LLC) line in vitro.Methods Eight concentrations of whole worm extract of A.lumbricoides were chosen to induce cytotoxicity in LLC.Twenty-four, 48, and 72 h after induction, the cell survival rate and inhibition rate were calculated according to the A492 results of a microculture tetrazolium test (MTT).Results Twenty-four, 48, and 72 h after induction with different concentrations of whole worm extract of A.lumbricoides, the inhibition rate behaved in a concentration-dependent manner.The inhibition rate peaked 48 h after induction but decreased afterwards.Conclusion A whole worm extract of A.lumbricoides had varying levels of cytotoxicity on LLC and induced cell apoptosis.

  4. The killing effect of Ascaris peptide yeast fermentation products on Leishmania donovani%蛔虫抗菌肽酵母发酵产物对杜氏利什曼原虫杀伤作用的研究

    Institute of Scientific and Technical Information of China (English)

    仲维霞; 屈金辉; 王洪法; 赵桂华; 崔勇


    目的 研究蛔虫抗菌肽酵母发酵产物对杜氏利什曼原虫的抑杀作用,探讨此抗菌肽可作为治疗黑热病的药物的可能性.方法 培养利什曼原虫至适当浓度,接种于96孔组织培养板中,设实验组和对照组,实验组分别加入10μl浓度为30、60、90、120、150、180μg∥ml的蛔虫抗菌肽酵母发酵产物浓缩上清液,每个浓度重复9孔,对照组加相应体积的对照表达产物,分别在连续培养24、48和72 h后,每孔加入20μl四甲基偶氮唑盐(5 mg∥ml),继续培养4 h,每孔加入100μlformanzan溶解液,孵育4 h左右,在570 am测定吸光度,根据吸光度数值计算杀伤率.结果 实验组按浓度由低到高(30~180μg//ml)对应的杀伤率在培养24 h后为20.12%、41.39%、64.89%、65.14%、66.49%和66.49%,培养48 h后为40.12%、67.34%、75.1l%、82.03%、82.75%和82.75%;培养72 h后为45.89%、65.57%、78.49%、82.58%、85.38%和85.38%.蛔虫抗菌肽发酵产物浓度为150μg/ml时,杀伤作用最大,杀伤率为85.38%,IC50为50μg/ml.结论 蛔虫抗菌肽对利什曼原虫有很强的杀伤作用.%Objective To study the killing effect of yeast fermentation product of Ascaris antibacterial peptide on Leishmania donovani and to investigate the possibility of antibacterial peptide as drug for kala-azar.Methods Leishmania was cultured to appropriate concentration,and was seeded in 96-well tissue culture plate.Experimental test and the negative control hole were designed.Then 10 μl supernatant of induced bacteria expression product was added into experimental hole with concentration of 30,60,90,120,150 and 180μg/ml.All levels were repeated nine holes.Then 20 μl methyl thiazolyl tetrazolium(MTT,5 mg/ml)was added into each hole and culturing for 4 h after culturing for 24,48 and 72 h,and another 100μl of Formanzan was pulsed,absorbance was read at 570 nm after another 4 h cultured.The killing effect is calculate from A570.Results At concentrations of the experimental


    Directory of Open Access Journals (Sweden)

    K.B. Mirbahar, R.B. Mirbahar, Nasreen Akhter, W.N. McDonell1 and P. Eyre2,


    Full Text Available The efficacy of atropine to attenuate Ascaris suum induced bronchospasm was studied in 6 conscious standing horses. Animals were challenged with saline and a 10-2 dilution of A. suum aerosolized for 3 minutes. Pulmonary function tests (PFT were performed at 15, 30 and 60 minutes after antigen challenge. Pulmonary mechanics and ventilation values were measured using a differential pressure transducer and a Fleisch Pnemotachograph. One week later, animals were treated with atropine sulfate (6.0 mg administered IM and rechallenged with saline followed by same dose of A. suum. Clinical signs noted after the inhalation of A. suum alone included hyperpnea, dyspnea, sweating and salivation. The effect of antigen was rapid in onset starting during the inhalation and lasting for over 60 minutes. The PFT revealed significant (P<0.05 increases in Wb, max.  Ppl RL, V1, f, and VT whereas the Cdyn decreased (P<0.05. The changes were more severe in lower airways. Atropine abolished the clinical signs. Comparison of post atropine saline and A. suum challenge values revealed significant increase in Wb, max.  Ppl at 15 minutes post antigen challenge. Changes in RL, f and Cdyn were abolished. Comparison of responses to A. suum in the presence and absence of atropine revealed a significant (P<0.05 inhibition of changes in max. Ppl, Wb, inspiratory and expiratory RL, VI, f and flow. The study suggested that the A. suum induced bronchospasm in the horses is mediated, at least in part by vagal reflexes.

  6. Descriptions of Philometra aenei n. sp. and P. tunisiensis n. sp. (Nematoda: Philometridae) from Epinephelus spp. off Tunisia confirm a high degree of host specificity of gonad-infecting species of Philometra Costa, 1845 in groupers (Serranidae). (United States)

    Moravec, František; Chaabane, Amira; Neifar, Lassad; Gey, Delphine; Justine, Jean-Lou


    Based on light and electron microscopical studies of males and mature females, two new gonad-infecting species of Philometra Costa, 1845 (Nematoda: Philometridae) are described from the ovary of groupers, Epinephelus spp. (Perciformes; Serranidae), in the Mediterranean Sea off Tunisia (near Sfax): Philometra aenei n. sp. from the white grouper E. aeneus (Geoffroy Saint-Hilaire) and P. tunisiensis n. sp. from the goldblotch grouper E. costae (Steindachner). Identification of both fish hosts was confirmed by barcoding of the infected fish specimens. Philometra aenei is mainly characterised by the length of conspicuously distended spicules (108-123 µm), the presence of a distinct dorsal barb at the middle region of the gubernaculum and a distinct protuberance consisting of two dorsolateral lamellar parts separated from each other by a smooth median field at its distal tip, a V-shaped mound on the male caudal extremity and by the body length of the males (2.34-3.05 mm). The male of this species was found to possess minute deirids in the cervical region, which is quite exceptional within the Philometridae. Philometra tunisiensis is distinguished from other gonad-infecting congeneric species parasitising serranids by the length of the needle-like spicules and gubernaculum (201-219 and 78-87 µm, respectively), spicule length representing 9-11% of body length, the gubernaculum/spicules length ratio of 1:2.52-2.77, the length of oesophagus in the male comprising 15-16% of the body length, the absence of a dorsal protuberance on the distal lamellar part of the gubernaculum and a pair of large papillae posterior to the cloaca, a dorsally interrupted mound on the male caudal extremity and the body length of the male (2.01-2.42 mm). The presence of three morphologically very different species of Philometra in congeneric hosts in the Mediterranean Sea confirms a high degree of host specificity of these gonad-infecting nematodes parasitising groupers. PMID:26790677

  7. A revision of the genus Paracanthonchus (Cyatholaimidae, Nematoda) with a tabular key to species and a description of P. mamubiae sp. n. from the deep North-Western Pacific (United States)

    Miljutina, Maria A.; Miljutin, Dmitry M.


    The species-rich genus of marine free-living nematodes, Paracanthonchus Mikoletzky 1924 (Nematoda: Cyatholaimidae), is revised. The genus numbers 72 valid species; twenty are indicated as species inquirenda because of poor descriptions and/or doubtful placement in the genus. Species of the genus were described from all oceans and latitudes. Of valid species, 64 ones (90%) were described from the tidal or upper subtidal zones, four species were recorded from the medium or lower shelf, and three species are abyssal. Thirty one species (43%) are known from Europe and the Northern Africa; 19 and 9 ones were described from South and North America (respectively); 8 ones were recorded from Asia; and 6 ones from the Australian region. The type species, Paracanthonchus caecus Mikoletzky 1924 has been recorded by a number of authors from various oceans around the World, yet many of these specimens have only roughly resembled the type description. Evidently, this species represents a complex of closely related species. Possibly, the same situation is in some other Paracanthonchus species, the repeated findings of which have no strong resemblance to type specimens. A tabular key to species is provided. A new abyssal species Paracanthonchus mamubiae from the Zenkevich Rise (North-Western Pacific, off North Japan, 5350 m depth) is described. The new species is characterized by: the tail, which is long with a thin, cylindrical terminal section; the absence of lateral differentiation of the cuticle; the presence of two groups of lateral pores (level of posterior part of pharynx and in cloacal region); one large dorsal tooth and two pairs of small subventral teeth combined with pharyngostomal cuticular ridges forming two denticles which may appear as a third pair of subventral teeth; 3-5 indistinct tubular preanal supplements; and a massive, proximally paired gubernaculum possessing broad flattened plates on each distal end. Each flattened gubernacular plate bears numerous (50

  8. Eosinophilic cholecystitis caused by Ascaris lumbricoides

    Institute of Scientific and Technical Information of China (English)

    Montiel-Jarquín Alvaro


    Eosinophilic cholecystitis is caused by the accumulation of eosinophils in the gallbladder wall and diagnosis is usually made based on histopahologic studies.The purpose of this paper is to comment on a case report published in Wodd J Gastroenterol 2007 luly;13 (27):3760-3762,about eosinophilic cholecystitis along with pericarditis without histopathological studies,which are considered necessary for its diagnosis.

  9. Small bowel Ascaris infestation: a diagnostic challenge


    Khan MW; Ghauri SK


    Muhammad Waqas Khan, Sanniya Khan Ghauri Section of Medicine, Department of Emergency Medicine, WHO Collaborating Centre for Emergency Medicine and Trauma Care, Aga Khan University Hospital, Karachi, Pakistan Abstract: Ascariasis is a common infestation in developing countries where there is poor hygiene. A majority of the cases are asymptomatic, with a few cases presenting with mild abdominal pain and nutritional deficiencies in the long term. Here we present a case of a young boy who prese...

