WorldWideScience

Sample records for ascaris suum muscle

  1. DNA extraction from Ascaris suum muscle tissue

    OpenAIRE

    Di Mito, Carmela; Betschart, Bruno

    2009-01-01

    A new method for the extraction of DNA from Ascaris suum muscle has been developed. It combines a standard SDS-based extraction with a plant DNA extraction procedure. The use of SDS and proteinase K allows the elimination of proteins, while CTAB and polyclar AT eliminate glycogen and polyphenols. The DNA thus obtained can easily be digested by endonucleases and amplified by PCR.

  2. Are Ascaris lumbricoides and Ascaris suum a single species?

    OpenAIRE

    Leles Daniela; Gardner Scott L; Reinhard Karl; Iñiguez Alena; Araujo Adauto

    2012-01-01

    Abstract Since the original description and naming of Ascaris lumbricoides from humans by Linnaeus in 1758 and later of Ascaris suum from pigs by Goeze 1782, these species have been considered to be valid. Four hypotheses relative to the conspecificity or lack thereof (and thus origin of these species) are possible: 1) Ascaris lumbricoides (usually infecting humans) and Ascaris suum (recorded mostly from pigs) are both valid species, with the two species originating via a speciation event fro...

  3. Transmission dynamics of Ascaris suum in organic pigs

    OpenAIRE

    Gautam, Susmita

    2014-01-01

    The transmission of Ascaris suum depends upon the type of swine production system. Organic farm with outdoor facilities provide favorable conditions for the development and survival of this soil transmitted helminth. The present study was carried out from late October 2013 to late February 2014 to study the infection dynamics of A. suum in pigs born and raised on two Danish organic.

  4. Immunological studies on Ascaris suum infections in mice

    NARCIS (Netherlands)

    Phan van Than*; Knapen; F.van

    1986-01-01

    Het betreft een rapportage van onderzoek dat werd verricht door Dr.Phan van Than, Instituut voor Parasitologie, Medische Faculteit Hanoi, Vietnam. Dr.Than heeft zich in het bijzonder bezig gehouden met het toetsen van verschillende antigenen afkomstig van Ascaris suum en Ascaris lumbricoides lar

  5. Untersuchung zur Übertragung von Ascaris suum durch Ratten (Rattus norvegicus).

    OpenAIRE

    Gaberle, Alexandra

    2010-01-01

    Investigation on the transmission of Ascaris suum by rats (Rattus norvegicus). In this study the possibility of rats being paratenic hosts of Ascaris suum were examined. Therefore an infection of swine with Ascaris suum by infected rats should be provoked. A group of 48 rats were experimentally infected with eggs of Ascaris suum. The rats were killed in different time intervals. They were examined for migrating larvae by digesting the organs and counting the developed larvae and by pr...

  6. Comparative analysis of microRNA profiles between adult Ascaris lumbricoides and Ascaris suum

    OpenAIRE

    Shao, Chang-Chun; Xu, Min-Jun; Alasaad, Samer; Song, Hui-Qun; Peng, Lifei; Tao, Jian-Ping; Zhu, Xing-Quang

    2014-01-01

    Background: The parasitic nematodes Ascaris lumbricoides and A. suum are of great public health and economic significance, and the two taxa were proposed to represent a single species. miRNAs are known with functions of gene regulations at post-transcriptional level. Results: We herein compared the miRNA profiles of A. lumbricoides and A. suum female adults by Solexa deep sequencing combined with bioinformatics analysis and stem-loop real-time PCR. Using the A. suum genome as the ...

  7. Mitochondrial ultrastructural and atpase changes during the life cycle of Ascaris Suum

    OpenAIRE

    Rodrick, G E; S. D. Long; W. A. Sodeman Junior; Smith, D. L.

    1982-01-01

    Ultrastructural morphology and ATPase specific activities of mitochondria isolated from 1-celled fertilized egg, 10-day embryo, 21-day infective larvae and adult body wall muscle of Ascaris suum and rat liver were determined and compared. Although cristae of both muscle and egg mitochondria contained numerous elementary particles with head pieces of conventional diameter (85 A), each muscle mitochondrion contained relatively few, short cristae with a diminished frequency of elementary particl...

  8. Immunological studies on Ascaris suum infections in mice

    OpenAIRE

    Phan van Than*; Knapen; F

    1986-01-01

    Het betreft een rapportage van onderzoek dat werd verricht door Dr.Phan van Than, Instituut voor Parasitologie, Medische Faculteit Hanoi, Vietnam. Dr.Than heeft zich in het bijzonder bezig gehouden met het toetsen van verschillende antigenen afkomstig van Ascaris suum en Ascaris lumbricoides larven op geschiktheid voor het opwekken van beschermende immuniteit in muizen. Tevens werd gekeken naar het gebruik van deze antigenen voor het verrichten van serodiagnostiek. Uit het onderzoek is naar v...

  9. Inactivation of Ascaris suum by short-chain fatty acids

    Science.gov (United States)

    Ascaris suum eggs were inactivated in distilled water and digested sludge by butanoic, pentanoic and hexanoic acids. The fatty acids (FA) were only effective when protonated and at sufficient concentration. The conjugate bases were not effective at the concentrations evaluated. Predictions from an ...

  10. Phosphorylation of the pyruvate dehydrogenase complex isolated from Ascaris suum

    Energy Technology Data Exchange (ETDEWEB)

    Thissen, J.; Komuniecki, R.

    1987-05-01

    The pyruvate dehydrogenase complex (PDC) from body wall muscle of the porcine nematode, Ascaris suum, plays a pivotal role in anaerobic mitochondrial metabolism. As in mammalian mitochondria, PDC activity is inhibited by the phosphorylation of the ..cap alpha..PDH subunit, catalyzed by an associated PDH/sub a/ kinase. However, in contrast to PDC's isolated from all other eukaryotic sources, phosphorylation decreases the mobility of the ..cap alpha..PDH subunit on SDS-PAGE and permits the separation of the phosphorylated and nonphosphorylated ..cap alpha..PDH's. Phosphorylation and the inactivation of the Ascaris PDC correspond directly, and the additional phosphorylation that occurs after complete inactivation in mammalian PDC's is not observed. The purified ascarid PDC incorporates 10 nmoles /sup 32/P/mg P. Autoradiography of the radiolabeled PDC separated by SDS-PAGE yields a band which corresponds to the phosphorylated ..cap alpha..PDH and a second, faint band which is present only during the first three minutes of PDC inactivation, intermediate between the phosphorylated and nonphosphorylated ..cap alpha..PDH subunit. Tryptic digests of the /sup 32/P-PDC yields one major phosphopeptide, when separated by HPLC, and its amino acid sequence currently is being determined.

  11. Phosphorylation of the pyruvate dehydrogenase complex isolated from Ascaris suum

    International Nuclear Information System (INIS)

    The pyruvate dehydrogenase complex (PDC) from body wall muscle of the porcine nematode, Ascaris suum, plays a pivotal role in anaerobic mitochondrial metabolism. As in mammalian mitochondria, PDC activity is inhibited by the phosphorylation of the αPDH subunit, catalyzed by an associated PDH/sub a/ kinase. However, in contrast to PDC's isolated from all other eukaryotic sources, phosphorylation decreases the mobility of the αPDH subunit on SDS-PAGE and permits the separation of the phosphorylated and nonphosphorylated αPDH's. Phosphorylation and the inactivation of the Ascaris PDC correspond directly, and the additional phosphorylation that occurs after complete inactivation in mammalian PDC's is not observed. The purified ascarid PDC incorporates 10 nmoles 32P/mg P. Autoradiography of the radiolabeled PDC separated by SDS-PAGE yields a band which corresponds to the phosphorylated αPDH and a second, faint band which is present only during the first three minutes of PDC inactivation, intermediate between the phosphorylated and nonphosphorylated αPDH subunit. Tryptic digests of the 32P-PDC yields one major phosphopeptide, when separated by HPLC, and its amino acid sequence currently is being determined

  12. Bacillus thuringiensis-derived Cry5B has potent anthelmintic activity against Ascaris suum

    Science.gov (United States)

    Ascaris suum and Ascaris lumbricoides are two closely related geo-helminth parasites that ubiquitously infect pigs and humans, respectively. Ascaris suum infection in pigs is considered a good model for A. lumbricoides infection in humans because of a similar biology and tissue migration to the inte...

  13. Comparative analysis of microRNA profiles between adult Ascaris lumbricoides and Ascaris suum

    OpenAIRE

    Shao, Chang-Chun; Xu, Min-Jun; Alasaad, Samer; Song, Hui-Qun; Peng, Lifei; Tao, Jian-Ping; Zhu, Xing-Quang

    2014-01-01

    Abstract Background The parasitic nematodes Ascaris lumbricoides and A. suum are of great public health and economic significance, and the two taxa were proposed to represent a single species. miRNAs are known with functions of gene regulations at post-transcriptional level. Results We herein compared the miRNA profiles of A. lumbricoides and A. suum female adults by Solexa deep sequencing combined with bioinformatics analysis and stem-loop real-time PCR. Using the A. suum genome as the refer...

  14. Comparative analysis of microRNA profiles between adult Ascaris lumbricoides and Ascaris suum

    OpenAIRE

    Shao, Chang-Chun; Xu, Min-Jun; Alasaad, Samer; Song, Hui-Qun; Peng, Lifei; Tao, Jian-Ping; Zhu, Xing-Quan

    2014-01-01

    Background The parasitic nematodes Ascaris lumbricoides and A. suum are of great public health and economic significance, and the two taxa were proposed to represent a single species. miRNAs are known with functions of gene regulations at post-transcriptional level. Results We herein compared the miRNA profiles of A. lumbricoides and A. suum female adults by Solexa deep sequencing combined with bioinformatics analysis and stem-loop real-time PCR. Using the A. suum genome as the reference geno...

  15. Effects of Disinfectants on Larval Development of Ascaris suum Eggs.

    Science.gov (United States)

    Oh, Ki-Seok; Kim, Geon-Tae; Ahn, Kyu-Sung; Shin, Sung-Shik

    2016-02-01

    The objective of this study was to evaluate the effects of several different commercial disinfectants on the embryogenic development of Ascaris suum eggs. A 1-ml aliquot of each disinfectant was mixed with approximately 40,000 decorticated or intact A. suum eggs in sterile tubes. After each treatment time (at 0.5, 1, 5, 10, 30, and 60 min), disinfectants were washed away, and egg suspensions were incubated at 25˚C in distilled water for development of larvae inside. At 3 weeks of incubation after exposure, ethanol, methanol, and chlorohexidin treatments did not affect the larval development of A. suum eggs, regardless of their concentration and treatment time. Among disinfectants tested in this study, 3% cresol, 0.2% sodium hypochlorite and 0.02% sodium hypochlorite delayed but not inactivated the embryonation of decorticated eggs at 3 weeks of incubation, because at 6 weeks of incubation, undeveloped eggs completed embryonation regardless of exposure time, except for 10% povidone iodine. When the albumin layer of A. suum eggs remained intact, however, even the 10% povidone iodine solution took at least 5 min to reasonably inactivate most eggs, but never completely kill them with even 60 min of exposure. This study demonstrated that the treatment of A. suum eggs with many commercially available disinfectants does not affect the embryonation. Although some disinfectants may delay or stop the embryonation of A. suum eggs, they can hardly kill them completely. PMID:26951988

  16. Ascaris suum: molecular cloning of an intermediate filament

    OpenAIRE

    Bisoffi, Marco; Betschart, Bruno

    2009-01-01

    It has been proposed that intermediate filament proteins are involved in force transduction from the muscle cells through the hypodermis to the cuticle of nematodes. An additional role of intermediate filaments as excretory/secretory components of parasitic nematodes is under discussion. We report on the molecular characterization of the cDNA clone AsIF of the intestinal nematode parasite Ascaris suum, encoding a member of the intermediate filament protein family by sequence comparison with i...

  17. Bacillus thuringiensis-derived Cry5B Has Potent Anthelmintic Activity against Ascaris suum

    OpenAIRE

    Urban, Joseph F.; Hu, Yan; Miller, Melanie M; Scheib, Ulrike; Ying Y Yiu; Aroian, Raffi V.

    2013-01-01

    Ascaris suum and Ascaris lumbricoides are two closely related geo-helminth parasites that ubiquitously infect pigs and humans, respectively. Ascaris suum infection in pigs is considered a good model for A. lumbricoides infection in humans because of a similar biology and tissue migration to the intestines. Ascaris lumbricoides infections in children are associated with malnutrition, growth and cognitive stunting, immune defects, and, in extreme cases, life-threatening blockage of the digestiv...

  18. In vitro synthesis of the pyruvate dehydrogenase complex components of Ascaris suum mitochondria

    Energy Technology Data Exchange (ETDEWEB)

    Desai, S.; Ruff, V.; DuBrul, E.F.; Komuniecki, R.W.

    1987-05-01

    The pyruvate dehydrogenase complex (PDC) plays a pivotal role in the anaerobic metabolism of Ascaris suum mitochondria. They have initiated a series of studies on the in vitro synthesis and mitochondrial import of PDC. PDC has been purified from adult Ascaris body wall muscle, fully phosphorylated in vitro, and separated into its component subunits on SDS/PAGE. The individual components were electroeluted from the gels and used to immunize rabbits. IgG's to the individual subunits were prepared from antisera and their specificities were verified by immuno-blotting. Each IgG identified a single specific band at the appropriate location in extracts of adult Ascaris body wall muscle mitochondria. Poly A/sup +/-RNA was prepared from body wall muscle and translated in a reticylocyte lysate system using /sup 35/S-methionine. Translation products were immunoprecipitated with specific IgG's, electrophoresed, and fluorographed. Each immunoprecipitation gave rise to a single radioactive polypeptide that was slightly larger than the specific PDC subunit isolated from the adult mitochondria. This system has demonstrated its feasibility for the study of mitochondrial import of a multienzyme complex that is critical for the anaerobic mitochondrial metabolism of Ascaris suum.

  19. In vitro synthesis of the pyruvate dehydrogenase complex components of Ascaris suum mitochondria

    International Nuclear Information System (INIS)

    The pyruvate dehydrogenase complex (PDC) plays a pivotal role in the anaerobic metabolism of Ascaris suum mitochondria. They have initiated a series of studies on the in vitro synthesis and mitochondrial import of PDC. PDC has been purified from adult Ascaris body wall muscle, fully phosphorylated in vitro, and separated into its component subunits on SDS/PAGE. The individual components were electroeluted from the gels and used to immunize rabbits. IgG's to the individual subunits were prepared from antisera and their specificities were verified by immuno-blotting. Each IgG identified a single specific band at the appropriate location in extracts of adult Ascaris body wall muscle mitochondria. Poly A+-RNA was prepared from body wall muscle and translated in a reticylocyte lysate system using 35S-methionine. Translation products were immunoprecipitated with specific IgG's, electrophoresed, and fluorographed. Each immunoprecipitation gave rise to a single radioactive polypeptide that was slightly larger than the specific PDC subunit isolated from the adult mitochondria. This system has demonstrated its feasibility for the study of mitochondrial import of a multienzyme complex that is critical for the anaerobic mitochondrial metabolism of Ascaris suum

  20. Elektroforetska analiza proteina iz spolnih organa i kutikule glista Ascaris lumbricoides i Ascaris suum

    OpenAIRE

    Alba, Julisar Elaine; Normandee Comia, Mary; Oyong, Glenn; Claveria, Florencia

    2009-01-01

    Ascaris lumbricoides i Ascaris suum bili su analizirani radi utvrđivanja sličnosti i razlike u elektroforetskoj pokretljivosti proteina iz njihove kutikule i spolnih organa. U obje vrste dokazana je znatna sličnost proteinskoga profila. Elektroforezom iscrpka kutikule ženki ustanovljeno je deset zajedničkih vrpci za obje vrste, dok je elektroforezom proteina kutikule mužjaka dobiveno 12 zajedničkih vrpci proteina od čega je najmanje pet proteina bilo zajedničko za oba spola. Usporedbom protei...

  1. Comparison of different monoclonal antibodies against immunosuppressive proteins of Ascaris suum

    OpenAIRE

    T.M. Oshiro; A. Rafael; C.S. Enobe; Fernandes, I; Macedo-Soares, M.F.

    2004-01-01

    The extract of Ascaris suum suppresses the humoral and cellular immune responses to unrelated antigens in the mouse. In order to further characterize the suppressive components of A. suum, we produced specific monoclonal antibodies which can provide an important tool for the identification of these proteins. The A. suum immunosuppressive fractions isolated by gel filtration from an extract of adult worms were used to immunize BALB/c mice. Popliteal lymph node cells taken from the immunized an...

  2. In vivo testing of alternatives for conventional treatment of Ascaris suum in pigs

    OpenAIRE

    Krimpen, van, M.M.; Binnendijk, G.P.; Borgsteede, F.H.M.; Gaasenbeek, C.P.H.

    2007-01-01

    Summary The percentage of disapproved livers of growing and finishing pigs has been increased significantly during the last years. In organic pig farms, this percentage is often higher than in conventional pig farms. In most cases, disapproved livers are the result of an infection with Ascaris suum. Usually, an infection of Ascaris suum is treated or controlled by using conventional synthetic drugs belonging to the benzimidazoles, levamisole and macrocyclic lactones. Organic farmers, howev...

  3. Ascaris suum in Saskatchewan Pigs: An Abattoir Survey of Prevalence and Intensity of Infection

    OpenAIRE

    Polley, L. R.; Mostert, P. E.

    1980-01-01

    In a survey of 2500 market weight pigs in a Saskatchewan abattoir, 37% were infected with adult Ascaris suum and in 46% there were milkspot hepatic lesions. A total of 60% of the pigs examined had some evidence of A. suum infection. Most infected pigs contained less than 50 adult ascarids.

  4. Anthelmintic effects of phytogenic feed additives in Ascaris suum inoculated pigs

    NARCIS (Netherlands)

    Krimpen, van M.M.; Binnendijk, G.P.; Borgsteede, F.H.M.; Gaasenbeek, C.P.H.

    2010-01-01

    Two experiments were performed to determine the anthelmintic effect of some phytogenic feed additives on a mild infection of Ascaris suum in growing and finishing pigs. Usually, an infection of A. suum is controlled by using conventional synthetic drugs. Organic farmers, however, prefer a non-pharma

  5. Survival of salmonella and Ascaris suum eggs in a thermophilic biogas plant

    Energy Technology Data Exchange (ETDEWEB)

    Plym-Forshell, L. [Swedish Univ. of Agricultural Sciences, Dept. of Animal Hygiene, Faculty of Veterinary Medicine, Skara (Denmark)

    1995-11-01

    In a continuous biogas plant, receiving manure from 200 dairy cows and 400 calves and young stock, survival of salmonella and Ascaris suum eggs was studied. The bacteria and parasite eggs were kept in filter sacs in the manure that ha a temperature of 55 deg. C. No viable salmonella or Ascaris suum eggs could be found after 24 h in the digester. Survival of salmonella and Ascaris suum eggs was also studied in the manure pit where the manure was stored after digestion. The temperature in the manure pit varied between 22-27 deg. C. Salmonella survived 35 but not 42 days. On day 56, when the experiments had to be stooped, 60% of the Ascaris eggs were viable. (au) 30 refs.

  6. Immunizing pigs with Ascaris suum hemoglobin increases the inflammatory response in the liver but fails to induce a protective immunity

    Science.gov (United States)

    To determine whether purified Ascaris suum hemoglobin (AsHb) is a suitable vaccine candidate for the control of Ascaris infections, pigs were 30 vaccinated with AsHb in combination with QuilA adjuvant and challenged with A. suum eggs. The number of liver lesions and worms in the intestine was assess...

  7. Effect of some herbs as alternative for conventional treatment of Ascaris suum in pigs

    NARCIS (Netherlands)

    Krimpen, van M.M.; Binnendijk, G.P.; Borgsteede, F.H.M.; Gaasenbeek, C.P.H.

    2008-01-01

    Het doel van het onderzoek was na te gaan wat de preventieve werking is van drie enkelvoudige kruiden, elk met een verschillend vermeend werkingsmechanisme (proteolytische enzymen, alkaloïden, bitterstoffen), op een milde besmetting met spoelwormen (Ascaris suum) bij vleesvarkens. Het besmettingsniv

  8. Galloylated proanthocyanidins from shea (Vitellaria paradoxa) meal have potent anthelmintic activity against Ascaris suum

    DEFF Research Database (Denmark)

    Ramsay, A; Williams, A R; Thamsborg, S M;

    2016-01-01

    -O-gallates, especially EGCg (575mg/kg meal), which is known for its health and anti-parasitic benefits. Proanthocyanidins were isolated and tested for bioactivity against Ascaris suum, which is an important parasite of pigs. Migration and motility tests revealed that these PA have potent activity against this parasitic...

  9. A role for eosinophils in the intestinal immunity against infective Ascaris suum larvae.

    Directory of Open Access Journals (Sweden)

    Dries Masure

    Full Text Available The aim of this study was to explore the mechanisms of resistance against invading Ascaris suum larvae in pigs. Pigs received a low dose of 100 A. suum eggs daily for 14 weeks. This resulted in a >99% reduction in the number of larvae that could migrate through the host after a challenge infection of 5000 A. suum eggs, compared to naïve pigs. Histological analysis at the site of parasite entry, i.e. the caecum, identified eosinophilia, mastocytosis and goblet cell hyperplasia. Increased local transcription levels of genes for IL5, IL13, eosinophil peroxidase and eotaxin further supported the observed eosinophil influx. Further analysis showed that eosinophils degranulated in vitro in response to contact with infective Ascaris larvae in the presence of serum from both immune and naïve animals. This effect was diminished with heat-inactivated serum, indicating a complement dependent mechanism. Furthermore, eosinophils were efficient in killing the larvae in vitro when incubated together with serum from immune animals, suggesting that A. suum specific antibodies are required for efficient elimination of the larvae. Together, these results indicate an important role for eosinophils in the intestinal defense against invading A. suum larvae.

  10. Profiling gene expression in mesenteric lymph nodes in pigs with different levels of resistance to Ascaris suum

    DEFF Research Database (Denmark)

    Skallerup, Per; Nejsum, Peter; Cirera, Susanna;

    2014-01-01

    A single nucleotide polymorphism on chromosome 4 (SNP TXNIP) has been reported to be associated with roundworm (Ascaris suum) burden in pigs. The objective of the present study was to profile the immune response mounted by pigs with two SNP TXNIP genotypes following an A. suum infection. We selec...

  11. Effect of disinfectants on viability of Ascaris suum and Ascaridia galli eggs

    OpenAIRE

    Gautam, Susmita; Petkeviciute, Egle; Takeuchi-Storm, Nao; Thapa, Sundar; Mejer, Helena

    2014-01-01

    Ascaris suum and Ascaridia galli, the large round worm of pigs and poultry, respectively, persist even in intensive management systems, where a high level of hygiene is practiced. It is necessary to control these helminths to minimize production losses and improve animal welfare. Commercial disinfectants are commonly used to clean pens in conventional pig and poultry farms but their efficacy against the thick-shelled nematode eggs has not been sufficiently documented. However, it might be dif...

  12. Survival of Ascaris suum and Ascaridia galli eggs in liquidmanure at different ammonia concentrations andtemperatures

    OpenAIRE

    Katakam, Kiran Kumar; Mejer, Helena; Dalsgaard, Anders; Kyyvsgaard, Niels Christian; Thamsborg, Stig Milan

    2014-01-01

    tEggs of Ascaris suum from pigs are highly resistant and commonly used as a conservativeindicator of pathogen inactivation during slurry storage. Eggs of Ascaridia galli, the poultryascarid, are also known to be highly resistant but the suitability as an indicator of pathogeninactivation has never been tested. Pig slurry has to be stored for several months to inac-tivate pathogens but chemical treatment of slurry may reduce this time. The suitability ofA. galli as an indicator of slurry sanit...

  13. Succinate-dependent energy generation and pyruvate dehydrogenase complex activity in isolated Ascaris suum mitochondria

    International Nuclear Information System (INIS)

    Body wall muscle from the parasitic nematode, Ascaris suum, contain unique anaerobic mitochondria that preferentially utilize fumarate and branched-chain enoyl CoA's as terminal electron acceptors instead of oxygen. While electron transport in these organelles is well characterized, the role of oxygen in succinate-dependent phosphorylation is still not clearly defined. Therefore, the present study was designed to more fully characterize succinate metabolism in these organelles as well as the in vitro regulation of a key mitochondrial enzyme, the pyruvate dehydrogenase complex (PDC). In the absence of added adenine nucleotides, incubations in succinate resulted in substantial elevations in intramitochrondrial ATP levels, but ATP/ADP ratios were considerably higher in incubations with malate. The stimulation of phosphorylation in aerobic incubations with succinate was rotenone sensitive and appears to be Site I dependent. Increase substrate level phosphorylation, coupled to propionate formation, or additional sites of electron-transport associated ATP synthesis were not significant. Under aerobic conditions, 14CO2 evolution from 1,4-[14C]succinate was stimulated and NADH/NAD+ ratios were elevated, but the formation of 14C propionate was unchanged

  14. Succinate-dependent energy generation and pyruvate dehydrogenase complex activity in isolated Ascaris suum mitochondria

    Energy Technology Data Exchange (ETDEWEB)

    Campbell, T.A.

    1988-01-01

    Body wall muscle from the parasitic nematode, Ascaris suum, contain unique anaerobic mitochondria that preferentially utilize fumarate and branched-chain enoyl CoA's as terminal electron acceptors instead of oxygen. While electron transport in these organelles is well characterized, the role of oxygen in succinate-dependent phosphorylation is still not clearly defined. Therefore, the present study was designed to more fully characterize succinate metabolism in these organelles as well as the in vitro regulation of a key mitochondrial enzyme, the pyruvate dehydrogenase complex (PDC). In the absence of added adenine nucleotides, incubations in succinate resulted in substantial elevations in intramitochrondrial ATP levels, but ATP/ADP ratios were considerably higher in incubations with malate. The stimulation of phosphorylation in aerobic incubations with succinate was rotenone sensitive and appears to be Site I dependent. Increase substrate level phosphorylation, coupled to propionate formation, or additional sites of electron-transport associated ATP synthesis were not significant. Under aerobic conditions, {sup 14}CO{sub 2} evolution from 1,4-({sup 14}C)succinate was stimulated and NADH/NAD{sup +} ratios were elevated, but the formation of {sup 14}C propionate was unchanged.

  15. Direct anthelmintic effects of condensed tannins from diverse plant sources against Ascaris suum.

    Directory of Open Access Journals (Sweden)

    Andrew R Williams

    Full Text Available Ascaris suum is one of the most prevalent nematode parasites in pigs and causes significant economic losses, and also serves as a good model for A. lumbricoides, the large roundworm of humans that is ubiquitous in developing countries and causes malnutrition, stunted growth and compromises immunity to other pathogens. New treatment options for Ascaris infections are urgently needed, to reduce reliance on the limited number of synthetic anthelmintic drugs. In areas where Ascaris infections are common, ethno-pharmacological practices such as treatment with natural plant extracts are still widely employed. However, scientific validation of these practices and identification of the active compounds are lacking, although observed effects are often ascribed to plant secondary metabolites such as tannins. Here, we extracted, purified and characterised a wide range of condensed tannins from diverse plant sources and investigated anthelmintic effects against A. suum in vitro. We show that condensed tannins can have potent, direct anthelmintic effects against A. suum, as evidenced by reduced migratory ability of newly hatched third-stage larvae and reduced motility and survival of fourth-stage larvae recovered from pigs. Transmission electron microscopy showed that CT caused significant damage to the cuticle and digestive tissues of the larvae. Furthermore, we provide evidence that the strength of the anthelmintic effect is related to the polymer size of the tannin molecule. Moreover, the identity of the monomeric structural units of tannin polymers may also have an influence as gallocatechin and epigallocatechin monomers exerted significant anthelmintic activity whereas catechin and epicatechin monomers did not. Therefore, our results clearly document direct anthelmintic effects of condensed tannins against Ascaris and encourage further in vivo investigation to determine optimal strategies for the use of these plant compounds for the prevention and

  16. Ecology and viability of eggs of the pig round worm (Ascaris suum) – on-farm and laboratory studies

    OpenAIRE

    Katakam, Kiran Kumar

    2014-01-01

    Ascaris suum is a highly prevalent parasitic helminth in pig production systems worldwide. In most industrialized countries production systems are highly intensive and fully in-doors (low prevalence of parasites) but there is a growing market for pigs produced out-door or under organic pig farming conditions (high prevalence of parasites). In organic pig production there is a number of factors related to housing and management practices that predispose for A. suum infections. These practices ...

  17. Early stages of Ascaris suum induce airway inflammation and hyperreactivity in a mouse model.

    Science.gov (United States)

    Enobe, C S; Araújo, C A; Perini, A; Martins, M A; Macedo, M S; Macedo-Soares, M F

    2006-09-01

    The inflammatory and functional changes that occur in murine lung after infection with 2500 infective Ascaris suum eggs were studied in this work. A sequential influx of neutrophils, mononuclear cells and eosinophils occurred into airways concomitantly with migration of larvae from liver to the lungs. Histological analysis of the lung showed a severe intra-alveolar haemorrhage at the peak of larval migration (day 8) and the most intense inflammatory cell infiltrate on day 14. Ascaris L3 were found in alveolar spaces and inside bronchioles on day 8. The number of eosinophils was elevated in the blood on days 8 and 14. The peak of eosinophil influx into the lung was at day 14, as indicated by the high levels of eosinophil peroxidase activity, followed by their migration into the airways. The antibody response against egg and larval antigens consisted mainly of IgG1 and IgM, and also of IgE and anaphylactic IgG1, that cross-reacted with adult worm antigens. Total IgE levels were substantially elevated during the infection. Measurement of lung mechanical parameters showed airway hyperreactivity in infected mice. In conclusion, the murine model of A. suum infection mimics the Th2-induced parameters observed in pigs and humans and can be used to analyse the immunoregulatory properties of this helminth. PMID:16916369

  18. ASCARIS SUUM: CDNA MICROARRAY ANALYSIS OF 4TH STAGE LARVAE (L4) DURING SELF-CURE FROM THE INTESTINE

    Science.gov (United States)

    There is spontaneous cure of a large portion of Ascaris suum 4th-stage larvae (L4) from the jejunum of infected pigs between 14 and 21 days after inoculation (DAI). Those L4 that remain in the jejunum continue to develop while those that have moved to the ileum are eventually expelled from the inte...

  19. Ascaris suum infection negatively affects the response to a Mycoplasma hyopneumoniae vaccination and subsequent challenge infection in pigs

    DEFF Research Database (Denmark)

    Steenhard, Nina R.; Jungersen, Gregers; Kokotovic, Branko; Beshah, Ethiopia; Dawson, Harry; Urban Jr., Joseph F.; Roepstorff, Allan; Thamsborg, Stig M.

    2009-01-01

    posed in this study was that a concurrent Ascaris suum infection of pigs vaccinated with a Mycoplasma hyopneumoniae (Mh)vaccine would modulate the protectiveimmuneresponse to a subsequent challenge infection. Four groups of pigs were either (1) untreated (group C), (2) vaccinated againstMh 3 weeks after...

  20. L3L4ES antigen and secretagogues induce histamine release from porcine peripheral blood basophils after Ascaris suum infection

    Science.gov (United States)

    The aim of this paper was to investigate the role of porcine basophils in protective immunity. Experimental pigs were infected with 1,000 Ascaris suum eggs daily for 21 days. Control pigs were maintained helminth-free. Circulating porcine basophils were isolated from the anti-coagulated whole blood ...

  1. Ascaris suum infection negatively affects the response to a Mycoplasma hyopneumoniae vaccination and subsequent challenge infection in pigs

    Science.gov (United States)

    It is vital to understand the possible mechanisms that may impair optimal vaccine efficacy. The hypothesis posed in this study was that a concurrent Ascaris suum infection of pigs vaccinated with a Mycoplasma hyopneumoniae (Mh) vaccine would modulate the protective immune response to a subsequent ch...

  2. Comparison of different monoclonal antibodies against immunosuppressive proteins of Ascaris suum.

    Science.gov (United States)

    Oshiro, T M; Rafael, A; Enobe, C S; Fernandes, I; Macedo-Soares, M F

    2004-02-01

    The extract of Ascaris suum suppresses the humoral and cellular immune responses to unrelated antigens in the mouse. In order to further characterize the suppressive components of A. suum, we produced specific monoclonal antibodies which can provide an important tool for the identification of these proteins. The A. suum immunosuppressive fractions isolated by gel filtration from an extract of adult worms were used to immunize BALB/c mice. Popliteal lymph node cells taken from the immunized animals were fused with SP2/O myeloma cells and the cloned hybrid cells obtained were screened to determine the specificity of secreted antibodies. Three monoclonal antibodies named MAIP-1, MAIP-2 and MAIP-3 were selected and were shown to react with different epitopes of high molecular weight proteins from the A. suum extract. All antibody molecules have kappa-type light chains but differ in heavy chain isotype. MAIP-1 is a mouse IgM, MAIP-2 is an IgA immunoglobulin and MAIP-3 is an IgG1 immunoglobulin and they recognize the antigen with affinity constants of 1.3 x 10(10) M-1, 7.1 x 10(9) M-1 and 3.8 x 10(7) M-1, respectively. The proteins recognized by these monoclonal antibodies (PAS-1, PAS-2 and PAS-3) were purified from the crude extract by affinity chromatography and injected with ovalbumin in BALB/c mice in order to determine their suppressive activity on heterologous antibody production. It was demonstrated that these three proteins are able to significantly suppress anti-ovalbumin antibody secretion, with PAS-1 being more efficient than the others. PMID:14762577

  3. Comparison of different monoclonal antibodies against immunosuppressive proteins of Ascaris suum

    Directory of Open Access Journals (Sweden)

    T.M. Oshiro

    2004-02-01

    Full Text Available The extract of Ascaris suum suppresses the humoral and cellular immune responses to unrelated antigens in the mouse. In order to further characterize the suppressive components of A. suum, we produced specific monoclonal antibodies which can provide an important tool for the identification of these proteins. The A. suum immunosuppressive fractions isolated by gel filtration from an extract of adult worms were used to immunize BALB/c mice. Popliteal lymph node cells taken from the immunized animals were fused with SP2/O myeloma cells and the cloned hybrid cells obtained were screened to determine the specificity of secreted antibodies. Three monoclonal antibodies named MAIP-1, MAIP-2 and MAIP-3 were selected and were shown to react with different epitopes of high molecular weight proteins from the A. suum extract. All antibody molecules have kappa-type light chains but differ in heavy chain isotype. MAIP-1 is a mouse IgM, MAIP-2 is an IgA immunoglobulin and MAIP-3 is an IgG1 immunoglobulin and they recognize the antigen with affinity constants of 1.3 x 10(10 M-1, 7.1 x 10(9 M-1 and 3.8 x 10(7 M-1, respectively. The proteins recognized by these monoclonal antibodies (PAS-1, PAS-2 and PAS-3 were purified from the crude extract by affinity chromatography and injected with ovalbumin in BALB/c mice in order to determine their suppressive activity on heterologous antibody production. It was demonstrated that these three proteins are able to significantly suppress anti-ovalbumin antibody secretion, with PAS-1 being more efficient than the others.

  4. Regional immune responses with stage-specific antigen recognition profiles develop in lymph nodes of pigs following Ascaris suum larval migration

    DEFF Research Database (Denmark)

    Jungersen, Gregers; Eriksen, Lizzie; Nansen, P.;

    2001-01-01

    The early life-cycle of the pig round worm, Ascaris suum, involves well-defined larval development in the liver; lungs and finally the small intestine. Distinct regional immune responses to larval antigens of A. suum were observed in the draining lymph nodes of immunized and challenged pigs during...

  5. Full scale validation of helminth ova (Ascaris suum) inactivation by different sludge treatment processes

    Energy Technology Data Exchange (ETDEWEB)

    Paulsrud, B.; Gjerde, B.; Lundar, A.

    2003-07-01

    The Norwegian sewage sludge regulation requires disinfection (hygienisation) of all sludges for land application, and one of the criteria is that disinfected sludge should not contain viable helminth ova. All disinfection processes have to be designed and operated in order to comply with this criteria, and four processes employed in Norway (thermophilic aerobic pre-treatment, pre-pasteurisation, thermal vacuum drying in membrane filter presses and lime treatment) have been tested in full scale by inserting semipermeable bags of Ascaris suum eggs into the processes for certain limes. For lime treatment supplementary laboratory tests have been conducted. The paper presents the results of the experiments, and it could be concluded that all processes, except lime treatment, could be operated at less stringent time-temperature regimes than commonly experienced at Norwegian plants today. (author)

  6. Galloylated proanthocyanidins from shea (Vitellaria paradoxa) meal have potent anthelmintic activity against Ascaris suum.

    Science.gov (United States)

    Ramsay, A; Williams, A R; Thamsborg, S M; Mueller-Harvey, I

    2016-02-01

    Proanthocyanidins (PA) from shea (Vitellaria paradoxa) meal were investigated by thiolytic degradation with benzyl mercaptan and the reaction products were analysed by high performance liquid chromatography-mass spectrometry. These PA were galloylated (≈40%), contained only B-type linkages and had a high proportion of prodelphinidins (>70%). The mean degree of polymerisation was 8 (i.e. average molecular size was 2384Da) and epigallocatechin gallate (EGCg) was the major flavan-3-ol subunit in PA. Shea meal also proved to be a potentially valuable source for extracting free flavan-3-ol-O-gallates, especially EGCg (575mg/kg meal), which is known for its health and anti-parasitic benefits. Proanthocyanidins were isolated and tested for bioactivity against Ascaris suum, which is an important parasite of pigs. Migration and motility tests revealed that these PA have potent activity against this parasitic nematode. PMID:26708339

  7. Direct anthelmintic effects of condensed tannins from diverse plant sources against Ascaris suum

    DEFF Research Database (Denmark)

    Williams, Andrew Richard; Fryganas, Christos; Ramsay, Aina;

    2014-01-01

    Ascaris suum is one of the most prevalent nematode parasites in pigs and causes significant economic losses, and also serves as a good model for A. lumbricoides, the large roundworm of humans that is ubiquitous in developing countries and causes malnutrition, stunted growth and compromises immunity...... to other pathogens. New treatment options for Ascaris infections are urgently needed, to reduce reliance on the limited number of synthetic anthelmintic drugs. In areas where Ascaris infections are common, ethno-pharmacological practices such as treatment with natural plant extracts are still widely...... condensed tannins against Ascaris and encourage further in vivo investigation to determine optimal strategies for the use of these plant compounds for the prevention and/or treatment of ascariosis....

  8. Anthelmintic effects of phytogenic feed additives in Ascaris suum inoculated pigs.

    Science.gov (United States)

    van Krimpen, M M; Binnendijk, G P; Borgsteede, F H M; Gaasenbeek, C P H

    2010-03-25

    Two experiments were performed to determine the anthelmintic effect of some phytogenic feed additives on a mild infection of Ascaris suum in growing and finishing pigs. Usually, an infection of A. suum is controlled by using conventional synthetic drugs. Organic farmers, however, prefer a non-pharmaceutical approach to worm control. Therefore, phytotherapy could be an appropriate alternative. In the first experiment, a commercial available organic starter diet was supplemented with 3% of a herb mixture, adding 1% Thymus vulgaris, 1% Melissa officinalis and 1% Echinacea purpurea to the diet, or with 4% of a herb mixture, thereby adding the mentioned herbs plus 1% Camellia sinensis (black tea). A negative control group (no treatment) and a positive control group (treatment with conventional synthetic drug flubendazole) were included. In the second experiment, the anthelmintic properties against A. suum of three individual herbs, Carica papaya, Peumus boldus and Artemisia vulgaris, each in a dose of 1%, were tested. Pigs were infected with 1000 infective worm eggs each. Each experiment was performed with 32 individually housed growing pigs (8 replicates/treatment), which were monitored for 67 days. It was hypothesized that the herbs would block the cycles of the larvae, thereby preventing the development of adult worms. Therefore, phytogenic feed additives were not supplied during the whole experimental period, but only from the start until D39. Pigs were inoculated with infective worm eggs during five consecutive days (D17-D21). At D67 all pigs were dissected, whereafter livers were checked for the presence of white spots. Also numbers of worms in the small intestine were counted. In experiment 1, the numbers of worm-infected pigs were similar for both the herb supplemented (groups 3 and 4) and the unsupplemented (group 1) treatments (5-6 pigs of 8), while the treatment with flubendazole (group 2) resulted in 0 infected pigs. In experiment 2, herb addition (groups 2

  9. Assessing the zoonotic potential of Ascaris suum and Trichuris suis

    DEFF Research Database (Denmark)

    Nejsum, Peter; Betson, M.; Bendall, R. P.;

    2012-01-01

    The two geohelminths, Ascaris lumbricoides and Trichuris trichiura, infect more than a billion people worldwide but are only reported sporadically in the developed part of the world. In contrast, the closely related species A. suum and T. suis in pigs have a truly global distribution, with infected...... pigs found in most production systems. In areas where pigs and humans live in close proximity or where pig manure is used as fertilizer on vegetables for human consumption, there is a potential risk of cross-infections. We therefore review this relationship between Ascaris and Trichuris in the human...

  10. Potensi Serbuk Daun Kelor (Moringa oleifera) Sebagai Anthelmintik Terhadap Infeksi Ascaris suum dan Feed Supplement pada Babi

    OpenAIRE

    Muhammad Ulqiya Syukron; I Made Damriyasa; Nyoman Adi Suratma

    2015-01-01

    Pig ascariasis is an intestinal parasitic disease caused by Ascaris suum. The economic losses in pig ascariasis are caused by a bad feed conversion ratio (FCR) and rejection of some organs after animal slaughtering. An anthelmintic utilization and farm management improvement are the common prevention action, however, recently the utilization of herbs as an athelmintic has been developed, one of them is Moringa oleifera leaves. Moringa oleifera leaves are also a potential for a sources of ani...

  11. N-glycans of the porcine nematode parasite Ascaris suum are modified with phosphorylcholine and core fucose residues

    OpenAIRE

    Pöltl, Gerald; Kerner, Denise; Paschinger, Katharina; Wilson, Iain B. H.

    2006-01-01

    In recent years, the glycoconjugates of many parasitic nematodes have attracted interest due to their immunogenic and immunomodulatory nature. Previous studies with the porcine roundworm parasite Ascaris suum have focussed on its glycosphingolipids which were found, in part, to be modified by phosphorylcholine. Using mass spectrometry and Western blotting, we have now analysed the PNGase A-released N-glycans of adults of this species. The presence of hybrid, bi- and triantennary N-glycans, so...

  12. Effect of Penicillium frequentans and Stachybotrys chartarum on respiratory metabolism of developing eggs of Ascaris suum (Nematoda)

    OpenAIRE

    Lidia Kołodziejczyk; Wanda Kuźna-Grygiel; Krystyna Janowicz; Kinga Mazurkiewicz-Zapałowicz

    2014-01-01

    Effect of saprotrophic soil fungi Penicillium frequentans and Stachybotrys chartarum on respiratory metabolism of Ascaris suum, during its embryogenesis was determined using histoenzymatic methods. Based on histochemical assessment of the enzyme actvity (glycolysis-lactate dehydrogenase-LDH; tricarboxylic acid cycle-succinate dehydrogenase-SDH) changes in the energy metabolism of developing eggs of A. suvm were detected. Of the fungi species tested - P. frequentans caused the most extensive d...

  13. Cross-Reactions between Toxocara canis and Ascaris suum in the diagnosis of visceral larva migrans by western blotting technique

    Directory of Open Access Journals (Sweden)

    NUNES Cáris Maroni

    1997-01-01

    Full Text Available Visceral larva migrans (VLM is a clinical syndrome caused by infection of man by Toxocara spp, the common roundworm of dogs and cats. Tissue migration of larval stages causes illness specially in children. Because larvae are difficult to detect in tissues, diagnosis is mostly based on serology. After the introduction of the enzyme-linked immunosorbent assay (ELISA using the larval excretory-secretory antigen of T. canis (TES, the diagnosis specificity was greatly improved although cross-reactivity with other helminths are still being reported. In Brazil, diagnosis is routinely made after absorption of serum samples with Ascaris suum antigens, a nematode antigenicaly related with Ascaris lumbricoides which is a common intestinal nematode of children. In order to identify T. canis antigens that cross react to A. suum antigens we analyzed TES antigen by SDS-PAGE and Western blotting techniques. When we used serum samples from patients suspected of VLM and positive result by ELISA as well as a reference serum sample numerous bands were seen (molecular weight of 210-200 kDa, 116-97 kDa, 55-50 kDa and 35-29 kDa. Among these there is at least one band with molecular weight around 55-66 kDa that seem to be responsible for the cross-reactivity between T. canis e A. suum once it disappears when previous absorption of serum samples with A. suum antigens is performed

  14. Incidence of Ascaris suum-specific antibodies in Austrian patients with suspected larva migrans visceralis (VLM) syndrome.

    Science.gov (United States)

    Schneider, Renate; Auer, Herbert

    2016-03-01

    The pig roundworm, Ascaris suum, is commonly found in domestic pigs all over the world. The transmission to humans takes place by ingestion of infective A. suum eggs present in soil because pig manure is widely used as fertilizer. The possible role of A. suum in the human visceral larva migrans (VLM) syndrome has been discussed controversially during past decades, even though various case reports, particularly from Japan document pulmonal, hepatic and even cerebral symptoms caused by migrating A. suum larvae after ingestion of infected row meat (liver) or contaminated vegetables. We examined 4481 sera by A. suum immunoblot (As-IB) and 5301 sera by Toxocara-ELISA from patients with symptoms associated with the VLM syndrome during three consecutive years (2012-2014). The incidence of A. suum-specific antibodies was 13.2 %, the incidence of T. canis specific antibodies 12.9 % and from a part of the As-IB positive sera (n = 417) additional Toxocara serology was performed to demonstrate the specificity of our tests. Only 56 out of the 417 (13.4 %) sera showed antibodies to both helminth species demonstrating that double infections exist. Interestingly the age distribution of the patients showed that 2.8 % of the Ascaris-positive patients were younger than 21 years, while in the Toxocara-positive group 13.4 % were <21 years. These results are in accordance with a Dutch study suspecting different ways of transmission as cause for this interesting age distribution. Due to the fact that large amounts of untreated pig manure are used as fertilizer and that the expulsion of adult A. suum worms causing intestinal ascariosis is extremely rare in Central European countries, the zoonotic potential of A. suum is considerably underestimated. We suggest that the performance of reliable immunoserological tests, in all industrialized countries where pigs are raised and their manure is used as fertilizer, could help to assess the actual potential of A. suum as causative agent of

  15. Potensi Serbuk Daun Kelor (Moringa oleifera Sebagai Anthelmintik Terhadap Infeksi Ascaris suum dan Feed Supplement pada Babi

    Directory of Open Access Journals (Sweden)

    Muhammad Ulqiya Syukron

    2015-06-01

    Full Text Available Pig ascariasis is an intestinal parasitic disease caused by Ascaris suum. The economic losses in pig ascariasis are caused by a bad feed conversion ratio (FCR and rejection of some organs after animal slaughtering. An anthelmintic utilization and farm management improvement are the common prevention action, however, recently the utilization of herbs as an athelmintic has been developed, one of them is Moringa oleifera leaves. Moringa oleifera leaves are also a potential for a sources of animal food because of their high nutrients. This intervention research aimed to examine the anthelmintic effect of Moringa oleifera leaves and its potency as feed supplement. Experimental design used was ccompletely randomized design split time (CRD Split Time with six treatments namely Moringa oleifera 5% and an infection of infective larvae of A. suum (1, Moringa oleifera 5% (2, positive control (3, Moringa oleifera 10% (4, Moringa oleifera 10% and infection of infective larvae of A. suum (5, and no treatment as negative control (6. Each treatment was imposed on four female landrace piglets aged 8 weeks and weighed around 11 kg. The results showed that Moringa oleifera 5% and 10% of the feed could inhibit the egg production of A.suum and had a significant effect (P<0.05 on weight gain of piglets. It can be concluded that Moringa oleifera leave have an anthelmintic effect to prevent the infection of A. suum and a potential for a feed supplement on pigs.

  16. The nicotinic acetylcholine receptors of the parasitic nematode Ascaris suum: formation of two distinct drug targets by varying the relative expression levels of two subunits.

    Directory of Open Access Journals (Sweden)

    Sally M Williamson

    2009-07-01

    Full Text Available Parasitic nematodes are of medical and veterinary importance, adversely affecting human health and animal welfare. Ascaris suum is a gastrointestinal parasite of pigs; in addition to its veterinary significance it is a good model of the human parasite Ascaris lumbricoides, estimated to infect approximately 1.4 billion people globally. Anthelmintic drugs are essential to control nematode parasites, and nicotinic acetylcholine receptors (nAChRs on nerve and muscle are the targets of cholinergic anthelmintics such as levamisole and pyrantel. Previous genetic analyses of nematode nAChRs have been confined to Caenorhabditis elegans, which is phylogenetically distinct from Ascaris spp. and many other important parasites. Here we report the cloning and expression of two nAChR subunit cDNAs from A. suum. The subunits are very similar in sequence to C. elegans UNC-29 and UNC-38, are expressed on muscle cells and can be expressed robustly in Xenopus oocytes to form acetylcholine-, nicotine-, levamisole- and pyrantel-sensitive channels. We also demonstrate that changing the stoichiometry of the receptor by injecting different ratios of the subunit cRNAs can reproduce two of the three pharmacological subtypes of nAChR present in A. suum muscle cells. When the ratio was 5:1 (Asu-unc-38ratioAsu-unc-29, nicotine was a full agonist and levamisole was a partial agonist, and oocytes responded to oxantel, but not pyrantel. At the reverse ratio (1:5 Asu-unc-38ratioAsu-unc-29, levamisole was a full agonist and nicotine was a partial agonist, and the oocytes responded to pyrantel, but not oxantel. These results represent the first in vitro expression of any parasitic nicotinic receptor and show that their properties are substantially different from those of C. elegans. The results also show that changing the expression level of a single receptor subunit dramatically altered the efficacy of some anthelmintic drugs. In vitro expression of these subunits may permit the

  17. Bioinformatic identification of cytochrome b5 homologues from the parasitic nematode Ascaris suum and the free-living nematode Caenorhabditis elegans highlights the crucial role of A. suum adult-specific secretory cytochrome b₅ in parasitic adaptation.

    Science.gov (United States)

    Takamiya, Shinzaburo; Hashimoto, Muneaki; Mita, Toshihiro; Yokota, Takehiro; Nakajima, Yoshitaka; Yamakura, Fumiyuki; Sugio, Shigetoshi; Fujimura, Tsutomu; Ueno, Takashi; Yamasaki, Hiroshi

    2016-04-01

    We previously reported that adult Ascaris suum possesses NADH-metmyoglobin and NADH-methaemoglobin reductase systems that are located in the cells of the body wall and in the extracellular perienteric fluid, respectively, which helps them adapt to environmental hypoxia by recovering the differential functions of myoglobin and haemoglobin. A. suum cytochrome b5, an adult-specific secretory protein and an essential component of the NADH-metmyo (haemo) globin reductase system, has been extensively studied, and its unique nature has been determined. However, the relationship between A. suum cytochrome b5 and the canonical cytochrome b5 proteins, from the free-living nematode Caenorhabditis elegans is unclear. Here, we have characterised four cytochrome b5-like proteins from C. elegans (accession numbers: CAB01732, CCD68984, CAJ58492, and CAA98498) and three from A. suum (accession numbers: ADY48796, ADY46277, and ADY48338) and compared them with A. suum cytochrome b5 in silico. Bioinformatic and molecular analyses showed that CAA98498 from C. elegans is equivalent of A. suum cytochrome b5, which was not expressed as a mature mRNA. Further, the CAA98498 possessed no secretory signal peptide, which occurs in A. suum cytochrome b5 precursor. These results suggest that this free-living nematode does not need a haemoprotein such as the A. suum cytochrome b5 and highlight the crucial function of this A. suum adult-specific secretory cytochrome b5 in parasitic adaptation. PMID:26571414

  18. Experimental Ascaris suum infection in the pig: protective memory response after three immunizations and effect of intestinal adult worm population

    DEFF Research Database (Denmark)

    Jungersen, Gregers; Eriksen, Lis; Roepstorff, Allan; Lind, Peter; Meeusen, E.N.T.; Rasmussen, Tina; Nansen, P.

    1999-01-01

    The protective immune response to larval migration in pigs, with or without adult intestinal worm populations, 10 weeks after 3 weekly Ascaris suum inoculations, was studied in 45 pigs. Controlled adult worm populations were achieved by oral transfer of 10 adult worms to previously immunized pigs...... after anthelmintic drenching. A significant reduction in larval recovery from lungs on day 7, and small intestine on day 14, was observed in immunized pigs compared with previously uninfected control pigs after challenge inoculation. The strong anamnestic response to larval migration was characterized...... inoculation or on the immune response before or after challenge inoculation could be detected. These results indicate that a significant protective memory immune response to A. suum challenge inoculation can be induced in pigs, and that this protective immunity is not significantly modulated by the presence...

  19. Anthelmintic properties of traditional African and Caribbean medicinal plants: identification of extracts with potent activity against Ascaris suum in vitro

    Directory of Open Access Journals (Sweden)

    Williams Andrew R.

    2016-01-01

    Full Text Available Ascariasis affects more than 1 billion people worldwide, mainly in developing countries, causing substantial morbidity. Current treatments for Ascaris infection are based on mass drug administration (MDA with synthetic anthelmintic drugs such as albendazole, however continual re-infection and the threat of drug resistance mean that complementary treatment options would be highly valuable. Here, we screened ethanolic extracts from 29 medicinal plants used in Africa (Ghana and the Caribbean (US Virgin Islands for in vitro anthelmintic properties against Ascaris suum, a swine parasite that is very closely related to the human A. lumbricoides. A wide variety of activities were seen in the extracts, from negligible to potent. Extracts from Clausena anisata, Zanthoxylum zanthoxyloides and Punica granatum were identified as the most potent with EC50 values of 74, 97 and 164 μg/mL, respectively. Our results encourage further investigation of their use as complementary treatment options for ascariasis, alongside MDA.

  20. Crystallization of mitochondrial rhodoquinol-fumarate reductase from the parasitic nematode Ascaris suum with the specific inhibitor flutolanil

    International Nuclear Information System (INIS)

    Rhodoquinol-fumarate reductase is a key enzyme in the anaerobic respiratory chain of adult A. suum mitochondria. Its crystallization in the presence of a mixture of octaethyleneglycol monododecyl ether and n-dodecyl-β-d-maltopyranoside in a form suitable for X-ray structure analysis is reported. In adult Ascaris suum (roundworm) mitochondrial membrane-bound complex II acts as a rhodoquinol-fumarate reductase, which is the reverse reaction to that of mammalian complex II (succinate-ubiquinone reductase). The adult A. suum rhodoquinol-fumarate reductase was crystallized in the presence of octaethyleneglycol monododecyl ether and n-dodecyl-β-d-maltopyranoside in a 3:2 weight ratio. The crystals belonged to the orthorhombic space group P212121, with unit-cell parameters a = 123.75, b = 129.08, c = 221.12 Å, and diffracted to 2.8 Å resolution using synchrotron radiation. The presence of two molecules in the asymmetric unit (120 kDa × 2) gives a crystal volume per protein mass (VM) of 3.6 Å3 Da−1

  1. Optimization of the agar-gel method for isolation of migrating Ascaris suum larvae from the liver and lungs of pigs

    DEFF Research Database (Denmark)

    Saeed, I.; Roepstorff, A.; Rasmussen, T.; Hog, M.; Jungersen, Gregers

    2001-01-01

    Experiments on use of an agar-gel method for recovery of migrating Ascaris suum larvae from the liver and lungs of pigs were conducted to obtain fast standardized methods. Subsamples of blended tissues of pig liver and lungs were mixed with agar to a final concentration of 1% agar and the larvae ...

  2. A TGF-B homologue identified from Ascaris suum 4th stage larvae (L4): Evidence for development-related transcription and incomplete gene splicing

    Science.gov (United States)

    Ascaris species represent the most prevalent parasitic worm infecting humans and swine worldwide. During the infection process, A. suum L4 establish in the jejunum and develop into adults. However, a large percentage of L4 spontaneously cure to the ileum at 14 to 21 days after inoculation (dpi), and...

  3. Survival of Ascaris suum and Ascaridia galli eggs in liquid manure at different ammonia concentrations and temperatures.

    Science.gov (United States)

    Katakam, Kiran Kumar; Mejer, Helena; Dalsgaard, Anders; Kyvsgaard, Niels Christian; Thamsborg, Stig Milan

    2014-08-29

    Eggs of Ascaris suum from pigs are highly resistant and commonly used as a conservative indicator of pathogen inactivation during slurry storage. Eggs of Ascaridia galli, the poultry ascarid, are also known to be highly resistant but the suitability as an indicator of pathogen inactivation has never been tested. Pig slurry has to be stored for several months to inactivate pathogens but chemical treatment of slurry may reduce this time. The suitability of A. galli as an indicator of slurry sanitation was tested by comparing the survival of eggs of A. suum and A. galli in pig slurry. In addition, the effect of urea treatment on inactivation of ascarid eggs in relation to storage time was also tested. Nylon bags with 10,000 eggs of either species were placed in 200 ml plastic bottles containing either urea-treated (2%) or untreated pig slurry for up to 120 days at 20°C, 6 days at 30°C, 36h at 40°C or 2h at 50°C. At all the temperatures in both slurry types, A. galli eggs were inactivated at a significantly faster rate (Pgalli eggs at 20°C where no significant difference was detected. In untreated slurry, the levels of pH (6.33-9.08) and ammonia (0.01-1.74 mM) were lower (Pgalli eggs are more sensitive to unfavourable conditions compared to A. suum eggs. The use of A. galli eggs as hygiene indicator may thus be suitable to assess inactivation of pathogens that are more sensitive than A. galli eggs. Addition of urea may markedly reduce the storage time of slurry needed to inactivate A. suum and A. galli eggs. PMID:24893691

  4. [Serological demonstration of experimental round worm infections-Ascaris suum, Toxocara canis--in swine by means of the indirect immunofluorescence antibody test].

    Science.gov (United States)

    Buchwalder, R; Matthes, H F; Hiepe, T

    1981-11-01

    By means of indirect immunofluorescent antibody reaction (IFAR), using serum of experimentally infected pigs, various antigens were studied with regard to their usefulness for serological verification of prepatent Ascaris suum and Toxocara canis infections. Eggs, egg larvae, larvae received from livers, lungs and brains of experimentally infected white mice and sections of adult T. canis as well as eggs, egg larvae, liver larvae and sections of frozen adult A. suum proved to be not suitable for the reliable serum diagnosis of the infections. On the other hand, A. suum larvae, isolated from lungs of white mice or guinea pigs days after experimental infection, represent an antigen applicable to IFAR for the evidence of prepatent A. suum infections in pigs. The antigen, stored at -20 degree C, is durable without substantial impairment of its reactivity at least 7 months. PMID:7039425

  5. Mass Spectrometry of Single GABAergic Somatic Motorneurons Identifies a Novel Inhibitory Peptide, As-NLP-22, in the Nematode Ascaris suum

    Science.gov (United States)

    Konop, Christopher J.; Knickelbine, Jennifer J.; Sygulla, Molly S.; Wruck, Colin D.; Vestling, Martha M.; Stretton, Antony O. W.

    2015-12-01

    Neuromodulators have become an increasingly important component of functional circuits, dramatically changing the properties of both neurons and synapses to affect behavior. To explore the role of neuropeptides in Ascaris suum behavior, we devised an improved method for cleanly dissecting single motorneuronal cell bodies from the many other cell processes and hypodermal tissue in the ventral nerve cord. We determined their peptide content using matrix-assisted laser desorption/ionization time-of-flight (MALDI-TOF) mass spectrometry (MS). The reduced complexity of the peptide mixture greatly aided the detection of peptides; peptide levels were sufficient to permit sequencing by tandem MS from single cells. Inhibitory motorneurons, known to be GABAergic, contain a novel neuropeptide, As-NLP-22 (SLASGRWGLRPamide). From this sequence and information from the A. suum expressed sequence tag (EST) database, we cloned the transcript ( As-nlp-22) and synthesized a riboprobe for in situ hybridization, which labeled the inhibitory motorneurons; this validates the integrity of the dissection method, showing that the peptides detected originate from the cells themselves and not from adhering processes from other cells (e.g., synaptic terminals). Synthetic As-NLP-22 has potent inhibitory activity on acetylcholine-induced muscle contraction as well as on basal muscle tone. Both of these effects are dose-dependent: the inhibitory effect on ACh contraction has an IC50 of 8.3 × 10-9 M. When injected into whole worms, As-NLP-22 produces a dose-dependent inhibition of locomotory movements and, at higher levels, complete paralysis. These experiments demonstrate the utility of MALDI TOF/TOF MS in identifying novel neuromodulators at the single-cell level.

  6. Expression of Ascaris suum malic enzyme in a mutant Escherichia coli allows production of succinic acid from glucose

    Energy Technology Data Exchange (ETDEWEB)

    Stols, L.; Donnelly, M.I. [Argonne National Lab., IL (United States); Kulkarni, G.; Harris, B.G. [Univ. of North Texas, Fort Worth, TX (United States)

    1997-12-31

    The malic enzyme gene of Ascaris suum was cloned into the vector pTRC99a in two forms encoding alternative amino-termini. The resulting plasmids, pMEA1 and pMEA2, were introduced into Escherichia coli NZN111, a strain that is unable to grow fermentatively because of inactivation of the genes encoding pyruvate dissimilation. Induction of pMEA1, which encodes the native animoterminus, gave better overexpression of malic enzyme, approx 12-fold compared to uninduced cells. Under the appropriate culture conditions, expression of malic enzyme allowed the fermentative dissimilation of glucose by NZN111. The major fermentation product formed in induced cultures was succinic acid.

  7. Effect of post-treatment conditions on the inactivation of helminth eggs (Ascaris suum) after the composting process.

    Science.gov (United States)

    Darimani, Hamidatu S; Ito, Ryusei; Maiga, Ynoussa; Sou, Mariam; Funamizu, Naoyuki; Maiga, Amadou H

    2016-01-01

    Safe and appropriate disposal of human waste is a basic requirement for sanitation and protection of public health. For proper sanitation and nutrient recovery, it is necessary to ensure effective treatment methods to complete pathogen destruction in excreta prior to reuse. Composting toilets convert faeces to a reusable resource such as fertilizer or humus for organic agriculture. A composting toilet for rural Burkina Faso was created by modifying a commercial model available in Japan to improve hygiene and increase food production. The toilet has shown to result in a degraded final product, but its effectiveness for pathogen destruction was unclear due to low temperatures generated from the toilet. This study aimed to sanitize compost withdrawn from the composting toilet for food production by setting post-treatment conditions. The inactivation kinetics of Ascaris suum eggs, selected as an indicator for helminth eggs, was determined during post-treatment at different temperatures (30°C, 40°C, 50°C and 60°C) with varying moisture contents (MC) (50%, 60% and 70%). The treatment of compost in a possible additional post-treatment after the composting process was tried in the laboratory test. Inactivation of A. suum eggs was fast with greater than two log reductions achieved within 2 h for temperature 50°C and 50% MC and greater than three log reductions for temperature 60°C and 50% MC within 3 h. Statistical analysis showed the significant impact of temperature and moisture on the inactivation rates of A. suum eggs. The post-treatment can efficiently increase helminth eggs destruction prior to reuse. PMID:26370295

  8. Proanthocyanidins inhibit Ascaris suum glutathione-S-transferase activity and increase susceptibility of larvae to levamisole in vitro.

    Science.gov (United States)

    Hansen, Tina V A; Fryganas, Christos; Acevedo, Nathalie; Caraballo, Luis; Thamsborg, Stig M; Mueller-Harvey, Irene; Williams, Andrew R

    2016-08-01

    Proanthocyanidins (PAC) are a class of plant secondary metabolites commonly found in the diet that have shown potential to control gastrointestinal nematode infections. The anti-parasitic mechanism(s) of PAC remain obscure, however the protein-binding properties of PAC suggest that disturbance of key enzyme functions may be a potential mode of action. Glutathione-S-transferases (GSTs) are essential for parasite detoxification and have been investigated as drug and vaccine targets. Here, we show that purified PAC strongly inhibit the activity of both recombinant and native GSTs from the parasitic nematode Ascaris suum. As GSTs are involved in detoxifying xenobiotic substances within the parasite, we hypothesised that this inhibition may render parasites hyper-susceptible to anthelmintic drugs. Migration inhibition assays with A. suum larvae demonstrated that the potency of levamisole (LEV) and ivermectin (IVM) were significantly increased in the presence of PAC purified from pine bark (4.6-fold and 3.2-fold reduction in IC50 value for LEV and IVM, respectively). Synergy analysis revealed that the relationship between PAC and LEV appeared to be synergistic in nature, suggesting a specific enhancement of LEV activity, whilst the relationship between PAC and IVM was additive rather than synergistic, suggesting independent actions. Our results demonstrate that these common dietary compounds may increase the efficacy of synthetic anthelmintic drugs in vitro, and also suggest one possible mechanism for their well-known anti-parasitic activity. PMID:27094225

  9. Characterization and expression of a spliced leader RNA in the parasitic nematode Ascaris lumbricoides var. suum.

    OpenAIRE

    Nilsen, T W; Shambaugh, J; Denker, J.; Chubb, G; Faser, C; Putnam, L; Bennett, K

    1989-01-01

    The parasitic nematode Ascaris spp. contains a 22-nucleotide spliced-leader (SL) sequence identical to the trans-SL previously described in Caenorhabditis elegans and other nematodes. The SL comprises the first 22 nucleotides of a approximately 110-base RNA and is transcribed by RNA polymerase II. The SL RNA contains a trimethylguanosine cap and a consensus Sm binding site. Furthermore, the Ascaris SL RNA has the potential to adopt a secondary structure which is nearly identical to potential ...

  10. Employment of anaerobic reactors in real scale and polishing ponds for removal of eggs Ascaris suum of swine effluent

    Directory of Open Access Journals (Sweden)

    Ana Cristina Araujo Pinto

    2014-02-01

    Full Text Available The swine confinement farms and the improper disposal of their wastes carry result in contamination of water and soil. On many farms is common slurry application to soil as a means of fertilization, but without any control over the quality of the effluent being released. What is a parasite Ascaris suum from pigs can infect humans, but is not given due importance to the presence of this contaminant as soil and water. In this work the effluent of a pig was treated in a system composed of anaerobic baffled reactor (ABR and a UASB followed by polishing ponds for removal of helminthes eggs. The experiment was conducted at the Hélio Barbosa Experimental Farm pig in the city of Igarapé / MG. Values found in the influent of helminthes eggs in the range from 2891 to 88,848 eggs L-1, while the effluent showed absence of eggs, showing the high efficiency of the treatment system. While the sludge ponds, it showed high concentration of viable eggs ranged from 10.1% to 59.8%, not being in conformity with the requirements for reuse in agriculture.

  11. Modification of the ATP inhibitory site of the Ascaris suum phosphofructokinase results in the stabilization of an inactive T state

    Energy Technology Data Exchange (ETDEWEB)

    Rao, G.S.J.; Cook, P.F.; Harris, B.G. (Univ. of North Texas, Fort Worth (United States))

    1991-10-15

    Treatment of the Ascaris suum phosphofructokinase (PFK) with 2{prime},3{prime}-dialdehyde ATP (oATP) results in an enzyme form that is inactive. The conformational integrity of the active site, however, is preserved, suggesting that oATP modification locks the PFK into an inactive T state that cannot be activated. A rapid, irreversible first-order inactivation of the PFK is observed in the presence of oATP. The rate of inactivation is saturable and gives a K{sub oATP} of 1.07 {plus minus} 0.27 mM. Complete protection against inactivation is afforded by high concentrations of ATP. This desensitized enzyme incorporates only 0.2-0.3 mol of ({sup 3}H)oATP/subunit, suggesting that in te native enzyme inactivation perhaps results from the modification of the ATP inhibitory site rather than the catalytic site. Modification of an active-site thiol by 4,4{prime}-dithiodipyridine is prevented yb ATP before and after oATP treatment. Finally, gel filtration HPLC studies show that the oATP-modified enzyme retains its tetrameric state and neither the tryptophan fluorescence nor the circular dichroic spectra of the modified enzyme are affected by fructose 2,6-bisphosphate, suggesting that the enzyme is locked into a tetrameric inactive T state.

  12. Immunosuppressive PAS-1 is an excretory/secretory protein released by larval and adult worms of the ascarid nematode Ascaris suum.

    Science.gov (United States)

    Antunes, M F P; Titz, T O; Batista, I F C; Marques-Porto, R; Oliveira, C F; Alves de Araujo, C A; Macedo-Soares, M F

    2015-05-01

    Helminths use several strategies to evade and/or modify the host immune response, including suppression or inactivation of the host antigen-specific response. Several helminth immunomodulatory molecules have been identified. Our studies have focused on immunosuppression induced by the roundworm Ascaris suum and an A. suum-derived protein named protein 1 from A. suum (PAS-1). Here we assessed whether PAS-1 is an excretory/secretory (E/S) protein and whether it can suppress lipopolysaccharide-induced inflammation. Larvae from infective eggs were cultured in unsupplemented Dulbecco's modified Eagle medium (DMEM) for 2 weeks. PAS-1 was then measured in the culture supernatants and in adult A. suum body fluid at different time points by enzyme-linked immunosorbent assay (ELISA) with the monoclonal antibody MAIP-1. Secreted PAS-1 was detected in both larval culture supernatant and adult body fluid. It suppressed lipopolysaccharide (LPS)-induced leucocyte migration and pro-inflammatory cytokine production, and stimulated interleukin (IL)-10 secretion, indicating that larval and adult secreted PAS-1 suppresses inflammation in this model. Moreover, the anti-inflammatory activity of PAS-1 was abolished by treatment with MAIP-1, a PAS-1-specific monoclonal antibody, confirming the crucial role of PAS-1 in suppressing LPS-induced inflammation. These findings demonstrate that PAS-1 is an E/S protein with anti-inflammatory properties likely to be attributable to IL-10 production. PMID:24703095

  13. Molecular evidence for sustained transmission of zoonotic Ascaris suum among zoo chimpanzees (Pan troglodytes)

    DEFF Research Database (Denmark)

    Nejsum, Peter; Bertelsen, Mads Frost; Betson, Martha;

    Chimpanzees in the Copenhagen Zoo frequently excrete ascarid worms onto the cage floor inspite of a regular anthelmintic treatment program. Previously it had been shown that the source of the infections was of pig origin. However, it was unknown whether the recurrence of the infection was due to...... reintroduction of eggs from an external source or to a sustained transmission cycle within the Zoo. We found that isolated eggs were able to embryonate into the infective stage and PCR-RFLP analysis on the ITS region amplified from single embryonated eggs suggest these to be Ascaris suum. In addition, sequence...... analysis of the cox1 gene (‘barcoding') on expelled worms followed by cluster analysis revealed that the chimpanzees are infected with pig A. suum which now, in spite of control efforts, has stabilized into a permanent transmission cycle in the Zoo's chimpanzee troop...