  10. Ascaris lumbricoides: an overview of therapeutic targets. (United States)

    Hagel, Isabel; Giusti, Tatiana


    A. lumbricoides is the largest of the common nematode parasites of man and has been associated with intestinal pathology, respiratory symptoms and malnutrition in children from endemic areas. Current anthelmintic treatments have proven to be safe. However, a reduced efficacy of single dose drugs has been reported. In veterinary practice, anthelmintic drug resistance is an irreversible problem. Thus, research and development of sensitive tools for early detection of drug resistance as well as new anthelmintic approaches are urgently needed. In this review, we summarized data providing information about current drug therapy against A. lumbricoides and other intestinal helminths, new drugs in experimental trials, future drugs perspectives and the identification of immunogenic parasite molecules that may be suitable vaccine targets. In addition to the WHO recommended drugs (albendazole, mebendazole, levamisole, and pyrantel pamoate), new anthelmintic alternatives such as tribendimidine and Nitazoxanide have proved to be safe and effective against A. lumbricoides and other soil-transmitted helminthiases in human trials. Also, some new drugs for veterinary use, monepantel and cyclooctadepsipeptides (e.g., PF1022A), will probably expand future drug spectrum for human treatments. The development of genomic technology has provided a great amount of available nematode DNA sequences, coupled with new gene function data that may lead to the identification of new drug targets through efficient mining of nematode genomic databases. On the other hand, the identification of nematode antigens involved in different parasite vital functions as well as immunomodulatory molecules in animals and humans may contribute to future studies of new therapeutic approaches. PMID:20701574

  11. Comparison of fecal examinations and worm collection results in an investigation of Ascaris lumbricoides infection%人群蛔虫感染调查粪检与驱虫结果比较

    Institute of Scientific and Technical Information of China (English)

    姜唯声; 曾小军; 李华忠; 陈颖丹; 洪献林; 胡神助; 兰炜明; 陈奕杨


    Objective To explore the relationship hetween fecal examinations and worm collection results in a community investigation of Ascaris lumbricoides infection. Methods A total of 1 019 residents in Zhangxi Village, Nanchang County, Jiangxi Province were investigated with the Kato-Katz technique and worm collection after deworming. Results Among 1 019 residents investigated, the actual prevalence of A. lumhricoides was 30.23%, and the egg and worm positive rates were 20.41 % and 23,75%, respectively. The average burden was 2.64 worms per person, and the heavier worm burden accounted for less proportion. The heavier the worm burden, the higher ihe probability to got egg in the feees. If one person had 7 worms or more, the probability to got eggs in his feces was 100%. Among people of false negative fecal examination, 61.00% of them were infected with male worms only, whereas 7.00% were infected with immature female worms with or without male worms, and 32.00% were infected with mature female worms with or without male worms. Totally 32.47% of infected people were missed by fecal examination, including 22.08% without egg excreted, and 10.39% missed because of the method itself. Conclusion The egg positive rate is obviously lower than the actual infection rate, and the egg detection rate is correlated with the worm burden.%目的 探讨社区人群蛔虫感染调查中粪检与驱虫结果的关系.方法 选择江西省南昌县塘南乡张溪村为试点,采用Kato-Katz法粪检,双羟萘噻嘧啶化疗驱虫后收集虫体,对两者结果进行比较分析.结果 共检测1019名村民,人群实际蛔虫感染率为30.23%,其中粪检阳性率为20.41%,淘虫阳性率为23.75%.淘虫阳性感染者平均虫荷2.64条,虫荷数高的感染者所占比例较低.感染者虫荷数越多,检出虫卵的概率越高,当感染者寄生7条以上蛔虫,虫卵检出率为100%.粪检虫卵假阴性者中,感染雄虫者占61.00%,感染雌虫

  12. [Three recent cases of ascariasis in northern Kyushu]. (United States)

    Makiya, K; Tsukamoto, M; Unoki, H; Sujita, K; Mori, N; Miki, T; Yokoyama, M


    Ascariasis is considered to be one of the rare infectious diseases in Japan, but recently it has been slightly increasing. This paper reports three ascariasis cases who seemed to be infected recently in the Kitakyushu area, Japan. Case 1: A 59-year-old woman in Kitakyushu City passed a round worm after continuous abdominal pain. The patient was discharged from the hospital because of no further abnormal intestinal symptoms and findings. Case 2: An 85-year-old woman in Nakama City, who suffered from cerebral infarction, vomited a round worm before hospitalization. Many ascarid eggs were detected after admission, and after treatment with pyrantel pamoate (Combantrin) two round worms were passed and egg detection became negative. Case 3: A 77-year-old man in Saikawa Town vomited 3 round worms after gastrectomy due to early gastric cancer. Many unfertilized eggs were also detected from the stool together with hook worm eggs, but no eggs were found after administration of pyrantel pamoate. Morphological examination was made by a scanning electron microscope on the denticles on the dentigerous lip ridges of the worms to differentiate from possible infection with a pig parasite, Ascaris suum. The three cases were diagnosed as ascariasis due to human Ascaris lumbricoides based on the following evidences that the expelled worms had 1) less pointed tips of the denticles and shallower or wider interdenticle notches, and 2) far more denticles of smaller size along the dentigerous ridges, compared with Ascaris suum. The necessity of differentiating pig- from human-ascarids, when considering human infection with Ascaris suum, is discussed. PMID:3368668

  13. Kinetics of inactivation of indicator pathogens during thermophilic anaerobic digestion. (United States)

    Popat, Sudeep C; Yates, Marylynn V; Deshusses, Marc A


    Thermophilic anaerobic sludge digestion is a promising process to divert waste to beneficial use, but an important question is the required temperature and holding time to achieve a given degree of pathogen inactivation. In this study, the kinetics of inactivation of Ascaris suum and vaccine strain poliovirus type 1 (PVS-1), selected as indicators for helminth ova and enteric viruses respectively, were determined during anaerobic digestion at temperatures ranging from 51 to 56 °C. Inactivation of both indicator organisms was fast with greater than two log reductions achieved within 2 h for A. suum and three log reductions for PVS-1, suggesting that the current U.S. regulations are largely conservative. The first-order inactivation rate constants k followed Arrhenius relationship with activation energies of 105 and 39 KJ mol(-1) for A. suum and PVS-1, respectively indicating that A. suum was more sensitive to temperature. Although inactivation was fast, the presence of compounds in the sludge that are known to be protective of pathogen inactivation was observed, suggesting that composition-dependent time-temperature relationships are necessary. PMID:20692678

  14. Anthelmintic activity of chicory (Cichorium intybus): in vitro effects on swine nematodes and relationship to sesquiterpene lactone composition. (United States)

    Williams, Andrew R; Peña-Espinoza, Miguel A; Boas, Ulrik; Simonsen, Henrik T; Enemark, Heidi L; Thamsborg, Stig M


    Chicory is a perennial crop that has been investigated as a forage source for outdoor-reared ruminants and pigs, and has been reported to have anthelmintic properties. Here, we investigated in vitro anthelmintic effects of forage chicory-extracts against the highly prevalent swine parasites Ascaris suum and Oesophagostomum dentatum. Methanol extracts were prepared and purified from two different cultivars of chicory (Spadona and Puna II). Marked differences were observed between the anthelmintic activity of extracts from the two cultivars. Spadona extracts had potent activity against A. suum third (L3) and fourth (L4) - stage larvae, as well as O. dentatum L4 and adults, whereas Puna II extracts had less activity against A. suum and no activity towards O. dentatum L4. Transmission-electron microscopy of A. suum L4 exposed to Spadona extracts revealed only subtle changes, perhaps indicative of a specific anthelmintic effect rather than generalized toxicity. Ultra-high liquid chromatography-mass spectrometry analysis revealed that the purified extracts were rich in sesquiterpene lactones (SL), and that the SL profile differed significantly between cultivars. This is the first report of anthelmintic activity of forage chicory towards swine nematodes. Our results indicate a significant anthelmintic effect, which may possibly be related to SL composition. PMID:26935644

  15. Paleoparasitological remains revealed by seven historic contexts from "Place d'Armes", Namur, Belgium

    Directory of Open Access Journals (Sweden)

    Gino Chaves da Rocha


    Full Text Available Human occupation for several centuries was recorded in the archaeological layers of "Place d'Armes", Namur, Belgium. Preventive archaeological excavations were carried out between 1996/1997 and seven historical strata were observed, from Gallo-Roman period up to Modern Times. Soil samples from cesspools, latrines, and structures-like were studied and revealed intestinal parasite eggs in the different archaeological contexts. Ascaris lumbricoides, A. suum, Trichuris trichiura, T. suis. Taenia sp., Fasciola hepatica, Diphyllobothrium sp., Capillaria sp. and Oxyuris equi eggs were found. Paleoparasitology confirmed the use of structures as latrines or cesspit as firstly supposed by the archaeologists. Medieval latrines were not only used for rejection of human excrements. The finding of Ascaris sp. and Trichuris sp. eggs may point to human's or wild swine's feces. Gallo-Roman people used to eat wild boar. Therefore, both A. suum and T. suis, or A. lumbricoides and T. trichuris, may be present, considering a swine carcass recovered into a cesspit. Careful sediment analysis may reveal its origin, although parasites of domestic animals can be found together with those of human's. Taenia sp. eggs identified in latrine samples indicate ingestion of uncooked beef with cysticercoid larvae. F. hepatica eggs suggest the ingestion of raw contaminated vegetables and Diphyllobothrium sp. eggs indicate contaminated fresh-water fish consumption. Ascaris sp. and Trichuris sp. eggs indicate fecal-oral infection by human and/or animal excrements.

  16. Paleoparasitological remains revealed by seven historic contexts from "Place d'Armes", Namur, Belgium. (United States)

    da Rocha, Gino Chaves; Harter-Lailheugue, Stephanie; Le Bailly, Matthieu; Araújo, Adauto; Ferreira, Luiz Fernando; da Serra-Freire, Nicolau Maués; Bouchet, Françoise


    Human occupation for several centuries was recorded in the archaeological layers of "Place d'Armes", Namur, Belgium. Preventive archaeological excavations were carried out between 1996/1997 and seven historical strata were observed, from Gallo-Roman period up to Modern Times. Soil samples from cesspools, latrines, and structures-like were studied and revealed intestinal parasite eggs in the different archaeological contexts. Ascaris lumbricoides, A. suum, Trichuris trichiura, T. suis. Taenia sp., Fasciola hepatica, Diphyllobothrium sp., Capillaria sp. and Oxyuris equi eggs were found. Paleoparasitology confirmed the use of structures as latrines or cesspit as firstly supposed by the archaeologists. Medieval latrines were not only used for rejection of human excrements. The finding of Ascaris sp. and Trichuris sp. eggs may point to human's or wild swine's feces. Gallo-Roman people used to eat wild boar. Therefore, both A. suum and T. suis, or A. lumbricoides and T. trichuris, may be present, considering a swine carcass recovered into a cesspit. Careful sediment analysis may reveal its origin, although parasites of domestic animals can be found together with those of human's. Taenia sp. eggs identified in latrine samples indicate ingestion of uncooked beef with cysticercoid larvae. F. hepatica eggs suggest the ingestion of raw contaminated vegetables and Diphyllobothrium sp. eggs indicate contaminated fresh-water fish consumption. Ascaris sp. and Trichuris sp. eggs indicate fecal-oral infection by human and/or animal excrements. PMID:17308808