  14. Useable diffraction data from a multiple microdomain-containing crystal of Ascaris suum As-p18 fatty-acid-binding protein using a microfocus beamline

    International Nuclear Information System (INIS)

    As-p18, an unusual fatty-acid-binding protein from a parasitic nematode, was expressed in bacteria, purified and crystallized. The use of a microfocus beamline was essential for data collection. As-p18 is a fatty-acid-binding protein from the parasitic nematode Ascaris suum. Although it exhibits sequence similarity to mammalian intracellular fatty-acid-binding proteins, it contains features that are unique to nematodes. Crystals were obtained, but initial diffraction data analysis revealed that they were composed of a number of ‘microdomains’. Interpretable data could only be collected using a microfocus beamline with a beam size of 12 × 8 µm

  15. The Ascaris suum nicotinic receptor, ACR-16, as a drug target: Four novel negative allosteric modulators from virtual screening.

    Science.gov (United States)

    Zheng, Fudan; Robertson, Alan P; Abongwa, Melanie; Yu, Edward W; Martin, Richard J

    2016-04-01

    Soil-transmitted helminth infections in humans and livestock cause significant debility, reduced productivity and economic losses globally. There are a limited number of effective anthelmintic drugs available for treating helminths infections, and their frequent use has led to the development of resistance in many parasite species. There is an urgent need for novel therapeutic drugs for treating these parasites. We have chosen the ACR-16 nicotinic acetylcholine receptor of Ascaris suum (Asu-ACR-16), as a drug target and have developed three-dimensional models of this transmembrane protein receptor to facilitate the search for new bioactive compounds. Using the human α7 nAChR chimeras and Torpedo marmorata nAChR for homology modeling, we defined orthosteric and allosteric binding sites on the Asu-ACR-16 receptor for virtual screening. We identified four ligands that bind to sites on Asu-ACR-16 and tested their activity using electrophysiological recording from Asu-ACR-16 receptors expressed in Xenopus oocytes. The four ligands were acetylcholine inhibitors (SB-277011-A, IC50, 3.12 ± 1.29 μM; (+)-butaclamol Cl, IC50, 9.85 ± 2.37 μM; fmoc-1, IC50, 10.00 ± 1.38 μM; fmoc-2, IC50, 16.67 ± 1.95 μM) that behaved like negative allosteric modulators. Our work illustrates a structure-based in silico screening method for seeking anthelmintic hits, which can then be tested electrophysiologically for further characterization. PMID:27054065

  16. Survival of Ascaris suum and Ascaridia galli eggs in liquid manure at different ammonia concentrations and temperatures

    DEFF Research Database (Denmark)

    Katakam, Kiran Kumar; Mejer, Helena; Dalsgaard, Anders; Kyvsgaard, Niels Christian; Thamsborg, Stig Milan

    Eggs of Ascaris suum from pigs are highly resistant and commonly used as a conservative indicator of pathogen inactivation during slurry storage. Eggs of Ascaridia galli, the poultry ascarid, are also known to be highly resistant but the suitability as an indicator of pathogen inactivation has...... never been tested. Pig slurry has to be stored for several months to inactivate pathogens but chemical treatment of slurry may reduce this time. The suitability of A. galli as an indicator of slurry sanitation was tested by comparing the survival of eggs of A. suum and A. galli in pig slurry. In...... at 40°C or 2h at 50°C. At all the temperatures in both slurry types, A. galli eggs were inactivated at a significantly faster rate (P<0.05) compared to A. suum eggs. For each 10°C raise in temperature from 20°C, T50 (time needed to inactivate 50% of eggs) for both types of eggs was reduced markedly...

  17. Regional immune responses with stage-specific antigen recognition profiles develop in lymph nodes of pigs following Ascaris suum larval migration.

    Science.gov (United States)

    Jungersen, G; Eriksen, L; Nansen, P; Lind, P; Rasmussen, T; Meeusen, E N

    2001-04-01

    The early life-cycle of the pig round worm, Ascaris suum, involves well-defined larval development in the liver, lungs and finally the small intestine. Distinct regional immune responses to larval antigens of A. suum were observed in the draining lymph nodes of immunized and challenged pigs during larval migration. This was reflected in a transient enlargement of the stimulated lymph nodes, due to increases in numbers of B cells and CD4 T cells, and the production of A. suum-specific antibody by antibody secreting cell (ASC) cultures. Larval antigen recognition pattern of antibodies in serum, bile and draining lymph node ASC culture supernatant (ASC-probes) was examined by immunoblotting. This revealed distinct organ-specific recognition patterns of larval-specific antigens by the draining lymph nodes at different times after challenge. In particular, an early larval 42 kDa antigen was recognized specifically by ASC-probes of the liver lymph nodes at 7 but not 14 days postchallenge (pc) which was not detected in other lymph nodes, serum or bile of the same pig. Similarly, a late larval antigen of 34 kDa was uniquely detected by lung and jejunal ASC-probes at 14 days pc. These observations demonstrate how development of distinct regional immune responses in tissues with different antigen stimulation can be monitored with ASC-probes and flow cytometry. PMID:11298295

  18. High pressure processing treatment prevents embryonation of eggs of Trichuris vulpis and Ascaris suum and induces delay in development of eggs.

    Science.gov (United States)

    Rosypal, Alexa C; Zajac, Anne M; Flick, George J; Bowman, Dwight D; Lindsay, David S

    2011-09-27

    High hydrostatic pressure processing (HPP) is an effective non-thermal treatment used to inactivate pathogens from a variety of food and food products. It has been extensively examined using prokaryotic organisms and protozoan's but has had limited study on metazoans. Treatment using HPP has been shown to be effective in inactivating nematode larvae in food and preventing embryonation of Ascaris suum eggs. We conducted experiments using eggs of the canine whipworm Trichuris vulpis collected from naturally infected dogs and A. suum eggs from naturally infected pigs. We observed a delay in development of eggs of T. vulpis in a preliminary experiment and conducted 2 experiments to test the hypothesis that appropriate HPP levels can induce a delay in embryonation of nematode eggs. In experiment 1, nonembryonated T. vulpis eggs in tap water were packaged in sealable bags and exposed to 138-600 megapascals (MPa; 1 MPa=10 atm=147 psi) for 60s in a commercial HPP unit. In a second experiment, nonembryonated eggs of A. suum were exposed to 138-600 MPa and treated for 60s in the same commercial HPP unit. Embyronation of T. vulpis eggs was delayed by 4 and 5 days for eggs treated with 207 and 241 MPa but eventually eggs developed and the numbers of embryonated eggs was similar to controls on day 55. Embryonation of T. vulpis eggs treated with 345 or 350 MPa was delayed by 9 days and never reached more than 5% of eggs embryonated. On day 55 post treatment, 95% of control nontreated T. vulpis eggs were embryonated, 100-65% of eggs treated with 138-276 MPa were embryonated, a maximum of 5% of eggs treated with 345-350 MPa were embryonated, and 0% of eggs treated with ≥ 400 MPa were embryonated. T. vulpis eggs treated with ≥ 400 MPa did not undergo cell division. Embryrnation of A. suum eggs was delayed by 4, 10, and 16 days for eggs treated with 207, 241, and 250MPa, respectively, compared to nontreated control eggs. A. suum eggs treated with 207 MPa eventually embryonated

  19. In situ hybridization of neuropeptide-encoding transcripts afp-1, afp-3, and afp-4 in neurons of the nematode Ascaris suum.

    Science.gov (United States)

    Nanda, Jennifer Cho; Stretton, Antony O W

    2010-03-15

    The gene transcripts encoding both the AF8 and AF2 neuropeptides of the nematode Ascaris suum have been identified, cloned, and sequenced. The AF8 transcript (afp-3) encodes five identical copies of AF8; each peptide-encoding region is flanked by the appropriate dibasic or monobasic cleavage processing sites. The AF2 transcript (afp-4) encodes three identical copies of AF2 along with the appropriate cleavage sites. In contrast, the afp-1 transcript (Edison et al. [1997] Peptides 18:929-935) encodes six different AF peptides (AF3, 4, 10, 13, 14, 20) which all share a -PGVLRFamide C-terminus but have different N-terminal sequences. By using in situ hybridization, gene transcript expression patterns of afp-1, afp-3, and afp-4 (As-flp-18, As-flp-6, and As-flp-14, respectively, in the naming convention proposed by Blaxter et al. [1997] Parasitol Today 13:416-417) were determined in the adult A. suum anterior nervous system. Each gene transcript can be localized to a different subset of neurons. These subsets of neurons are different from the subsets of Caenorhabditis elegans neurons that were shown to express identical or similar peptides by the use of promoter GFP constructs (Kim and Li [2004] J Comp Neurol 475:540-550). PMID:20058230

  20. PAS-1, a protein affinity purified from Ascaris suum worms, maintains the ability to modulate the immune response to a bystander antigen.

    Science.gov (United States)

    Oshiro, Telma M; Enobe, Cristina S; Araújo, Cláudia A; Macedo, Mahasti S; Macedo-Soares, Maria Fernanda

    2006-04-01

    Helminth infections and parasite components have potent immunomodulatory effects on a host's immune system. In the present study, we investigated the effect of PAS-1, a protein component of Ascaris suum adult worms recognized by a monoclonal antibody (MAIP-1), on humoral and cell-mediated responses to a bystander antigen (ovalbumin [OVA]). MAIP-1 recognized only one of the three polypeptide chains of PAS-1, but neutralized the suppressive effect of the whole worm extract on OVA-specific antibody production. PAS-1 inhibited antibody production against a T-cell-dependent, but not a T-cell-independent, antigen in a dose-dependent way. IgM, IgG1, IgG2b, and also IgE and anaphylactic IgG1 levels were downregulated. In addition, PAS-1 inhibited OVA-specific delayed type hypersensitivity reactions in the footpad of mice, showing a potent immunosuppressive activity on both Th1 and Th2 responses that seems to be mediated by the induction of large amounts of IL-10 and IL-4. Indeed, PAS-1-specific spleen cells secreted sevenfold more IL-10 and threefold more IL-4 than OVA-specific cells in response to in vitro restimulation with the respective antigens. In conclusion, we showed that PAS-1, a single protein component from A. suum, maintains all its immunosuppressive properties. PMID:16519731

  1. The PCome of Ascaris suum as a model system for intestinal nematodes: identification of phosphorylcholine-substituted proteins and first characterization of the PC-epitope structures.

    Science.gov (United States)

    Timm, Thomas; Grabitzki, Julia; Severcan, Cinar; Muratoglu, Suzan; Ewald, Lisa; Yilmaz, Yavuz; Lochnit, Guenter

    2016-03-01

    In multicellular parasites (e.g., nematodes and protozoa), proteins and glycolipids have been found to be decorated with phosphorylcholine (PC). PC can provoke various effects on immune cells leading to an immunomodulation of the host's immune system. This immunomodulation allows long-term persistence but also prevents severe pathology due to downregulation of cellular immune responses. PC-containing antigens have been found to interfere with key proliferative signaling pathways in B and T cells, development of dendritic cells and macrophages, and mast cell degranulation. These effects contribute to the observed modulated cytokine levels and impairment of lymphocyte proliferation. In contrast to glycosphingolipids, little is known about the PC-epitopes of proteins. So far, only a limited number of PC-modified proteins from nematodes have been identified. In this project, PC-substituted proteins and glycolipids in Ascaris suum have been localized by immunohistochemistry in specific tissues of the body wall, intestine, and reproductive tract. Subsequently, we investigated the PCome of A. suum by 2D gel-based proteomics and detection by Western blotting using the PC-specific antibody TEPC-15. By peptide-mass-fingerprint matrix-assisted laser-desorption ionization time-of-flight mass spectrometry (MALDI-TOF-MS), we could identify 59 PC-substituted proteins, which are in involved multiple cellular processes. In addition to membrane proteins like vitellogenin-6, we found proteins with structural (e.g., tubulins) and metabolic (e.g., pyruvate dehydrogenase) functions or which can act in the defense against the host's immune response (e.g., serpins). Initial characterization of the PC-epitopes revealed a predominant linkage of PC to the proteins via N-glycans. Our data form the basis for more detailed investigations of the PC-epitope structures as a prerequisite for comprehensive understanding of the molecular mechanisms of immunomodulation. PMID:26728072

  2. Potentiation of IgE responses to third-party antigens mediated by Ascaris suum soluble products.

    Science.gov (United States)

    Lee, T D; McGibbon, A

    1993-01-01

    A reductive approach was used to examine the potentiation of IgE responses by nematode infection. Ascaris homogenized extract, Ascaris pseudocoelomic (body) fluid (ABF) and purified Ascaris allergen (ABA) were tested for their ability to act as protein carriers and as mediators of potentiated IgE responses to third-party (ovalbumin; OVA) responses. All three nematode products were excellent protein carriers for the hapten dinitrophenol and showed significantly better activity in this respect than OVA. Neither ABF nor ABA enhanced the level of the IgE response to the third-party antigen but both prolonged the response markedly. ABF, but not ABA, induced high levels of total circulating IgE when given at the same time as OVA with alum. The data suggest that the enhancement and prolongation of IgE responses by nematodes may be two separate but related activities. PMID:8400897

  3. Decoding the Ascaris suum genome using massively parallel sequencing and advanced bioinformatic methods

    DEFF Research Database (Denmark)

    Jex, Aaron R.; Liu, Shiping; Li, Bo;

    2013-01-01

    Parasitic nematodes cause substantial morbidity and mortality in animals and people globally and major losses to food production annually. Ascaris is among the commonest geohelminths of swine and people worldwide, and causes major disease and socioeconomic losses, particularly in developing count...

  4. Localization of serotoni (5-hydroxytryptamine, 5-HT) with partial purification and characterization of a serotonin binding protein in the intestinal tissue of the nematode Ascaris suum

    International Nuclear Information System (INIS)

    An intracellular 5-HT binding protein (SBP) from intestinal tissue was partially purified and characterized. Binding of [3H] 5-HT to the protein appeared to be Fe+2-sensitive and maximal (20.8pmol/mg protein) at 5 x 10-4M Fe+2 and 10-7M [3H] 5-HT. There were two 5-HT binding sites present at optimum Fe+2 concentrations. The Bmax values of these sites were more sensitive to Fe+2 than Kd values. Sulfhydryl reducing agents, cation chelators, Fe+3, Ca+2 and antagonists of 5-HT uptake and storage inhibited binding of 5-HT to SBP. Gel exclusion chromatography indicated the presence of a 45Kda SBP that in 5 x 10-5M Fe+2 may form aggregates ranging in size from approximately 80 to >1000Kda. The data indicate these in vitro aggregates may correspond to the electron-opaque patches observed in situ. Ascaris suum may provide a model system to further elucidate the physiological role of analogous serotonin binding proteins that have been identified in mammalian systems

  5. Localization of serotoni (5-hydroxytryptamine, 5-HT) with partial purification and characterization of a serotonin binding protein in the intestinal tissue of the nematode Ascaris suum

    Energy Technology Data Exchange (ETDEWEB)

    Martin, R.E.

    1989-01-01

    An intracellular 5-HT binding protein (SBP) from intestinal tissue was partially purified and characterized. Binding of ({sup 3}H) 5-HT to the protein appeared to be Fe{sup +2}-sensitive and maximal (20.8pmol/mg protein) at 5 {times} 10{sup {minus}4}M Fe{sup +2} and 10{sup {minus}7}M ({sup 3}H) 5-HT. There were two 5-HT binding sites present at optimum Fe{sup +2} concentrations. The Bmax values of these sites were more sensitive to Fe{sup +2} than Kd values. Sulfhydryl reducing agents, cation chelators, Fe{sup +3}, Ca{sup +2} and antagonists of 5-HT uptake and storage inhibited binding of 5-HT to SBP. Gel exclusion chromatography indicated the presence of a 45Kda SBP that in 5 {times} 10{sup {minus}5}M Fe{sup +2} may form aggregates ranging in size from approximately 80 to >1000Kda. The data indicate these in vitro aggregates may correspond to the electron-opaque patches observed in situ. Ascaris suum may provide a model system to further elucidate the physiological role of analogous serotonin binding proteins that have been identified in mammalian systems.

  6. Optimization of the Agar-gel Method for Isolation of Migrating Ascaris suum Larvae From the Liver and Lungs of Pigs

    Directory of Open Access Journals (Sweden)

    Høg M

    2001-06-01

    Full Text Available Experiments on use of an agar-gel method for recovery of migrating Ascaris suum larvae from the liver and lungs of pigs were conducted to obtain fast standardized methods. Subsamples of blended tissues of pig liver and lungs were mixed with agar to a final concentration of 1% agar and the larvae allowed to migrate out of the agar-gel into 0.9% NaCl at 38°C. The results showed that within 3 h more than 88% of the recoverable larvae migrated out of the liver agar-gel and more than 83% of the obtained larvae migrated out of the lung agar-gel. The larvae were subsequently available in a very clean suspension which reduced the sample counting time. Blending the liver for 60 sec in a commercial blender showed significantly higher larvae recovery than blending for 30 sec. Addition of gentamycin to reduce bacterial growth during incubation, glucose to increase larval motility during migration or ice to increase sedimentation of migrated larvae did not influence larvae recovery significantly.

  7. Multiple Exposures to Ascaris suum Induce Tissue Injury and Mixed Th2/Th17 Immune Response in Mice.

    Science.gov (United States)

    Nogueira, Denise Silva; Gazzinelli-Guimarães, Pedro Henrique; Barbosa, Fernando Sérgio; Resende, Nathália Maria; Silva, Caroline Cavalcanti; de Oliveira, Luciana Maria; Amorim, Chiara Cássia Oliveira; Oliveira, Fabrício Marcus Silva; Mattos, Matheus Silvério; Kraemer, Lucas Rocha; Caliari, Marcelo Vidigal; Gaze, Soraya; Bueno, Lilian Lacerda; Russo, Remo Castro; Fujiwara, Ricardo Toshio

    2016-01-01

    Ascaris spp. infection affects 800 million people worldwide, and half of the world population is currently at risk of infection. Recurrent reinfection in humans is mostly due to the simplicity of the parasite life cycle, but the impact of multiple exposures to the biology of the infection and the consequences to the host's homeostasis are poorly understood. In this context, single and multiple exposures in mice were performed in order to characterize the parasitological, histopathological, tissue functional and immunological aspects of experimental larval ascariasis. The most important findings revealed that reinfected mice presented a significant reduction of parasite burden in the lung and an increase in the cellularity in the bronchoalveolar lavage (BAL) associated with a robust granulocytic pulmonary inflammation, leading to a severe impairment of respiratory function. Moreover, the multiple exposures to Ascaris elicited an increased number of circulating inflammatory cells as well as production of higher levels of systemic cytokines, mainly IL-4, IL-5, IL-6, IL-10, IL-17A and TNF-α when compared to single-infected animals. Taken together, our results suggest the intense pulmonary inflammation associated with a polarized systemic Th2/Th17 immune response are crucial to control larval migration after multiple exposures to Ascaris. PMID:26814713

  8. Ascaris and ascariasis

    OpenAIRE

    HOLLAND, CELIA

    2011-01-01

    PUBLISHED Ascaris lumbricoides and Ascaris suum are widespread parasitic nematodes of humans and pigs respectively. Recent prevalence data suggests that approximately 1.2 billion people are infected. Adult worms exhibit an overdispersed frequency distribution in their hosts and individuals harbouring heavy burdens display associated morbidity. In this review, we describe the parasite, its distribution and measures undertaken to control infection.

  9. 人蛔虫和猪蛔虫同域种群DNA多态性研究%DNA POLYMORPHISM OF SYMPATRIC POPULATIONS OF ASCARIS LUMBRICOIDES AND ASCARIS SUUM

    Institute of Scientific and Technical Information of China (English)

    彭卫东; 周宪民; 安德森; 肯尼迪

    1999-01-01

    @@ 在我国蛔虫感染遍布各地,受染人数达5亿多.而在多数农村流行区,生猪饲养十分普遍,人群和猪群的蛔虫感染往往并存,且人、猪接触密切.据作者在江西省新建县蔓湖村进行的一年纵向调查,当地人群蛔虫感染率和猪群蛔虫感染率比较接近(约60%-70%),土壤蛔虫卵污染普遍而严重,并长年稳定 ( Peng, W.D. et al. 1996 Ascaris, people and pigs in rural Jiangxi, China. Parasitology 113:547~557.). 因此这些地区人蛔虫和猪蛔虫交叉感染的机会是大量存在的.

  10. Localized Th1-, Th2-, T Regulatory Cell-, and Inflammation-Associated Hepatic and Pulmonary Immune Responses in Ascaris suum-Infected Swine Are Increased by Retinoic Acid▿ †

    OpenAIRE

    Dawson, Harry; Solano-Aguilar, Gloria; Beal, Madeline; Beshah, Ethiopia; Vangimalla, Vandana; Jones, Eudora; Botero, Sebastian; Joseph F. Urban

    2009-01-01

    Pigs infected with Ascaris suum or controls were given 100 μg (low-dose) or 1,000 μg (high-dose) all-trans retinoic acid (ATRA)/kg body weight in corn oil or corn oil alone per os on days after inoculation (DAI) −1, +1, and +3 with infective eggs. Treatment with ATRA increased interleukin 4 (IL4) and IL12p70 in plasma of infected pigs at 7 DAI and augmented bronchoalveolar lavage (BAL) eosinophilia observed at 7 and 14 DAI. To explore potential molecular mechanisms underlying these observatio...

  11. Protonation mechanism and location of rate-determining steps for the Ascaris suum nicotinamide adenine dinucleotide-malic enzyme reaction from isotope effects and pH studies

    Energy Technology Data Exchange (ETDEWEB)

    Kiick, D.M.; Harris, B.G.; Cook, P.F.

    1986-01-14

    The pH dependence of the kinetic parameters and the primary deuterium isotope effects with nicotinamide adenine dinucleotide (NAD) and also thionicotinamide adenine dinucleotide (thio-NAD) as the nucleotide substrates were determined in order to obtain information about the chemical mechanism and location of rate-determining steps for the Ascaris suum NAD-malic enzyme reaction. The maximum velocity with thio-NAD as the nucleotide is pH-independent from pH 4.2 to 9.6, while with NAD, V decreases below a pK of 4.8. V/K for both nucleotides decreases below a pK of 5.6 and above a pK of 8.9. Both the tartronate pKi and V/Kmalate decrease below a pK of 4.8 and above a pK of 8.9. Oxalate is competitive vs. malate above pH 7 and noncompetitive below pH 7 with NAD as the nucleotide. The oxalate Kis increases from a constant value above a pK of 4.9 to another constant value above a pK of 6.7. The oxalate Kii also increases above a pK of 4.9, and this inhibition is enhanced by NADH. In the presence of thio-NAD the inhibition by oxalate is competitive vs. malate below pH 7. For thio-NAD, both DV and D(V/K) are pH-independent and equal to 1.7. With NAD as the nucleotide, DV decreases to 1.0 below a pK of 4.9, while D(V/KNAD) and D(V/Kmalate) are pH-independent. Above pH 7 the isotope effects on V and the V/K values for NAD and malate are equal to 1.45, the pH-independent value of DV above pH 7. Results indicate that substrates bind to only the correctly protonated form of the enzyme. Two enzyme groups are necessary for binding of substrates and catalysis. Both NAD and malate are released from the Michaelis complex at equal rates which are equal to the rate of NADH release from E-NADH above pH 7. Below pH 7 NADH release becomes more rate-determining as the pH decreases until at pH 4.0 it completely limits the overall rate of the reaction.

  12. Protonation mechanism and location of rate-determining steps for the Ascaris suum nicotinamide adenine dinucleotide-malic enzyme reaction from isotope effects and pH studies

    International Nuclear Information System (INIS)

    The pH dependence of the kinetic parameters and the primary deuterium isotope effects with nicotinamide adenine dinucleotide (NAD) and also thionicotinamide adenine dinucleotide (thio-NAD) as the nucleotide substrates were determined in order to obtain information about the chemical mechanism and location of rate-determining steps for the Ascaris suum NAD-malic enzyme reaction. The maximum velocity with thio-NAD as the nucleotide is pH-independent from pH 4.2 to 9.6, while with NAD, V decreases below a pK of 4.8. V/K for both nucleotides decreases below a pK of 5.6 and above a pK of 8.9. Both the tartronate pKi and V/Kmalate decrease below a pK of 4.8 and above a pK of 8.9. Oxalate is competitive vs. malate above pH 7 and noncompetitive below pH 7 with NAD as the nucleotide. The oxalate Kis increases from a constant value above a pK of 4.9 to another constant value above a pK of 6.7. The oxalate Kii also increases above a pK of 4.9, and this inhibition is enhanced by NADH. In the presence of thio-NAD the inhibition by oxalate is competitive vs. malate below pH 7. For thio-NAD, both DV and D(V/K) are pH-independent and equal to 1.7. With NAD as the nucleotide, DV decreases to 1.0 below a pK of 4.9, while D(V/KNAD) and D(V/Kmalate) are pH-independent. Above pH 7 the isotope effects on V and the V/K values for NAD and malate are equal to 1.45, the pH-independent value of DV above pH 7. Results indicate that substrates bind to only the correctly protonated form of the enzyme. Two enzyme groups are necessary for binding of substrates and catalysis. Both NAD and malate are released from the Michaelis complex at equal rates which are equal to the rate of NADH release from E-NADH above pH 7. Below pH 7 NADH release becomes more rate-determining as the pH decreases until at pH 4.0 it completely limits the overall rate of the reaction

  13. Effect of the injection of an extract of Ascaris suum on macrophage activation during the early phase of Mycobacterium bovis BCG infection in C57Bl/6 mice

    Directory of Open Access Journals (Sweden)

    Ferreira A.P.

    1999-01-01

    Full Text Available Injection of an Ascaris suum extract (Asc affects both the humoral and cellular immune responses to unrelated antigens when it is co-administered with these antigens. In the present study we evaluated the effect of Asc on macrophage activation in the early phase of Mycobacterium bovis BCG (Pasteur strain TMCC 1173 infection in C57Bl/6 mice. C57Bl/6 mice were injected intraperitoneally (ip with 0.1 mg BCG (BCG group or BCG plus 1 mg Asc (BCG + Asc group. The peritoneal exudates were obtained at 2, 7 and 14 days after infection. The numbers of IFN-g-secreting cells were assessed by the ELISPOT assay. Nitric oxide (NO production was measured by the Griess method and by the evaluation of NADPH diaphorase activity in the peritoneal exudates. The administration of Asc extract increased NADPH diaphorase activity (2 days: control = 0, BCG = 7%, BCG + Asc = 13%, and Asc = 4%; 7 days: control = 4, BCG = 13%, BCG + Asc = 21%, and Asc = 4.5% and TNF-a levels (mean ± SD; 2 days: control = 0, BCG = 169 ± 13, BCG + Asc = 202 ± 37, and Asc = 0; 7 days: control = 0, BCG = 545 ± 15.5, BCG + Asc = 2206 ± 160.6, and Asc = 126 ± 26; 14 days: control = 10 ± 1.45, BCG = 9 ± 1.15, BCG + Asc = 126 ± 18, and Asc = 880 ± 47.67 pg/ml in the early phase of BCG infection. Low levels of NO production were detected at 2 and 7 days after BCG infection, increasing at 14 days (mean ± SD; 2 days: control = 0, BCG = 3.7 ± 1.59, BCG + Asc = 0.82 ± 0.005, Asc = 0.48 ± 0.33; 7 days: control = 0, BCG = 2.78 ± 1.54, BCG + Asc = 3.07 ± 1.05, Asc = 0; 14 days: control = 0, BCG = 9.05 ± 0.53, BCG + Asc = 9.61 ± 0.81, Asc = 10.5 ± 0.2 (2 x 106 cells/ml. Furthermore, we also observed that Asc co-injection induced a decrease of BCG-colony-forming units (CFU in the spleens of BCG-infected mice during the first week of infection (mean ± SD; 2 days: BCG = 1.13 ± 0.07 and BCG + Asc = 0.798 ± 0.305; 7 days: BCG = 1.375 ± 0.194 and BCG + Asc = 0.548 ± 0.0226; 14 days: BCG

  14. Evaluation of a serodiagnostic test using Ascaris suum haemoglobin for the detection of roundworm infections in pig populations

    DEFF Research Database (Denmark)

    Vlaminck, Johnny; Nejsum, Peter; Vangroenweghe, Frédéric;

    2012-01-01

    novel indirect ELISA using the purified A. suum haemoglobin (AsHb) molecule as an antigen. Initial validation using sera from 190 pigs experimentally infected twice a week with A. suum and Trichuris suis (25 and 5 eggs kg(-1)day(-1) respectively) demonstrated that the AsHb ELISA is able to detect long....... suis infection was shown to be limited after analysing sera from pigs with an experimental T. suis mono-infection. Seroconversion was shown to occur from week 6 onwards in pigs receiving 100 A. suum eggs 5 times a week. Preliminary testing of the ELISA on six randomly selected farms confirmed the...... the tested samples were seropositive, while in 19.8% of the farms 80-100% of all pigs were seropositive. The results of this study suggest that the AsHb ELISA could provide pig farmers and veterinarians with an easier and more sensitive way to estimate the overall prevalence of A. suum on their farm....

  15. Modification of a thiol at the active site of the Ascaris suum NAD-malic enzyme results in changes in the rate-determining steps for oxidative decarboxylation of L-malate

    International Nuclear Information System (INIS)

    A thiol group at the malate-binding site of the NAD-malic enzyme from Ascaris suum has been modified to thiocyanate. The modified enzyme generally exhibits slight increases in KNAD and Kimetal and decreases in Vmax as the metal size increases from Mg2+ to Mn2+ to Cd2+, indicative of crowding in the site. The Kmalate value increases 10- to 30-fold, suggesting that malate does not bind optimally to the modified enzyme. Deuterium isotope effects on V and V/Kmalate increase with all three metal ions compared to the native enzyme concomitant with a decrease in the 13C isotope effect, suggesting a switch in the rate limitation of the hydride transfer and decarboxylation steps with hydride transfer becoming more rate limiting. The 13C effect decreases only slightly when obtained with deuterated malate, suggestive of the presence of a secondary 13C effect in the hydride transfer step, similar to data obtained with non-nicotinamide-containing dinucleotide substrates for the native enzyme (see the preceding paper in this issue). The native enzyme is inactivated in a time-dependent manner by Cd2+. This inactivation occurs whether the enzyme alone is present or whether the enzyme is turning over with Cd2+ as the divalent metal activator. Upon inactivation, only Cd2+ ions are bound at high stoichiometry to the enzyme, which eventually becomes denatured. Conversion of the active-site thiol to thiocyanate makes it more difficult to inactivate the enzyme by treatment with Cd2+

  16. Modification of a thiol at the active site of the Ascaris suum NAD-malic enzyme results in changes in the rate-determining steps for oxidative decarboxylation of L-malate

    Energy Technology Data Exchange (ETDEWEB)

    Gavva, S.R.; Harris, B.G.; Cook, P.F. (Texas Coll. of Osteopathic Medicine, Fort Worth (United States)); Weiss, P.M. (Univ. of Wisconsin, Madison (United States))

    1991-06-11

    A thiol group at the malate-binding site of the NAD-malic enzyme from Ascaris suum has been modified to thiocyanate. The modified enzyme generally exhibits slight increases in K{sub NAD} and K{sub i metal} and decreases in V{sub max} as the metal size increases from Mg{sup 2+} to Mn{sup 2+} to Cd{sup 2+}, indicative of crowding in the site. The K{sub malate} value increases 10- to 30-fold, suggesting that malate does not bind optimally to the modified enzyme. Deuterium isotope effects on V and V/K{sub malate} increase with all three metal ions compared to the native enzyme concomitant with a decrease in the {sup 13}C isotope effect, suggesting a switch in the rate limitation of the hydride transfer and decarboxylation steps with hydride transfer becoming more rate limiting. The {sup 13}C effect decreases only slightly when obtained with deuterated malate, suggestive of the presence of a secondary {sup 13}C effect in the hydride transfer step, similar to data obtained with non-nicotinamide-containing dinucleotide substrates for the native enzyme (see the preceding paper in this issue). The native enzyme is inactivated in a time-dependent manner by Cd{sup 2+}. This inactivation occurs whether the enzyme alone is present or whether the enzyme is turning over with Cd{sup 2+} as the divalent metal activator. Upon inactivation, only Cd{sup 2+} ions are bound at high stoichiometry to the enzyme, which eventually becomes denatured. Conversion of the active-site thiol to thiocyanate makes it more difficult to inactivate the enzyme by treatment with Cd{sup 2+}.

  17. The effect of γ-aminobutyric acid on the input conductance and membrane potential of Ascaris muscle

    OpenAIRE

    Martin, R. J.

    1980-01-01

    1 Twin intracellular recordings were made from the bag region of Ascaris muscle in order to make conductance measurements. The preparation was bathed in a cool (22°C) Ringer solution to abolish the large spontaneous depolarizing potentials and to improve stability for recording.

  18. 负载人蛔虫和猪蛔虫抗原树突状细胞影响T细胞亚群活性研究%Comparative analysis of T cell subsets response induced by DC fused with Ag of Ascaris lumbricoides and Ascaris suum

    Institute of Scientific and Technical Information of China (English)

    祝伟; 黄川; 黄艳琴; 胡银英; 戴志芳; 袁芳; 袁铿

    2013-01-01

    respectively by flow cytometry (FCM),ELISA and real time PCR.And the LCs were isolated from bone marrow cells cultured with granulocyte/macrophage colony-stimulating factor (GM-CSF) and IL-4 in vitro.The FCM results showed that DCs isolated from bone marrow cells were with high expression of kinds of surface molecules (CD86,85.5 %; CD83 38.24%; CD80,94 %).CD80 and CD83 declined after heing cultured with ascaris extract for 2 days and that of the groups fused separately with Ag of A.lumbricoides and A.suum was respectively higher and lower than the control group.ELISA showed the level of expression of TNF-α in each period of each experimental group was lower than the control group (P<0.05); IL-10 in each group increased over time,and the groups with ascaris antigen were higher than groups with same concentration of A.suum antigen (P< 0.05) in each time except the time point of 24 hours.The qPCR results showed that the levels of the groups with A.lumbricoides Ag were declined over time but significantly higher than the control groups and the groups with A.suum Ag in different time points (P<0.05).The differences between the groups with A.suum Ag and the control groups were not statistically significant (P>0.05).In conclusion,DC fused with the Ag of A.lumbricoides promoted a stronger Th2 type response and the expression of Foxp3 mRNA in vitro.