  17. Dicty_cDB: Contig-U13948-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nqrkilkiktkkivmtnhyqskwlswiskeskilnlqietkyfywli*krk*in Frame B: illllffylltdhqnvepykhylyyldfviffymfn*lffsk*tfs...*lllskcskkcckn cnvspikfrsqyfiiylprnsyfq*pc*klv**k*kf*ffgklklklifflffklhgfys sllflnddkfnwrkkyar... whole genome shotgu... 40 0.86 2 ( ED280205 ) AUAC-aax35c01.g1 Ascaris suum whole genome shotgu... 40 0.89 ...ATTTTTATTGGCTTATATAAAAAAGGAAATAAATAAA TAA Gap no gap Contig length 1253 Chromosome number (1..6, M) 4 Chromosome length 5430582 Star...Acid sequence (All Frames) Frame A: yiiiiiflfin*sskc*ai*tlfilfgfcyfflhv*laff**idi*litplqmfkkml*e l*cfsh*ipvsvfyhlssqe*lfs

  18. Dicty_cDB: Contig-U15826-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 46 7.2 1 ( GE442748 ) 294565860 Nasonia vitripennis Adult Female Nasoni... 46 7....2 1 ( GE435651 ) 294560060 Nasonia vitripennis Adult Male Nasonia ... 46 7.2 1 ( GE385053 ) 293694144 Nasonia vitripenni...s Female Pupae Nasoni... 46 7.2 1 ( GE366071 ) 292293037 Nasonia vitripennis Male Pupae Nasonia ...... 48 1.8 1 ( ED401724 ) AUAC-aau22b02.g1 Ascaris suum whole genome shotgu... 48 1.8 1 ( AL170046 ) Tetraodon nigrovirid...a glabrata strain CBS138 chromosome H compl... 46 7.2 1 ( DJ205648 ) Method for identification of useful

  19. Worm peptidomics

    Directory of Open Access Journals (Sweden)

    Steven J. Husson


    Full Text Available Bioactive peptides are present in all metazoan species where they orchestrate diverse functions. In the last decade, high-throughput approaches based on mass spectrometry helped the identification of endogenously occurring peptides in different species. We here review biochemical strategies to obtain sequence information of natural (non-tryptic peptides in Caenorhabditis elegans and in the related nematodes Caenorhabditis briggsae and Ascaris suum with particular attention for sample preparation and methodology. In addition, we describe seven new C. elegans neuropeptides that we recently discovered by sequencing additional peptides. Finally, we explain how differential peptidomics approaches were used to characterize key neuropeptide processing enzymes.

  20. 改水改厕和环境整治控制土壤蛔虫虫卵及鞭虫虫卵污染的纵向观察%Longitudinal observation of contamination with eggs of Ascaris lumbricoides and Trichuris trichiura and control efforts through improved drinking water, latrine improvements and environmental improvements

    Institute of Scientific and Technical Information of China (English)

    戴坤教; 曾小军; 姜唯声; 洪献林; 葛军; 谢曙英; 兰炜明; 陈红根


    Objective To ascertain the level of contamination with eggs of soil-transmitted nematodes and the effects of efforts to control infection in the population through improved drinking water, latrine improvements, and environmental improvements. Methods In two villages of Jinxian County, Ascaris lumbricoides and Trichuris trichiura eggs in soil were tested using saturated magnesium sulfate flotation, and the population was tested for infection with soil-transmitted nematodes using the Kato-Katz method. Results After drinking water was improved and latrine improvements were implemented . The rate at which eggs of A. Lumbricoides and T. Trichiura were detected in soil tended to decrease in both villages. One year after drinking water was improved and latrine improvements were made, the rate at which Ascaris eggs were detected in yards, living rooms, latrines, and vegetable farms and the overall rate at which these eggs were detected decreased; respective rates decreased 76. 48% (P 0.05), and 59. 03%(P<0.01). Rates remained relatively low afterwards. The rate at which Trichuris eggs were detected in those locations and the overall rate of detection decreased 68. 74%, 62.50% (P<0.01), 64.71%, 64.71%, and 65. 15%. The rate of dead Ascaris eggs and Trichuris eggs increased from 2. 57% and 0. 61% in 2005 to 69. 81% and 78. 13% in 2006, respectively, and the rate if dead eggs remained at about 70% two years later. Conclusion Control measures to improve drinking water and implement latrine improvements and environmental improvements significantly affected contamination of A. Lumbricoides and T. Trichiura eggs in soil and also proved to be an effective strategy for control of geohelminth infection in the human population.%目的 了解农村地区实施改水改厕和环境整治等综合措施后土壤中土源性线虫虫卵污染情况、变化规律及对人群土源性线虫感染的控制效果.方法 在江西省进贤县2个村,用饱和硫酸镁离心浮聚法检查

  1. Procamallanus brasileiros - parte I (Nematoda, Camallanoidea

    Directory of Open Access Journals (Sweden)

    R. Magalhães Pinto


    Full Text Available Nessa primeira parte do trabalho referente ao estudo dos Procamallanus brasileiros, os autores propoêm que Spirocamallanus Olsen, 1952, seja aceito apenas como um bom subgênero, baseando-se exclusivamente no aspecto de cápsula bucal. Assi, Spirocamallanus identifica os camalanídeos de cápsula bucal com lâminas espiraladas ou outras estruturas semelhantes, enquanto que Procamallanus se aplicaria aos de cápsula bucal lisa. Quanto às demais subdivisões existentes para o gênero, apoiadas em aspecto e quantidade de espículos, são consideradas resultado de um critério bastante arbitrário para conservarem-se válidas, visto serem os espículos caracteres sujeitos a diversas interpretações por parte dos especialistas, devido à fragilidade que os toma tão sujeitos a modificações no grupo dos camalanídeos. Três espécies são aqui tratadas: Procamallanus (Spirocamallanus rarus Travassos, Artigas & Pereira, 1928, Procamallanus (Spirocamallanus pimelodus, e Procamallanus (Spirocamallanus intermedius. As duas últimas são propostas como novas. Procamallanus (S. pimelodus é comparada a Procamallanus (Spirocamallanus olseni Campana-Rouget & Razahihelissoa, 1965, dela se distinguindo, principalmente, por apresentar o rebordo da asa caudal franjado e fortemente musculoso. Procamallanus (S. intermedius aproxima-se unicamente de Procamallanus (S. rarus, por apresentar o espículo maior com bifurcação distal e dela se afasta pelo maior número e menor espessura das lâminas espiraladas na cápsula bucal. Para Procamallanus (S. rarus é apresentada a descrição da fêmea, a redescrição do macho, salientando-se pela primeira vez no gênero, o aspecto singular do espículo maior, aspecto esse também observado ao se lidar com Procamallanus (S. intermedius, depois de se ter tido acesso ao exemplar tipo e único de Procamallanus (S. rarus. Foram examinadas 31 amostras de material que faz parte da Coleção Helmintológica do Instituto Oswaldo Cruz.By introducing this work on brazilian nematodes under Procamallanus Baylis, 1923, the authors propose that Spirocamallanus Olsen, 1952, must be regarded only as a good subgenus based on the aspect of the buccal capsule. For this reason, Spirocamallanus should identify those worms bearing spiral thickenings, as well as similar structures inside their buccal cavity while Procamallanus may be applied every time the nematodes present a completely smooth capsule, lacking the above mentioned structures. Regarding to the early propositions in order to subdivide the genus using number and shape of the spicules as differential characters, the authors fully disagree with this point of view, which is rather a poor criterion, for the spicules are weakly chitinised in this group and for this reason they do not present enough strutural uniformity to be of great systematic significance. The authors deal here with three species: Procamallanus (Spirocamallanus rarus Travassos, Artigas & Pereira, 1928, Procamallanus (Spirocamallanus pimelodus and Procamallanus (Spirocamallanus intermedius. The last two are proposed as new species. Procamallanus (S. pimelodus is related to Procamallanus (Spirocamallanus olseni Campanarouget & Razahihelissoa, 1965 and differs from it mainly by its caudal alae which shows a strongly muscular fringed rim. Procamallanus (S. intermedius only comes nearer to Procamallanus (S. rarus by possessing the bigger spicule with distal bifurcation and differs from it by the aspect of the buccal capsule which has more and thinner spiral thickenings. Of Procamallanus (S. rarus, the female is described, a redescription of the male is presented and the very peculiar aspect of the bigger spicule is pointed out for the first time in the genus. This was also observed when dealing with Procamallanus (S. intermedius, after examining the type of Procamallanus (S. rarus. In this first part of the work the authors handled 31 samples of nematodes as follows: From intestines of Pimelodus clarias (L.(27; Catfish (indeterminate(3 and Pimelodella lateristriga (Müll. Trosch.(1.

  2. Application of zero-inflated negative binomial model to study the pattern of Ascaris lumbricoides and hookworm re-infection%零膨胀的负二项模型在蛔虫与钩虫再感染模式研究中的应用

    Institute of Scientific and Technical Information of China (English)

    王骏; 梁松; 陈颖丹; 李华忠; 汤林华


    Objective Use zero-inflated negative binomial model for modeling the pattern of Ascoris lumbricoides and hookworm re-infection.Methods Field survey was carried out in three villages:Qiuchang in Yibin City of Sichuan Province,Tangnan in Jinxian County of Jiangxi Province,and Sanhe in Yueyang County of Hunan Province.The survey consisted of baseline stool examination and treatment,re-examination after one month and one year,and questionnaire survey.Zero-inflated negative binomial model was applied to fit the egg count data collected after one year,meanwhile,the risk factors for the re-infection occurrence and intensity were evaluated.Results Totally 374 subjects were recruited in the survey after one year.The prevalences of Ascaris lumbricoides and hookworm at baseline 38.08%(139/365) and 39.17%(141/360).The re-infection rates of Ascaris lumbricoides and hookworm one year after treatment were 15.89% (58/365) and 8.89% (32/360),respectively.A.lumbricoides model showed:the higher infection intensity before treatment,the higher risk of re-infection occurrence(OR=1.94,95%CI:1.33~2.81),high level of household electrical appliances and not drinking un-boiled water were protective factors.The risk of re-infection in age group 15~44 years and 45~64 years was lower than that in group 5~14 years significantly.The higher infection intensity before treatment,the higher risk of high re-infection intensity after treatment (OR=1.56,95%CI:1.10~2.23).Compared to age group 5~14 years,15~44 years and 65~70 years had low risk of getting high re-infection intensity.Not drinking unboiled water was also a protective factor for acquiring high intensity.Hookworm model showed:the higher infection intensity before treatment,the higher risk of re-infection occurrence (OR =3.97,95%CI:2.07~7.60),living in brick house opposed to adobe house was protective factor for re-infection.Compared to age group 5~14 years,the other 3 age groups had higher risk of getting

  3. Anthelmintic activity of trans-cinnamaldehyde and A- and B-type proanthocyanidins derived from cinnamon (Cinnamomum verum). (United States)

    Williams, Andrew R; Ramsay, Aina; Hansen, Tina V A; Ropiak, Honorata M; Mejer, Helena; Nejsum, Peter; Mueller-Harvey, Irene; Thamsborg, Stig M