  19. ZAPA, (Z)-3-[(aminoiminomethyl)thio]-2-propenoic acid hydrochloride, a potent agonist at GABA-receptors on the Ascaris muscle cell.

    OpenAIRE

    Holden-Dye, L.; Walker, R. J.

    1988-01-01

    This study is the first report of a compound which is equal in efficacy to gamma-aminobutyric acid (GABA) at the nematode Ascaris muscle GABA-receptor. The GABA-receptor at the Ascaris muscle cell which mediates a membrane hyperpolarization and muscle relaxation has eluded classification. The structure-activity profile of this receptor is not typical of GABAA or GABAB-receptors. Here we report that the isothiouronium compound ZAPA is as potent as GABA at this receptor. This finding has import...

  20. Molecular epidemiology of ascariasis: a global perspective on the transmission dynamics of Ascaris in people and pigs.

    OpenAIRE

    Betson, M.; Nejsum, P; Bendall, RP; Deb, RM; Stothard, JR

    2014-01-01

    Background.  The roundworm Ascaris lumbricoides infects 0.8 billion people worldwide, and Ascaris suum infects innumerable pigs across the globe. The extent of natural cross-transmission of Ascaris between pig and human hosts in different geographical settings is unknown, warranting investigation. Methods.  Adult Ascaris organisms were obtained from humans and pigs in Europe, Africa, Asia, and Latin America. Barcodes were assigned to 536 parasites on the basis of sequence analysis of the mito...

  1. Reduction of Ascaris transmission to pigs by cleaning the dunging area

    OpenAIRE

    Vermeer, H. M.; Borgsteede, F.H.M.; Gaasenbeek, C.P.H.; Blanken, K.

    2008-01-01

    Ascaris suum is the most prevalent helminth on organic pig farms (Carstensen et al., 2002) and is transmitted mainly via the faeces. The use of anthelmintics does not fit in the organic principles and preventive measures are promoted. This project focused on assessing the efficacy of a cleaning protocol for the dunging area of pens on Ascaris s. transmission to pigs. In 4 batches with 8 identical pens for 15 pigs each (n=480 pigs) 6 pigs per pen were orally infected with Ascaris s. The other ...

  2. Feeding Probiotic Bacteria To Swine Enhances Immunity To Ascaris Suum

    Science.gov (United States)

    Probiotic bacterial species are included in the diet to promote health. Probiotics purportedly protect the intestine against pathogenic microorganisms and can reduce inflammation; however, quantitative measurement of probiotic growth and related effects on intestinal function are often lacking. Asca...

  3. Serum antibody responses in pigs trickle-infected with Ascaris and Trichuris

    DEFF Research Database (Denmark)

    Kringel, Helene; Thamsborg, Stig Milan; Petersen, Heidi Huus;

    2015-01-01

    A humoral immune response following helminth infection in pigs is well documented. However, it has been difficult to confirm the existence of antibody mediated resistance against the large roundworm, Ascaris suum, and whipworm, Trichuris suis, in experimental settings by correlating worm burdens ...

  4. Community Rates of IgG4 Antibodies to Ascaris Haemoglobin Reflect Changes in Community Egg Loads Following Mass Drug Administration

    OpenAIRE

    Vlaminck, Johnny; Supali, Taniawati; Geldhof, Peter; Cornelis H Hokke; Fischer, Peter U.; Weil, Gary J

    2016-01-01

    Background Conventional diagnostic methods for human ascariasis are based on the detection of Ascaris lumbricoides eggs in stool samples. However, studies of ascariasis in pigs have shown that the prevalence and the number of eggs detected in the stool do not correlate well with exposure of the herd to the parasite. On the other hand, an ELISA test measuring antibodies to Ascaris suum haemoglobin (AsHb) has been shown to be useful for estimating transmission intensity on pig farms. In this st...

  5. Distribution of 3H-GABA uptake sites in the nematode Ascaris

    International Nuclear Information System (INIS)

    The distribution of uptake sites for the inhibitory neurotransmitter gamma-aminobutyric acid (GABA) in the nematode Ascaris suum was examined by autoradiography of 3H-GABA uptake. Single neural processes in both the ventral and dorsal nerve cords were labeled with 3H-GABA. Serial section analysis identified the cells of origin of these processes as the RMEV-like and RMED-like neurons. These cells belong to a set of four neurons in the nerve ring, all of which are labeled by 3H-GABA. 3H-GABA labeling of at least two other sets of cephalic neurons was seen. One of these pairs consists of medium-sized lateral ganglia neurons, located at the level of the amphid commissure bundle. A second pair is located in the lateral ganglia at the level of the deirid commissure bundle. The position and size of these lateral ganglia cells suggest that they are the GABA-immunoreactive lateral ganglia cells frequently seen in whole-mount immunocytochemical preparations. Four neuronal cell bodies located in the retrovesicular ganglion were also labeled with 3H-GABA. These cells, which are probably cholinergic excitatory motor neurons, do not contain detectable GABA-like immunoreactivity. Heavy labeling of muscle cells was also observed. The ventral and dorsal nerve cord inhibitory motor neurons, which are known to contain GABA-like immunoreactivity, were not labeled above background with 3H-GABA. Together with the experiments reported previously, these results define three classes of GABA-associated neurons in Ascaris: (1) neurons that contain endogenous GABA and possess a GABA uptake system; (2) neurons that contain endogenous GABA, but that either lack a GABA uptake system or possess a GABA uptake system of low activity; (3) neurons that possess a GABA uptake system, but that lack endogenous GABA

  6. Distribution of 3H-GABA uptake sites in the nematode Ascaris

    Energy Technology Data Exchange (ETDEWEB)

    Guastella, J.; Stretton, A.O. (University of Wisconsin, Madison (USA))

    1991-05-22

    The distribution of uptake sites for the inhibitory neurotransmitter gamma-aminobutyric acid (GABA) in the nematode Ascaris suum was examined by autoradiography of 3H-GABA uptake. Single neural processes in both the ventral and dorsal nerve cords were labeled with 3H-GABA. Serial section analysis identified the cells of origin of these processes as the RMEV-like and RMED-like neurons. These cells belong to a set of four neurons in the nerve ring, all of which are labeled by 3H-GABA. 3H-GABA labeling of at least two other sets of cephalic neurons was seen. One of these pairs consists of medium-sized lateral ganglia neurons, located at the level of the amphid commissure bundle. A second pair is located in the lateral ganglia at the level of the deirid commissure bundle. The position and size of these lateral ganglia cells suggest that they are the GABA-immunoreactive lateral ganglia cells frequently seen in whole-mount immunocytochemical preparations. Four neuronal cell bodies located in the retrovesicular ganglion were also labeled with 3H-GABA. These cells, which are probably cholinergic excitatory motor neurons, do not contain detectable GABA-like immunoreactivity. Heavy labeling of muscle cells was also observed. The ventral and dorsal nerve cord inhibitory motor neurons, which are known to contain GABA-like immunoreactivity, were not labeled above background with 3H-GABA. Together with the experiments reported previously, these results define three classes of GABA-associated neurons in Ascaris: (1) neurons that contain endogenous GABA and possess a GABA uptake system; (2) neurons that contain endogenous GABA, but that either lack a GABA uptake system or possess a GABA uptake system of low activity; (3) neurons that possess a GABA uptake system, but that lack endogenous GABA.

  7. Localized Th1-, Th2-,and inflamation-associated hepatic and pulmonary immune responses in Ascaris-infected swine are increased by retinoic acid.

    Science.gov (United States)

    Pigs infected with Ascaris suum were treated with all-trans retinoic acid (ATRA) on d–1, d+1, d+3 of infection. Control or infected pigs were given 100 (LD-ATRA) or 1,000 (HD-ATRA) µg/kg ATRA in corn oil, or corn oil alone, and sacrificed at 7 and 14 days after inoculation (DAI) with infective eggs...

  8. Phylogeographical studies of Ascaris spp. based on ribosomal and mitochondrial DNA sequences.

    Directory of Open Access Journals (Sweden)

    Serena Cavallero

    Full Text Available BACKGROUND: The taxonomic distinctiveness of Ascaris lumbricoides and A. suum, two of the world's most significant nematodes, still represents a much-debated scientific issue. Previous studies have described two different scenarios in transmission patterns, explained by two hypotheses: (1 separated host-specific transmission cycles in highly endemic regions, (2 a single pool of infection shared by humans and pigs in non-endemic regions. Recently, A. suum has been suggested as an important cause of human ascariasis in endemic areas such as China, where cross-infections and hybridization have also been reported. The main aims of the present study were to investigate the molecular epidemiology of human and pig Ascaris from non-endemic regions and, with reference to existing data, to infer the phylogenetic and phylogeographic relationships among the samples. METHODOLOGY: 151 Ascaris worms from pigs and humans were characterized using PCR-RFLP on nuclear ITS rDNA. Representative geographical sub-samples were also analysed by sequencing a portion of the mitochondrial cox1 gene, to infer the extent of variability at population level. Sequence data were compared to GenBank sequences from endemic and non-endemic regions. PRINCIPAL FINDINGS: No fixed differences between human and pig Ascaris were evident, with the exception of the Slovak population, which displays significant genetic differentiation. The RFLP analysis confirmed pig as a source of human infection in non-endemic regions and as a corridor for the promulgation of hybrid genotypes. Epidemiology and host-affiliation seem not to be relevant in shaping molecular variance. Phylogenetic and phylogeographical analyses described a complex scenario, involving multiple hosts, sporadic contact between forms and an ancestral taxon referable to A. suum. CONCLUSIONS/SIGNIFICANCE: These results suggest the existence of homogenizing gene flow between the two taxa, which appear to be variants of a single

  9. Type I-like intervening sequences are found in the rDNA of the nematode Ascaris lumbricoides.

    OpenAIRE

    Neuhaus, H; Müller, F.; Etter, A; Tobler, H

    1987-01-01

    The intervening sequences in the large ribosomal RNA gene of Ascaris lumbricoides var. suum show many similarities to the type I insertions, previously found only in some insect species. They include structural features, but also a presumed transcriptional inactivity in vivo: No transcript of the rDNA intervening sequence in A. lumbricoides could be detected in Northern and dot blot hybridizations. However, the primary structure of the Pol I promoter region is well conserved in interrupted an...

  10. Ascaris suum infections in pigs born and raised on contaminated paddocks

    DEFF Research Database (Denmark)

    Mejer, Helena; Roepstorff, Allan Knud

    2006-01-01

    .p. by removing the sow. Paddock infection levels were estimated by regular examination of soil samples and in late June and late November using parasite naïve tracer pigs. Paddock contamination was high but eggs developed slowly resulting in a low initial transmission to the experimental pigs. By week 5...

  11. Development and survival of Ascaris suum eggs in deep litter of pigs

    DEFF Research Database (Denmark)

    Katakam, Kiran Kumar; Thamsborg, Stig Milan; Kyvsgaard, Niels Christian;

    2014-01-01

    pens on an organic farm in four seasons. There was some variation, but mean ammonia levels were generally very low (1·0-2·6 mm) and pH levels were moderate (8·04-8·88) in all three areas. Relatively, resting areas were characterized by overall moderate moisture (36%) and moderately high temperature (35......·7 °C) levels. The area contained few eggs (50 eggs g-1 DM) of which 17% were viable, and though only 4% were larvated and 0·7% appeared infective, it was more than in the other areas. Intermediate areas had moderate moisture (43%) and high temperature (43·6 °C) levels. There were many eggs (523 eggs g......-1 DM), but overall viability was very low (5%) and few eggs were larvated (0·004%) or even infective (0·002%). Latrines typically had high moisture (79%) and moderate temperature (30 °C) levels. The concentration of eggs was very high (1444 egg g-1 DM) and though 32% were viable, none had developed...

  12. [Sonographic imaging of Ascaris lumbricoides].

    Science.gov (United States)

    Barzilai, M; Khamaysi, N

    1996-10-01

    The round worm, Ascaris lumbricoides, is one of the largest of the parasites that infest the human bowel. The worms usually develop in the jejunum and can reach several thousand in number, causing bowel obstruction, volvulus, intussusception, appendicitis and even bowel perforation with penetration into the peritoneal cavity. They tend to invade the bile and pancreatic ducts and may cause acute cholecystitis and pancreatitis. Ascaris lumbricoides can be detected by sonography. This imaging modality can be helpful in diagnosing the presence of the worms and in evaluating response to treatment. We present an 18-month-old girl in whom bowel worms were detected by sonography. PMID:8940520

  13. Churg-Strauss vasculitis and ascaris infection.

    OpenAIRE

    Chauhan, A.; Scott, D G; Neuberger, J; Gaston, J. S.; Bacon, P A

    1990-01-01

    A patient with Churg-Strauss vasculitis presenting with mononeuritis multiplex, who developed obstructive jaundice, is described. On investigation the jaundice proved to be due to ascaris infestation. As the immune abnormalities associated with ascaris infection are also typical of those seen in the Churg-Strauss syndrome it is speculated that the vasculitis occurred because of a failure to regulate the anti-ascaris immune response.

  14. GABA localization in the nematode Ascaris

    International Nuclear Information System (INIS)

    A histochemical approach was used to examine the distribution of GABA-associated neurons in the nematode Ascaris, an organism whose small number of morphologically simple neurons make it an excellent preparation for analyzing neuronal phenotypes. Two GABAergic markers were examined: GABA-like immunoreactivity (GLIR), a marker for endogenous stores of GABA; and [3H]-GABA uptake, a marker for GABA uptake sites. Strong GLIR was present in the cell bodies, neurites and commissures of dorsal and ventral inhibitory motorneurons present in this region. Strong GLIR was also present in the cell bodies and processes of the four RME neurons in the nerve ring and in several other ganglionic neurons. Staining was absent in excitatory motorneurons, in ventral cord interneurons and in muscle cells and hypodermis. GABA uptake sites were found in single neural processes in both the ventral and dorsal nerve cords. [3H]-GABA labeling was also observed in the other two RME cells and several other cephalic neurons. Four putative cholinergic excitatory motorneurons in the retrovesicular ganglion (RVG) were heavily labeled. Ventral and dorsal nerve cord inhibitory motorneurons did not take up [3H]-GABA. Labeling of the ventral cord excitatory motorneuron somata and cell bodies was at or slightly above background. Heavy labeling of muscle cells was also observed

  15. GABA localization in the nematode Ascaris

    Energy Technology Data Exchange (ETDEWEB)

    Guastella, J.

    1988-01-01

    A histochemical approach was used to examine the distribution of GABA-associated neurons in the nematode Ascaris, an organism whose small number of morphologically simple neurons make it an excellent preparation for analyzing neuronal phenotypes. Two GABAergic markers were examined: GABA-like immunoreactivity (GLIR), a marker for endogenous stores of GABA; and ({sup 3}H)-GABA uptake, a marker for GABA uptake sites. Strong GLIR was present in the cell bodies, neurites and commissures of dorsal and ventral inhibitory motorneurons present in this region. Strong GLIR was also present in the cell bodies and processes of the four RME neurons in the nerve ring and in several other ganglionic neurons. Staining was absent in excitatory motorneurons, in ventral cord interneurons and in muscle cells and hypodermis. GABA uptake sites were found in single neural processes in both the ventral and dorsal nerve cords. ({sup 3}H)-GABA labeling was also observed in the other two RME cells and several other cephalic neurons. Four putative cholinergic excitatory motorneurons in the retrovesicular ganglion (RVG) were heavily labeled. Ventral and dorsal nerve cord inhibitory motorneurons did not take up ({sup 3}H)-GABA. Labeling of the ventral cord excitatory motorneuron somata and cell bodies was at or slightly above background. Heavy labeling of muscle cells was also observed.

  16. Cytogenetic study of Ascaris trypsin inhibitor in cultured human lymphocytes with metabolic activation

    Indian Academy of Sciences (India)

    Joanna Blaszkowska; Wanda Bratkowska; Dobroslawa Lopaczynska; Tomasz Ferenc

    2009-04-01

    The trypsin inhibitor (ATI) isolated from gastrointestinal nematode Ascaris suum was tested in vitro for induction of chromosome aberrations and sister chromatid exchanges (SCE). Genotoxicity assessment of purified ATI was carried out on metaphase plates received from peripheral blood lymphocyte macroculture (48 h test of structural chromosome aberrations and 72 h test of SCE) with exogenous metabolic activation. ATI was tested in dose of 25, 50 and 100 μg per ml of culture. Kinetics of cell divisions were determined by the replication index (RI). The mitotic index (MI) was expressed as a number of metaphases per 1000 nuclei analysed. Analysis of chromosome aberrations showed that higher doses of ATI (50 and 100 /ml) significantly increased the frequency of chromosome aberrations (mainly of chromatid gaps and breaks) compared to the negative control. All concentrations of ATI caused a statistically significant reduction in the MI and RI. In comparison with the negative control, a significant increase in the SCE frequency was observed in all applied doses of ATI. Thus, in the presence of S9 activation, the Ascaris trypsin inhibitor showed potential clastogenic activity and inhibition of the dynamics of lymphocyte divisions.

  17. Characterization of ascaris from ecuador and zanzibar.

    Science.gov (United States)

    Sparks, A M; Betson, M; Oviedo, G; Sandoval, C; Cooper, P J; Stothard, J R

    2015-07-01

    To shed light on the epidemiology of ascariasis in Ecuador and Zanzibar, 177 adult worms retrieved by chemo-expulsion from either people or pigs were collected, measured and subjected to polymerase chain reaction-restriction fragment length polymorphism (PCR-RFLP) analysis of the ribosomal internal transcribed spacer (ITS) region. Upon double digestion with RsaI and HaeIII, PCR-RFLP analysis revealed the presence of A. lumbricoides in people and A. suum in pigs in Ecuador. In contrast, while there are no pigs on Zanzibar, of the 56 worms obtained from people, one was genotyped as A. suum. No additional genetic variation was detected upon further PCR-RFLP analysis with several other restriction enzymes. Upon measurement, worm mass and length differed by location and by species, A. suum being lighter and longer. While there is no evidence to suggest zoonotic transmission in Ecuador, an enduring historical signature of previous zoonotic transmission remains on Zanzibar. PMID:26017334

  18. 人蛔虫和猪蛔虫差异的比较研究%Comparative Studies on the Difference Between Ascaris lumbricoides and Ascaris suum

    Institute of Scientific and Technical Information of China (English)

    翁培兰; 彭卫东

    2006-01-01

    人蛔虫和猪蛔虫的分类地位一直存在争议.本文就人蛔虫和猪蛔虫的形态学、宿主感染特异性、免疫学、生化学和核型进行比较研究,对近年来分子遗传学方面的有关进展进行了综述.

  19. Pancreatitis secondary to Ascaris Lumbricoides: A case series analysis

    OpenAIRE

    Ab hameed Raina, Ghulam Nabi Yattoo, Feroz Ahmad Wani, Reyaz Ahmad Para, Khaild Hamid Changal, Arshed Hussain Parry

    2013-01-01

    Ascaris lumbricoides infestations are endemic in tropical countries. Ascaris lumbricoides is the second most common intestinal parasite world-wide and, although the infection can be asymptomatic, in some cases it can present with complications, such as acute pancreatitis. Pancreatitis secondary to ascaris is more common in females. We describe three cases who presented with Ascaris lumbricoides-induced acute pancreatitis and all of them were females and were diagnosed on ultrasonography. In t...

  20. Destruction of Ascaris ova by accelerated electron

    Science.gov (United States)

    Capizzi, S.; Chevallier, A.; Schwartzbrod, J.

    1999-11-01

    We investigated the efficiency of radiation treatment to destroy Ascaris ova viability and found that no ova were viable after exposure to 0.75 kGy (D 90 at 0.39 kGy). Although the outer coat of the Ascaris ovum had a protective effect at low doses (0.20 kGy) no difference in ova viability was observed at 0.30 kGy. As the doses commonly used for sanitary treatment of wastewater are much higher, Ascaris ova should be effectively eliminated from sludge by the 10 kGy dose required by EPA regulations ( U.S. EPA, 1993 Federal Register 58, 9248-9415).

  1. Isotope partitioning for NAD-malic enzyme from Ascaris suum confirms a steady-state random kinetic mechanism

    Energy Technology Data Exchange (ETDEWEB)

    Chen, C.Y.; Harris, B.G.; Cook, P.F.

    1988-01-12

    Isotope partitioning studies beginning with E-(/sup 14/C)NAD, E-(/sup 14/C) malate, E-(/sup 14/C) NAD-Mg/sup 2 +/, and E-Mg-(/sup 14/C)malate suggest a steady-state random mechanism for the NAD-malic enzyme. Isotope trapping beginning with E-(/sup 14/C)NAD and with varying concentrations of Mg/sup 2 +/ and malate in the chase solution indicates that Mg/sup 2 +/ is added in rapid equilibrium and must be added prior to malate for productive ternary complex formation. Equal percentage trapping from E-(/sup 14/C)NAD-Mg and E-Mg-(/sup 14/C) malate indicates the mechanism is steady-state random with equal off-rates for NAD and malate from E-NAD-Mg-malate. The off-rates for both do not change significantly in the ternary E-Mg-malate and E-NAD-Mg complexes, nor does the off-rate change for NAD from E-NAD. No trapping of malate was obtained from E-(/sup 14/C) malate, suggesting that this complex is nonproductive. A quantitative analysis of the data allows an estimation of values for a number of the rate constants along the reaction pathway.

  2. Isotope partitioning for NAD-malic enzyme from Ascaris suum confirms a steady-state random kinetic mechanism

    International Nuclear Information System (INIS)

    Isotope partitioning studies beginning with E-[14C]NAD, E-[14C] malate, E-[14C] NAD-Mg2+, and E-Mg-[14C]malate suggest a steady-state random mechanism for the NAD-malic enzyme. Isotope trapping beginning with E-[14C]NAD and with varying concentrations of Mg2+ and malate in the chase solution indicates that Mg2+ is added in rapid equilibrium and must be added prior to malate for productive ternary complex formation. Equal percentage trapping from E-[14C]NAD-Mg and E-Mg-[14C] malate indicates the mechanism is steady-state random with equal off-rates for NAD and malate from E-NAD-Mg-malate. The off-rates for both do not change significantly in the ternary E-Mg-malate and E-NAD-Mg complexes, nor does the off-rate change for NAD from E-NAD. No trapping of malate was obtained from E-[14C] malate, suggesting that this complex is nonproductive. A quantitative analysis of the data allows an estimation of values for a number of the rate constants along the reaction pathway

  3. Small bowel Ascaris infestation: a diagnostic challenge.

    Science.gov (United States)

    Khan, Muhammad Waqas; Ghauri, Sanniya Khan

    2016-01-01

    Ascariasis is a common infestation in developing countries where there is poor hygiene. A majority of the cases are asymptomatic, with a few cases presenting with mild abdominal pain and nutritional deficiencies in the long term. Here we present a case of a young boy who presented as a diagnostic dilemma, with signs of acute intestinal obstruction without any supporting radiological evidence. A barium study revealed the presence of low-burden Ascaris infestation that was managed medically. PMID:27175091

  4. Surgical complications of Ascaris lumbricoides in children

    OpenAIRE

    Ramareddy, Raghu S.; Anand Alladi; O S Siddapa; Deepti, V; Tanveer Akthar; B Mamata

    2012-01-01

    Aim : To report the surgical complications of Ascaris lumbricoides infestation in children. Materials and Methods : This is a retrospective study and cases of intestinal ascariasis managed conservatively were excluded. Results : Sixteen children presented with Ascariasis sequelae, which included ileal volvulus (n=5), perforations (n=4), intussusception (n=1), biliary ascariasis (n-1) and impacted multiple worm boluses (n=5). Plain abdominal radiographs showed pneumoperitoneum (3), cigar bundl...

  5. INTUSSUSCEPTION DUE TO ENTRAPPED ASCARIS: AN ULTRASOUND CASE REPORT

    OpenAIRE

    Prashant U; Bhawana D; Pradip B; Narendra G.

    2014-01-01

    Intestinal intussusception caused by ascaris is uncommon. Abdominal ultrasound is generally done as a first imaging investigation for abdominal symptoms. This report described the ultrasound features in this rare case of adult intussusception due to entrapped ascaris, making a significant contribution to radiological knowledge in diagnosing the cause at the earliest for better management.

  6. Ascaris lumbricoides: an unusual aetiology of gastric perforation

    OpenAIRE

    Gupta, Shahana; Kumar, Sanjeev; Satapathy, Ayusman; Ray, Udipta; Chatterjee, Souvik; Choudhury, Tamal Kanti

    2012-01-01

    Gastrointestinal (GI) infestation with Ascaris lumbricoides is common in the tropical countries, particularly in children. A wide range of clinical presentations are reported for GI ascariasis in both adults and children. We report a case of gastric perforation due to Ascaris, a rare presentation.

  7. Small bowel Ascaris infestation: a diagnostic challenge

    Directory of Open Access Journals (Sweden)

    Khan MW

    2016-04-01

    Full Text Available Muhammad Waqas Khan, Sanniya Khan Ghauri Section of Medicine, Department of Emergency Medicine, WHO Collaborating Centre for Emergency Medicine and Trauma Care, Aga Khan University Hospital, Karachi, Pakistan Abstract: Ascariasis is a common infestation in developing countries where there is poor hygiene. A majority of the cases are asymptomatic, with a few cases presenting with mild abdominal pain and nutritional deficiencies in the long term. Here we present a case of a young boy who presented as a diagnostic dilemma, with signs of acute intestinal obstruction without any supporting radiological evidence. A barium study revealed the presence of low-burden Ascaris infestation that was managed medically. Keywords: partial intestinal obstruction, gastro-intestinal helminthic infection, pediatric

  8. A quantitative assessment method for Ascaris eggs on hands

    DEFF Research Database (Denmark)

    Jeandron, Aurelie; Ensink, Jeroen H. J.; Thamsborg, Stig Milan;

    2014-01-01

    The importance of hands in the transmission of soil transmitted helminths, especially Ascaris and Trichuris infections, is under-researched. This is partly because of the absence of a reliable method to quantify the number of eggs on hands. Therefore, the aim of this study was to develop a method...... with Ascaris eggs and of their role in human infection. Follow-up studies are needed that validate the hand washing method under field conditions, e.g. including people of different age, lower levels of contamination and various levels of hand cleanliness....... to assess the number of Ascaris eggs on hands and determine the egg recovery rate of the method. Under laboratory conditions, hands were seeded with a known number of Ascaris eggs, air dried and washed in a plastic bag retaining the washing water, in order to determine recovery rates of eggs for four...

  9. Wandering ascaris coming out through the abdominal wall

    Directory of Open Access Journals (Sweden)

    Mohd L Wani

    2013-01-01

    Full Text Available A rare case of ascaris coming out through the anterior abdominal wall is reported here. A 40-year-old female had undergone dilatation and curettage by a quack. On the second day she presented with presented with features of peritonitis. She was explored. Resection anastomosis of the ileum was done for multiple perforations of the ileum. Patient developed a fistula in the anterior abdominal wall which was draining bile-colored fluid. On the 12 th postoperative day a 10-cm-long worm was seen coming out through the fistulous tract which was found to be Ascaris lumbricoids. Ascaris lumbricoids can lead to many complications ranging from worm colic to intestinal obstruction, volvulus, peritonitis, pancreatitis, cholangiohepatitis, liver abscess and many more. Worm has been reported to come out through mouth, nostrils, abdominal drains, T-tubes etc. But ascaris coming out through the anterior abdominal wall is very rare hence reported here.

  10. Laryngeal spasm after general anaesthesia due to Ascaris Lumbricoides

    OpenAIRE

    Finsnes, K D

    2013-01-01

    Postoperative upper airway obstruction during recovery from general anaesthesia may have several causes. This is a report of a young girl who developed laryngeal spasm as a result of an ectopic roundworm Ascaris lumbricoides.

  11. Mammalian metallopeptidase inhibition at the defense barrier of Ascaris parasite

    OpenAIRE

    Sanglas, Laura; Aviles, Francesc X.; Huber, Robert; Gomis-Rüth, F. Xavier; Arolas, Joan L.

    2009-01-01

    Roundworms of the genus Ascaris are common parasites of the human gastrointestinal tract. A battery of selective inhibitors protects them from host enzymes and the immune system. Here, a metallocarboxypeptidase (MCP) inhibitor, ACI, was identified in protein extracts from Ascaris by intensity-fading MALDI-TOF mass spectrometry. The 67-residue amino acid sequence of ACI showed no significant homology with any known protein. Heterologous overexpression and purification of ACI rendered a functio...

  12. Liver abscess caused by Ascaris lumbricoides: case report

    OpenAIRE

    PINILLA Análida Elizabeth; LÓPEZ Myriam Consuelo; Orlando RICAURTE; CASTILLO Blanca; Murcia, Martha Isabel; Nicholls, Rubén Santiago; Duque, Sofía; Orozco, Luis Carlos

    2001-01-01

    A case is reported of a woman who lived in a rural area with a chronic illness that consisted of weight loss and abdominal pain in the epigastrium and upper right quadrant. The initial diagnosis was a mass in the liver, which was later, demonstrated, both by direct and histological examination, to be an abscess caused by Ascaris lumbricoides. Eggs of Ascaris lumbricoides and abundant Charcot-Leyden Crystals were found.

  13. Esophageal space-occupying lesion caused by Ascaris lumbricoides

    OpenAIRE

    Zheng, Ping-Ping; Wang, Bing-Yuan; Wang, Fei; Ao, Ran; Wang, Ying(School of Physics, Shandong University, Jinan, 250100, PR China)

    2012-01-01

    Ascaris lumbricoides is the largest intestinal nematode parasite of man, which can lead to various complications because of its mobility. As the esophagus is not normal habitat of Ascaris, the report of esophageal ascariasis is rare. An old female presented with dysphagia after an intake of several red bean buns and haw jellies. The barium meal examination revealed a spherical defect in the lower esophagus. Esophageal bezoar or esophageal carcinoma was considered at the beginning. The patient...

  14. Tube within Tube: Ascaris in Bowel and Biliary-Tract

    OpenAIRE

    Goyal, Ankur; Gamanagatti, Shivanand; Sriram, Jaganathan

    2010-01-01

    Ascaris lumbricoides is one of the most common human helminthic diseases worldwide. On ultrasound, it is seen as linear non-shadowing echogenic structures with target appearance in cross section, and the live worm may show writhing movements in real time. On barium meal follow through, it appears as radiolucent tubular filling defects within the bowel lumen. Though not sensitive, direct real-time visualization of Ascaris on ultrasound is quick, non-invasive, and definitive.

  15. The Dynamics of Ascaris lumbricoides Infections.

    Science.gov (United States)

    Fowler, A C; Déirdre Hollingsworth, T

    2016-04-01

    The Anderson-May model of human parasite infections and specifically that for the intestinal worm Ascaris lumbricoides is reconsidered, with a view to deriving the observed characteristic negative binomial distribution which is frequently found in human communities. The means to obtaining this result lies in reformulating the continuous Anderson-May model as a stochastic process involving two essential populations, the density of mature worms in the gut, and the density of mature eggs in the environment. The resulting partial differential equation for the generating function of the joint probability distribution of eggs and worms can be partially solved in the appropriate limit where the worm lifetime is much greater than that of the mature eggs in the environment. Allowing for a mean field nonlinearity, and for egg immigration from neighbouring communities, a negative binomial worm distribution can be predicted, whose parameters are determined by those in the continuous Anderson-May model; this result assumes no variability in predisposition to the infection. PMID:27066982

  16. Medical image of the week: ascaris lumbridoies

    Directory of Open Access Journals (Sweden)

    Wong C

    2015-02-01

    Full Text Available No abstract available. Article truncated at 150 words. A 25 year-old man was admitted to the ICU with acute renal failure and acute respiratory failure from fluid overload after attempting to cross the border. The patient was successfully extubated after five days of mechanical ventilation and renal replacement therapy. Following extubation, the patient had a bowel movement and passed a 23cm adult Ascaris lumbricoides. He was treated with a single dose of albendazole 400 mg. Ascariasis is a very common helminthic infection, particularly in pediatric populations, and affects mostly the gastrointestinal tract. When infective eggs are swallowed by the host, larvae hatch in the GI tract. The larvae invade the GI mucosa and then are brought into the lungs via portal circulation. The larvae can then move up the tracheobronchial tree and then are swallowed into the GI tract where the mature worms form (1. While our patient had a simple gastrointestinal infection, several pulmonary complications of ascariasis ...

  17. Serum malondialdehyde level in patients infected with Ascaris lumbricoides

    Institute of Scientific and Technical Information of China (English)

    Eser Kilic; Süleyman Yazar; Recep Saraymen; Hatice Ozbilge

    2003-01-01

    AIM:The aim of the study was to investigate the changes of serum malondialdehyde level, I.e; the oxidative stress hypothesis in patients infected with Ascaris lumbricoides.METHODS: Serum malondialdehyde activity was measured in 43 patients who were positive for intestinal parasite of Ascaris lumbricoides. Scores were obtained for the positives and their age-and sex-matched 60 Ascaris lumbricoides negative healthy controls.RESULTS: The difference between malondialdehyde levels of patients infected with Ascaris lumbricoides and control group was statistically significant both for females (P<0.05)and for males (P<0.05). In the patient and control groups,no correlation was found between age and malondialdehyde levels (P>0.05) both in females and in males. In addition,no significant correlation could be found between malondialdehyde levels of both females and males for patients and control groups (P>0.05).CONCLUSION: Malondialdehyde levels clearly increase in patients infected with Ascaris lumbricoides.

  18. Paleoparasitological report on Ascaris aDNA from an ancient East Asian sample

    Directory of Open Access Journals (Sweden)

    Chang Seok Oh

    2010-03-01

    Full Text Available In this study, Ascaris DNA was extracted and sequenced from a medieval archaeological sample in Korea. While Ascaris eggs were confirmed to be of human origin by archaeological evidence, it was not possible to pinpoint the exact species due to close genetic relationships among them. Despite this shortcoming, this is the first Ascaris ancient DNA (aDNA report from a medieval Asian country and thus will expand the scope of Ascaris aDNA research.

  19. Paleoparasitological report on Ascaris aDNA from an ancient East Asian sample

    OpenAIRE

    Chang Seok Oh; Min Seo; Nam Jin Lim; Sang Jun Lee; Eun-Joo Lee; Soong Deok Lee; Dong Hoon Shin

    2010-01-01

    In this study, Ascaris DNA was extracted and sequenced from a medieval archaeological sample in Korea. While Ascaris eggs were confirmed to be of human origin by archaeological evidence, it was not possible to pinpoint the exact species due to close genetic relationships among them. Despite this shortcoming, this is the first Ascaris ancient DNA (aDNA) report from a medieval Asian country and thus will expand the scope of Ascaris aDNA research.

  20. Developing a method for quantification of Ascaris eggs on hands

    DEFF Research Database (Denmark)

    Jeandron, Aurelie; Ensink, Jeroen J. H.; Thamsborg, Stig Milan;

    In transmission of soil transmitted helminths, especially with Ascaris and Trichuris infections, the importance of hands is unclear and very limited literature exists. This is partly because of the absence of a reliable method to quantify the number of helminth eggs on hands. The aim of this study...... was to develop a method to assess the number of Ascaris eggs on hands and determine the egg recovery rate of the method. Under laboratory conditions, hands were contaminated with app. 1000 Ascaris eggs, air dried and washed in a plastic bag retaining the washing water, in order to determine recovery rates...... of eggs for two different detergents (cationic [benzethonium chloride 0.1%], anionic [7X 1% - quadrafos, glycol ether, and dioctyl sulfoccinate sodium salt]) and de-ionized water used as control. The highest recovery rate (95.6%) was achieved with a hand rinse performed with 7X 1%. Washing hands...