    Cinnamon (Cinnamomum verum) has been shown to have anti-inflammatory and antimicrobial properties, but effects on parasitic worms of the intestine have not been investigated. Here, extracts of cinnamon bark were shown to have potent in vitro anthelmintic properties against the swine nematode Ascaris suum. Analysis of the extract revealed high concentrations of proanthocyanidins (PAC) and trans-cinnamaldehyde (CA). The PAC were subjected to thiolysis and HPLC-MS analysis which demonstrated that they were exclusively procyanidins, had a mean degree of polymerization of 5.2 and 21% of their inter-flavan-3-ol links were A-type linkages. Purification of the PAC revealed that whilst they had activity against A. suum, most of the potency of the extract derived from CA. Trichuris suis and Oesophagostomum dentatum larvae were similarly susceptible to CA. To test whether CA could reduce A. suum infection in pigs in vivo, CA was administered daily in the diet or as a targeted, encapsulated dose. However, infection was not significantly reduced. It is proposed that the rapid absorption or metabolism of CA in vivo may prevent it from being present in sufficient concentrations in situ to exert efficacy. Therefore, further work should focus on whether formulation of CA can enhance its activity against internal parasites. PMID:26420588

  4. Synthesis of a radiolabeled cyclodepsipeptide [{sup 3}H-methyl]PF1022A

    Energy Technology Data Exchange (ETDEWEB)

    Pleiss, U. [Bayer AG, Wuppertal (Germany). Metabolism and Isotope Chemistry; Harder, A.; Turberg, A.; Londershausen, M.; Mencke, N.; Jeschke, P.; Bonse, G. [Bayer AG, Monheim (Germany). Agricultural Centre; Iinuma, K. [Meiji Seika Kaisha Ltd., Kanagawa (Japan)


    For receptor binding studies and the elucidation of the mode of action of the potent anthelmintic compound PF1022A a tritium labeled compound with very high specific activity was necessary. Tritium was introduced into the compound by methylation of the [bis-N-demethyl]precursor of PF1022A (PF1022-219). The identity of [bis-N-methyl-{sup 3}H]PF1022A was determined by LC/MS. After synthesis and purification, 88.9 {mu}g [bis-N-methyl-{sup 3}H]PF1022A were available showing a specific activity of 162 Ci/mmol (5,99 TBq/mmol) determined by mass spectrometry. The total activity was 15 mCi (555 MBq). Radiolabeled PF1022A showed an efficient and specific binding to a membrane fraction from Ascaris suum. Displacement by unlabeled PF1022A was half-maximal at about 40 nM. At 100-fold higher concentrations the biologically much less effective optical antipodean (PF1022-001) competed for maximal 40% of the [{sup 3}H]PF1022A-binding in the Ascaris suum membrane preparation. In-vitro comparison of PF1022A with its optical antipdean revealed a more than 100-fold higher anthelmintic activity of PF1022A against Heterakis spumosa, Nippostrongylus brasiliensis and Trichinella spiralis. (author).

  5. Synthesis of a radiolabeled cyclodepsipeptide [3H-methyl]PF1022A

    International Nuclear Information System (INIS)

    For receptor binding studies and the elucidation of the mode of action of the potent anthelmintic compound PF1022A a tritium labeled compound with very high specific activity was necessary. Tritium was introduced into the compound by methylation of the [bis-N-demethyl]precursor of PF1022A (PF1022-219). The identity of [bis-N-methyl-3H]PF1022A was determined by LC/MS. After synthesis and purification, 88.9 μg [bis-N-methyl-3H]PF1022A were available showing a specific activity of 162 Ci/mmol (5,99 TBq/mmol) determined by mass spectrometry. The total activity was 15 mCi (555 MBq). Radiolabeled PF1022A showed an efficient and specific binding to a membrane fraction from Ascaris suum. Displacement by unlabeled PF1022A was half-maximal at about 40 nM. At 100-fold higher concentrations the biologically much less effective optical antipodean (PF1022-001) competed for maximal 40% of the [3H]PF1022A-binding in the Ascaris suum membrane preparation. In-vitro comparison of PF1022A with its optical antipdean revealed a more than 100-fold higher anthelmintic activity of PF1022A against Heterakis spumosa, Nippostrongylus brasiliensis and Trichinella spiralis. (author)

  6. Radiological findings of intraparenchymal liver Ascaris (hepatobiliary ascariasis)

    Energy Technology Data Exchange (ETDEWEB)

    Akata, D.; Oezmen, M.N.; Kaya, A.; Akhan, O. [Dept. of Radiology, Hacettepe University School of Medicine, Ankara (Turkey)


    Ascariasis is a well-known cause of acute cholangitis and cholecystitis; however, very rarely do worms penetrate and colonize the liver parenchyma. Here we present the unique radiological demonstration (US, CT and ERCP) of hepatobiliary ascariasis in which worm was first alive in the parenchyma of the liver and subsequently died and formed liver abscess. (orig.) (orig.) With 3 figs., 8 refs.

  7. Radiological findings of intraparenchymal liver Ascaris (hepatobiliary ascariasis)

    International Nuclear Information System (INIS)

    Ascariasis is a well-known cause of acute cholangitis and cholecystitis; however, very rarely do worms penetrate and colonize the liver parenchyma. Here we present the unique radiological demonstration (US, CT and ERCP) of hepatobiliary ascariasis in which worm was first alive in the parenchyma of the liver and subsequently died and formed liver abscess. (orig.) (orig.)

  8. Post-partum pyogenic abscess containing Ascaris lumbricoides


    Hamid, Raashid; Wani, Sajad; Ahmad, Nawab; Akhter, Afrozah


    We report an unusual case of multiple pyogenic liver abscesses containing Ascariasis lumbricoides in a 35-year-old post-partum female who had delivered 1 month back. Open drainage of liver abscess along with liver worm was done. Patient did well post-operatively.

  9. Granulomatosis peritoneal por Ascaris lumbricoides.Presentación de un caso Granulomatous peritonitis due to Ascaris lumbricoides. Case report


    Carlos Aguirre Muñoz; Alberto Bustamante Gallego; Blair Ortiz Giraldo; Elvia Góez Gutiérrez


  1. Alternate substrates and isotope effects as a probe of the malic enzyme reaction

    International Nuclear Information System (INIS)

    Dissociation constants for alternative dinucleotide substrates and competitive inhibitors suggest that the dinucleotide binding site of the Ascaris suum NAD-malic enzyme is hydrophobic in the vicinity of the nicotinamide ring. Changes in the divalent metal ion activator from Mg2+ to Mn2+ or Cd2+ results in a decrease in the dinucleotide affinity and an increase in the affinity for malate. Primary deuterium and 13C isotope effects obtained with the different metal ions suggest either a change in the transition state structure for the hydride transfer or decarboxylation steps or both. Deuterium isotope effects are finite whether reactants are maintained at saturating or limiting concentrations with all the metal ions and dinucleotide substrates used. For the native enzyme, primary deuterium isotope effects increase with a concomitant decrease in the 13C effects when NAD is replaced by an alternate dinucleotide substrate different in redox potential

  2. Alternate substrates and isotope effects as a probe of the malic enzyme reaction

    Energy Technology Data Exchange (ETDEWEB)

    Gavva, S.R.


    Dissociation constants for alternative dinucleotide substrates and competitive inhibitors suggest that the dinucleotide binding site of the Ascaris suum NAD-malic enzyme is hydrophobic in the vicinity of the nicotinamide ring. Changes in the divalent metal ion activator from Mg{sup 2+} to Mn{sup 2+} or Cd{sup 2+} results in a decrease in the dinucleotide affinity and an increase in the affinity for malate. Primary deuterium and {sup 13}C isotope effects obtained with the different metal ions suggest either a change in the transition state structure for the hydride transfer or decarboxylation steps or both. Deuterium isotope effects are finite whether reactants are maintained at saturating or limiting concentrations with all the metal ions and dinucleotide substrates used. For the native enzyme, primary deuterium isotope effects increase with a concomitant decrease in the {sup 13}C effects when NAD is replaced by an alternate dinucleotide substrate different in redox potential.

  3. Genetic control of eosinophilia in mice: gene(s) expressed in bone marrow-derived cells control high responsiveness

    International Nuclear Information System (INIS)

    A heterogeneity in the capacity of strains of mice to mount eosinophilia is described. BALB/c and C3H are eosinophil high responder strains (EO-HR) and CBA and A/J are eosinophil low responder strains (EO-LR), judged by the response of blood eosinophils to Ascaris suum, and the response of blood, bone marrow, and spleen eosinophils to keyhole limpet hemocyanin given 2 days after 150 mg/kg cyclophosphamide. Some of the gene(s) for high responsiveness appear to be dominant because (EO-HR x EO-LR)F1 mice were intermediate to high responders. This gene is expressed in bone marrow-derived cells because radiation chimeras of the type EO-HR→F1 were high responders and EO-LR→F1 were low responders. This description of a genetic control of eosinophilia in mice may be useful in understanding the role of this cell in parasite immunity and allergy

  4. Malic enzyme: Tritium isotope effects with alternative dinucleotide substrates and divalent metal ions

    International Nuclear Information System (INIS)

    The NAD-malic enzyme from Ascaris suum catalyzes the divalent metal ion dependent oxidative decarboxylation of L-malate to yield pyruvate, carbon dioxide and NADH. Multiple isotope effect studies suggest a stepwise chemical mechanism with hydride transfer from L-malate to NAD occurring first to form oxalacetate, followed by decarboxylation. Utilizing L-malate-2-T, tritium V/K isotope effects have been determined for the hydride transfer step using a variety of alternative dinucleotide substrates and divalent metal ions. Combination of these data with deuterium isotope effects data and previously determined 13C isotope effects has allowed the calculation of intrinsic isotope effects for the malic enzyme catalyzed reaction. The identity of both the dinucleotide substrate and divalent metal ion has an effect of the size of the intrinsic isotope effect for hydride transfer

  5. Malic enzyme: Tritium isotope effects with alternative dinucleotide substrates and divalent metal ions

    Energy Technology Data Exchange (ETDEWEB)

    Karsten, W.E.; Harris, B.G.; Cook, P.F. (Texas College of Osteopathic Medicine, Fort Worth (United States))


    The NAD-malic enzyme from Ascaris suum catalyzes the divalent metal ion dependent oxidative decarboxylation of L-malate to yield pyruvate, carbon dioxide and NADH. Multiple isotope effect studies suggest a stepwise chemical mechanism with hydride transfer from L-malate to NAD occurring first to form oxalacetate, followed by decarboxylation. Utilizing L-malate-2-T, tritium V/K isotope effects have been determined for the hydride transfer step using a variety of alternative dinucleotide substrates and divalent metal ions. Combination of these data with deuterium isotope effects data and previously determined [sup 13]C isotope effects has allowed the calculation of intrinsic isotope effects for the malic enzyme catalyzed reaction. The identity of both the dinucleotide substrate and divalent metal ion has an effect of the size of the intrinsic isotope effect for hydride transfer.

  6. A survey for potentially zoonotic gastrointestinal parasites of dogs and pigs in Cambodia

    DEFF Research Database (Denmark)

    Inpankaew, Tawin; Murrell, Kenneth Darwin; Pinyopanuwat, Nongnuch;


    There is little information available on parasites of zoonotic significance in Cambodia. In 2011, in an effort to obtain data on potentially zoonotic gastrointestinal parasites in domestic animals, 50 dogs and 30 pigs residing in 38 households located in Ang Svay Check village, Takeo province......, Cambodia were examined for parasites from faecal samples. The samples were processed using the formalin-ethyl acetate concentration technique (FECT). Hookworms were the most common zoonotic parasite found in dogs (80.0%) followed by Echinostomes (18.0%). While, in pigs, Fasciolopsis buski was the most...... common zoonotic parasite (30.0%) followed by Ascaris suum (13.3%). This study provides baseline data on gastrointestinal parasites in dogs and pigs from Cambodia and underscores the importance of domestic animals as reservoir hosts for human parasites for Cambodian veterinary and public health agencies...

  7. Dicty_cDB: Contig-U07060-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available IHFVLLVK NLLKK*innkynii*y own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U07060-1 (Contig-U07060-1...) S1: 12 (24.3 bits) S2: 15 (30.2 bits) dna update 2008.11.11 Homology vs DNA Query= Contig-U07060-1 (Contig...ce *** SEQUENCING IN PROGRESS *** f... 36 9.0 4 ( AC157641 ) Rhinolophus ferrumequinum clone VMRC7...-215A14, WOR... 34 9.2 5 ( ED374959 ) AUAC-aaf81g10.b1 Ascaris suum whole genome shotgu... 38 9.6 2 ( EJ272106 ) 1095353020898 Glo...1: 11 (21.8 bits) S2: 22 (44.1 bits) protein update 2009. 6.23 Homology vs Protein Query= Contig-U07060-1 (C

  8. Characterization of Sm14 related components in different helminths by sodium dodecyl sulphate-polyacrylamide gel electrophoresis and Western blotting analysis

    Directory of Open Access Journals (Sweden)

    Nilton Thaumaturgo


    Full Text Available Sm14 was the first fatty acid-binding protein homologue identified in helminths. Thereafter, members of the same family were identified in several helminth species, with high aminoacid sequence homology between them. In addition, immune crossprotection was also reported against Fasciola hepatica infection, in animals previously immunized with the Schistosoma mansoni vaccine candidate, r-Sm14. In the present study, data on preliminary sodium dodecyl sulphate-polyacrylamide gel electrophoresis and Western blotting analysis of nine different helminth extracts focusing the identification of Sm14 related proteins, is reported. Out of these, three extracts - Ascaris suum (males and females, Echinostoma paraensei, and Taenia saginata - presented components that comigrated with Sm14 in SDS-PAGE, and that were recognized by anti-rSm14 policlonal serum, in Western blotting tests.

  9. Identification of cDNA clones expressing immunodiagnostic antigens from Trichinella spiralis

    Energy Technology Data Exchange (ETDEWEB)

    Zarlenga, D.; Gamble, H.R.


    A cDNA expression library was built in lambda gt11 phage using poly A mRNA isolated from Trichinella spiralis muscle stage larvae. This library was screened with rabbit antibodies to parasite excretory-secretory (ES) products and greater than 180 clones were isolated. Thirteen clones producing highly immunogenic protein antigens were plaque purified and rescreened with pig antisera to T.spiralis, Trichuris suis or Ascaris suum to identify clones producing epitopes specific to T.spiralis ES products, only. Two clones, TsAc-2 and TsAc-8, which displayed strong interactions with pig antisera to T. spiralis were lysogenized in E. coli Y1089 and the protein extracted. Western blots of the crude fusion proteins revealed molecular weights of 133 kD and 129 kD, respectively. Northern blot analysis of total RNA with TSP labelled cDNA:lambda gt11 probes indicated single RNA transcripts for each clone with molecular sizes corresponding to 800-850 nucleotides. dscDNA inserts were estimated by southern blot analysis to be 500 bp and 340 bp, respectively, with no cross-hybridization observed between the cloned sequences. Dot blots using pig sera to screen crude fusion protein preparations, total bacterial protein (negative controls) and crude worm extract or ES products from T.spiralis, T.suis and A.suum (positive controls) corroborated the specificity and sensitivity of these clones as potential diagnostic antigens for swine trichinellosis.

  10. Identification of cDNA clones expressing immunodiagnostic antigens from Trichinella spiralis

    International Nuclear Information System (INIS)

    A cDNA expression library was built in lambda gt11 phage using poly A mRNA isolated from Trichinella spiralis muscle stage larvae. This library was screened with rabbit antibodies to parasite excretory-secretory (ES) products and greater than 180 clones were isolated. Thirteen clones producing highly immunogenic protein antigens were plaque purified and rescreened with pig antisera to T.spiralis, Trichuris suis or Ascaris suum to identify clones producing epitopes specific to T.spiralis ES products, only. Two clones, TsAc-2 and TsAc-8, which displayed strong interactions with pig antisera to T. spiralis were lysogenized in E. coli Y1089 and the protein extracted. Western blots of the crude fusion proteins revealed molecular weights of 133 kD and 129 kD, respectively. Northern blot analysis of total RNA with 32P labelled cDNA:lambda gt11 probes indicated single RNA transcripts for each clone with molecular sizes corresponding to 800-850 nucleotides. dscDNA inserts were estimated by southern blot analysis to be 500 bp and 340 bp, respectively, with no cross-hybridization observed between the cloned sequences. Dot blots using pig sera to screen crude fusion protein preparations, total bacterial protein (negative controls) and crude worm extract or ES products from T.spiralis, T.suis and A.suum (positive controls) corroborated the specificity and sensitivity of these clones as potential diagnostic antigens for swine trichinellosis

  11. Standardization of a method for the detection of helminth eggs and larvae in lettuce. (United States)

    Matosinhos, F C; Valenzuela, V C; Silveira, J A; Rabelo, E M


    Despite reports that food-borne parasitic infections have been increasing worldwide, the methodologies employed to detect food contamination by helminths are still largely based on methodologies used to detect these pathogens in feces and water. This study sought to improve the diagnosis of parasitic contaminants in lettuce by standardizing a method for detecting helminth eggs and larvae and estimating their percentage of recovery. Sanitized lettuces were artificially contaminated with different amounts of Ascaris suum and hookworm eggs and larvae. To standardize the method, we tested liquid extractors, vegetable washing steps, and spontaneous sedimentation times. Higher percentages of egg and larvae recovery were obtained using 1 M glycine as the liquid extractor, manual shaking for 3 min and 2 h of sedimentation. Five different levels of artificial contamination (ten replicates each; n = 50) were tested using these standardized conditions, yielding an average recovery of 62.6 % (±20.2), 51.9 % (±20.0), and 50.0 % (±27.3) for A. suum eggs, hookworm eggs, and larvae, respectively. Tests were performed with a different matrix to evaluate the performance of the method. Furthermore, collaborative analytical studies performed by different laboratories produced satisfactory results. The method for the identification of helminth eggs and larvae proposed in this study proved to be simpler and more efficient than previously published procedures, thereby demonstrating its potential contribution to health surveillance and epidemiological studies. PMID:26786833

  12. Půdní hlístice (Nematoda)

    Czech Academy of Sciences Publication Activity Database

    Háněl, Ladislav

    Veselí nad Moravou : ZO ČSOP Bílé Karpaty ve Veselí nad Moravou, 2008, s. 205-207. ISBN 978-80-903444-6-4 Institutional research plan: CEZ:AV0Z60660521 Keywords : nematodes * soil * White Carpathian Mts. Subject RIV: EH - Ecology, Behaviour

  13. Reproduction in Strongyloides (Nematoda): a life between sex and parthenogenesis. (United States)

    Streit, A


    Nematodes of the genus Strongyloides parasitize the small intestines of vertebrates. In addition to a parasitic life-cycle, which is generally considered to be parthenogenetic, Strongyloides can also have a facultative, free-living generation involving male and female worms. The purpose of the present article was to review the literature on the modes of reproduction, the routes of development in the two generations of Strongyloides, discuss the controversial opinions in the literature regarding these aspects and point to new opportunities for addressing key questions in relation to the biology of reproduction of members of the genus employing genetic and genomic tools. PMID:18076772

  14. Nematoda of Kinosternon scorpioides (Testudines: Kinosternidae) from Northeastern Brazil. (United States)

    Viana, Diego C; Rodrigues, João Fabrício M; Madelaire, Carla B; Clara, Ana; Santos, G; Sousa, Alana L


    The scorpion mud turtle (Kinosternon scorpioides) is a small freshwater turtle broadly distributed in South America and commonly consumed in some Brazilian regions. This study aimed to identify the species of helminths that parasitize the digestive tract of K. scorpioides and report infection parameters such as parasite prevalence, mean intensity of the infection, abundance, and the relationship between these nematodes and host body size in this species. We captured 20 adult male K. scorpioides, and 6 animals had nematodes in their gastrointestinal tract. These animals had Serpinema magathi (prevalence = 0.3) and Spiroxys figueiredoi (prevalence = 0.25). There were no correlations between the number of total parasites and carapace length (rs = 0.17, n = 6, P = 0.74) or the length of the gastrointestinal tract (rs = 0.18, n = 6, P = 0.73). PMID:26485115

  15. Calodium (Capillaria hepaticum (Nematoda, Capillariidae in insular small rodent populations

    Directory of Open Access Journals (Sweden)

    Bugmyrin Sergey


    Full Text Available The data on the distribution of the nematode Calodium hepaticum (Bancroft 1893 Moravec 1982 (syn.: Capillaria hepatica, Hepaticola hepatica on the islands of Kizhi Archipelago are reported (N 62°00'; E 35°12'. Samples were collected on 18 islands and the mainland part of the Kizhi skerries region in the period from August 2005 till 2014. The method of partial helminthological dissection was applied to 346 specimens of rodents belonging to two species – the bank vole Myodes glareolus Schreber 1780 (301 spm. and the field vole Microtus agrestis Linnaeus 1761 (45 spm.. The prevalence and the abundance index of nematode were 16.6% and 1.1 in M. glareolus and 11.1%; 0.3 in M. agrestis, respectively. The highest prevalence and abundance of C. hepaticum were detected in mature voles. No sex-related differences were found. C. hepaticum was present in 12 of 19 sampling sites. On the islands where the sample number (host individuals was over 15, the highest prevalence and abundance values were 57% and 5.8 spm., respectively. Significant positive coefficients of correlation (Spearman’s and Pearson’s ones between nematode numbers and characteristics of the island were found in the pair «Prevalence – degree of isolation» (0.48 and 0.49. Single-factor analysis of variance showed that the size of the island had some effect on the nematode invasion prevalence and abundance. However, no significant regression relationship between the prevalence and abundance of nematodes and characteristics of an island was revealed by multivariate regression analysis (multiple regression: the coefficient of determination of the regression equation R2 < 0.3, and the regression coefficients were insignificant The reasons for high abundance of C. hepaticum in northern insular ecosystems are discussed. Possible key factors for the stable vitality of the parasite populations are: 1 favourable hydrothermal conditions of the soil in the shore (littoral zone; 2 the possibility of passive transfer between islands; 3 the ability to survive outside the host for a long time (an egg can remain invasive in the external environment for up to three years; and 4 cannibalism as the main pathway of vermination circulation in isolated populations of small mammals.