  1. Liver abscess caused by Ascaris lumbricoides: case report Absceso hepático por Ascaris lumbricoides: reporte de un caso

    OpenAIRE

    PINILLA Análida Elizabeth; LÓPEZ Myriam Consuelo; Orlando RICAURTE; CASTILLO Blanca; Murcia, Martha Isabel; Nicholls, Rubén Santiago; Duque, Sofía; Orozco, Luis Carlos

    2001-01-01

    A case is reported of a woman who lived in a rural area with a chronic illness that consisted of weight loss and abdominal pain in the epigastrium and upper right quadrant. The initial diagnosis was a mass in the liver, which was later, demonstrated, both by direct and histological examination, to be an abscess caused by Ascaris lumbricoides. Eggs of Ascaris lumbricoides and abundant Charcot-Leyden Crystals were found.Se presenta el caso de una mujer que vivía en zona rural con una enfermedad...

  2. Optimization of the agar-gel method for isolation of migrating Ascaris suum larvae from the liver and lungs of pigs

    DEFF Research Database (Denmark)

    Saeed, I.; Roepstorff, A.; Rasmussen, T.;

    2001-01-01

    clean suspension which reduced the sample counting time. Blending the liver for 60 sec in a commercial blender showed significantly higher larvae recovery than blending for 30 sec. Addition of gentamycin to reduce bacterial growth during incubation, glucose to increase larval motility during migration...

  3. Genetic diversity of Ascaris in southwestern Uganda

    DEFF Research Database (Denmark)

    Betson, Martha; Nejsum, Peter; Llewellyn-Hughes, Julia;

    2012-01-01

    Despite the common occurrence of ascariasis in southwestern Uganda, helminth control in the region has been limited. To gain further insights into the genetic diversity of Ascaris in this area, a parasitological survey in mothers (n=41) and children (n=74) living in two villages, Habutobere and M...

  4. Esophageal space-occupying lesion caused by Ascaris lumbricoides

    Institute of Scientific and Technical Information of China (English)

    Ping-Ping Zheng; Bing-Yuan Wang; Fei Wang; Ran Ao; Ying Wang

    2012-01-01

    Ascaris lumbricoides is the largest intestinal nematode parasite of man,which can lead to various complications because of its mobility.As the esophagus is not normal habitat of Ascaris,the report of esophageal ascariasis is rare.An old female presented with dysphagia after an intake of several red bean buns and haw jellies.The barium meal examination revealed a spherical defect in the lower esophagus.Esophageal bezoar or esophageal carcinoma was considered at the beginning.The patient fasted,and received fluid replacement treatment as well as some oral drugs such as proton pump inhibitor and sodium bicarbonate.Then upper gastrointestinal endoscopy was done to further confirm the diagnosis and found a live Ascaris lumbricoides in the gastric antrum and two in the duodenal bulb.The conclusive diagnosis was ascariasis.The esophageal space-occupying lesion might be the entangled worm bolus.Anthelmitnic treatment with mebendazole improved patient's clinical manifestations along with normalization of the radiological findings during a 2-wk follow-up.Authors report herein this rare case of Ascaris lumbricoides in the esophagus,emphasizing the importance of awareness of this parasitic infection as it often presents with different and unspecific symptoms.

  5. Ascaris lumbricoides and Ascaris suum represent the same species based on sequence analysis of mitochondrial nad5 gene%人蛔虫和猪蛔虫线粒体nad5基因的序列分析

    Institute of Scientific and Technical Information of China (English)

    吴昌义; 林瑞庆; 朱艳平; 刘国华

    2014-01-01

    以采自中国不同地方的人蛔虫与猪蛔虫为研究对象,PCR扩增其线粒体烟酰胺脱氢酶亚基V基因(nad5)的部分序列(pnad5)并进行序列测定,应用ClustalX 1.81程序对序列进行比对.结果显示:所获得的pnad5序列长度一致,均为556 bp;人蛔虫和猪蛔虫的pnad5序列差异仅为0.0%~2.6%,本研究结果支持人蛔虫与猪蛔虫是同一个种的结论.

  6. Ultrasonographic findings of ascaris in the small bowel: A case report

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Hyun Cheol; Shin, Hyeong Cheol; Kim, Hyung Hwan; Bae, Won Kyung; Kim, Il Young [Cheonan Hospital, Soonchunhyang University college of Medicine, Cheonan (Korea, Republic of); Park, Seong Jin [Bucheon Hospital, Soonchunhyang University college of Medicine, Bucheon (Korea, Republic of); Choi, Jin Soo [Keimyung University college of Medicine, Taegu (Korea, Republic of)

    2003-12-15

    Ascariasis is one of the most common helminthic disease worldwide and evoked variable clinical manifestations by the migration of worm in the alimentary and biliary tract. The ultrasonographic detection of ascaris in the small bowel is relatively difficult, and no report on the ultrasonographic findings have been published in Korea. On abdominal ultrasonography, ascaris is seen as an intraluminal tubular structure with 4 linear echogenic stripes and movement. We report a case of ascaris in the small bowel detected by abdominal ultrasonography.

  7. Ultrasonographic findings of ascaris in the small bowel: A case report

    International Nuclear Information System (INIS)

    Ascariasis is one of the most common helminthic disease worldwide and evoked variable clinical manifestations by the migration of worm in the alimentary and biliary tract. The ultrasonographic detection of ascaris in the small bowel is relatively difficult, and no report on the ultrasonographic findings have been published in Korea. On abdominal ultrasonography, ascaris is seen as an intraluminal tubular structure with 4 linear echogenic stripes and movement. We report a case of ascaris in the small bowel detected by abdominal ultrasonography.

  8. Internal Transcribed Spacer 1 (ITS1) based sequence typing reveals phylogenetically distinct Ascaris population

    OpenAIRE

    Koushik Das; Punam Chowdhury; Sandipan Ganguly

    2015-01-01

    Taxonomic differentiation among morphologically identical Ascaris species is a debatable scientific issue in the context of Ascariasis epidemiology. To explain the disease epidemiology and also the taxonomic position of different Ascaris species, genome information of infecting strains from endemic areas throughout the world is certainly crucial. Ascaris population from human has been genetically characterized based on the widely used genetic marker, internal transcribed spacer1 (ITS1). Along...

  9. Ascaris lumbricoides: To Expect the Unexpected during a Routine Colonoscopy

    OpenAIRE

    Kalyan Kanneganti; Makker, Jasbir S.; Prospere Remy

    2013-01-01

    Ascaris lumbricoides is a common nematode infecting humans worldwide with increased prevalence in tropical and subtropical areas of less developed countries. Recently, it has been estimated that over one billion individuals are infected with ascariasis worldwide with 7% in USA. Although most of these cases are due to increasing immigration and travel outside America it is worth recognizing that prevalence of ascariasis is high in southeastern parts of USA due to their temperate climate. Infec...

  10. Diagnosis of Ascaris lumbricoides infection using capsule endoscopy

    OpenAIRE

    Yamashita, Eduardo Tomohissa; Takahashi, Wagner; Kuwashima, Daniel Yuiti; Langoni, Tiago Ribeiro; Costa-Genzini, Adriana

    2013-01-01

    Ascaris lumbricoides (A. lumbricoides) is the most common intestinal roundworm parasite, infecting approximately one quarter of the world’s population. Infection can lead to various complications because it can spread along the gastrointestinal tract. Although A. lumbricoides infection is a serious healthcare issue in developing countries, it now also has a worldwide distribution as a result of increased immigration and travel. Intestinal obstruction is the most common complication of A. lumb...

  11. Dicty_cDB: VHD771 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available pfkccnlyhqsim*sth*c*rgsplklsi isii--- Frame C: SNNSSYNAKDDDDDEPGSSGNDIQKILGKERLGRILSS... (bits) Value N ED460729 |ED460729.1 AUAC-aao05g05.g1 Ascaris suum whole genome shotgun library (PMAJ_4GSS) Ascaris... suum genomic, genomic survey sequence. 50 0.069 1 ED450392 |ED450392.1 AUAC-aan56c12.g1 Ascaris suum... whole genome shotgun library (PMAJ_4 GSS) Ascaris suum genomic, genomic survey sequence. 50 0.069 1 ED39324...2 |ED393242.1 AUAC-aai25f10.g1 Ascaris suum whole genome shotgun library (PMAJ_4 GSS) Ascaris

  12. Rare cause of intestinal obstruction, Ascaris lumbricoides infestation: two case reports

    OpenAIRE

    Yetim, Ibrahim; Ozkan, Orhan Veli; Semerci, Ersan; Abanoz, Recep

    2009-01-01

    Ascaris lumbricoides is common resident of intestine especially low socioeconomic areas in the world. Complication of Ascaris lumbricoides has been reported include obstruction of the small intestine, intestinal volvulus and intussusception. We report two children with severe sequelae of intestinal obstruction.

  13. Inactivation of ascaris lumbricoides eggs by heat, radiation, and thermoradiation

    International Nuclear Information System (INIS)

    It is desirable to eliminate the public health hazards associated with land application of municipal sewage sludge as a fertilizer or soil conditioner. This report describes experimentation to determine the effects of heat, radiation, and thermoradiation on the suppression of embryonation of Ascaris lumbricoides ova, a parasite commonly found in sewage sludge. Heat effects were observed at a minimum temperature of 510C and radiation effects at doses in excess of 15 krads of radiation. Thermoradiation at 470C suppressed embryonation at less than half the total dose required by radiation alone. (U.S.)

  14. First Case of Ascaris lumbricoides Infestation Complicated with Hemophagocytic Lymphohistiocytosis.

    Science.gov (United States)

    Bayhan, Gülsüm İclal; Çenesiz, Funda; Tanır, Gönül; Taylan Özkan, Ayşegül; Çınar, Gökçe

    2015-06-01

    Ascariasis is a common soil-transmitted helminth infestation worldwide. Ascaris lumbricoides infestation is generally asymptomatic or cause nonspecific signs and symptoms. We report a 5-year-old male with hemophagocytic lymphohistiocytosis associated with A. lumbricoides infestation. The presented patient recovered completely after defecating an A. lumbricoides following intravenous immunoglobulin (IVIG) and mebendazole treatment. We wanted to emphasize that because helminth infestation is easily overlooked, the diagnosis of ascariasis should be considered in patients who live in endemic areas and treated timely to prevent severe complications. PMID:26081893

  15. Wandering ascaris coming out through the abdominal wall

    OpenAIRE

    Wani, Mohd L; Rather, Ajaz A.; Parray, Fazl Q; Ahangar, Abdul G.; Bijli, Akram H.; Ifat Irshad; Nayeem-Ul-Hassan; Khan, Tahir S.

    2013-01-01

    A rare case of ascaris coming out through the anterior abdominal wall is reported here. A 40-year-old female had undergone dilatation and curettage by a quack. On the second day she presented with presented with features of peritonitis. She was explored. Resection anastomosis of the ileum was done for multiple perforations of the ileum. Patient developed a fistula in the anterior abdominal wall which was draining bile-colored fluid. On the 12 th postoperative day a 10-cm-long worm was seen co...

  16. Accelerated larvae development of Ascaris lumbricoides eggs with ultraviolet radiation

    International Nuclear Information System (INIS)

    In order to investigate the effect of UV radiation on the development of Ascaris lumbricoides larvae, eggs were exposed to increasing UV doses. Filtered wastewater from the secondary effluent taken from the Damascus wastewater treatment plant (DWTP) was used as irradiation and incubation medium. The progressive and accelerated embryonation stages were microscopically observed and the percentages of completely developed larvae were determined weekly. Results indicated that the UV radiation accelerated the development of larvae with increasing UV dose. Preliminary information about the relationship between the UV radiation dose and rate of embryonation is also presented

  17. Accelerated larvae development of Ascaris lumbricoides eggs with ultraviolet radiation

    Science.gov (United States)

    Aladawi, M. A.; Albarodi, H.; Hammoudeh, A.; Shamma, M.; Sharabi, N.

    2006-01-01

    In order to investigate the effect of UV radiation on the development of Ascaris lumbricoides larvae, eggs were exposed to increasing UV doses. Filtered wastewater from the secondary effluent taken from the Damascus wastewater treatment plant (DWTP) was used as irradiation and incubation medium. The progressive and accelerated embryonation stages were microscopically observed and the percentages of completely developed larvae were determined weekly. Results indicated that the UV radiation accelerated the development of larvae with increasing UV dose. Preliminary information about the relationship between the UV radiation dose and rate of embryonation is also presented.

  18. Accelerated larvae development of Ascaris lumbricoides eggs with ultraviolet radiation

    Energy Technology Data Exchange (ETDEWEB)

    Aladawi, M.A. [Syrian Atomic Energy Commission, Radiation Technology Department, P.O. Box 6091, Damascus (Syrian Arab Republic)]. E-mail: Scientific@aec.org.sy; Albarodi, H. [Syrian Atomic Energy Commission, Radiation Technology Department, P.O. Box 6091, Damascus (Syrian Arab Republic); Hammoudeh, A. [Syrian Atomic Energy Commission, Radiation Technology Department, P.O. Box 6091, Damascus (Syrian Arab Republic); Shamma, M. [Syrian Atomic Energy Commission, Radiation Technology Department, P.O. Box 6091, Damascus (Syrian Arab Republic); Sharabi, N. [Syrian Atomic Energy Commission, Radiation Technology Department, P.O. Box 6091, Damascus (Syrian Arab Republic)

    2006-01-15

    In order to investigate the effect of UV radiation on the development of Ascaris lumbricoides larvae, eggs were exposed to increasing UV doses. Filtered wastewater from the secondary effluent taken from the Damascus wastewater treatment plant (DWTP) was used as irradiation and incubation medium. The progressive and accelerated embryonation stages were microscopically observed and the percentages of completely developed larvae were determined weekly. Results indicated that the UV radiation accelerated the development of larvae with increasing UV dose. Preliminary information about the relationship between the UV radiation dose and rate of embryonation is also presented.

  19. Ultrasonographic appearance of Ascaris lumbricoides in the small bowel.

    Science.gov (United States)

    Mahmood, T; Mansoor, N; Quraishy, S; Ilyas, M; Hussain, S

    2001-03-01

    Roundworm infestation, one of the most common helminthic diseases worldwide, is caused by Ascaris lumbricoides, one of the largest parasites that infests the human bowel. A lumbricoides is virtually universal at some stage of childhood in semitropical and tropical regions. This study describes our experience with the ultrasonographic appearance of intestinal ascariasis in 84 patients, 2.5 to 42 years of age, examined over 2 years beginning October 1997. The patients' conditions ranged from acute intestinal obstruction to no clinical features pertaining to obstruction. Ultrasonographic examination was performed with an Echocee power Doppler real-time unit with a variable-frequency 3.7-MHz convex, 7.5-MHz linear probe. In longitudinal section the Ascaris worm presented as a linear intraluminal mass with 3 or 4 linear echogenic interfaces; in the cross section, it was round, sometimes appearing as a "target" sign. Some worms also showed serpentine movements. Sonographic examination of the patients in the left lateral decubitus position after ingestion of water improved detection and visualization of the worms in some cases. It is concluded that A lumbricoides in the small bowel has a sonographic appearance that can be recognized by the wary observer. PMID:11270532

  20. Ancient Mitochondrial DNA Analyses of Ascaris Eggs Discovered in Coprolites from Joseon Tomb

    OpenAIRE

    Oh, Chang Seok; Seo, Min; Hong, Jong Ha; Chai, Jong-Yil; Oh, Seung Whan; Park, Jun Bum; Shin, Dong Hoon

    2015-01-01

    Analysis of ancient DNA (aDNA) extracted from Ascaris is very important for understanding the phylogenetic lineage of the parasite species. When aDNAs obtained from a Joseon tomb (SN2-19-1) coprolite in which Ascaris eggs were identified were amplified with primers for cytochrome b (cyt b) and 18S small subunit ribosomal RNA (18S rRNA) gene, the outcome exhibited Ascaris specific amplicon bands. By cloning, sequencing, and analysis of the amplified DNA, we obtained information valuable for co...

  1. Evidence for in utero sensitization to Ascaris lumbricoides in newborns of mothers with ascariasis

    OpenAIRE

    Guadalupe, Irene; Mitre, Edward; Benitez, Susana; Martha E Chico; Nutman, Thomas B.; Cooper, Philip J.

    2009-01-01

    Human infections with Ascaris lumbricoides may have important effects on allergy and susceptibility to infectious diseases that start in early life. To investigate if sensitization to Ascaris occurs in utero, we measured IFN-γ and IL-4 responses in Ascaris antigen-stimulated cord blood of newborns of infected and non-infected mothers using flow cytometry. There was evidence of elevated frequencies of IFN-γ and IL-4-expressing CD4+ T cells in newborns of infected mothers compared to those of n...

  2. Radioimmunoassay for Ascaris specific protein and its clinical approach to gastro-intestinal diseases

    International Nuclear Information System (INIS)

    In this study, we developed a reliable radioimmunoassay (RIA) method for Ascaris specific protein (ASP) and measured the serum levels in control subjects average; 5.94 +- 5.94 ng/ml) and in patients with Ascaris and a variety of gastrointestinal diseases. In all Ascaris carriers, very high concentration of ASP (average; 151.4 ng/ml) was observed. 12 out of 38 patients with ulcerative colitis showed significantly high serum levels of ASP. The high titer of ASP and the presence of antibody to ASP, previously described, may suggest the close relationship between ASP and ulcerative colitis. RIA for ASP, also provides simple method for screening the patients with Ascaris and hence may open the new field in parasitology. (author)

  3. Detection and quantification of viable Ascaris sp. and other helminth eggs in sewage sludge.

    Science.gov (United States)

    Bastos, Veridiana Karmann; Cutolo, Silvana Audra; Doria, Maria do Carmo Oliveira; Razzolini, Maria Tereza Pepe

    2013-01-01

    Some epidemiologic studies conducted in developing countries demonstrated a high incidence of enteroparasites, Ascaris sp. being the most prevalent. Therefore, the use of sewage sludge in agriculture may pose risks to human health. In order to protect public health, a Brazilian regulation has established standards regarding its use in rural areas. The objective of this study was to quantify Ascaris sp. and other helminth eggs in sewage sludge from five wastewater treatment plants from a dense metropolitan region, and also to check compliance with the law. The analysis was carried according to USEPA 2003 . A rich parasitological fauna was found, with a prevalence of the eggs of Ascaris sp. (9.55%). The samples analyzed presented a large variety of helminth eggs, and Ascaris sp. proved to be the most prevalent which put in evidence that its application poses public health concerns. PMID:23072414

  4. Ascaris worm in the intercostal drainage bag: inadvertent intercostal tube insertion into jejunum: a case report

    OpenAIRE

    Mehta Harshad; Mistry Jitendra H; Mohite Prashant N; Patra BS

    2010-01-01

    Abstract Inadvertent insertion of the intercostal tube into abdomen is not rare. It can present by different ways. In the present case an Ascaris worm crept into the intercostal drainage bag to reveal the false passage of the tube.

  5. The Half-life of Ascaris lumbricoides Prevalence in Japanese School Children

    OpenAIRE

    Wang,Da-Hong; Wang, Bing-Ling; Takaki, Jiro; Ito, Takehiko; Kurosawa,Carmen Miwa; Takigawa,Tomoko; Ogino, Keiki

    2008-01-01

    In the present study, we examined the dynamic of school-health-based parasite control and the related socio-economic influences. This is an ecological study based on data from 46 prefectures in Japan. The exponential decay of Ascaris lumbricoides prevalence was calculated by iterative least-squares method. Pearsonʼs correlation and multiple linear regression model analysis were performed to assess the associations between the prevalence of Ascaris lumbricoides in Japanese school children...

  6. Ascaris lumbricoides-Induced Acute Pancreatitis: Diagnosis during EUS for a Suspected Small Pancreatic Tumor

    OpenAIRE

    Benedetto Mangiavillano; Silvia Carrara; Maria Chiara Petrone; Paolo Giorgio Arcidiacono; Pier Alberto Testoni

    2009-01-01

    Context Ascaris lumbricoides is the second most common intestinal parasite world-wide and, although the infection can be asymptomatic, in some cases it can present with complications, such as acute pancreatitis. Case report We describe the case of a 37- year-old man, with a history of travelling in Eastern countries who presented with Ascaris lumbricoides-induced acute pancreatitis mimicking a small pancreatic cancer, diagnosed during an upper EUS. The endoscopy revealeda roundworm floating i...

  7. Ascaris and hookworm transmission in preschool children in rural Panama: role of subsistence agricultural activities.

    Science.gov (United States)

    Krause, Rachel J; Koski, Kristine G; Pons, Emérita; Sinisterra, Odalis; Scott, Marilyn E

    2016-07-01

    This longitudinal study explored whether aspects of subsistence agriculture were associated with presence and intensity of Ascaris and hookworm in preschool children in rural Panama. Questionnaires were used to collect data on household socio-demographics, child exposure to agriculture and household agricultural practices. Stool samples were collected from children (6 months-5 years) at 3 time points, with albendazole administered after each to clear infections, resulting in 1 baseline and 2 reinfection measures. A novel Agricultural Activity Index (AAI) was developed using principal components analysis to measure the intensity of household agricultural practices. Zero-inflated negative binomial regression models revealed baseline hookworm egg counts were higher if children went to the agricultural plot and if the plot was smaller. Baseline and reinfection Ascaris egg counts were higher if children went to the plot and households had higher AAI, and higher at baseline if the plot was smaller. Caregiver time in the plot was negatively associated with baseline Ascaris egg counts, but positively associated with baseline hookworm and Ascaris reinfection egg counts. Children who spent more time playing around the home were less likely to be infected with Ascaris at baseline. We conclude that preschool child exposure to subsistence agriculture increased Ascaris and hookworm intensity. PMID:27000494

  8. Obstrução nasolacrimal em criança: Ascaris lumbricoides como uma causa incomum Nasolacrimal obstruction in a child: Ascaris lumbricoides as an unusual cause

    OpenAIRE

    Ernesto Helder Palma Araújo; Sérgio Schneider Guimarães

    2000-01-01

    Este artigo descreve um caso incomum de obstrução de vias lacrimais por Ascaris lumbricoides em uma criança de 1 ano de idade e faz um breve relato de outros casos semelhantes na literatura, enfatizando a necessidade de se pensar em helmintíase como provável causa de obstrução lacrimal em crianças desnutridas que moram em áreas de alta prevalência de parasitose intestinal.This article describes an unusual case of an obstruction of the tear ducts caused by Ascaris lumbricoides in an one-year-o...

  9. The IgE response to Ascaris molecular components is associated with clinical indicators of asthma severity

    OpenAIRE

    Buendía, Emiro; Zakzuk, Josefina; Mercado, Dilia; Alvarez, Alvaro; Caraballo, Luis

    2015-01-01

    Background Asthma is a common chronic disease worldwide and Ascaris lumbricoides infection (ascariasis) is frequent in tropical regions. However, the effect of ascariasis on asthma severity has not been sufficiently explored. We sought to evaluate the influence of the IgE immune response to Ascaris extract and purified house dust mites (HDM) and Ascaris allergens on indicators of asthma severity in patients living in the tropics. Methods Asthmatic patients from Cartagena, Colombia were recrui...

  10. Presensitization to Ascaris antigens promotes induction of mite-specific IgE upon mite antigen inhalation in mice

    OpenAIRE

    Mayu Suzuki; Mutsuko Hara; Saori Ichikawa; Seiji Kamijo; Takuya Nakazawa; Hideki Hatanaka; Kazuo Akiyama; Hideoki Ogawa; Ko Okumura; Toshiro Takai

    2016-01-01

    Background: Patients with house dust mite (HDM) allergy or Ascariasis produce serum IgE specific to the antigens of HDM or nematode Ascaris, respectively. Although human IgE cross-reactivity has been reported between HDM and Ascaris antigens, it remains unclear whether it contributes to the pathogenesis of allergic diseases. We herein investigated the induction of cross-reactive antibodies and T cells in mice and effects of airway exposure to HDM antigens after preimmunization with Ascaris an...

  11. Ascaris lumbricoides: reinfection in children bearing an established worm burden

    Directory of Open Access Journals (Sweden)

    Fausto E. Lima Pereira

    1991-12-01

    Full Text Available To clarify the existance of reinfection in children bearing an established Ascaris lumbricoides infection, the authors evaluated the weight and the length of worms collected from ten cases of ascaridiasis. The worm burden was greater than 27 worms in nine cases. In seven cases the weight and the length of worms showed little variation, with unimodal distribution of values, suggesting that all the worms in each case belong to the same population, originated from a single brood infection or from successive infections over small time intervals. In three cases there was great variation in worm size indicated by the different values for the means and medians and by the high values for the standard deviation and coefficient of variation. In these three cases there was a bimodal distribution of worm's size suggesting the coexistance of two distinct populations: one, less numerous, composed of mature worms and the other, more numerous, composed ofimmature worms, in two cases, and two distinct populations of immature worms in one case. The existance of worms in different stages of maturation indicates that the less mature population was acquired when the mature worms were established in the gut. These results indicate that the reinfection with Ascaris in children bearing an established infection is not rare and resistance induced by a preexisting infection is not the rule.Para tentar esclarecer a existência de reinfecção em crianças portadoras de ascaridíase já estabelecida, foram avaliados o peso e o comprimento dos vermes colhidos em 10 casosde ascaridíase, em nove dos quais a carga parasitária foi maior do que 27 vermes. Em sete casos o peso e o comprimento dos vermes apresentaram pouca variação, com distribuição unimodal dos valores, sugerindo assim pertencerem todos a uma mesma população originada de uma única infecção ou de infecções repetidas com intervalos muito curtos. Em três casos, o peso e o comprimento dos vermes

  12. Molecular paleoparasitological diagnosis of Ascaris sp. from coprolites: new scenery of ascariasis in pre-Colombian South America times

    Directory of Open Access Journals (Sweden)

    Daniela Leles

    2008-02-01

    Full Text Available Paleoparasitological studies using microscopy showed that Ascarisand Trichuris trichiura are the human intestinal parasites most found in archaeological sites. However, in pre-Columbian South American archaeological sites, Ascaris is rare. In this work we standardized a molecular methodology for Ascaris diagnosis directly from ancient DNA retrieved from coprolites. Using cythochrome b gene (142 bp target, ancient DNA sequences were retrieved from South American samples, negative by microscopy. Moreover, the methodology applied was sensitive enough to detect ancient DNA extracted from 30 Ascaris eggs from an European coprolite. These results revealed a new scenery for the paleodistribution of Ascaris in South America.

  13. Gamma radiation effects in Ascaris sp. eggs in the treated and untreated sewage; Efeitos da irradiacao gama em ovos de Ascaris sp. presentes em esgoto bruto e tratado

    Energy Technology Data Exchange (ETDEWEB)

    Bastos, Gloria S.M.; Chernicharo, Carlos A.L.; Zerbini, Adriana M. [Minas Gerais Univ., Belo Horizonte, MG (Brazil). Dept. de Engenharia Sanitaria e Ambiental]. E-mail: gsuzanbio@yahoo.com.br; Grossi, Pablo A.; Corres, Ricardo F. [Centro de Desenvolvimento de Tecnologia Nuclear (CDTN), Belo Horizonte, MG (Brazil)

    2005-07-01

    This work evaluated the efficiency of domestic sewage disinfection. The sewage was treated in UASB reactor (upflow anaerobic sludge blanket), and the influent and affluent disinfection was promoted by gamma irradiation. To test the efficiency of disinfection, Ascaris eggs viability was analyzed undo microscopic observation in samples before and after the irradiation. The Ascaris sp. eggs were recovered from human's faeces and inoculated into sewage samples. The viability of Ascaris sp. eggs was analyzed after exposure to 0.5 KGy, 1.0 KGy, 2.5 KGy, 5.0 KGy e 10 KGy. In addition, suspended solids were analyzed in order to verify the effect of solids content to the irradiation efficiency. Preliminary results indicated that for doses lower than 1.5 KGy, the efficiency of inactivation in the affluent was higher than the influent. It was also observed that doses above of 2.5 KGy had inactivated practically 100% of eggs of Ascaris sp. in the treated and untreated sewage samples. These results suggest that gamma irradiation can be used as an efficient technique to disinfect domestic sewage. (author)

  14. Electronic structures of Ascaris trypsin inhibitor in solution

    Science.gov (United States)

    Zheng, Haoping

    2003-11-01

    The electronic structures of Ascaris trypsin inhibitor in solution are obtained by the first-principles, all-electron, ab initio calculation using the self-consistent cluster-embedding (SCCE) method. The inhibitor, made up of 62 amino acid residues with 912 atoms, has two three-dimensional solution structures: 1ata and 1atb. The calculated ground-state energy of structure 1atb is lower than that of structure 1ata by 6.12 eV. The active sites are determined and explained: only structure 1atb has a N terminal at residue ARG+31. This shows that the structure 1atb is the stable and active form of the inhibitor, which is in agreement with the experimental results. The calculation reveals that some parts of the inhibitor can be easily changed while the inhibitor’s biological activity may be kept. This kind of information may be helpful in fighting viruses such as AIDS, SARS, and flu, since these viruses have higher variability. The calculation offers an independent theoretical estimate of the precision of structure determination.

  15. Pseudoobstrucción intestinal por Ascaris lumbricoides

    Directory of Open Access Journals (Sweden)

    Alessio Garro Donini

    2015-12-01

    Full Text Available La ascariosis es una geohelmintosis, ya que el agente causal requiere de la tierra para que se forme la fase infectiva para el hombre, que en este caso la fase es el huevo larvado conteniendo la larva de segundo estadio. Es una infección producida por el nematodo Ascaris lumbricoides, uno de los parásitos descritos desde la antigüedad (Becerril, 2008. Esta parasitosis tiene gran importancia epidemiológica, pues las zonas donde se presenta con mayor frecuencia son las de gran pobreza; aquellas donde la gente acostumbra a defecar a ras del suelo, pues no tiene el recurso económico necesario para construir baños, ni dispone de agua potable. Esta parasitosis afecta a 25 a 35% de la población mundial (Biagi, 2004 (Becerril, 2008. Generalmente los pacientes infectados por este nematodo cursan asintómaticos, pero en caso contrario la sintomatología dependerá de la fase del ciclo vital en la que el parásito se encuentre pudiendo existir síntomas pulmonares o gastrointestinales, incluso en ciertas poblaciones como la pediátrica podría incluso ocasionar la muerte por múltiples mecanismos dentro de los cuales se incluyen la migración errática y/o la obstrucción intestinal (MS., 1996

  16. Internal Transcribed Spacer 1 (ITS1 based sequence typing reveals phylogenetically distinct Ascaris population

    Directory of Open Access Journals (Sweden)

    Koushik Das

    2015-01-01

    Full Text Available Taxonomic differentiation among morphologically identical Ascaris species is a debatable scientific issue in the context of Ascariasis epidemiology. To explain the disease epidemiology and also the taxonomic position of different Ascaris species, genome information of infecting strains from endemic areas throughout the world is certainly crucial. Ascaris population from human has been genetically characterized based on the widely used genetic marker, internal transcribed spacer1 (ITS1. Along with previously reported and prevalent genotype G1, 8 new sequence variants of ITS1 have been identified. Genotype G1 was significantly present among female patients aged between 10 to 15 years. Intragenic linkage disequilibrium (LD analysis at target locus within our study population has identified an incomplete LD value with potential recombination events. A separate cluster of Indian isolates with high bootstrap value indicate their distinct phylogenetic position in comparison to the global Ascaris population. Genetic shuffling through recombination could be a possible reason for high population diversity and frequent emergence of new sequence variants, identified in present and other previous studies. This study explores the genetic organization of Indian Ascaris population for the first time which certainly includes some fundamental information on the molecular epidemiology of Ascariasis.

  17. Internal Transcribed Spacer 1 (ITS1) based sequence typing reveals phylogenetically distinct Ascaris population.

    Science.gov (United States)

    Das, Koushik; Chowdhury, Punam; Ganguly, Sandipan

    2015-01-01

    Taxonomic differentiation among morphologically identical Ascaris species is a debatable scientific issue in the context of Ascariasis epidemiology. To explain the disease epidemiology and also the taxonomic position of different Ascaris species, genome information of infecting strains from endemic areas throughout the world is certainly crucial. Ascaris population from human has been genetically characterized based on the widely used genetic marker, internal transcribed spacer1 (ITS1). Along with previously reported and prevalent genotype G1, 8 new sequence variants of ITS1 have been identified. Genotype G1 was significantly present among female patients aged between 10 to 15 years. Intragenic linkage disequilibrium (LD) analysis at target locus within our study population has identified an incomplete LD value with potential recombination events. A separate cluster of Indian isolates with high bootstrap value indicate their distinct phylogenetic position in comparison to the global Ascaris population. Genetic shuffling through recombination could be a possible reason for high population diversity and frequent emergence of new sequence variants, identified in present and other previous studies. This study explores the genetic organization of Indian Ascaris population for the first time which certainly includes some fundamental information on the molecular epidemiology of Ascariasis. PMID:26504510

  18. Design and testing of fish drier system utilizing geothermal energy resource in Ie Suum, Aceh Besar

    Science.gov (United States)

    Mubarak, Amir Zaki; Maulana, M. Ilham; Syuhada, Ahmad

    2016-03-01

    In an effort to increase the value of fish produced by the community in Krueng Raya Sub-district, it has been designed and tested a fish drier system utilizing geothermal energy resource in IeSuum Village, Krueng Raya Sub-district, Aceh Besar District. The geothermal energy is in the form of hot water with the temperature range is between 86 and 86.4 °C. Based on the design consideration, it is used a terraced rack type drier system. The drier system consists of a heat exchanger, drying chamber, and a blower to blow the air. Hot water from the geothermal source is passed into the heat exchanger to increase the air temperature outside it. The air is then blown into the drying chamber. Based on the design analysis is obtained that to dry 200 kg of fish in 24 hour, it is required a drying chamber with 1m long, 1 m width and 0.4 m high, the temperature of hot water entering the exchanger is 80 °C and the temperature of the air entering the drying chamber is maintained at 60°C. The average time required to dry fish till 10% of water level is 18-20 jam. The research is then continued by developing and testing the drying system with three layer rack to put in the fish. From the experimental result is obtained that the average water temperature flows out of the chamber is in the range of 76-78 °C and the temperature in the chamber is in the range of 57-62 °C. In addition, the weight of the fish, which initially is 20 kg, becomes12 kg in average after 18 hours drying process.