  16. The phylogenetics of Anguillicolidae (Nematoda: Anguillicoloidea, swimbladder parasites of eels

    Directory of Open Access Journals (Sweden)

    Laetsch Dominik R


    Full Text Available Abstract Background Anguillicolidae Yamaguti, 1935 is a family of parasitic nematode infecting fresh-water eels of the genus Anguilla, comprising five species in the genera Anguillicola and Anguillicoloides. Anguillicoloides crassus is of particular importance, as it has recently spread from its endemic range in the Eastern Pacific to Europe and North America, where it poses a significant threat to new, naïve hosts such as the economic important eel species Anguilla anguilla and Anguilla rostrata. The Anguillicolidae are therefore all potentially invasive taxa, but the relationships of the described species remain unclear. Anguillicolidae is part of Spirurina, a diverse clade made up of only animal parasites, but placement of the family within Spirurina is based on limited data. Results We generated an extensive DNA sequence dataset from three loci (the 5' one-third of the nuclear small subunit ribosomal RNA, the D2-D3 region of the nuclear large subunit ribosomal RNA and the 5' half of the mitochondrial cytochrome c oxidase I gene for the five species of Anguillicolidae and used this to investigate specific and generic boundaries within the family, and the relationship of Anguillicolidae to other spirurine nematodes. Neither nuclear nor mitochondrial sequences supported monophyly of Anguillicoloides. Genetic diversity within the African species Anguillicoloides papernai was suggestive of cryptic taxa, as was the finding of distinct lineages of Anguillicoloides novaezelandiae in New Zealand and Tasmania. Phylogenetic analysis of the Spirurina grouped the Anguillicolidae together with members of the Gnathostomatidae and Seuratidae. Conclusions The Anguillicolidae is part of a complex radiation of parasitic nematodes of vertebrates with wide host diversity (chondrichthyes, teleosts, squamates and mammals, most closely related to other marine vertebrate parasites that also have complex life cycles. Molecular analyses do not support the recent division of Anguillicolidae into two genera. The described species may hide cryptic taxa, identified here by DNA taxonomy, and this DNA barcoding approach may assist in tracking species invasions. The propensity for host switching, and thus the potential for invasive behaviour, is found in A. crassus, A. novaezelandiae and A. papernai, and thus may be common to the group.

  17. Diversification and adaptive sequence evolution of Caenorhabditis lysozymes (Nematoda: Rhabditidae

    Directory of Open Access Journals (Sweden)

    Boehnisch Claudia


    Full Text Available Abstract Background Lysozymes are important model enzymes in biomedical research with a ubiquitous taxonomic distribution ranging from phages up to plants and animals. Their main function appears to be defence against pathogens, although some of them have also been implicated in digestion. Whereas most organisms have only few lysozyme genes, nematodes of the genus Caenorhabditis possess a surprisingly large repertoire of up to 15 genes. Results We used phylogenetic inference and sequence analysis tools to assess the evolution of lysozymes from three congeneric nematode species, Caenorhabditis elegans, C. briggsae, and C. remanei. Their lysozymes fall into three distinct clades, one belonging to the invertebrate-type and the other two to the protist-type lysozymes. Their diversification is characterised by (i ancestral gene duplications preceding species separation followed by maintenance of genes, (ii ancestral duplications followed by gene loss in some of the species, and (iii recent duplications after divergence of species. Both ancestral and recent gene duplications are associated in several cases with signatures of adaptive sequence evolution, indicating that diversifying selection contributed to lysozyme differentiation. Current data strongly suggests that genetic diversity translates into functional diversity. Conclusion Gene duplications are a major source of evolutionary innovation. Our analysis provides an evolutionary framework for understanding the diversification of lysozymes through gene duplication and subsequent differentiation. This information is expected to be of major value in future analysis of lysozyme function and in studies of the dynamics of evolution by gene duplication.

  18. Střevní nematoda koní


    JAROLÍMKOVÁ, Alžběta


    The intestinal nematodes of horses were investigated in this study. Especially the gastrointestinal parasites of groups Strongylinae and Cyathostominae were studied: Strongyloides westeri, Parascaris eqourum a Oxyuris equi. Study concerns with preventive proceeding of inception of parasitic diseases, selection of right anthelmintics and antiparasitic programmes, resistance of gastrointestinal parasites on anthelmintics and their effective matters. Finally, the possible solutions are suggested...

  19. Five new species of the genus Tripylella (Nematoda: Enoplida: Tripylidae). (United States)

    Prado-Vera, Ignacio Cid Del; Ferris, Howard; Nadler, Steven A


    Five new species of the genus Tripylella are described, two from México, one from Fátima, Portugal, one from Quito, Ecuador, and one from California, USA. Tripylella mexicana sp. n. is characterized by its short body (average 0.74 mm), short pharynx (average 161 μm), short tail (average 117 μm), presence of an excretory pore and small setae distributed sparsely along the body, the presence of body pores, the posterior position of the subventral teeth in relation to the small dorsal tooth with all teeth in contiguous stomal chambers, the finely-striated cuticle with many anastomoses, the non-protruding vulval lips, and the presence of sclerotized pieces in the vulval region. Tripylella muscusi sp. n. is characterized by its body length (average 0.94 mm), pharynx length (average 201 μm), tail length (average 140 μm), the anterior position of the subventral teeth in relation to the small dorsal tooth in a single stomal chamber, the presence of an excretory pore, the presence of body pores and sparse somatic setae, the finely-striated cuticle with sparse anastomoses, protruding vulval lips and sclerotized oval-shaped pieces present in the vulval region. Tripylella quitoensis sp. n. is characterized by the short body length (average 0.72 mm), the short outer labial setae, the short pharynx (average 175 μm), the location of the anterior subventral teeth and posterior dorsal tooth in the same stomal chamber, the short tail (average 98 μm), the apparent absence of an excretory pore, presence of body pores, presence of somatic setae, a finely-striated cuticle, non-protruding vulval lips, and very small oval sclerotized pieces in the vulva. Tripylella fatimaensis sp. n. is characterized by the short body, (average 0.74 mm) long, by the length of the pharynx (average 180 μm), the length of the tail (average 110 μm) and in the length of its reduced diameter portion, 45-58 μm, the presence of an excretory pore, body pores and three pairs of caudal setae (one pair each latero-ventral, latero-dorsal and ventral). Tripylella dentata sp. n. is characterized, and differs from all the species of the genus, by the presence of two adjacent stomal chambers, with two large teeth, one dorsal and one ventral, in the posterior stomal chamber and two subventral teeth in the anterior smaller chamber, short body (average 0.85 mm), pharynx length (average 209 μm), tail length (average 115 μm), the apparent absence of an excretory pore, the presence of two cervical setae in a lateral position, and by the presence of conspicuous pores along the body. PMID:27394860


    Protostrongylids, a putative monophyletic group among the lungworms (Metastrongylina: Metastrongyloidea), are economically important pathogens infecting domestic and free-ranging ungulate and leporid hosts throughout the world. Here, we reconstruct a molecular phylogeny based on ribosomal DNA (28S) ...

  1. Sectonema caobangense sp. n. from Vietnam (Nematoda, Dorylaimida, Aporcelaimidae) (United States)

    Álvarez-Ortega, Sergio; Duong Nguyen, Thi Anh; Abolafia, Joaquín; Bonkowski, Michael; Peña-Santiago, Reyes


    Sectonema caobangense sp. n. from evergreen forest soil in Vietnam is described, including scanning electron micrograph (SEM) observations and D2-D3 LSU rDNA analysis. The new species is characterized by its 3.12 to 5.80 mm long body, lip region offset by deep constriction and 21 to 23 μm broad, mural tooth 13 to 14 μm long at its ventral side, 940 to 1,112 μm long neck, pharyngeal expansion occupying 61% to 69% of total neck length, uterus a long simple tube-like structure 292 to 363 μm long or 2.7 to 2.9 times the corresponding body diameter, pars refringens vaginae well developed, V = 48 to 56, short (36–51 μm, c = 77–132, c′ = 0.5–0.8) and rounded tail, 87 to 99 μm long spicules, and four or five irregularly spaced ventromedian supplements bearing hiatus. Sectonema caobangense sp. n. differs from the typical pattern of Sectonema in the nature of the stomatal protrusible structure, bearing a mural tooth attached to the ventral side of the stoma. Molecular data obtained and the derived evolutionary trees support a close phylogenetic relationship with other Sectonema species. PMID:27418702

  2. Description of Rotylenchus graecus n. sp. from Greece (Nematoda: Hoplolaimidae)


    Vovlas, N.; Troccoli, A.


    Rotylenchus graecus n. sp. is described and illustrated from a bisexual population found in Filippias, Epirus, northwestern Greece, in the rhizosphere of ivy (Hedera helix L.) and giant reed (Arundo donax L.) grown on the edge of irrigation canals. Rotylenchus graecus n. sp. is characterized by a lip region with five annules, stylet length of 29-32 μm, vulva position at 53-65%, female tail pointed-conoid with 15-23 annules, and bursa with regularly annulated margins enveloping tail. The new s...

  3. Halicephalobus gingivalis (Nematoda) infection in a Grevy's zebra (Equus grevyi). (United States)

    Isaza, R; Schiller, C A; Stover, J; Smith, P J; Greiner, E C


    A 6-yr-old female Grevy's zebra (Equus grevyi) with a disseminated rhabditiform nematode infection is described. Antemortem clinical signs were limited to blindness and abnormal behavior believed to be caused by a recurrent nematode-induced uveitis. Histologic examination of the kidneys, heart, eyes, uterus, and lymph nodes revealed granulomas containing multiple sections of rhabditiform nematodes. Most of the recovered nematodes were larval stages with only a few adult females noted. The adults measured 243-297 microm x 11-16 microm (x = 269 x 14 microm). The distinctive rhabditiform esophagi had corpus:isthmus:bulb proportions of 19:11:5. On the basis of adult morphology, the nematode was identified as Halicephalobus gingivalis. This is the first report of this parasite in a zebra and indicates that this parasitic granulomatous disease should be considered in zebras with neurologic disease. PMID:10884129

  4. Two Procamallanus spp. (Nematoda, Camallanidae) from fishes in the Philippines

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Cruz-Lacierda, E. R.; Nagasawa, K.


    Roč. 49, č. 4 (2004), s. 309-318. ISSN 1230-2821 R&D Projects: GA AV ČR IAA6022201 Institutional research plan: CEZ:AV0Z6022909 Keywords : parasitic nematode * Procamallanus * Spirocamallanus Subject RIV: EA - Cell Biology Impact factor: 0.560, year: 2004

  5. Presence of Skrjabingylus petrowi (Nematoda) in central Europe

    Czech Academy of Sciences Publication Activity Database

    Koubek, Petr; Baruš, Vlastimil; Koubková, B.


    Roč. 93, č. 4 (2004), s. 301-303. ISSN 0932-0113 R&D Projects: GA AV ČR IBS6093003 Institutional research plan: CEZ:AV0Z6093917 Keywords : Cranial helminth parasites * mustelids Subject RIV: EG - Zoology Impact factor: 1.060, year: 2004

  6. Sectonema caobangense sp. n. from Vietnam (Nematoda, Dorylaimida, Aporcelaimidae). (United States)

    Álvarez-Ortega, Sergio; Duong Nguyen, Thi Anh; Abolafia, Joaquín; Bonkowski, Michael; Peña-Santiago, Reyes


    Sectonema caobangense sp. n. from evergreen forest soil in Vietnam is described, including scanning electron micrograph (SEM) observations and D2-D3 LSU rDNA analysis. The new species is characterized by its 3.12 to 5.80 mm long body, lip region offset by deep constriction and 21 to 23 μm broad, mural tooth 13 to 14 μm long at its ventral side, 940 to 1,112 μm long neck, pharyngeal expansion occupying 61% to 69% of total neck length, uterus a long simple tube-like structure 292 to 363 μm long or 2.7 to 2.9 times the corresponding body diameter, pars refringens vaginae well developed, V = 48 to 56, short (36-51 μm, c = 77-132, c' = 0.5-0.8) and rounded tail, 87 to 99 μm long spicules, and four or five irregularly spaced ventromedian supplements bearing hiatus. Sectonema caobangense sp. n. differs from the typical pattern of Sectonema in the nature of the stomatal protrusible structure, bearing a mural tooth attached to the ventral side of the stoma. Molecular data obtained and the derived evolutionary trees support a close phylogenetic relationship with other Sectonema species. PMID:27418702

  7. Camallanus tridentatus (Drasche) (Nematoda: Camallanidae): new taxonomically important morphological data

    Czech Academy of Sciences Publication Activity Database

    Santos, C. P.; Moravec, František


    Roč. 104, č. 1 (2009), s. 93-99. ISSN 1678-8060 R&D Projects: GA ČR(CZ) GA524/06/0170 Institutional research plan: CEZ:AV0Z60220518 Keywords : Camallanus * Arapaima * Brazil Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine

  8. The life cycle of Dichelyne (Cucullanellus) minutus (Nematoda: Cucullanidae). (United States)

    Køie, M


    Mature specimens of the nematode Dichelyne (Cucullanellus) minutus (Rudolphi, 1819) (Ascaridida, Cucullanidae, Seuratoidea) were obtained from the intestine of flounder Platichthys flesus (L.) caught in the Oresund, Denmark. Plaice Pleuronectes platessa L. and common goby Pomatoschistus microps (Kröyer) also harbour this species. The eggs embryonate on the seabottom. Larvae about 440 microm long, and believed to be in their third stage, hatch from the eggs. These larvae are not directly infective to flounders or gobies. The polychaete Nereis diversicolor O.F. Muller acts as obligatory intermediate host. Experimental infections showed that larvae >600 microm long and provided with achitinous tooth survived in flounder and common goby. The third-stage larvae moult to fourth-stage larvae in the fish gut wall. Mature worms occur in the lumen of the anterior part of the intestine. All developmental stages may be transferred from one flounder to another; thus the flounder may acquire the parasite also by devouring infected gobies. PMID:11817453

  9. The response of Phasmarhabditis hermaphrodita (Nematoda: Rhabditidae) and Steinernema feltiae (Nematoda: Steinernematidae) to different host-associated cues

    Czech Academy of Sciences Publication Activity Database

    Nermuť, Jiří; Půža, Vladimír; Mráček, Zdeněk


    Roč. 61, č. 3 (2012), s. 201-206. ISSN 1049-9644 R&D Projects: GA MŠk(CZ) ME10078 Institutional research plan: CEZ:AV0Z50070508 Keywords : chemoattraciton * entomopathogenic nematode * gastropod parasitic nematode Subject RIV: EH - Ecology, Behaviour Impact factor: 1.917, year: 2012

  10. Estudio de la captación de ácido hialurónico por Ascaris lumbricoides Study of hyaluronic acid capture by Ascaris lumbricoides

    Directory of Open Access Journals (Sweden)

    Patricia Ponce de León


    Full Text Available El ácido hialurónico (AH tiene importantes funciones en la inmunidad. En experiencias previas se demostró que extractos de adultos de A. lumbricoides y concentrados larvarios, tienen capacidad de unión a AH. El objetivo de este trabajo fue estudiar la captación de AH por este helminto. Se trabajó con tres extractos del parásito adulto ([EA]B,C,D y 3 concentrados de larvas ([CLAL1]: 1100 a 1200 larvas/ mL; [CLAL2]: 400 a 600 larvas/ mL y [CLAL3]: 100 a 200 larvas/ mL. Se empleó la técnica modificada de Inhibición de la Adhesión para detección del Receptor CD44 soluble de hialuronato en suero humano. Se definió CexpAdhE AH como el cociente entre los eritrocitos adheridos por el AH en presencia y ausencia del parásito y se definió IexpCP AH, como la cantidad de eritrocitos que se dejaron de adherir debido a la captación de AH por el parásito, referido al número total de eritrocitos. Los resultados mostraron diferencias significativas en CexpAdhE AH y en IexpCP AH, por efecto de la concentración larvaria y del [EA]. Las medias aritméticas de CexpAdhE AH y de IexpCP AH para los concentrados larvarios fueron 0,636 y 0,21 ([CLAL1]; 0,819 y 0,068 ([CLAL2]; 0,97 y 0,013 ([CLAL3]. Las medianas de CexpAdhE AH y de IexpCP AH para los extractos fueron [EA]C 0,275 y 0,4; [EA]B: 0,20 y 0,43; [EA]D: 0,075 y 0,495. La experiencia permitiría suponer que el parásito puede captar AH para interferir en la respuesta inmune del hospedador.Hyaluronan Acid (HA has important functions in immunity. Previous experiences have shown that A. lumbricoides's extracts of adult specimens and larval concentrates have hyaluronan binding capacity. The aim of this study was to analyse the HA capture by this helminth. Three extracts of adult specimens ([AE]B,C,D and 3 larval concentrates ([ALLC1]: 1100 to 1200 larvae/ mL; [ALLC2]: 400 to 600 larvae/ mL and [ALLC3]: 100 to 200 larvae/ mL were studied. The modified test of serum soluble CD44 Detection by Aggregation Inhibition was used. CexpAdhE AH was defined as the quotient between erythrocytes adhered by the HA in presence and in absence of the parasite, and IexpCP AH was defined as the amount of erythrocytes that stopped adhering due to the HA capture by the parasite in relation to the total number of erythrocytes. The results showed significant differences in CexpAdhE AH and IexpCP AH as the result of larvae concentration and of the extracts. The arithmetic means of CexpAdhE AH and IexpCP AH for the larvae were 0.636 and 0.21 ([ALLC1]; 0.819 and 0.068 ([ALLC2]; 0.97 and 0.013 ([ALLC3]. Medians of CexpAdhE AH and IexpCP AH for the extracts were [EA]C:0.275 and 0.4; [EA]B: 0.20 and 0.43; [EA]D: 0.075 and 0.495. From the experience, it could be assumed that the parasite can capture the HA to interfere in the host's immune response.

  11. Parasites diversity in carnivorous animals in the territory of Dnipropetrovsk


    О. О. Boyko; L. I. Faly; V. V. Brygadyrenko


    In Dnipropetrovsk sity (Ukraine, Dnipropetrovsk region) in carnivorous animals 10 species of parasites (helminths and coccidia) were found: Uncinaria sp., Ancylostoma sp., Dictyocaulus immitis (Nematoda, Strongylata), Strongyloides stercoralis (Nematoda, Rhabditata), Spirocerca lupi (Nematoda, Spirurata), Toxocara canis (Nematoda, Ascaridata), Trichuris vulpis (Nematoda, Trichurata), Dipylidium caninum (Cestoda, Hymenolepidata), Cystoisospora sp. and Toxoplasma gondii (Sporozoa, Coccidia). In...

  12. In vitro and in vivo efficacy of Monepantel (AAD 1566 against laboratory models of human intestinal nematode infections.

    Directory of Open Access Journals (Sweden)

    Lucienne Tritten


    Full Text Available BACKGROUND: Few effective drugs are available for soil-transmitted helminthiases and drug resistance is of concern. In the present work, we tested the efficacy of the veterinary drug monepantel, a potential drug development candidate compared to standard drugs in vitro and in parasite-rodent models of relevance to human soil-transmitted helminthiases. METHODOLOGY: A motility assay was used to assess the efficacy of monepantel, albendazole, levamisole, and pyrantel pamoate in vitro on third-stage larvae (L3 and adult worms of Ancylostoma ceylanicum, Necator americanus and Trichuris muris. Ancylostoma ceylanicum- or N. americanus-infected hamsters, T. muris- or Ascaris suum-infected mice, and Strongyloides ratti-infected rats were treated with single oral doses of monepantel or with one of the reference drugs. PRINCIPAL FINDINGS: Monepantel showed excellent activity on A. ceylanicum adults (IC(50 = 1.7 µg/ml, a moderate effect on T. muris L3 (IC(50 = 78.7 µg/ml, whereas no effect was observed on A. ceylanicum L3, T. muris adults, and both stages of N. americanus. Of the standard drugs, levamisole showed the highest potency in vitro (IC(50 = 1.6 and 33.1 µg/ml on A. ceylanicum and T. muris L3, respectively. Complete elimination of worms was observed with monepantel (10 mg/kg and albendazole (2.5 mg/kg in A. ceylanicum-infected hamsters. In the N. americanus hamster model single 10 mg/kg oral doses of monepantel and albendazole resulted in worm burden reductions of 58.3% and 100%, respectively. Trichuris muris, S. ratti and A. suum were not affected by treatment with monepantel in vivo (following doses of 600 mg/kg, 32 mg/kg and 600 mg/kg, respectively. In contrast, worm burden reductions of 95.9% and 76.6% were observed following treatment of T. muris- and A. suum infected mice with levamisole (200 mg/kg and albendazole (600 mg/kg, respectively. CONCLUSIONS/SIGNIFICANCE: Monepantel reveals low or no activities against N. americanus

  13. Production of class a biosolids with anoxic low dose alkaline treatment and odor management

    Energy Technology Data Exchange (ETDEWEB)

    Abu-Orf, M.M.; Brewster, J.; Oleszkiewicz, J.; Reimers, R.S.; Lagasse, P.; Amy, B.; Glindemann, D.