  19. SjAPI, the first functionally characterized Ascaris-type protease inhibitor from animal venoms.

    Directory of Open Access Journals (Sweden)

    Zongyun Chen

    Full Text Available BACKGROUND: Serine protease inhibitors act as modulators of serine proteases, playing important roles in protecting animal toxin peptides from degradation. However, all known serine protease inhibitors discovered thus far from animal venom belong to the Kunitz-type subfamily, and whether there are other novel types of protease inhibitors in animal venom remains unclear. PRINCIPAL FINDINGS: Here, by screening scorpion venom gland cDNA libraries, we identified the first Ascaris-type animal toxin family, which contains four members: Scorpiops jendeki Ascaris-type protease inhibitor (SjAPI, Scorpiops jendeki Ascaris-type protease inhibitor 2 (SjAPI-2, Chaerilus tricostatus Ascaris-type protease inhibitor (CtAPI, and Buthus martensii Ascaris-type protease inhibitor (BmAPI. The detailed characterization of Ascaris-type peptide SjAPI from the venom gland of scorpion Scorpiops jendeki was carried out. The mature peptide of SjAPI contains 64 residues and possesses a classical Ascaris-type cysteine framework reticulated by five disulfide bridges, different from all known protease inhibitors from venomous animals. Enzyme and inhibitor reaction kinetics experiments showed that recombinant SjAPI was a dual function peptide with α-chymotrypsin- and elastase-inhibiting properties. Recombinant SjAPI inhibited α-chymotrypsin with a Ki of 97.1 nM and elastase with a Ki of 3.7 μM, respectively. Bioinformatics analyses and chimera experiments indicated that SjAPI contained the unique short side chain functional residues "AAV" and might be a useful template to produce new serine protease inhibitors. CONCLUSIONS/SIGNIFICANCE: To our knowledge, SjAPI is the first functionally characterized animal toxin peptide with an Ascaris-type fold. The structural and functional diversity of animal toxins with protease-inhibiting properties suggested that bioactive peptides from animal venom glands might be a new source of protease inhibitors, which will accelerate the

  20. Specific IgE Anti-Ascaris in Brazilian Children and Adolescents

    OpenAIRE

    Emanuel S. Sarinho; Medeiros, Décio; Silva, Almerinda; Rizzo, José Ângelo

    2010-01-01

    From an article published by our group by Medeiros et al, we discuss and review the literature on the role of serum specific anti-ascaris IgE in patients with respiratory allergies living in countries where helminthic infestations are common. Medeiros et al conducted a study using 101 patients aged 12 to 21 years with respiratory allergy. Median IgE level was 660 IU/mL. Serum specific anti-ascaris IgE was positive in 73% (74/101) of the individuals, but parasitological stool examination yield...

  1. Modelagem geoestatística da infecção por Ascaris lumbricoides Geostatistical modeling of Ascaris lumbricoides infection

    Directory of Open Access Journals (Sweden)

    Bruno de Paula Menezes Drumond Fortes

    2004-06-01

    Full Text Available O estudo tem por objetivo modelar a distribuição espacial da ocorrência de ascaríase, utilizando mapas de risco mediante técnicas de geoprocessamento e análise geoestatística. Com base no banco de dados do PAISQUA, foram selecionados 19 setores censitários do Rio de Janeiro. Foram amostradas e georreferenciadas, no centróide de seu respectivo domicílio, 1.550 crianças com idade de 1 a 9 anos. Mapas de risco de Ascaris lumbricoides foram gerados usando krigagem indicadora. Com base na validação cruzada, os valores estimados foram comparados aos observados por intermédio da curva ROC. Um modelo de semivariograma isotrópico esférico com alcance de 30m e efeito pepita de 50% foi empregado na krigagem ordinária indicadora para a construção de um mapa de probabilidade de infecção por A. lumbricoides. A acurácia global, mensurada por meio da área sob a curva ROC, mostrou-se significativa. O uso da krigagem ordinária indicadora permitiu a modelagem de mapas de risco valendo-se da amostra de uma variável indicadora. O emprego das técnicas de análise estatística espacial mostrou-se adequado na predição da ocorrência do fenômeno, não ficando restrita a delimitações político-administrativas da região.The following study intends to model the spatial distribution of ascariasis, through the use of geoprocessing and geostatistic analysis. The database used in the study was taken from the PAISQUA project, including a coproparasitologic and domiciliary survey, conducted in 19 selected census tracts of Rio de Janeiro State, Brazil, randomly selecting a group of 1,550 children aged 1 to 9 years old plotting them in their respective domicile's centroids. Risk maps of Ascaris lumbricoides were generated by indicator kriging. The estimated and observed values from the cross-validation were compared using a ROC curve. An isotropic spherical semivariogram model with a range of 30m and nugget effect of 50% was employed in ordinary

  2. Possible presence of common tyvelose-containing glycans in Trichinella L1 larvae and embryonated eggs of several nematodes

    Directory of Open Access Journals (Sweden)

    Dea-Ayuela M.A.

    2001-06-01

    Full Text Available A monoclonal antibody (mAb US4 recognising an epitope containing tyvelose within the T. spiralis L-1 muscle larvae (TSL-1 antigens was tested in western-blot against various antigenic preparations from different stages of the following nematodes: T. spiralis (L1,adult, T. muris (egg, L1, L3, adult, Ascaris suum (egg, adult, Toxocara canis (egg, adult, Anisakis simplex (L3 and Haemochus contortus (egg. Positive reaction was present in antigen preparations from L1 larvae of T. spiralis and T. muris and from embryonated eggs of T. muris, A. suum, T. canis and H. conlortus.

  3. Ascaris worm in the intercostal drainage bag: inadvertent intercostal tube insertion into jejunum: a case report

    Directory of Open Access Journals (Sweden)

    Mehta Harshad

    2010-12-01

    Full Text Available Abstract Inadvertent insertion of the intercostal tube into abdomen is not rare. It can present by different ways. In the present case an Ascaris worm crept into the intercostal drainage bag to reveal the false passage of the tube.

  4. Massive Infestation of the biliary duct for Ascaris lumbricoides: case report

    International Nuclear Information System (INIS)

    We present a case of a woman who arrived with acute cholangitis symptomatology, and was diagnosed preoperatively by ultrasound as biliary ascariasis. During surgery, we extracted 32 worms of Ascaris lumbricoides from the Gallbladder and the common bile duct. Clinical outcome was successful, with out retention of worms

  5. Gamma radiation effects in Ascaris sp. eggs in the treated and untreated sewage

    International Nuclear Information System (INIS)

    This work evaluated the efficiency of domestic sewage disinfection. The sewage was treated in UASB reactor (upflow anaerobic sludge blanket), and the influent and affluent disinfection was promoted by gamma irradiation. To test the efficiency of disinfection, Ascaris eggs viability was analyzed undo microscopic observation in samples before and after the irradiation. The Ascaris sp. eggs were recovered from human's faeces and inoculated into sewage samples. The viability of Ascaris sp. eggs was analyzed after exposure to 0.5 KGy, 1.0 KGy, 2.5 KGy, 5.0 KGy e 10 KGy. In addition, suspended solids were analyzed in order to verify the effect of solids content to the irradiation efficiency. Preliminary results indicated that for doses lower than 1.5 KGy, the efficiency of inactivation in the affluent was higher than the influent. It was also observed that doses above of 2.5 KGy had inactivated practically 100% of eggs of Ascaris sp. in the treated and untreated sewage samples. These results suggest that gamma irradiation can be used as an efficient technique to disinfect domestic sewage. (author)

  6. Enumeration of viable and non-viable larvated Ascaris eggs with quantitative PCR

    Science.gov (United States)

    Aims: The goal of the study was to further develop an incubation-qPCR method for quantifying viable Ascaris eggs. The specific objectives were to characterize the detection limit and number of template copies per egg, determine the specificity of the method, and test the method w...

  7. Successful Elimination of Ascaris lumbricoides from the Gallbladder by Conservative Medical Therapy

    OpenAIRE

    Misra, Manish Kumar; Singh, Sarabjeet; Bhagat, Tripta Sethi

    2012-01-01

    Migration of Ascaris lumbricoides into the gallbladder is rare, unlike ascariasis of the bile duct and when it does occur, treatment is generally by endoscopic or surgical extraction. We describe a case of the successful treatment of gallbladder ascariasis with conservative therapy.

  8. A Proteomic Investigation of Hepatic Resistance to Ascaris in a Murine Model.

    Science.gov (United States)

    Deslyper, Gwendoline; Colgan, Thomas J; Cooper, Andrew J R; Holland, Celia V; Carolan, James C

    2016-08-01

    The helminth Ascaris causes ascariasis in both humans and pigs. Humans, especially children, experience significant morbidity including respiratory complications, growth deficits and intestinal obstruction. Given that 800 million people worldwide are infected by Ascaris, this represents a significant global public health concern. The severity of the symptoms and associated morbidity are related to the parasite burden and not all hosts are infected equally. While the pathology of the disease has been extensively examined, our understanding of the molecular mechanisms underlying resistance and susceptibility to this nematode infection is poor. In order to investigate host differences associated with heavy and light parasite burden, an experimental murine model was developed utilising Ascaris-susceptible and -resistant mice strains, C57BL/6J and CBA/Ca, respectively, which experience differential burdens of migratory Ascaris larvae in the host lungs. Previous studies identified the liver as the site where this difference in susceptibility occurs. Using a label free quantitative proteomic approach, we analysed the hepatic proteomes of day four post infection C57BL/6J and CBA/Ca mice with and without Ascaris infection to identify proteins changes potentially linked to both resistance and susceptibility amongst the two strains, respectively. Over 3000 proteins were identified in total and clear intrinsic differences were elucidated between the two strains. These included a higher abundance of mitochondrial proteins, particularly those associated with the oxidative phosphorylation pathway and reactive oxygen species (ROS) production in the relatively resistant CBA/Ca mice. We hypothesise that the increased ROS levels associated with higher levels of mitochondrial activity results in a highly oxidative cellular environment that has a dramatic effect on the nematode's ability to successfully sustain a parasitic association with its resistant host. Under infection, both

  9. Presensitization to Ascaris antigens promotes induction of mite-specific IgE upon mite antigen inhalation in mice

    Directory of Open Access Journals (Sweden)

    Mayu Suzuki

    2016-01-01

    Conclusions: We demonstrated that the immunization of naïve mice with Ascaris antigens induced production of antibodies and differentiation of Th2 cells, which were cross-reactive to HDM antigens, and accelerated induction of serum HDM-specific IgE upon subsequent airway exposure to HDM antigens in mice. These results suggest that sensitization to HDM towards IgE-mediated allergic diseases is faster in individuals with a previous history of Ascaris infection than in those without presensitization to Ascaris.

  10. Massive infestation by Ascaris lumbricoides of the biliary tract: report of a successfully treated case Infestação maciça por Ascaris lumbricoides nas vias biliares: relato de um caso tratado com sucesso

    OpenAIRE

    Dahir Ramos de Andrade Júnior; José Abi Karam; Maria do Patrocínio Tenório Nunes Warth; Alexandre Frederico de Marca; José Jukemura; Marcel Cerqueira Cesar Machado; Antonino dos Santos Rocha

    1992-01-01

    This is a report of a 25 years old black woman from the city of São Paulo, Brazil, who developed acute obstructive cholangitis of Ascaris lumbricoides with septicemia and multiple hepatic abscesses. The patient had sickle cell trait and normal delivery 3 months ago. Massive infestation of the biliary tract by Ascaris lumbricoides was diagnosed by abdominal ultrasonography and endoscopic retrograde cholangiography. Sixty worms were removed from the common bile duct and hepatic abscesses were d...

  11. Perbandingan Kadar IL-5 dan Jumlah Eosinofil Antara Anak dan Orang Dewasa yang Terinfeksi Ascaris Lumbricoides

    Directory of Open Access Journals (Sweden)

    Darmadi ,

    2015-09-01

    Full Text Available Abstrak Ascaris lumbricoides pada umumnya menginfeksi anak, tetapi juga dapat terjadi pada orang dewasa. Respon imun hospes terhadap infeksi cacing dimulai dengan teraktifasinya Th2 dengan peningkatan yang signifikan dari IL-4, IL-5, IL-9, IL-10 dan IL-13. IL-5 yang terbentuk merangsang perkembangan dan aktivasi eosinofil. Tujuan penelitian ini adalah mengetahui perbandingan kadar IL-5 dan jumlah eosinofil antara anak dan orang dewasa yang terinfeksi oleh Ascaris lumbricoides. Telah dilakukan penelitian secara cross sectional terhadap 16 orang anak dan 16 orang dewasa yang terinfeksi Ascaris lumbricoides. Spesimen darah dan serum anak dan orang dewasa diperiksa IL-5 metode ELISA dan jumlah eosinofil metode mikroskopis. Data dianalisis dengan uji t independent dengan hasil statistik bermakna bila p<0,05. Didapatkan rerata kadar IL-5 anak 5,90±3,61 pg/ml dan 4,10±1,98 pg/ml rerata kadar IL-5 pada orang dewasa dengan nilai p=0,092 (p>0,05, sedangkan rerata jumlah eosinofil anak 14,56±7,77% dan 8,81±4,65% rerata jumlah eosinofil orang dewasa dengan nilai p=0,018 (p<0,05. Kadar IL-5 tidak berbeda signifikan antara anak dan orang dewasa, sebaliknya jumlah eosinofil terdapat perbedaan yang signifikan antara anak dan orang dewasa. Kesimpulan hasil penelitian ini ialah jumlah eosinofil anak lebih tinggi dari pada jumlah eosinofil orang dewasa yang terinfeksi Ascaris lumbricoides. Kata kunci: IL-5, jumlah eosinofil, anak, orang dewasa, infeksi Ascaris lumbricoides Abstract The infection of Ascaris lumbricides common infect children, but it also can be occurred to adult. The immune’s host respond to the worm infection begin from the activation of Th2 by the significant increasing from IL-4, IL-5, IL-9 and IL-13. IL-5 which formed stimulate the development and eosinofil’s activation. The objective of this study was to know the comparison IL-5 degree with the total of eosinofil between the child and adult who is infected by Ascaris lumbricides. The

  12. Molecular paleoparasitological diagnosis of Ascaris sp. from coprolites: new scenery of ascariasis in pre-Colombian South America times

    OpenAIRE

    Daniela Leles; Adauto Araújo; Luiz Fernando Ferreira; Ana Carolina Paulo Vicente; Alena Mayo Iñiguez

    2008-01-01

    Paleoparasitological studies using microscopy showed that Ascarisand Trichuris trichiura are the human intestinal parasites most found in archaeological sites. However, in pre-Columbian South American archaeological sites, Ascaris is rare. In this work we standardized a molecular methodology for Ascaris diagnosis directly from ancient DNA retrieved from coprolites. Using cythochrome b gene (142 bp) target, ancient DNA sequences were retrieved from South American samples, negative by microscop...

  13. Screening for Anthelminthic Activities from Extracts of Zanthoxylum Zanthoxyloides, Neocarya Macrophylla and Celosia Laxa Against Ascaris Infection in Rabbits

    OpenAIRE

    B B Barnabas; Mann, A.; T S Ogunrinola; P E Anyanwu

    2010-01-01

    Summary: Extracts of Celosia laxa, Neocarya macrophylla and Zanthoxylum zanthoxyloides leaves were screened for anthelminthic activities on Ascaris lumbricoides. Celosia laxa appeared to be more potent against A. lumbricoides with rapid recovery of weight while Z. zanthoxyloides has the lowest potency. The effects of these plant extracts on Ascaris lumbricoides suggest that they could serve as an alternative source of anthelminthic agent. Industrial relevance: Infectious diseases pose serio...

  14. Recurrent episodes of upper airway blockage associated with Ascaris lumbricoides causing cardiopulmonary arrest in a young patient

    OpenAIRE

    Husain, Shahid Javed; Zubairi, Ali Bin Sarwar; Sultan, Nabeel; Beg, Muhammad Asim; Mehraj, Vikram

    2009-01-01

    Ascaris lumbricoides (AL) is one of the most common helminthic infections of humans, affecting mainly children and malnourished individuals residing in developing countries. It is estimated the 25% of the world’s population is infected with this nematode. Infection occurs via ingestion of water and food contaminated by Ascaris eggs, causing asymptomatic infection to disease with abdominal pain, vomiting, constipation and faecal passage of worms. The present report concerns an unusual case in ...

  15. 21 CFR 520.1242d - Levamisole resinate.

    Science.gov (United States)

    2010-04-01

    ... (Ascaris suum), nodular worms (Oesophagostomum spp.), lungworms (Metastrongylus spp.), intestinal threadworms (Strongyloides ransomi), and swine kidney worms (Stephanurus dentatum). (3) Limitations. For...

  16. Determination the lethal dose of ascaris lumbricoides ova by gamma irradiation

    CERN Document Server

    Shamma, M A; Sharabi, N

    2002-01-01

    The lethal gamma irradiation dose of ascaris lumbricoides which collected from Damascus Sewage water Plant was determined. Ascaris lumbricoides ova were treated with several gamma irradiation doses with (0.1, 0.2, 0.3, 0.4,...and 1.5 KGy). No morphological changes were observed on the eggs when directly examined microscopically after irradiation. However after two weeks of incubation at 37 degree centigrade the cell contents of the eggs which irradiated with 0.5 KGy and beyond were fragmented and scattered in the whole eggs and no larvae were observed after eight weeks of incubation. It is concluded that the dose 0.5 my be considered as the dose of choice if sewage water is to be treated by gamma rays.

  17. Determination the lethal dose of ascaris lumbricoides ova by gamma irradiation

    International Nuclear Information System (INIS)

    The lethal gamma irradiation dose of ascaris lumbricoides which collected from Damascus Sewage water Plant was determined. Ascaris lumbricoides ova were treated with several gamma irradiation doses with (0.1, 0.2, 0.3, 0.4,...and 1.5 KGy). No morphological changes were observed on the eggs when directly examined microscopically after irradiation. However after two weeks of incubation at 37 degree centigrade the cell contents of the eggs which irradiated with 0.5 KGy and beyond were fragmented and scattered in the whole eggs and no larvae were observed after eight weeks of incubation. It is concluded that the dose 0.5 my be considered as the dose of choice if sewage water is to be treated by gamma rays. (author)

  18. Density-dependent effects on the weight of female Ascaris lumbricoides infections of humans and its impact on patterns of egg production

    OpenAIRE

    Basáñez María-Gloria; Anderson Roy M; Hall Andrew; Walker Martin

    2009-01-01

    Abstract Background Ascaris lumbricoides exhibits density-dependent egg production, a process which has a marked impact on both the transmission dynamics and the stability of the parasite population. Evidence suggests that the egg production of female Ascaris is also associated with the size of the worm. If worm size is mediated by density-dependent processes then the size of female worms may have a causal impact upon patterns of Ascaris egg production. Results We analyse data collected from ...

  19. IgE cross-reactivity between house dust mite allergens and Ascaris lumbricoides antigens

    OpenAIRE

    Valmonte, Gardette R.; Cauyan, Gil A.; Ramos, John Donnie A.

    2012-01-01

    Background Common antigens between intestinal parasites and environmental allergens may play a role in the modulation of allergic immune responses. There is a growing interest in investigating cross-reactivity between common helminths and dust mites affecting humans, particularly in the tropics. Objective This study examined the cross-reactivity between the human roundworm Ascaris lumbricoides (Al) and three house dust mite (HDM) species. Methods Specific serum IgE levels to HDM species Blomi...

  20. Genes on chromosomes 1 and 13 have significant effects on Ascaris infection

    OpenAIRE

    Williams-Blangero, Sarah; Vandeberg, John L; Subedi, Janardan; Aivaliotis, Mary Jo; Rai, Dev Raj; Upadhayay, Ram Prasad; Jha, Bharat; Blangero, John

    2002-01-01

    Nematode parasites show a characteristic aggregated distribution among hosts. This observation has important implications for pathogenesis, immunology, and control of these infections, but the relative roles of environment and genetics in determining these patterns have remained uncertain. This paper presents the results of the first genome scan for susceptibility to infection with roundworm (Ascaris lumbricoides). Data on 375 genetic markers were generated for each of 44...

  1. The morphological changes of Ascaris lumbricoides ova in sewage sludge water treated by gamma irradiation

    International Nuclear Information System (INIS)

    Untreated wastewater sampled from Damascus sewage water treatment plant containing nematode Ascaris lumbricoides ova were treated using gamma irradiation (doses between 1.5 and 8 kGy), immediately after irradiation the morphological and developmental status of eggs was examined microscopically. Major morphological changes of the contents of the eggs were detected. These eggs were incubated for 8 weeks, after this period no larvae 'inside the eggs' were observed. Thus the morphological changes can be used as a viable parameter

  2. The morphological changes of ascaris lumbricoides ova in sewage sludge water treated by gamma irradiation

    International Nuclear Information System (INIS)

    Untreated wastewater sampled from Damascus sewage water treatment plant containing nematode Ascaris lumbricoides ova were treated using gamma irradiation (doses between 1.5 and 8 kGy), immediately after irradiation the morphological and developmental status of eggs were examined microscopically. Major morphological changes of the contents of the eggs were detected. These eggs were incubated for 8 weeks, after this period no larvae, inside the eggs, were observed. Thus the morphological changes can be used as a viable parameter. (author)

  3. SjAPI, the First Functionally Characterized Ascaris-Type Protease Inhibitor from Animal Venoms

    OpenAIRE

    Chen, Zongyun; Wang, Bin; Hu, Jun; Yang, Weishan; Cao,Zhijian; Zhuo, Renxi; Li, Wenxin; Wu, Yingliang

    2013-01-01

    Background Serine protease inhibitors act as modulators of serine proteases, playing important roles in protecting animal toxin peptides from degradation. However, all known serine protease inhibitors discovered thus far from animal venom belong to the Kunitz-type subfamily, and whether there are other novel types of protease inhibitors in animal venom remains unclear. Principal Findings Here, by screening scorpion venom gland cDNA libraries, we identified the first Ascaris-type animal toxin ...

  4. New Allergens of Relevance in Tropical Regions: The Impact of Ascaris lumbricoides Infections

    OpenAIRE

    Caraballo, Luis; Acevedo, Nathalie

    2011-01-01

    One of the many aspects of the relationships between parasite infections and allergic diseases is the possibility that allergens from parasites enhance the TH2 responses, especially IgE production, in allergic diseases such as asthma. In this review we discuss about the allergenic composition of the nematode Ascaris lumbricoides and their potential impact on allergy sensitization and asthma pathogenesis and prevalence in populations living in the tropics and naturally exposed to both, mite al...

  5. Serologic evidence that Ascaris and Toxoplasma infections impact inflammatory responses to Helicobacter pylori in Colombians

    OpenAIRE

    Ek, Courtney; Whary, Mark T.; Ihrig, Melanie; Bravo, Luis E.; Correa, Pelayo; Fox, James G.

    2012-01-01

    Background: Helicobacter pylori-infected children from coastal Tumaco, Colombia, have more parasitism, and adults have lower gastric cancer risk compared with high-altitude Pasto/Tuquerres residents. Because helminth and Toxoplasma gondii infections alter helicobacter gastritis in rodent models, we determined whether seropositivity to Ascaris lumbricoides or T. gondii was associated with Th2-IgG1 or Th1-IgG2 responses to H. pylori. Methods: Sera (240) from the two populations were evaluate...

  6. Proteomic and Immunochemical Characterization of Glutathione Transferase as a New Allergen of the Nematode Ascaris lumbricoides

    OpenAIRE

    Nathalie Acevedo; Jens Mohr; Josefina Zakzuk; Martin Samonig; Peter Briza; Anja Erler; Anna Pomés; Huber, Christian G.; Fatima Ferreira; Luis Caraballo

    2013-01-01

    Helminth infections and allergy have evolutionary and clinical links. Infection with the nematode Ascaris lumbricoides induces IgE against several molecules including invertebrate pan-allergens. These antibodies influence the pathogenesis and diagnosis of allergy; therefore, studying parasitic and non-parasitic allergens is essential to understand both helminth immunity and allergy. Glutathione transferases (GSTs) from cockroach and house dust mites are clinically relevant allergens and compa...

  7. A Community Based Survey of the Burden of Ascaris Lumbricoides in Enugu

    OpenAIRE

    Chijioke, IR; Ilechukwu, GC; Ilechukwu, GCA; Okafor, CI; Ekejindu, IM; Sridhar, MKC

    2011-01-01

    Background: Intestinal helminthiasis is common in our environment and antihelminthic drugs are specie specific. Thus, need to identify and characterize the species cannot be overemphasized. Objective: To determine the prevalence of Ascaris Lumbricoides in Enugu Metropolis. Methods: A cross-sectional survey of 361 subjects in Enugu metropolis was carried out in this study. A single stool sample was collected for examination from the subjects, using appropriately labelled clean specimen contain...

  8. Management of biliary Ascaris lumbricoides in Kabul, Afghanistan: crossroads of advancing technology

    OpenAIRE

    Manning, Richard Gerard; Tani, Mohammad Kamal

    2009-01-01

    The case is presented of the successful removal of a dead Ascaris lumbricoides from the right hepatic duct of a middle aged woman from a rural province in Afghanistan. The case was started laparoscopically, but converted to an open procedure because of difficulty identifying the anatomic landmarks required to safely perform laparoscopic cholecystectomy. After worm removal, the common bile duct (CBD) was reconstructed with a Roux-en-Y hepaticojejunostomy. The patient was discharged on postoper...

  9. The morphological changes of Ascaris lumbricoides ova in sewage sludge water treated by gamma irradiation

    Science.gov (United States)

    Shamma, M.; Al-Adawi, M. A.

    2002-10-01

    Untreated wastewater sampled from Damascus sewage water treatment plant containing nematode Ascaris lumbricoides ova were treated using gamma irradiation (doses between 1.5 and 8 kGy), immediately after irradiation the morphological and developmental status of eggs was examined microscopically. Major morphological changes of the contents of the eggs were detected. These eggs were incubated for 8 weeks, after this period no larvae "inside the eggs" were observed. Thus the morphological changes can be used as a viable parameter.

  10. Effect of Ascaris lumbricoides infection on T helper cell type 2 in rural Egyptian children

    OpenAIRE

    Shalaby NM

    2016-01-01

    Naglaa M Shalaby,1 Nehad M Shalaby2 1Department of Parasitology, Faculty of Medicine, 2Mansoura University Children Hospital, Mansoura University, Mansoura, Egypt Abstract: Ascaris lumbricoides is a neglected parasite that induces changes in host immune response. This study is conducted to define the serum levels of tumor necrosis factor alpha (TNF-α), interleukin-4 (IL-4), and interleukin-5 (IL-5) in some Egyptian children and their relations to intensity of infection, age, and asc...

  11. Individual Predisposition, Household Clustering and Risk Factors for Human Infection with Ascaris lumbricoides: New Epidemiological Insights

    OpenAIRE

    Walker, Martin; Hall, Andrew; Basáñez, María-Gloria

    2011-01-01

    Background Much of our current understanding of the epidemiology of Ascaris lumbricoides infections in humans has been acquired by analyzing worm count data. These data are collected by treating infected individuals with anthelmintics so that worms are expelled intact from the gastrointestinal tract. Analysis of such data established that individuals are predisposed to infection with few or many worms and members of the same household tend to harbor similar numbers of worms. These effects, kn...

  12. Muscle Cramps

    Science.gov (United States)

    Muscle cramps are sudden, involuntary contractions or spasms in one or more of your muscles. They often occur after exercise or at night, ... to several minutes. It is a very common muscle problem. Muscle cramps can be caused by nerves ...

  13. Muscle Disorders

    Science.gov (United States)

    Your muscles help you move and help your body work. Different types of muscles have different jobs. There are many problems that can affect muscles. Muscle disorders can cause weakness, pain or even ...

  14. Muscle atrophy

    Science.gov (United States)

    Muscle wasting; Wasting; Atrophy of the muscles ... There are two types of muscle atrophy. Disuse atrophy occurs from a lack of physical activity. In most people, muscle atrophy is caused by not using the ...

  15. The Half-life of Ascaris lumbricoides Prevalence in Japanese School Children

    Directory of Open Access Journals (Sweden)

    Wang,Da-Hong

    2008-10-01

    Full Text Available In the present study, we examined the dynamic of school-health-based parasite control and the related socio-economic influences. This is an ecological study based on data from 46 prefectures in Japan. The exponential decay of Ascaris lumbricoides prevalence was calculated by iterative least-squares method. Pearsonʼs correlation and multiple linear regression model analysis were performed to assess the associations between the prevalence of Ascaris lumbricoides in Japanese school children and socio-economic variables such as the prefecture income per capita, the percentage of primary industry, the population density per 1 km2, the diffusion rate of population under water supply, and the percentage of upper secondary school enrollment. The results indicated that the parasite carrier rate was higher in younger students. The half-life of Ascaris lumbricoides prevalence was approximately 3 years with significant variation among prefectures. Multiple regression analyses showed that the decrease of infection in elementary and lower secondary school children had a significant positive association with primary industry and a significant negative association with prefecture income per capita. The school-health-based parasite intervention differs by prefecture and has changed over time according to the respective prefectural stage of economic development.

  16. Granulomatous peritonitis due to Ascaris lumbricoides. Case report Granulomatosis peritoneal por Ascaris lumbricoides.Presentación de un caso

    Directory of Open Access Journals (Sweden)

    Carlos Aguirre Muñoz

    2008-06-01

    the underdeveloped countries. It is related to conditions of poverty, malnutrition and poor hygiene. According to the complex life cycle of the parasite, several and different intestinal and extraintestinal complications can arise, including peritonitis. Appropriate treatment and preventive measures are very important factors to avoid deaths caused by this disease.

    We report the case of a 3 year-old girl, coming from a rural area of Colombia, who presented peritonitis by Ascaris lumbricoides, preceded by persistent diarrhea, pain and abdominal mass. She was incidentally diagnosed by means of laparotomy and peritoneal biopsy, because an intestinal lymphoma was suspected.

  1. Modelagem geoestatística da infecção por Ascaris lumbricoides

    OpenAIRE

    Bruno de Paula Menezes Drumond Fortes; Luis Iván Ortiz Valencia; Simone do Vale Ribeiro; Roberto de Andrade Medronho

    2004-01-01

    O estudo tem por objetivo modelar a distribuição espacial da ocorrência de ascaríase, utilizando mapas de risco mediante técnicas de geoprocessamento e análise geoestatística. Com base no banco de dados do PAISQUA, foram selecionados 19 setores censitários do Rio de Janeiro. Foram amostradas e georreferenciadas, no centróide de seu respectivo domicílio, 1.550 crianças com idade de 1 a 9 anos. Mapas de risco de Ascaris lumbricoides foram gerados usando krigagem indicadora. Com base na validaçã...

  2. The morphological changes of Ascaris lumbricoides ova in sewage sludge water treated by gamma irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Shamma, M. E-mail: atom@sy.net; Al-Adawi, M.A

    2002-10-01

    Untreated wastewater sampled from Damascus sewage water treatment plant containing nematode Ascaris lumbricoides ova were treated using gamma irradiation (doses between 1.5 and 8 kGy), immediately after irradiation the morphological and developmental status of eggs was examined microscopically. Major morphological changes of the contents of the eggs were detected. These eggs were incubated for 8 weeks, after this period no larvae 'inside the eggs' were observed. Thus the morphological changes can be used as a viable parameter.

  3. Possible Approach for Serodiagnosis of Ascariasis by Evaluation of Immunoglobulin G4 Response Using Ascaris lumbricoides Somatic Antigen

    OpenAIRE

    Bhattacharyya, Tanusree; Santra, Amal; Majumder, Debendra N. Guha; Chatterjee, Bishnu P.

    2001-01-01

    Somatic antigen of Ascaris lumbricoides was purified to homogeneity (molecular mass, 34 kDa) by ammonium sulfate fractionation and successive chromatographic procedures, namely, gel permeation, ion exchange, and high-performance gel permeation liquid chromatographies. The antigen showed strong binding with immunoglobulin G (IgG) in Ascaris-infested patients and was cross-reactive with IgE and IgG in patients infested with other nematodes. It reacted specifically with IgG4 (P < 0.001) in 63 As...

  4. Helmint eggs elimination performance during lammelar settling and sand filters in Beniel WWTP (Murcia, Spain)

    International Nuclear Information System (INIS)

    With this study, it was observed Ascaris suum eggs elimination yield of tertiary treatment in Beniel wastewater treatment plant (WWTP) in Murcia Region (Spain). It was inoculated a sample of Ascaris suum eggs in the treatment in maximum flow conditions and it was calculated the retention yield of the lamellar settling and sand filters. (Author) 3 refs.

  5. Helmint eggs elimination performance during lammelar settling and sand filters in Beniel WWTP (Murcia, Spain); Rendimiento en la eliminacion de huevos de helminto en la decantacion lamelar y filtracion por arena en la EDAR de Beniel (Murcia)

    Energy Technology Data Exchange (ETDEWEB)

    Simon Andreu, P. J.; Cardin Mifsut, C.; Pacheco Ballarin, S.; Martinez Muro, M. A.; Vicente Gonzalez, J. A.; Llosar Llacer, C.

    2010-07-01

    With this study, it was observed Ascaris suum eggs elimination yield of tertiary treatment in Beniel wastewater treatment plant (WWTP) in Murcia Region (Spain). It was inoculated a sample of Ascaris suum eggs in the treatment in maximum flow conditions and it was calculated the retention yield of the lamellar settling and sand filters. (Author) 3 refs.

  6. Proteomic and immunochemical characterization of glutathione transferase as a new allergen of the nematode Ascaris lumbricoides.

    Directory of Open Access Journals (Sweden)

    Nathalie Acevedo

    Full Text Available Helminth infections and allergy have evolutionary and clinical links. Infection with the nematode Ascaris lumbricoides induces IgE against several molecules including invertebrate pan-allergens. These antibodies influence the pathogenesis and diagnosis of allergy; therefore, studying parasitic and non-parasitic allergens is essential to understand both helminth immunity and allergy. Glutathione transferases (GSTs from cockroach and house dust mites are clinically relevant allergens and comparative studies between them and the GST from A. lumbricoides (GSTA are necessary to evaluate their allergenicity. We sought to analyze the allergenic potential of GSTA in connection with the IgE response to non-parasitic GSTs. IgE to purified GSTs from Ascaris (nGSTA and rGSTA, house dust mites (rDer p 8, nBlo t 8 and rBlo t 8, and cockroach (rBla g 5 was measured by ELISA in subjects from Cartagena, Colombia. Also, multidimensional proteomic approaches were used to study the extract of A. lumbricoides and investigate the existence of GST isoforms. We found that among asthmatics, the strength of IgE levels to GSTA was significantly higher than to mite and cockroach GSTs, and there was a strong positive correlation between IgE levels to these molecules. Specific IgE to GSTA was found in 13.2% of controls and 19.5% of asthmatics. In addition nGSTA induced wheal and flare in skin of sensitized asthmatics indicating that it might be of clinical relevance for some patients. Frequency and IgE levels to GSTA were higher in childhood and declined with age. At least six GST isoforms in A. lumbricoides bind human IgE. Four isoforms were the most abundant and several amino acid substitutions were found, mainly on the N-terminal domain. In conclusion, a new allergenic component of Ascaris has been discovered; it could have clinical impact in allergic patients and influence the diagnosis of mite and cockroach allergy in tropical environments.

  7. Sludge hygienization: Helminth eggs destruction by lime treatment Ascaris eggs as model

    Energy Technology Data Exchange (ETDEWEB)

    Banas, S.; Schwartzbrod, J. [Lab. de Chimie Physique et Microbiologie de l' Environnement, Nancy (France); Remy, M. [Lhoist, on behalf of the European Lime Assoication (EuLA), Bruessel (Germany); Boehm, R. [Univ. Hohenheim, Stuttgart (Germany); Verfuerden, M. [Fels-Werke GmbH, im Namen des Bundesverbandes der Deutschen Kalkindustrie (BVK), Koeln (Germany)

    2003-07-01

    Most pathogens in the raw sewage are concentrated into the sewage sludge. They can be separated into four categories: viruses, bacteria, protozoa and larger parasites such as human roundworms, tapeworms and liver flukes. Such micro-organisms can cause disease in humans, the transmission occurring in several ways e.g. by inhaling sludge aerosols or dust, by eating vegetables or fruits contaminated by sludge, drinking water contaminated by run-off or by eating meat from livestock infected by grazing pastures fertilised with sludge. The presence of helminth eggs in urban sludge may constitute a sanitary risk when used as agricultural fertiliser. To avoid any contamination, the efficiency of a certain number of sludge hygienization processes must be tested. One of these involves decontamination with quicklime. The Ascaris egg inactivation by liming with lime milk, slaked lime and quicklime is studied in a series of sludges coming from slaughterhouses. (orig.)

  8. Aspectos imunológicos na infecção por Ascaris lumbricoides

    OpenAIRE

    Vaz, Ana Catarina Rodrigues Lopes

    2014-01-01

    Dissertação para obtenção do grau de Mestre no Instituto Superior de Ciências da Saúde Egas Moniz Ascaris lumbricoides é um parasita, geo-helminta, a sua prevalência é maior em zonas quentes e húmidas, em que as condições de saneamento e higiene são precárias. É o principal responsável por parasitoses intestinais, principalmente em crianças, manifestando-se por náuseas, vómitos e dor abdominal. Em casos mais graves pode causar défice no desenvolvimento físico e cognitivo. O sistema imun...

  9. Distribuição espacial da infecção por Ascaris lumbricoides

    OpenAIRE

    Campos Mônica Rodrigues; Valencia Luis Iván Ortiz; Fortes Bruno de Paula Menezes Drumond; Braga Ricardo Cerqueira Campos; Medronho Roberto de Andrade

    2002-01-01

    OBJETIVO: Estimar áreas de risco para a ocorrência de carga parasitária produzida pelo Ascaris lumbricoides, por meio da utilização de técnicas de geoprocessamento e análise geoestatística. MÉTODOS: Foram selecionados 19 setores censitários para a realização do inquérito copro-parasitológico e domiciliar na localidade de Parque Fluminense, no município de Duque de Caxias, RJ. Foram amostradas e plotadas no centróide de seu respectivo domicílio 1.664 crianças com idade entre 1 e 9 anos. As téc...

  10. Eosinophilic cholecystitis along with pericarditis caused by Ascaris lumbricoides: A case report

    Institute of Scientific and Technical Information of China (English)

    Kosuke Kaji; Mitsuteru Kitade; Hideto Kawaratani; Masahito Uemura; Junichi Yamao; Masao Fujimoto; Akira Mitoro; Masahisa Toyohara; Motoyuki Yoshida; Hiroshi Fukui; Hitoshi Yoshiji; Masahide Yoshikawa; Masaharu Yamazaki; Yasuhide Ikenaka; Ryuichi Noguchi; Masayoshi Sawai; Masatoshi Ishikawa; Tsuyoshi Mashitani

    2007-01-01

    Although the etiology of eosinophilic cholecystitis is still obscure, the postulated causes include allergies,parasites, hypereosinophilic syndrome, and eosinophilic gastroenteritis. It is sometimes accompanied by several complications, but a simultaneous onset with pericarditis is very rares. A 28-year-old woman complained of acute right hypocondrial pain and dyspnea associated with systemic eruption. Several imaging modalities revealed acute cholecystitis and pericarditis with massive pericardial effusion. A marked peripheral blood eosinophilia was observed, and the eruption was diagnosed as urticaria. Her serum had a high titer of antibody against Ascaris lumbricoides. Treatment with albendazole drastically improved all clinical manifestations along with normalization of the imaging features and eosinophilia. We report herein a rare case of simultaneous onset of acute cholecystitis and pericarditis associated with a marked eosinophilia caused by parasitic infection.

  11. Radiographic plain film and CT findings in lipoid pneumonia in infants following aspiration of mineral oil used in the treatment of partial small bowel obstruction by Ascaris lumbricoides

    International Nuclear Information System (INIS)

    Four children developed lipoid pneumonia following ingestion of mineral oil for the treatment of partial small bowel obstruction by Ascaris lumbricoides whorl. CT of the chest showed negative Hounsfield numbers which may prove useful in diagnosis. (orig.)

  12. Radiographic plain film and CT findings in lipoid pneumonia in infants following aspiration of mineral oil used in the treatment of partial small bowel obstruction by Ascaris lumbricoides

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, G.A. de; Del Caro, S.R.; Bender Lamego, C.M.; Mercon de Vargas, P.R.; Vervloet, V.E.C.

    1985-02-01

    Four children developed lipoid pneumonia following ingestion of mineral oil for the treatment of partial small bowel obstruction by Ascaris lumbricoides whorl. CT of the chest showed negative Hounsfield numbers which may prove useful in diagnosis.

  13. Hubungan Infeksi Ascaris lumbricoides Terhadap Hasil Uji Tusuk Kulit (Skin Prick Test) dengan Alergen dari Cacing Ascaris pada Anak Sekolah Dasar Negeri 047/XI Koto Baru yang Memiliki Riwayat Atopi di Kecamatan Pesisir Bukit Kota Sungai Penuh Provinsi Jambi

    OpenAIRE

    Rachman, Faisal

    2015-01-01

    Infectious diseases, intestinal worms that are transmitted through the soil (Soil-transmitted helminthiasis) is a common infection that involves many people in the world. Estimates suggests Ascaris lumbricoides infects over one billion people. The number of most worm infections apply to sub-Saharan Africa, the Americas, China and East Asia. Prevalence of asthma and other atopic diseases in children has increased worldwide in recent years, but the reason behind the increase in prevalence is un...

  14. Ascaris lumbricoides causing infarction of the mesenteric lymph nodes and intestinal gangrene in a child: a case report

    OpenAIRE

    Bhutia, Kincho Lhasong; Dey, Subhajeet; Singh, Varun; Gupta, Amlan

    2011-01-01

    Ascaris lumbricoides or round worm infestation is quite common in the developing world. It affects all age groups but is more common in children. Most of the cases remain asymptomatic. The usual presentation is an intestinal obstruction. The physicians should be aware of this condition and consider it in the differential diagnosis when faced with such a case. The rare fatal complications include bleeding, perforation and gangrene.

  15. Multiparasitic Infection (Hydatid Cyst of the Spleen and Ascaris Lumbricoides Infestation) Mimicking an Acute Surgical Abdomen – Case Report

    OpenAIRE

    Molnar Călin; Vizitiu Alexandru; Deak Karoly; Russu Cristian; Tudor Adrian; Suciu Bogdan; Stolnicu Simona; Hulub Marius; Molnar Claudiu

    2016-01-01

    Hydatid cyst involving the spleen is a rare clinical condition (0.5-4%). We report a case of multi-parasitic infection in a 62 year old female (hydatid cyst and ascaris lumbricoides infestation), confirmed during surgery. The purpose of the paper is to emphasize on the rare association of the two parasitic infections, affecting two different organs (spleen and jejunum). The combined symptomatology of the two parasites could mimic an acute surgical abdomen.

  16. COMPARISON OF EXCRETORY SECRETORY ANTIGENS OF ASCARIS LUMBRICOLDES AND TOXOCARA CATI 2ND. STAGE LARVAE WITH BIOCHEMICAL METHODES

    OpenAIRE

    F. Maleky; Massoud, J.

    1995-01-01

    Purification of parasitic antigens is a major activity in immunoparasitology because of its application in immunodiagnosis, vaccination analysis of immunopathology, preparation of monocolomal antibody and finding out the cross reactive antigens versus specific antigens of a parasite. In this survey F2 ultrafiltration excretory secretory antigens of Ascaris lumbricoides and Toxocara cati were separated by gel chromatography on sephacryl S-200 into several antigenic and non antigenic fractions....

  17. Ascaris lumbricoides causing infarction of the mesenteric lymph nodes and intestinal gangrene in a child: a case report.

    Science.gov (United States)

    Bhutia, Kincho Lhasong; Dey, Subhajeet; Singh, Varun; Gupta, Amlan

    2011-01-01

    Ascaris lumbricoides or round worm infestation is quite common in the developing world. It affects all age groups but is more common in children. Most of the cases remain asymptomatic. The usual presentation is an intestinal obstruction. The physicians should be aware of this condition and consider it in the differential diagnosis when faced with such a case. The rare fatal complications include bleeding, perforation and gangrene. PMID:21698086

  18. Screening for Anthelminthic Activities from Extracts of Zanthoxylum Zanthoxyloides, Neocarya Macrophylla and Celosia Laxa Against Ascaris Infection in Rabbits

    Directory of Open Access Journals (Sweden)

    B B Barnabas

    2010-12-01

    Full Text Available Summary: Extracts of Celosia laxa, Neocarya macrophylla and Zanthoxylum zanthoxyloides leaves were screened for anthelminthic activities on Ascaris lumbricoides. Celosia laxa appeared to be more potent against A. lumbricoides with rapid recovery of weight while Z. zanthoxyloides has the lowest potency. The effects of these plant extracts on Ascaris lumbricoides suggest that they could serve as an alternative source of anthelminthic agent. Industrial relevance: Infectious diseases pose serious challenges to global health care delivery. Moreoever, in developing countries, the cost of orthodox medication is out of reach of the common man, especially those in rural areas. This is coupled with the adulterated drugs and emergences of drug resistant strains have led to an intensive search for natural products of higher plants, which are biologically active against parasitic infections. Many plants are used locally in traditional medicine to treat parasitic infections. Nigeria offers a rich floral diversity that are used traditionally to treat worm infections. Nigerian medicinal plants (Celosia laxa, Neocarya macrophylla, Zanthoxylum zanthoxyloides used commonly used in Bida, Niger State, Nigeria for the treatment of worm infections were screened for anthelminthic activity. The extracts exhibited varying degree of anthelminthic activities against Ascaris lumbricoides. The extract of C. laxa display potent anthelminthic property. The extract of C. laxa with pronounced activity against A. lumbricoides may contain metabolites that have pharmacologically active principles with promising anthelminthic properties. This indicates the medical potential of C. laxa in the treatment of helminthiasis.

  19. Effect of Ascaris lumbricoides infection on T helper cell type 2 in rural Egyptian children

    Directory of Open Access Journals (Sweden)

    Shalaby NM

    2016-03-01

    Full Text Available Naglaa M Shalaby,1 Nehad M Shalaby2 1Department of Parasitology, Faculty of Medicine, 2Mansoura University Children Hospital, Mansoura University, Mansoura, Egypt Abstract: Ascaris lumbricoides is a neglected parasite that induces changes in host immune response. This study is conducted to define the serum levels of tumor necrosis factor alpha (TNF-α, interleukin-4 (IL-4, and interleukin-5 (IL-5 in some Egyptian children and their relations to intensity of infection, age, and ascariasis symptoms. Stool samples were examined using formol-ether concentration and Kato-Katz thick smear techniques. Sera of 60 A. lumbricoides-infected children and 20 controls were tested by enzyme-linked immunosorbent assay. The mean sera concentrations of TNF-α, IL-4, and IL-5 were 7.41±2.5 pg/mL, 107.60±18.3 pg/mL, and 389.52±28.0 pg/mL, respectively. The controls had mean serum TNF-α 7.10±2.4 pg/mL, IL-4 25.49±2.6 pg/mL, and IL-5 88.76±22.7 pg/mL. The difference in the concentration of sera cytokines was statistically significant for IL-4 and IL-5 (P<0.01 between A. lumbricoides-infected children and controls. The intensity of infection correlated positively with IL-4 and IL-5 at r=0.959 and r=0.919, respectively. The concentrations of IL-4 and IL-5 correlated positively with the age at r=0.845 and r=0.934, respectively. Asthma and gastrointestinal tract upsets were correlated positively with IL-4 and IL-5. These data indicate that A. lumbricoides infection in our locality is associated with significantly high levels of IL-4 and IL-5.Keywords: Ascaris lumbricoides, children, rural, Egypt, IL-4, IL-5, TNF-α

  20. KETAHANAN HIDUP (VIABILITY TELUR ASCARIS LUMBRICOIDES DALAM CAIRAN OLAHAN TINJA TANGKI PENCERNA

    Directory of Open Access Journals (Sweden)

    Pinardi Hadidjaja

    2012-09-01

    Full Text Available An introduction of integrated management system for human excreta was carried out in the village of Cirimekar, Cibinong subdistrict, West Java The purpose of this study is to gain the readiness and motivation of the population in that village to participate and benefit the product of this system for fish farming and the growth of water hyacinth (Eichornia crassipes. The study was performed integratedly between several aspects namely the socio-economica, tech­nical, medical, biologicatas well as environmental, and this involved the establishment of the profile of the community, stool, sludge, effluent and fish examinations In this paper only the Viability of Ascaris lumbricoides eggs is discussed. The digestion tank seemed to work as expected, resulted in the de­generation of 423%. A lumbricoides eggs found in the tank as well as in the experimental ponds It was most probable that the death of the A. lumbricoides eggs was due to aerobic decomposition which took place in the tank giving rise to an increase of temperature which would enhance the death of the eggs

  1. Successful treatment of lipoid pneumonia associated with bowel obstruction by Ascaris lumbricoides.

    Science.gov (United States)

    Azevedo Sias, Selma; Oliveira Caetano, Regina; Dutra Comarella, Júlia; de Oliveira, Elen; Santos Ferreira, Angela; Quirico-Santos, Thereza

    2011-08-01

    Partial bowel obstruction is a serious complication of ascariasis infestation generally treated with mineral oil. This prospective study aimed to evaluate the efficacy of multiple bronchoalveolar lavages (BAL) as a therapeutic strategy for reducing lung inflammation of lipoid pneumonia associated with ascariasis. The study included five children (mean age 25 months) with partial small-bowel obstruction by Ascaris lumbricoides, who underwent diagnostic bronchoalveolar lavage for assessment of refractory pneumonia. Routine biochemical, microbiological and cytological analysis were carried out in the BAL. Protein, lactate dehydrogenase and tumor necrosis factor-alpha (TNF-α) cytokine levels were determined in the serum before and after treatment. At admission, children consistently had respiratory symptoms, altered hematological function, increased immunoglobulin E serum level and peripheral blood eosinophilia. Chest tomography showed consolidation with air bronchogram (4/4), ground-glass infiltration (3/4) and decreased attenuation in the consolidation areas (2/4). Presence of marked pleocytosis with Sudan positive foamy alveolar macrophages, high protein and lactate dehydrogenase levels in the BAL indicated presence of mixed alveolitis. One child with extensive consolidation and air bronchogram in both lungs died before treatment. Multiple bronchoalveolar lavages efficiently removed alveolar oil deposits, restored BAL cellularity, improved clinical symptoms, radiological parameters and further reduced inflammatory reaction evidenced by marked decrease of the inflammatory cytokine, TNF-α. This study presents a therapeutic strategy for management of lung complications caused by mineral oil administration to treat intestinal bowel obstruction associated with ascariasis. PMID:20026557

  2. Getting Muscles

    Science.gov (United States)

    ... Safe Health Problems Illnesses & Injuries Health Problems of Grown Ups People, Places & Things That Help Feelings Q&A ... This kind of exercise can improve muscle tone, meaning a kid's muscles will be leaner and stronger, but not really bigger. Push-ups, sit-ups, and chin-ups also help build ...

  3. SjAPI-2 is the first member of a new neurotoxin family with Ascaris-type fold and KCNQ1 inhibitory activity.

    Science.gov (United States)

    Chen, Jing; Zhang, Chuangeng; Yang, Weishan; Cao, Zhijian; Li, Wenxin; Chen, Zongyun; Wu, Yingliang

    2015-08-01

    Peptides with Ascaris-type fold are a new kind of toxins founded from venomous animals recently. Functionally, these unique toxin peptides had been identified as potent protease inhibitors, which was similar to other known Ascaris-type peptides from non-venomous animals. Whether Ascaris-type peptides from venom animals have neurotoxin activities remains unclear. Here, a scorpion toxin SjAPI-2 with Ascaris-type fold was characterized to have a neurotoxin activity, which can selectively inhibit KCNQ1 potassium channel. SjAPI-2 had 62 amino acid residues, including 10 cysteine residues. Charged residue analyses showed that two acidic residues of SjAPI-2 were regionally distributed, and 10 basic residues were distributed widely throughout the whole peptide, which was similar to classical potassium channel toxins. Pharmacological studies confirmed that SjAPI-2 was a selective KCNQ1 potassium channel inhibitor with weak effects on other potassium channels, such as Kv1.1, Kv1.2, Kv1.3, SKCa2, SKCa3, and IKCa channels. Concentration-dependent studies showed that SjAPI-2 inhibited the KCNQ1 potassium channel with an IC50 of 771.5±169.9 nM. To the best of our knowledge, SjAPI-2 is the first neurotoxin with a unique Ascaris-type fold, providing novel insights into the divergent evolution of neurotoxins from venomous animals. PMID:26014142

  4. Atividade de detergentes e desinfetantes sobre a evolução dos ovos de Ascaris lumbricoides Effects of detergents and disinfectants on the development of Ascaris lumbricoides eggs

    OpenAIRE

    Cristiano Lara Massara; Rafaela Salgado Ferreira; Luiz Dias de Andrade; Henrique Leonardo Guerra; Omar dos Santos Carvalho

    2003-01-01

    A infecção por Ascaris lumbricoides decorre da ingestão de ovos embrionados deste parasita, o que justifica a pesquisa de substâncias que tenham efeito deletério sobre estes ovos. Nosso objetivo foi estudar a ação de 16 produtos detergentes e desinfetantes, de uso doméstico e laboratorial, sobre a embriogênese deste helminto. Crianças portadoras desta infecção foram tratadas com levamisol e os vermes fêmeas expelidos foram recolhidos e dissecados, para obtenção dos ovos intra-uterinos. Os ovo...

  5. Estrategia de Ascaris lumbricoides y Trichuris trichiura para la contaminación del medio ambiente, en una zona endemica Strategy of Ascaris lumbricoides and Trichuris trichiura for the environment contamination in an endemic area

    OpenAIRE

    Gustavo Morales; Luz Arelis Pino

    1988-01-01

    La distribución de frecuencias del número de huevos por gramo de heces tanto de Ascaris lumbricoides como de Trichuris trichiura en humanos infestados en una zona endémica se corresponde con una ley binomial negativa y la disposición espacial de dichos huevos en la materia fecal, resultó ser en agregados, independientemente de que los hospedadores sean mayores o menores de 15 años. Estos resultados nos indican que solamente unos pocos hospedadores son los responsables de la mayor contaminació...

  6. Modelagem geoestatística da infecção por Ascaris lumbricoides

    Directory of Open Access Journals (Sweden)

    Fortes Bruno de Paula Menezes Drumond

    2004-01-01

    Full Text Available O estudo tem por objetivo modelar a distribuição espacial da ocorrência de ascaríase, utilizando mapas de risco mediante técnicas de geoprocessamento e análise geoestatística. Com base no banco de dados do PAISQUA, foram selecionados 19 setores censitários do Rio de Janeiro. Foram amostradas e georreferenciadas, no centróide de seu respectivo domicílio, 1.550 crianças com idade de 1 a 9 anos. Mapas de risco de Ascaris lumbricoides foram gerados usando krigagem indicadora. Com base na validação cruzada, os valores estimados foram comparados aos observados por intermédio da curva ROC. Um modelo de semivariograma isotrópico esférico com alcance de 30m e efeito pepita de 50% foi empregado na krigagem ordinária indicadora para a construção de um mapa de probabilidade de infecção por A. lumbricoides. A acurácia global, mensurada por meio da área sob a curva ROC, mostrou-se significativa. O uso da krigagem ordinária indicadora permitiu a modelagem de mapas de risco valendo-se da amostra de uma variável indicadora. O emprego das técnicas de análise estatística espacial mostrou-se adequado na predição da ocorrência do fenômeno, não ficando restrita a delimitações político-administrativas da região.

  7. Effect of Ascaris lumbricoides infection on T helper cell type 2 in rural Egyptian children.

    Science.gov (United States)

    Shalaby, Naglaa M; Shalaby, Nehad M

    2016-01-01

    Ascaris lumbricoides is a neglected parasite that induces changes in host immune response. This study is conducted to define the serum levels of tumor necrosis factor alpha (TNF-α), interleukin-4 (IL-4), and interleukin-5 (IL-5) in some Egyptian children and their relations to intensity of infection, age, and ascariasis symptoms. Stool samples were examined using formol-ether concentration and Kato-Katz thick smear techniques. Sera of 60 A. lumbricoides-infected children and 20 controls were tested by enzyme-linked immunosorbent assay. The mean sera concentrations of TNF-α, IL-4, and IL-5 were 7.41±2.5 pg/mL, 107.60±18.3 pg/mL, and 389.52±28.0 pg/mL, respectively. The controls had mean serum TNF-α 7.10±2.4 pg/mL, IL-4 25.49±2.6 pg/mL, and IL-5 88.76±22.7 pg/mL. The difference in the concentration of sera cytokines was statistically significant for IL-4 and IL-5 (Plumbricoides-infected children and controls. The intensity of infection correlated positively with IL-4 and IL-5 at r=0.959 and r=0.919, respectively. The concentrations of IL-4 and IL-5 correlated positively with the age at r=0.845 and r=0.934, respectively. Asthma and gastrointestinal tract upsets were correlated positively with IL-4 and IL-5. These data indicate that A. lumbricoides infection in our locality is associated with significantly high levels of IL-4 and IL-5. PMID:27022269

  8. Intensity of reinfection with Ascaris lumbricoides and its implications for parasite control.

    Science.gov (United States)

    Hall, A; Anwar, K S; Tomkins, A M

    1992-05-23

    Intestinal helminths are among the most common and widespread of human infections. Because it is typical to find that most worms are aggregated in a few potential hosts it has been suggested that some individuals are predisposed to heavy infections and that morbidity could be controlled by the treatment of heavily infected individuals only. We have studied the prevalence and intensity of reinfection with the intestinal nematode Ascaris lumbricoides among people living in Dhaka, Bangladesh. 880 people were treated with pyrantel pamoate three times at six month intervals, and on each occasion they collected all their stools for 48 h after treatment. Worms expelled by each subject were counted and weighed. The prevalence of infection at round 1 of treatment was 89% and the mean burden was 18.5 worms. Reinfection was rapid and at rounds 2 and 3 the prevalence was 82% and 80%, respectively, with mean burdens of 14.0 and 11.5 worms. The intensity of reinfection was not random: more subjects than expected became heavily reinfected (greater than or equal to 15 worms) and more subjects than expected remained lightly infected (less than or equal to 14 worms) (p less than 0.001). Worms were highly aggregated at each round of treatment but although just over 10% of all subjects were heavily infected at each and every round of treatment, over 60% of all subjects were heavily infected at least once. The findings show that some individuals seem to be susceptible to heavy infection whereas others are not, that deworming has a greater effect on the intensity of infection than on the prevalence, and that mass chemotherapy is likely to be a more effective means to control morbidity than is selective treatment of heavily infected individuals only. PMID:1349668

  9. Individual predisposition, household clustering and risk factors for human infection with Ascaris lumbricoides: new epidemiological insights.

    Directory of Open Access Journals (Sweden)

    Martin Walker

    Full Text Available BACKGROUND: Much of our current understanding of the epidemiology of Ascaris lumbricoides infections in humans has been acquired by analyzing worm count data. These data are collected by treating infected individuals with anthelmintics so that worms are expelled intact from the gastrointestinal tract. Analysis of such data established that individuals are predisposed to infection with few or many worms and members of the same household tend to harbor similar numbers of worms. These effects, known respectively as individual predisposition and household clustering, are considered characteristic of the epidemiology of ascariasis. The mechanisms behind these phenomena, however, remain unclear. In particular, the impact of heterogeneous individual exposures to infectious stages has not been thoroughly explored. METHODOLOGY/PRINCIPAL FINDINGS: Bayesian methods were used to fit a three-level hierarchical statistical model to A. lumbricoides worm counts derived from a three-round chemo-expulsion study carried out in Dhaka, Bangladesh. The effects of individual predisposition, household clustering and household covariates of the numbers of worms per host (worm burden were considered simultaneously. Individual predisposition was found to be of limited epidemiological significance once household clustering had been accounted for. The degree of intra-household variability among worm burdens was found to be reduced by approximately 58% when household covariates were included in the model. Covariates relating to decreased affluence and quality of housing construction were associated with a statistically significant increase in worm burden. CONCLUSIONS/SIGNIFICANCE: Heterogeneities in the exposure of individuals to infectious eggs have an important role in the epidemiology of A. lumbricoides infection. The household covariates identified as being associated with worm burden provide valuable insights into the source of these heterogeneities although above all

  10. Atividade de detergentes e desinfetantes sobre a evolução dos ovos de Ascaris lumbricoides

    OpenAIRE

    Massara Cristiano Lara; Ferreira Rafaela Salgado; Andrade Luiz Dias de; Guerra Henrique Leonardo; Carvalho Omar dos Santos

    2003-01-01

    A infecção por Ascaris lumbricoides decorre da ingestão de ovos embrionados deste parasita, o que justifica a pesquisa de substâncias que tenham efeito deletério sobre estes ovos. Nosso objetivo foi estudar a ação de 16 produtos detergentes e desinfetantes, de uso doméstico e laboratorial, sobre a embriogênese deste helminto. Crianças portadoras desta infecção foram tratadas com levamisol e os vermes fêmeas expelidos foram recolhidos e dissecados, para obtenção dos ovos intra-uterinos. Os ovo...

  11. Ascaris lumbricoides EGGS AND HUMAN-INTESTINAL PROTOZOAN CYSTS FOUND IN RIVER WATER OF ANGKE RIVER, JAKARTA

    OpenAIRE

    Lisawati Sutanto; Rizal Subahar

    2008-01-01

    Fecal contamination is a serious environmental problem at Angke River Jakarta. A cross-sectional study was conducted during April-June 2007 and the aim of the study is to assess the water quality of Angke River by detection of Ascaris lumbricoides eggs and the protozoan cysts. A total 24 L water of Angke River was collected from 8 sampling locations consisted of Kembangan/Duri Kosambi (upper reaches of river), Pesing Polgar (lower reaches of river), Teluk Gong (lower reaches of river), Pantai...

  12. The strength of the antibody response to the nematode Ascaris lumbricoides inversely correlates with levels of B-Cell Activating Factor (BAFF)

    OpenAIRE

    Bornacelly, Adriana; Mercado, Dilia; Acevedo, Nathalie; Caraballo, Luis

    2014-01-01

    Background B-Cell Activating Factor (BAFF) is a cytokine regulating antibody production. Polymorphisms in the gene encoding BAFF were associated with the antibody response to Ascaris but not to mite allergens. In the present study we evaluated the relationship between BAFF and specific antibodies against Ascaris and mites in 448 controls and 448 asthmatics. Soluble BAFF was measured by ELISA and BAFF mRNA by qPCR. Surface expression of BAFF and its receptor (BAFF-R) was analyzed by flow cytom...

  13. Estrategia de Ascaris lumbricoides y Trichuris trichiura para la contaminación del medio ambiente, en una zona endemica Strategy of Ascaris lumbricoides and Trichuris trichiura for the environment contamination in an endemic area

    Directory of Open Access Journals (Sweden)

    Gustavo Morales

    1988-06-01

    Full Text Available La distribución de frecuencias del número de huevos por gramo de heces tanto de Ascaris lumbricoides como de Trichuris trichiura en humanos infestados en una zona endémica se corresponde con una ley binomial negativa y la disposición espacial de dichos huevos en la materia fecal, resultó ser en agregados, independientemente de que los hospedadores sean mayores o menores de 15 años. Estos resultados nos indican que solamente unos pocos hospedadores son los responsables de la mayor contaminación del medio ambiente y que esos individuos no pertenecen a ningún grupo etario en particular.The distribution of frequences of the number per grame of Ascaris lumbricoides and Trichuris trichiura in the faeces of naturally infected human in endemic areas, were found following a negative binomial distribution and an overdispersal pattern, independently of the ages of hosts. These results show, that only few hosts, independently of their ages, are involved in the higher environment contamination.

  14. Serum cytokines profiles in Nigerian children withAscaris lumbricoides infection

    Institute of Scientific and Technical Information of China (English)

    Irior Dominic Osagie; Abu Maliki

    2010-01-01

    Objective:To investigate the cytokines profile in the serum of some Nigerian children with Ascaris lumbricoides (A. lumbricoides) infection and relations between the intensity of infection, age and the concentration of these cytokines.Methods: Feacal samples from consenting children were examined using formol ether concentration techniques and Kato-Katz thick smear technique. Sera of 96 children comprising 76A. lumbricoides infection and 20 controls were subjected to enzymes-linked immunosorbent assay.Results: The mean sera concentration of tumor necrosis factor alpha (TNF-α), interleukin-4 (IL-4), interleukin-5 (IL-5), interleukin-10 (IL-10) were (16.7±7.6) pg/mL, (4.6±0.8)pg/mL, (391.6±52.0) pg/mL and (181.2±30.4) pg/mL, respectively. The control subjects had the following mean serum cytokines: TNF-α(2.9±1.8) pg/m, IL-4 (4.0±0.1) pg/mL, IL-5 (125.1±50.1) pg/mL, IL-10 (74.5±54.2) pg/mL, respectively. The difference between the sera cytokines concentration of theA. lumbricoides infected children and their controls were statistically significant for TNF-α, IL- 5 and IL-10(χ2= 9.99,P< 0.05;χ2 = 137.24,P < 0.05;χ2 = 44.30,P < 0.05, respectively). The intensity of infection correlated positively with TNF-α, and IL-5 (r = 0.93 and 0.98, respectively) while IL-4 and IL- 10 correlated negatively with the intensity of infection (r = -0.62 and 0.99, respectively). TNF-α, IL-4 and IL-5 correlated positively with age (r = 0.19, 0.33 and 0. 66, respectively). The mean cytokines between those with mild and moderate infections were statistically significant for TNF-α, IL-5 and IL-10 (χ2 = 3.60, 4.52 and 5.30, respectively). The ratio of TNF-α: IL-10 was 0.092.Conclusions: Elevated IL-5, IL-10 and TNF-α found in the sera of the volunteers with Ascariasis implicates these cytokines as key mediators in the host responses toA. lumbriocoides infection in our studied area.

  15. A comparison of the efficacy of single doses of albendazole, ivermectin, and diethylcarbamazine alone or in combinations against Ascaris and Trichuris spp.

    OpenAIRE

    Belizario, V. Y.; Amarillo, M. E.; de Leon, W. U.; de los Reyes, A. E.; Bugayong, M. G.; Macatangay, B. J. C.

    2003-01-01

    OBJECTIVE: To determine the efficacy of single doses of albendazole, ivermectin and diethylcarbamazine, and of the combinations albendazole + ivermectin and albendazole + diethylcarbamazine against common intestinal helminthiases caused by Ascaris and Trichuris spp. METHODS: In a randomized, placebo-controlled trial, infected children were randomly assigned to treatment with albendazole + placebo, ivermectin + placebo, diethylcarbamazine + placebo, albendazole + ivermectin, or albendazole + d...

  16. Muscle strain (image)

    Science.gov (United States)

    A muscle strain is the stretching or tearing of muscle fibers. A muscle strain can be caused by sports, exercise, a ... something that is too heavy. Symptoms of a muscle strain include pain, tightness, swelling, tenderness, and the ...

  17. 21 CFR 558.315 - Levamisole hydrochloride (equivalent).

    Science.gov (United States)

    2010-04-01

    .... Treatment of the following gastrointestinal worms and lung worm infections; stomach worms (Haemonchus, Trichostrongylus, Ostertagia), intestinal worms (Trichostrongylus Cooperia, Nematodirus, Bunostomum.... Treatment of the following nematode infections: large roundworms (Ascaris suum), nodular...

  18. 21 CFR 520.1242f - Levamisole hydrochloride gel.

    Science.gov (United States)

    2010-04-01

    ... effective against the following nematode infections: Stomach worms (Haemonchus, Trichostrongylus, Ostertagia), intestinal worms (Trichostrongylus, Cooperia, Nematodirus, Bunostomum, Oesophagostomum), and lungworms... with the following nematodes: Large roundworms (Ascaris suum), nodular worms (Oesophagostomum...

  19. Severity of atopic dermatitis and Ascaris lumbricoides infection: an evaluation of CCR4+ and CXCR3+ helper T cell frequency

    Directory of Open Access Journals (Sweden)

    Maria Teresa Nascimento Silva

    2012-12-01

    Full Text Available INTRODUCTION: Ascaris lumbricoides-infected patients present lower prevalence of severe atopic dermatitis. METHODS: Peripheral blood of infected children with atopic dermatitis was assessed by flow cytometry of the frequency of Th1 and Th2 cells through the expression of CXCR3 and CCR4 chemokine receptors, respectively. RESULTS: Helminth-free patients with atopic dermatitis presented a high frequency of CCR4+Th2 cells. Parasitized patients with atopic dermatitis showed a lower frequency of CXCR3+Th1 cells compared to infected individuals only. CONCLUSIONS: Ascariasis modifies the blood traffic of Th2 cells in atopic dermatitis patients, while the allergic disease down-regulates the traffic of Th1 cells in parasitized patients.

  20. Crystallization and preliminary crystallographic studies of a cysteine protease inhibitor from the human nematode parasite Ascaris lumbricoides

    International Nuclear Information System (INIS)

    A recombinant cysteine protease inhibitor from the human nematode parasite A. lumbricoides has been overexpressed in E. coli, purified and crystallized. Diffraction data were collected to 2.1 Å resolution. The cysteine protease inhibitor from Ascaris lumbricoides, a roundworm that lives in the human intestine, may be involved in the suppression of human immune responses. Here, the molecular cloning, protein expression and purification, preliminary crystallization and crystallographic characterization of the cysteine protease inhibitor from A. lumbricoides are reported. The rod-shaped crystal belonged to space group C2, with unit-cell parameters a = 99.40, b = 37.52, c = 62.92 Å, β = 118.26°. The crystal diffracted to 2.1 Å resolution and contained two molecules in the asymmetric unit

  1. Muscle Loss in Elderly

    OpenAIRE

    Nikolić, Marina; Šoić Vranić, Tamara; Arbanas, Juraj; Cvijanović, Olga; Bajek, Snježana

    2010-01-01

    Aging is associated with loss of skeletal muscle mass, strength and endurance. The aim of this study was to determinate age related changes in human muscles with different function and location in the body (vastus lateralis muscle and intercostal internus muscle). Our results suggest that age related muscle atrophy affect both human skeletal muscles. Also, the results showed the increase in percentage of muscle fibers with high oxidative activity during aging.