    The feasibility of full-scale anoxic disinfection of dewatered and digested sludge from Winnipeg, Manitoba with low lime doses and lagoon fly ash was investigated to determine if a class A product could be produced. Lime doses of 50g, 100g, and 200g per kg of biosolids (dry) were used along with fly ash doses of 500g. 1000g. and 1500g per kg of biosolids (dry). The mixed product was buried in eight-10 cubic meter trenches at the West End Water Pollution Control Center In Winnipeg. The trenches were backfilled with dirt and trapped to simulate anoxic conditions. Sampling cages were packed with the mixed product and pathogens non-indigenous to Winnipeg's biosolids. The cages were buried amongst the mixed biosolids in the trench. The non-indigenous pathogens spiked in the laboratory were the helminth Ascaris suum and the enteric virus reovirus. Samples were removed at days 12, 40, 69, 291, and 356 and were tested for the presence of fecal Coliform, Clostridium perfringens spores, Ascaris suum eggs, and reovirus. The pH, total solids, and free ammonia content of the mixed product were also determined for each sample. Odor was quantified for samples at both 291 and 356 days. Fecal Coliform bacteria and reovirus were completely inactivated for doses as low as 100g lime per kg biosolids (dry) and 50g lime + 500g fly ash per kg biosolids (dry). Spores of the bacteria C. perfringens experienced a 4-log reduction when treated with 100g lime per kg biosolids and a 5-log reduction when treated with doses as low as 50g lime + 500g fly ash per kg biosolids (dry) after 69 days. Ascaris eggs were completely inactivated in 5 gram packets for all treatments involving 100g lime per kg biosolids (dry) after 69 days. Class A pathogen requirements were met for all treatments involving a lime dose of at least 100g per kg biosolids. The odor potential from the produced biosolids is also assessed. (author)

  14. Structural basis for nematode eIF4E binding an m(2,2,7)G-Cap and its implications for translation initiation. (United States)

    Liu, Weizhi; Jankowska-Anyszka, Marzena; Piecyk, Karolina; Dickson, Laura; Wallace, Adam; Niedzwiecka, Anna; Stepinski, Janusz; Stolarski, Ryszard; Darzynkiewicz, Edward; Kieft, Jeffrey; Zhao, Rui; Jones, David N M; Davis, Richard E


    Metazoan spliced leader (SL) trans-splicing generates mRNAs with an m(2,2,7)G-cap and a common downstream SL RNA sequence. The mechanism for eIF4E binding an m²²⁷G-cap is unknown. Here, we describe the first structure of an eIF4E with an m(2,2,7)G-cap and compare it to the cognate m⁷G-eIF4E complex. These structures and Nuclear Magnetic Resonance (NMR) data indicate that the nematode Ascaris suum eIF4E binds the two different caps in a similar manner except for the loss of a single hydrogen bond on binding the m(2,2,7)G-cap. Nematode and mammalian eIF4E both have a low affinity for m(2,2,7)G-cap compared with the m⁷G-cap. Nematode eIF4E binding to the m⁷G-cap, m(2,2,7)G-cap and the m(2,2,7)G-SL 22-nt RNA leads to distinct eIF4E conformational changes. Additional interactions occur between Ascaris eIF4E and the SL on binding the m(2,2,7)G-SL. We propose interactions between Ascaris eIF4E and the SL impact eIF4G and contribute to translation initiation, whereas these interactions do not occur when only the m(2,2,7)G-cap is present. These data have implications for the contribution of 5'-UTRs in mRNA translation and the function of different eIF4E isoforms. PMID:21965542



    Pinardi Hadidjaja; Siti Alisah N. Abidin; Sulistyoweni W


    An introduction of integrated management system for human excreta was carried out in the village of Cirimekar, Cibinong subdistrict, West Java The purpose of this study is to gain the readiness and motivation of the population in that village to participate and benefit the product of this system for fish farming and the growth of water hyacinth (Eichornia crassipes). The study was performed integratedly between several aspects namely the socio-economica, tech­nical, medical, biologicatas well...

  16. Association of geophagia with Ascaris, Trichuris and hookworm transmission in Zanzibar, Tanzania


    Young, Sera L.; Goodman, Dave; Farag, Tamer H.; Ali, Said M.; Khatib, Mzee R.; Khalfan, Sabra S.; Tielsch, James M; Stoltzfus, Rebecca J.


    Geophagia may be harmful as a method for the transmission of geohelminths. In this study, we pose two questions in a representative sample of 970 pregnant women from Pemba Island, Zanzibar, Tanzania. Can consumed earth be a vector for geohelminth infection? And do geophagists have differential parasitic infection? The parasitological content of 59 non-food substance samples was analysed. Cross-sectional data regarding pica behaviour were collected through interviews conducted by local researc...

  17. Deep small RNA sequencing from the nematode Ascaris reveals conservation, functional diversification, and novel developmental profiles


    Wang, Jianbin; Czech, Benjamin; Crunk, Amanda; Wallace, Adam; Mitreva, Makedonka; Hannon, Gregory J.; Davis, Richard E


    Eukaryotic cells express several classes of small RNAs that regulate gene expression and ensure genome maintenance. Endogenous siRNAs (endo-siRNAs) and Piwi-interacting RNAs (piRNAs) mainly control gene and transposon expression in the germline, while microRNAs (miRNAs) generally function in post-transcriptional gene silencing in both somatic and germline cells. To provide an evolutionary and developmental perspective on small RNA pathways in nematodes, we identified and characterized...

  18. Investigations of selected pathogens among village pigs in Central Papua, Indonesia. (United States)

    Nugroho, Widi; Cargill, Colin Frank; Putra, I Made; Kirkwood, Roy Neville; Trott, Darren John; Salasia, Siti Isrina Oktavia; Slipranata, Mitra; Reichel, Michael Philipp


    Village pig husbandry is an important part of livestock production in Papua Province, Eastern Indonesia. However, high level of disease and mortality constrains production. The aim of this study was to investigate the prevalence of the selected pathogens in village pigs in the Jayawijaya Region of Papua Province, Indonesia. Two studies were conducted: Study 1 determined the prevalence of selected pathogens in dead or moribund pigs sent to the main local market for sale. Study 2 recorded the prevalence of the selected pathogens, on pig farms in the Subdistrict of Wamena that had not recorded a case of pig mortality during the duration of Study 1. Blood samples of individuals from both groups were tested for CSF antigen and antibody, as well as antibody against PCV2. Organs with evident pathological changes from Study 1 and tonsilar swabs from Study 2 were subjected to bacteriological culture and identification of Streptococcus suis and Streptococcus zooepidemicus. Faecal samples from both studies were examined for eggs of strongyle parasites, Trichuris suis, Ascaris suum, Strongyloides ransomi and coccidia. The main infections in both studies were CSF, PCV2 and strongyle parasites, but prevalence was higher in Study 1 (P < 0.05). T. suis and S. zooepidemicus were prevalent in pigs in Study 1, but rare in healthy pigs (P < 0.05). Infections with coccidia, A. suum and S. ransomi were common but did not differ between groups (P < 0.05), with S. suis infections uncommon in both studies. This suggests that infections with CSF, PCV2, strongyle and T. suis are important pathogens in village pig farms in Jayawijaya. Local pig husbandry practices, such as confining pigs and heat-treating pig feeds, may be practical solutions to help minimize infection in village pigs in Jayawijaya. PMID:26381546

  19. An evaluation of ethyl-6-ethoxybenzothiazole-2-carbamate (Sch 18099) for anthelmintic activity in domestic animals. (United States)

    Panitz, E


    Ethyl-6-ethoxybenzothiazole-2-carbamate (Sch 18099) was evaluated for efficacy against natural helminth infections in ponies, pigs, lambs and chickens. Sixteen critical trials were conducted in ponies at dosages of 15 to 150 mg/kg. At 15 mg/kg, efficacy against adult and larval Oxyuris equi was 100% and 91% and against small strongyles it was 98%. Efficacy levels were 95% against Strongylus vulgaris and S. edentatus at the 20 mg/kg dosage. In two trials at 100 mg/kg efficacy against Parascaris equorum was 77%. No efficacy was observed against Gastrophilus spp. or Anoplocephala spp. In swine single oral doses of 10 to 100 mg/kg were not effective. 500 ppm Sch 18099 in the diet for seven days resulted in 100% efficacy against Ascaris suum and Trichuris suis but had no effect on Stongyloides ransomi. Efficacy at 250 ppm against A. suum was 77%. Efficacy at 200 mg/kg in lambs was greater than 90% for Haemonchus contortus, Trichostrongylus axei, Marshallagia marshalli, Bunostomum trignocephalum, Oesophagostomum columbianum, Trichuris ovis, and Chabertia spp. Efficacy was less than 80% for Trichostrongylus vitrinus, Nematodirus filicollis, Ostertagia circumcinta and Cooperia curticei. Except for O. circumcinta and C. curticei, drug efficacy was reduced for these worms in lambs treated at 100 mg/kg. Efficacies of 14.3-89% against Ascaridia galli were obtained with dietary levels of 125-1000 ppm Sch 18099 fed for 7 days. Efficacy of 100% was recorded against Heterakis gallinarum at the 1000 ppm dietary drug level. PMID:864223

  20. Radiation hygienization of cattle and swine slurry with high energy electron beam

    International Nuclear Information System (INIS)

    The research was carried out to assess the efficiency of radiation hygienization of cattle and swine slurry of different density using the high energy electron beam based on the inactivation rate of Salmonella ssp, Escherichia coli, Enterococcus spp and Ascaris suum eggs. The experiment was conducted with use of the linear electron accelerator Elektronika 10/10 in Institute of Nuclear Chemistry and Technology in Warsaw. The inoculated slurry samples underwent hygienization with high energy electron beam of 1, 3, 5, 7 and 10 kGy. Numbers of reisolated bacteria were determined according to the MPN method, using typical microbiological media. Theoretical lethal doses, D90 doses and hygienization efficiency of high energy electron beam were determined. The theoretical lethal doses for all tested bacteria ranged from 3.63 to 8.84 kGy and for A. suum eggs from 4.07 to 5.83 kGy. Salmonella rods turned out to be the most sensitive and Enterococcus spp were the most resistant to electron beam hygienization. The effectiveness or radiation hygienization was lower in cattle than in swine slurry and in thick than in thin one. Also the species or even the serotype of bacteria determined the dose needed to inactivation of microorganisms. - Highlights: ► The hygienic efficiency of electron beam against slurry was researched. ► The hygienization efficiency depended on the slurry characteristics and microorganism species. ► In most of the cases 7 kGy dose was sufficient for slurry hygienization. ► Dose below 1 kGy allowed for 90% elimination of microorganism population. ► The radiation hygienization is a good alternative for typical slurry treatment methods