  2. Utilização da jejunostomia para extração endoscópica de Ascaris lumbricoides da via biliar principal em paciente com doença de Caroli Use of visiting jejunostomy loopfor extracting Ascaris lumbricoides in the common bile ducts in patients with Caroli diseases

    OpenAIRE

    Leonardo Fernandes Valentim; Ary Pires de Souza; Edison Iglesias Vidal; José Geraldo Menezes; Patrícia Gomes Bittencourt Valentim

    2009-01-01

    Grumbach-Auvert disease represents a type of Obstructive Disease of the Intrahepatic Biliary Tree. We presents a case report of a patient with hepatic abscess caused by Ascaris which ascended into hepatic parenquima through hepaticojejunostomy, resolved by endoscopic extraction of it after the jejunostomy of permanent access was opened.

  3. Utilização da jejunostomia para extração endoscópica de Ascaris lumbricoides da via biliar principal em paciente com doença de Caroli Use of visiting jejunostomy loopfor extracting Ascaris lumbricoides in the common bile ducts in patients with Caroli diseases

    Directory of Open Access Journals (Sweden)

    Leonardo Fernandes Valentim

    2009-10-01

    Full Text Available Grumbach-Auvert disease represents a type of Obstructive Disease of the Intrahepatic Biliary Tree. We presents a case report of a patient with hepatic abscess caused by Ascaris which ascended into hepatic parenquima through hepaticojejunostomy, resolved by endoscopic extraction of it after the jejunostomy of permanent access was opened.

  4. Structure of Skeletal Muscle

    Science.gov (United States)

    ... and in some they are oblique. Each skeletal muscle fiber is a single cylindrical muscle cell. An individual ... made up of hundreds, or even thousands, of muscle fibers bundled together and wrapped in a connective tissue ...

  5. Extraocular muscle function testing

    Science.gov (United States)

    Extraocular muscle function testing examines the function of the eye muscles. A health care provider observes the movement of ... evaluate weakness or other problem in the extraocular muscles. These problems may result in double vision or ...

  6. Muscle strain treatment

    Science.gov (United States)

    Treatment - muscle strain ... Question: How do you treat a muscle strain ? Answer: Rest the strained muscle and apply ice for the first few days after the injury. Anti-inflammatory medicines or acetaminophen ( ...

  7. Eye muscle repair - discharge

    Science.gov (United States)

    ... Lazy eye repair - discharge; Strabismus repair - discharge; Extraocular muscle surgery - discharge ... You or your child had eye muscle repair surgery to correct eye muscle ... term for crossed eyes is strabismus. Children most often ...

  8. Ascaris lumbricoides Infection Following School-Based Deworming in Western Kenya: Assessing the Role of Pupils' School and Home Water, Sanitation, and Hygiene Exposures

    OpenAIRE

    Garn, JV; Mwandawiro, CS; Nikolay, B.; Drews-Botsch, CD; Kihara, JH; Brooker, SJ; Simiyu, EW; Okoyo, C; Freeman, MC

    2016-01-01

    Water, sanitation, and hygiene (WaSH) technologies and behaviors can prevent infection by soil-transmitted helminth species independently, but may also interact in complex ways. However, these interactions are poorly understood. The purpose of this study was to characterize how school and home WaSH exposures were associated with Ascaris lumbricoides infection and to identify relevant interactions between separate WaSH technologies and behaviors. A study was conducted among 4,404 children atte...

  9. 81 Dose Response Relationship Between Ascaris Sensitisation and Atopy and Bronchial Hyper-Responsiveness but not Allergic Diseases in Black South Africans

    OpenAIRE

    Levin, Michael; Muloiwah, Rudzani; Le Souëf, Peter; Motalah, Cassim

    2012-01-01

    Background The relationship between sensitisation to helminths and atopy, bronchial-hyperresponsiveness and allergic diseases may differ depending on many factors, including the genes of the population studied. We sought to examine this relationship in an African cohort. Methods Urban Xhosa children were tested for ascaris IgE levels, bronchial hyper-responsiveness (BHR) by methacholine challenge, atopic sensitisation (skin tests to aeroallergens) and allergic disease (asthma, eczema and rhin...

  10. Ascaris lumbricoides Infection and Its Relation to Environmental Factors in the Mbeya Region of Tanzania, a Cross-Sectional, Population-Based Study

    OpenAIRE

    Steffen Andreas Schüle; Petra Clowes; Inge Kroidl; Kowuor, Dickens O.; Anthony Nsojo; Chacha Mangu; Helene Riess; Christof Geldmacher; Rüdiger Paul Laubender; Seif Mhina; Leonard Maboko; Thomas Löscher; Michael Hoelscher; Elmar Saathoff

    2014-01-01

    BACKGROUND: With one quarter of the world population infected, the intestinal nematode Ascaris lumbricoides is one of the most common infectious agents, especially in the tropics and sub-tropics. Infection is caused by oral intake of eggs and can cause respiratory and gastrointestinal problems. To identify high risk areas for intervention, it is necessary to understand the effects of climatic, environmental and socio-demographic conditions on A. lumbricoides infection. METHODOLOGY: Cross-sect...

  11. Perbedaan Kadar Interferon Gamma dan Interleukin-10 pada Orang Dewasa Terinfeksi Ascaris Lumbricoides dengan Tidak Terinfeksi yang Diinduksi Vaksin Bacille Calmette-Guerin

    OpenAIRE

    Weni Mulyani; Nuzulia Irawati; Netti Suharti

    2016-01-01

    AbstrakKecacingan merupakan penyakit yang masih banyak di negara berkembang. Penyakit ini dapat menimbulkan gangguan gizi, pertumbuhan dan penurunan produktifitas kerja. Infeksi cacing dapat menimbulkan penurunan respon terhadap antigen sebagai akibat modified Th2 response. Vaksin BCG merupakan antigen yang dikenal sebagai penginduksi respon sel Th1. Tujuan penelitian ini adalah menentukan perbedaan kadar IFN-γ dan IL-10 antara orang dewasa terinfeksi Ascaris lumbricoides dan tidak terinfeksi...

  12. Perbedaan Kadar Interferon Gamma dan Interleukin-10 pada Orang Dewasa Terinfeksi Ascaris Lumbricoides dengan Tidak Terinfeksi yang Diinduksi Vaksin Bacille Calmette-Guerin

    OpenAIRE

    weni Mulyani; Nuzulia Irawati; Netti Suharti

    2015-01-01

    Abstrak Kecacingan merupakan penyakit yang masih banyak di negara berkembang. Infeksi cacing dapat menimbulkan penurunan respon terhadap antigen yang terjadi akibat modified Th2 response. Vaksin BCG merupakan antigen yang dikenal sebagai penginduksi respon sel Th1. Tujuan penelitian ini adalah untuk mengetahui perbedaan kadar IFN-γdan IL-10 pada orang dewasa terinfeksi Ascaris lumbricoides dengan tidak terinfeksi yang diinduksi vaksi BCG.Penelitian dilakukan di Kelurahan Muara Fajar Kecamatan...

  13. Hubungan Infeksi Cacing Ascaris Lumbricoides Dengan Indeks Massa Tubuh Pada Siswa Perempuan SD Salsabila Kecamatan Medan Marelan Kota Medan Tahun 2014

    OpenAIRE

    Simbolon, Christiani

    2015-01-01

    Cacing gelang (Ascaris lumbricoides) merupakan salah satu penyebab infeksi dengan prevalensi mencapai 60-90% di Indonesia. Cacing ini dapat mengambil sumber karbohidrat dan protein di usus sebelum diserap tubuh. Infeksi cacing banyak diderita anak sekolah dasar, yaitu sekitar 40-60%. Metode yang digunakan untuk penelitian ini adalah observasional analitik dengan studi cross-sectional. Sampel diambil dengan metode consecutive sampling pada siswa perempuan kelas I sampai kelas VI SD Salsabil...

  14. Follow-up of Ascaris lumbricoides and Trichuris trichiura infections in children living in a community treated with ivermectin at 3-monthly intervals

    OpenAIRE

    Ranque, S.; Chippaux, Jean-Philippe; Garcia, A.; Boussinesq, Michel

    2001-01-01

    Ivermectin treatment was administered every 3 months over a 1-year period (April 1993-April 1994) to the whole eligible population of a village in South Cameroon where both #Ascaris lumbricoides$ and #Trichuris trichiura$ were hyper-endemic. A parasitological stool examination was performed before each treatment. Thirty children, aged 5-15 years, were not only found egg-positive for #A. lumbricoides$ and/or #T. trichiura$ before the first treatment but were also each treated and examined in e...

  15. Atividade de detergentes e desinfetantes sobre a evolução dos ovos de Ascaris lumbricoides Effects of detergents and disinfectants on the development of Ascaris lumbricoides eggs

    Directory of Open Access Journals (Sweden)

    Cristiano Lara Massara

    2003-02-01

    Full Text Available A infecção por Ascaris lumbricoides decorre da ingestão de ovos embrionados deste parasita, o que justifica a pesquisa de substâncias que tenham efeito deletério sobre estes ovos. Nosso objetivo foi estudar a ação de 16 produtos detergentes e desinfetantes, de uso doméstico e laboratorial, sobre a embriogênese deste helminto. Crianças portadoras desta infecção foram tratadas com levamisol e os vermes fêmeas expelidos foram recolhidos e dissecados, para obtenção dos ovos intra-uterinos. Os ovos foram postos em contato com os produtos em diversas diluições e tempos, lavados e incubados a 28ºC, por 20 dias, para teste da viabilidade e determinação da porcentagem de embrionamento. Apenas um produto inibiu completamente o embrionamento dos ovos, em todos os tempos e diluições testados. Cinco produtos inibiram o embrionamento dos ovos em mais de 50%, seis inibiram o embrionamento em menos de 50% e três não tiveram efeito sobre o embrionamento dos ovos. Por outro lado, com um produto observou-se aumento da porcentagem de embrionamento dos ovos em relação aos controles.Ascaris lumbricoides infection is acquired via ingestion of embryonated eggs of the parasite, thus justifying the search for ovicidal compounds. We studied the effect of 16 household and laboratory detergents and disinfectants on the embryogenesis of this helminth. Children carrying this infection were treated with levamisole. Eliminated female worms were collected and dissected to obtain eggs from the uteri. The eggs were placed in contact with various products at different dilutions and for various periods of time. After washing, eggs were incubated at 28ºC for 20 days, for viability tests and to determine the embryonation rate. Only one product completely inhibited the embryonation of eggs at every dilution and for every time period tested. Five products inhibited more than 50% of embryonation, while six inhibited less than 50%. Three products showed no

  16. Ascaridíase das vias urinárias: um caso de penetração de Ascaris lumbricoides através do rim

    Directory of Open Access Journals (Sweden)

    Mario Caymmi Gomes

    1977-10-01

    Full Text Available Uma criança de 2 anos com desnutrição grave e infestação intestinal maciça por Ascaris lumbricoides, apresentou como complicação, documentada em necrópsia, a migração de vermes adultos para a cavidade peritonial e penetração aberrante de dois parasitos através do rim esquerdo. Os Ascaris ficaram alojados no sistema pielo-ureteral, determinando grave infecção purulenta e obstrução ureteral. Esta complicação demonstra a capacidade agressiva de vermes erráticos na cavidade peritonial, com possibilidade de perfurar mesmo uma víscera sólida. São comentados os fatores que facilitaram a migração dos vermes por aqueles órgãos.The author reports an autopsy case of a two year old child with massive intestinal ascariasis and malnutrition, presenting the migration of two adult Ascaris lumbricoides through the left kidney into the pyelo-ureteral system. As a result she developed acute pyelonephritis and ureteral obstruction. Previously the worms left the intestine into the peritoneal cavity (lesser sac through a duodenal cleft. Factors contributing to the migration of the roundworms by those pathways are discussed.

  17. Atividade de detergentes e desinfetantes sobre a evolução dos ovos de Ascaris lumbricoides

    Directory of Open Access Journals (Sweden)

    Cristiano Lara Massara

    2003-02-01

    Full Text Available A infecção por Ascaris lumbricoides decorre da ingestão de ovos embrionados deste parasita, o que justifica a pesquisa de substâncias que tenham efeito deletério sobre estes ovos. Nosso objetivo foi estudar a ação de 16 produtos detergentes e desinfetantes, de uso doméstico e laboratorial, sobre a embriogênese deste helminto. Crianças portadoras desta infecção foram tratadas com levamisol e os vermes fêmeas expelidos foram recolhidos e dissecados, para obtenção dos ovos intra-uterinos. Os ovos foram postos em contato com os produtos em diversas diluições e tempos, lavados e incubados a 28ºC, por 20 dias, para teste da viabilidade e determinação da porcentagem de embrionamento. Apenas um produto inibiu completamente o embrionamento dos ovos, em todos os tempos e diluições testados. Cinco produtos inibiram o embrionamento dos ovos em mais de 50%, seis inibiram o embrionamento em menos de 50% e três não tiveram efeito sobre o embrionamento dos ovos. Por outro lado, com um produto observou-se aumento da porcentagem de embrionamento dos ovos em relação aos controles.

  18. Atividade de detergentes e desinfetantes sobre a evolução dos ovos de Ascaris lumbricoides

    Directory of Open Access Journals (Sweden)

    Massara Cristiano Lara

    2003-01-01

    Full Text Available A infecção por Ascaris lumbricoides decorre da ingestão de ovos embrionados deste parasita, o que justifica a pesquisa de substâncias que tenham efeito deletério sobre estes ovos. Nosso objetivo foi estudar a ação de 16 produtos detergentes e desinfetantes, de uso doméstico e laboratorial, sobre a embriogênese deste helminto. Crianças portadoras desta infecção foram tratadas com levamisol e os vermes fêmeas expelidos foram recolhidos e dissecados, para obtenção dos ovos intra-uterinos. Os ovos foram postos em contato com os produtos em diversas diluições e tempos, lavados e incubados a 28masculineC, por 20 dias, para teste da viabilidade e determinação da porcentagem de embrionamento. Apenas um produto inibiu completamente o embrionamento dos ovos, em todos os tempos e diluições testados. Cinco produtos inibiram o embrionamento dos ovos em mais de 50%, seis inibiram o embrionamento em menos de 50% e três não tiveram efeito sobre o embrionamento dos ovos. Por outro lado, com um produto observou-se aumento da porcentagem de embrionamento dos ovos em relação aos controles.

  19. Infection by Ascaris lumbricoides and bronchial hyper reactivity: an outstanding association in Venezuelan school children from endemic areas.

    Science.gov (United States)

    Hagel, I; Cabrera, M; Hurtado, M A; Sanchez, P; Puccio, F; Di Prisco, M C; Palenque, M

    2007-09-01

    Asthma and other respiratory diseases have increased in the last years among Venezuelan children from helminthic endemic areas where the infection by Ascaris lumbricoides has been associated to bronchial airway inflammation in parasitized individuals. The aim of this work was to investigate the possible associations between the development of bronchial hyper reactivity and the immune response against A. lumbricoides in urban and rural children. We evaluated 470 school children from rural and urban communities. Pulmonary function tests were performed and >or=20% PC(20) changes were considered as a positive diagnostic of bronchial hyper reactivity. The prevalence and intensity of A. lumbricoides infection was determined by faecal examination. Specific serum IgE levels using a modified ELISA and skin prick tests against A. lumbricoides and the common allergen Dermatophagoides pteronyssinus were done. The number of circulating lymphocyte sub populations was determined by flow cytometry analysis. In rural children, bronchial hyper reactivity was associated with increased specific levels of anti-A. lumbricoides IgE (pallergen (p=0.003) and to an increase in the number of CD3+CD8+ (presponse against A. lumbricoides infection may be involved in the development of bronchial hyper reactivity among rural children from endemic areas and also that improved hygienic conditions in the urban environment is associated with increased responses to airborne allergens. PMID:17698018

  20. Effect of electron beam irradiation on bacterial and Ascaris ova loads and volatile organic compounds in municipal sewage sludge

    Science.gov (United States)

    Engohang-Ndong, Jean; Uribe, R. M.; Gregory, Roger; Gangoda, Mahinda; Nickelsen, Mike G.; Loar, Philip

    2015-07-01

    Wastewater treatment plants produce large amounts of biosolids that can be utilized for land applications. However, prior to their use, these biosolids must be treated to eliminate risks of infections and to reduce upsetting odors. In this study, microbiological and chemical analyzes were performed before and after treatment of sewage sludge with 3 MeV of an electron beam accelerator in a pilot processing plant. Thus, we determined that dose 4.5 kGy was required to reduce fecal coliform counts to safe levels for land applications of sludge while, 14.5 kGy was necessary to decrease Ascaris ova counts to safe levels. Furthermore, at low doses, electron beam irradiation showed little effect on the concentrations of volatile organic compounds, while some increase were recorded at high doses. The concentration of dimethyl sulfide was reduced by 50-70% at irradiation doses of 25.7 kGy and 30.7 kGy respectively. By contrast, electron beam irradiation increased dimethyl disulfide concentrations. We also showed that electron beam treatment was less energy-consuming with shorter processing times than conventional techniques used to decontaminate sludge. Hence opening new avenues for large urban agglomerations to save money and time when treating biosolids for land application.

  1. Imaging of muscle injuries

    Energy Technology Data Exchange (ETDEWEB)

    El-Khoury, G.Y. [Iowa Univ., Iowa City, IA (United States). Dept. of Radiology; Brandser, E.A. [Iowa Univ., Iowa City, IA (United States). Dept. of Radiology; Kathol, M.H. [Iowa Univ., Iowa City, IA (United States). Dept. of Radiology; Tearse, D.S. [Iowa Univ., Iowa City, IA (United States). Dept. of Orthopaedic Surgery; Callaghan, J.J. [Iowa Univ., Iowa City, IA (United States). Dept. of Orthopaedic Surgery

    1996-01-01

    Although skeletal muscle is the single largest tissue in the body, there is little written about it in the radiologic literature. Indirect muscle injuries, also called strains or tears, are common in athletics, and knowing the morphology and physiology of the muscle-tendon unit is the key to the understanding of these injuries. Eccentric muscle activation produces more tension within the muscle tan when it is activated concentrically, making it more susceptible to tearing. Injuries involving the muscle belly tend to occur near the myotendinous junction. In adolescents, the weakest link in the muscle-tendon-bone complex is the apophysis. Traditionally, plain radiography has been the main diagnostic modality for evaluation of these injuries; however, with the advent of MRI it has become much easier to diagnose injuries primarily affecting the soft tissues. This article reviews the anatomy and physiology of the muscle-tendon unit as they relate to indirect muscle injuries. Examples of common muscle injuries are illustrated. (orig.)

  2. Imaging of muscle injuries

    International Nuclear Information System (INIS)

    Although skeletal muscle is the single largest tissue in the body, there is little written about it in the radiologic literature. Indirect muscle injuries, also called strains or tears, are common in athletics, and knowing the morphology and physiology of the muscle-tendon unit is the key to the understanding of these injuries. Eccentric muscle activation produces more tension within the muscle tan when it is activated concentrically, making it more susceptible to tearing. Injuries involving the muscle belly tend to occur near the myotendinous junction. In adolescents, the weakest link in the muscle-tendon-bone complex is the apophysis. Traditionally, plain radiography has been the main diagnostic modality for evaluation of these injuries; however, with the advent of MRI it has become much easier to diagnose injuries primarily affecting the soft tissues. This article reviews the anatomy and physiology of the muscle-tendon unit as they relate to indirect muscle injuries. Examples of common muscle injuries are illustrated. (orig.)

  3. [Muscle fiber atrophy].

    Science.gov (United States)

    Nonaka, Ikuya

    2012-01-01

    Muscle fibers have been classified into two major forms of red (slow twitch) and white (fast twitch) muscles. The red muscle utilizes lipid as energy source through mitochondrial metabolism and function to sustain the position against gravity (sometimes called as antigravity muscle). Under microgravity the red muscle is selectively involved. In our unloading study by hindlimb suspension experiment on rats, the one of the representative red muscle of soleus muscle underwent rapid atrophy; they reduced their weights about 50% after 2 week-unloading. In addition, myofibrils were occasionally markedly disorganized with selective thin filament loss. Mitochondria in the degenerated area were decreased in number. The white muscle fibers in the soleus muscle had mostly transformed to the red ones. It took about 1 month to recover morphologically. The satellite cell playing a major role in muscle regeneration was not activated. There still remained unsolved what are the mechanosensors to keep muscle function under normal gravity. Dr Nikawa's group proposed that one of ubiquitin ligases, Cbl-b is activated under microgravity and induces muscle fiber degeneration. There might be many factors to induce muscle atrophy and degeneration under microgravity. Further study is necessary to explore the pathomechanism of muscle atrophy in disused and under immobility conditions. PMID:23196603

  4. A muscle stem cell for every muscle: variability of satellite cell biology among different muscle groups

    OpenAIRE

    Randolph, Matthew E.; Pavlath, Grace K.

    2015-01-01

    The human body contains approximately 640 individual skeletal muscles. Despite the fact that all of these muscles are composed of striated muscle tissue, the biology of these muscles and their associated muscle stem cell populations are quite diverse. Skeletal muscles are affected differentially by various muscular dystrophies (MDs), such that certain genetic mutations specifically alter muscle function in only a subset of muscles. Additionally, defective muscle stem cells have been implicate...

  5. Human Muscle Fiber

    Science.gov (United States)

    2003-01-01

    The stimulus of gravity affects RNA production, which helps maintain the strength of human muscles on Earth (top), as seen in this section of muscle fiber taken from an astronaut before spaceflight. Astronauts in orbit and patients on Earth fighting muscle-wasting diseases need countermeasures to prevent muscle atrophy, indicated here with white lipid droplets (bottom) in the muscle sample taken from the same astronaut after spaceflight. Kerneth Baldwin of the University of California, Irvine, is conducting research on how reducing the stimulus of gravity affects production of the RNA that the body uses as a blueprint for making muscle proteins. Muscle proteins are what give muscles their strength, so when the RNA blueprints aren't available for producing new proteins to replace old ones -- a situation that occurs in microgravity -- the muscles atrophy. When the skeletal muscle system is exposed to microgravity during spaceflight, the muscles undergo a reduced mass that translates to a reduction in strength. When this happens, muscle endurance decreases and the muscles are more prone to injury, so individuals could have problems in performing extravehicular activity [space walks] or emergency egress because their bodies are functionally compromised.

  6. [Anti-tumor effect of the whole worm extract of Ascaris lumbricoides on Lewis lung carcinoma in mice].

    Science.gov (United States)

    Yang, Xiao-Jun; Yang, Jun-Ping; Huang, Yan-Qin; Liang, Hua; Yuan, Keng

    2013-12-01

    Forty-five C57BL/6 mice were randomly divided into five groups (A-E). Group B and D served as the control group of A and C. Each mouse of group A was intraperitoneally injected with 0.1 ml whole worm extract of Ascaris lumbricoides every other day, and 10 days later injected with 0.1 ml Lewis lung carcinoma (LLC) cells at right axillary subcutaneously region. Mice of group B were injected with normal saline and then developed tumor model. Each mouse of group C was injected with 0.1 ml LLC cells, and two days later, injected with 0.1 ml whole worm extract of A. lumbricoides every other day for 5 times. After the tumor model developed, mice in group D were injected with normal saline. Group E was the negative control group. Time intervals between implantation and active growth and tumor weight were recorded. Tumor inhibition rate was calculated. The average time interval between tumor implantation and measurable tumor growth for groups A, B, C and D was (7.0 +/-1.1), (6.0 +/- 0.7), (9.0 +/- 1.2) and (7.0 +/- 0.9) days. Tumor weight of [(338.9 +/- 282.2) mg] (P inhibition rate group A [(722.2 +/- 413.5) mg] was heavier than that of group B was the highest in group C (33.3%). Tumor weight of group C [(237.8 +/- 101.8) mg] was lighter than that of group D [(356.7 +/- 176.9) mg] (P < 0.05). The results indicated that the tumor formation is affected by the whole worm extract of A. lumbricoides which may have an inhibitory effect on tumour growth. PMID:24818416

  7. Effect of electron beam irradiation on bacterial and Ascaris ova loads and volatile organic compounds in municipal sewage sludge

    International Nuclear Information System (INIS)

    Wastewater treatment plants produce large amounts of biosolids that can be utilized for land applications. However, prior to their use, these biosolids must be treated to eliminate risks of infections and to reduce upsetting odors. In this study, microbiological and chemical analyzes were performed before and after treatment of sewage sludge with 3 MeV of an electron beam accelerator in a pilot processing plant. Thus, we determined that dose 4.5 kGy was required to reduce fecal coliform counts to safe levels for land applications of sludge while, 14.5 kGy was necessary to decrease Ascaris ova counts to safe levels. Furthermore, at low doses, electron beam irradiation showed little effect on the concentrations of volatile organic compounds, while some increase were recorded at high doses. The concentration of dimethyl sulfide was reduced by 50–70% at irradiation doses of 25.7 kGy and 30.7 kGy respectively. By contrast, electron beam irradiation increased dimethyl disulfide concentrations. We also showed that electron beam treatment was less energy-consuming with shorter processing times than conventional techniques used to decontaminate sludge. Hence opening new avenues for large urban agglomerations to save money and time when treating biosolids for land application. - Highlights: • Use of electron beam irradiation for the treatment of municipal sewage sludge. • Irradiation at 4.5 kGy is required to eliminate risks of bacterial infection. • Irradiation at 14.5 kGy is required to eliminate risks of helminth infection. • Electron beam technology is not effective for controlling volatile organic compounds. • Electron beam treatment of sludge is less expensive than traditional techniques

  8. THE EFFECT OF VARIOS CHEMICALS AND TEMPERATURE IN CESTRUCTION OF THE EGGS OF ASCARIS LUMBRICOIDES: A PROGRESS REPORT

    Directory of Open Access Journals (Sweden)

    F.Arfaa

    1978-11-01

    Full Text Available Infestation of soil and night-soil with the eggs or larvae of soil-transmitted helminthes is very important factor in the transmission of these infections. The effect of various temperatures and different chemicals on the development of larva inside the eggs of Ascaris, which is the most resistant eggs or larvae of helminthes, or destruction of developed larvae inside the eggs has been evaluated by infecting white mice or by direct observations. In eggs with developed larva, temperature of 600C for one hour kills all larvae while in lower temperature, 40% or more larvae are still alive. In a temperature of 600C for 15 and 20 minutes no larvae is found in the liver of mice. Of levamisole, thiabendazole, mebendazole, sodium-nitrite and calcium superphophate, thiabendazole and mebendazole have higher effect in destruction of eggs. In eggs with undeveloped larva, it was shown that in a temperature of 600C for 15 minutes or more, development of larva does not take place, while in lower temperature development of larva in some eggs takes place. In a temperature of 700C for 10 minutes no development of larva has been observed. Evaluation of the effect of levamisole, thiabendazole, mebendazole, urea, iodine and potassium dichromate has shown that mebendazole with a concentration of 1/100,000 or more inhibit the development of larvae. Other chemicals have some effects on the development of larvae. Results of previous investigations have shown that although many chemicals are effective in the laboratory conditions, they are not very effective when used in the field. Therefore, more studies on this subject in the field are necessary, in order to find application of this control method.

  9. Trickle or clumped infection process? A stochastic model for the infection process of the parasitic roundworm of humans, Ascaris lumbricoides.

    Science.gov (United States)

    Walker, Martin; Hall, Andrew; Basáñez, María-Gloria

    2010-10-01

    The importance of the mode of acquisition of infectious stages of directly-transmitted parasitic helminths has been acknowledged in population dynamics models; hosts may acquire eggs/larvae singly in a "trickle" type manner or in "clumps". Such models have shown that the mode of acquisition influences the distribution and dynamics of parasite loads, the stability of host-parasite systems and the rate of emergence of anthelmintic resistance, yet very few field studies have allowed these questions to be explored with empirical data. We have analysed individual worm weight data for the parasitic roundworm of humans, Ascaris lumbricoides, collected from a three-round chemo-expulsion study in Dhaka, Bangladesh, with the aim of discerning whether a trickle or a clumped infection process predominates. We found that hosts tend to harbour female worms of a similar weight, indicative of a clumped infection process, but acknowledged that unmeasured host heterogeneities (random effects) could not be completely excluded as a cause. Here, we complement our previous statistical analyses using a stochastic infection model to simulate sizes of individual A. lumbricoides infecting a population of humans. We use the intraclass correlation coefficient (ICC) as a quantitative measure of similarity among simulated worm sizes and explore the behaviour of this statistic under assumptions corresponding to trickle or clumped infections and unmeasured host heterogeneities. We confirm that both mechanisms are capable of generating aggregates of similar-sized worms, but that the particular pattern of ICCs described pre- and post-anthelmintic treatment in the data is more consistent with aggregation generated by clumped infections than by host heterogeneities alone. This provides support to the notion that worms may be acquired in clumps. We discuss our results in terms of the population biology of A. lumbricoides and highlight the significance of our modelling approach for the study of the

  10. Prevalência e intensidade de infecção por Ascaris lumbricoides em amostra populacional urbana (São Paulo, SP)

    OpenAIRE

    Cláudio Santos Ferreira; Marcelo Urbano Ferreira; Marcos Roberto Nogueira

    1991-01-01

    Pesquisaram-se ovos de Ascaris lumbricoides em amostras fecais de 407 moradores (8,87% do total) de uma favela da cidade de São Paulo. Realizaram-se exames qualitativos (sedimentação por gravidade) e quantitativos (técnica de Kato & Miura adaptada a contagens). Discutem-se aspectos diferenciais da epidemiologia da ascaríase em áreas urbanas e rurais, com base em dados deste estudo e da literatura. Salienta-se a importância, em epidemiologia, da quantificação de exames de fezes.Prevalence and ...

  11. Muscles of the Trunk

    Science.gov (United States)

    ... four muscle pairs, arranged in layers, and the fascia that envelops them. The abdominal wall muscles are ... formed by two muscular sheets and their associated fascia. « Previous (Head and Neck) Next (Upper Extremity) » Contact ...

  12. Healthy Muscles Matter

    Science.gov (United States)

    ... body? These muscles help you move, lift things, pump blood through your body, and even help you breathe. ... is a specialized type of involuntary muscle. It pumps blood through your body, changing its speed to keep ...

  13. Oxidative metabolism in muscle.

    OpenAIRE

    Ferrari, M; Binzoni, T.; Quaresima, V.

    1997-01-01

    Oxidative metabolism is the dominant source of energy for skeletal muscle. Near-infrared spectroscopy allows the non-invasive measurement of local oxygenation, blood flow and oxygen consumption. Although several muscle studies have been made using various near-infrared optical techniques, it is still difficult to interpret the local muscle metabolism properly. The main findings of near-infrared spectroscopy muscle studies in human physiology and clinical medicine are summarized. The advantage...

  14. Muscle Session Summary

    Science.gov (United States)

    Baldwin, Kenneth; Feeback, Daniel

    1999-01-01

    Presentations from the assembled group of investigators involved in specific research projeects related to skeletal muscle in space flight can categorized in thematic subtopics: regulation of contractile protein phenotypes, muscle growth and atrophy, muscle structure: injury, recovery,and regeneration, metabolism and fatigue, and motor control and loading factors.

  15. A muscle stem cell for every muscle: variability of satellite cell biology among different muscle groups

    Directory of Open Access Journals (Sweden)

    Matthew Emerson Randolph

    2015-10-01

    Full Text Available The human body contains approximately 640 individual skeletal muscles. Despite the fact that all of these muscles are composed of striated muscle tissue, the biology of these muscles and their associated muscle stem cell populations are quite diverse. Skeletal muscles are affected differentially by various muscular dystrophies, such that certain genetic mutations specifically alter muscle function in only a subset of muscles. Additionally, defective muscle stem cells have been implicated in the pathology of some muscular dystrophies. The biology of muscle stem cells varies depending on their embryologic origins and the muscles with which they are associated. Here we review the biology of skeletal muscle stem cell populations of eight different muscle groups. Understanding the biological variation of skeletal muscles and their resident stem cells could provide valuable insight into mechanisms underlying the susceptibility of certain muscles to myopathic disease.

  16. Right sternalis muscle

    Directory of Open Access Journals (Sweden)

    Jetti R

    2009-03-01

    Full Text Available Knowledge regarding the muscular variations of the chest and their identification for the proper dissection planes through radiological examination is important. Sternalis is an occasional muscle, which lies along the side of the sternum. It may be confused as a tumor. The existence of sternalis muscle, its location, orientation and early identification are necessary in breast surgeries. Presence of sternalis muscle adjacent to the breast is of clinical importance.

  17. Observação in vitro da ação dos isolados fúngicos Duddingtonia flagrans, Monacrosporium thaumasium e Verticillium chlamydosporium sobre ovos de Ascaris lumbricoides (Lineu, 1758) In vitro observation of the action of isolates of the fungi Duddingtonia flagrans, Monacrosporium thaumasium and Verticillium chlamydosporium on the eggs of Ascaris lumbricoides (Linnaeus, 1758)

    OpenAIRE

    Fábio R. Braga; Jackson V. Araújo; Artur K. Campos; Rogério O. Carvalho; André R. Silva; Alexandre O. Tavela; Alessandro S. Maciel

    2007-01-01

    Observou-se a ação in vitro dos fungos nematófagos Duddingtonia flagrans, Monacrosporium thaumasium e Verticillium chlamydosporium sobre ovos de Ascaris lumbricoides. Após sete, dez e quatorze dias de interação, o fungo promissor a ser utilizado no controle biológico de Asaris lumbricoides foi o Verticillium chlamydosporium (26-30%). Os outros fungos não foram satisfatórios.The in vitro action of the nematophagous fungi Duddingtonia flagrans, Monacrosporium thaumasium and Verticillium chlamyd...

  18. DIMINISHED FATIGUE AT REDUCED MUSCLE LENGTH IN HUMAN SKELETAL MUSCLE

    OpenAIRE

    Lee, Samuel C. K.; Braim, Anthony; Becker, Cara N.; Prosser, Laura A.; Tokay, Ann M.; Binder-Macleod, Stuart A.

    2007-01-01

    Understanding muscle fatigue properties at different muscle lengths is essential to improve electrical stimulation applications in which impaired muscle is activated to produce function or to serve as an orthotic assist. This study examined the effects of muscle length on fatigue in human quadriceps muscle. Twelve healthy subjects were tested at short and long muscle lengths (15° and 90° of knee flexion, respectively) before and after a fatigue-producing protocol using low-, high-, and variab...

  19. Ischemia causes muscle fatigue

    Science.gov (United States)

    Murthy, G.; Hargens, A. R.; Lehman, S.; Rempel, D. M.

    2001-01-01

    The purpose of this investigation was to determine whether ischemia, which reduces oxygenation in the extensor carpi radialis (ECR) muscle, causes a reduction in muscle force production. In eight subjects, muscle oxygenation (TO2) of the right ECR was measured noninvasively and continuously using near infrared spectroscopy (NIRS) while muscle twitch force was elicited by transcutaneous electrical stimulation (1 Hz, 0.1 ms). Baseline measurements of blood volume, muscle oxygenation and twitch force were recorded continuously, then a tourniquet on the upper arm was inflated to one of five different pressure levels: 20, 40, 60 mm Hg (randomized order) and diastolic (69 +/- 9.8 mm Hg) and systolic (106 +/- 12.8 mm Hg) blood pressures. Each pressure level was maintained for 3-5 min, and was followed by a recovery period sufficient to allow measurements to return to baseline. For each respective tourniquet pressure level, mean TO2 decreased from resting baseline (100% TO2) to 99 +/- 1.2% (SEM), 96 +/- 1.9%, 93 +/- 2.8%, 90 +/- 2.5%, and 86 +/- 2.7%, and mean twitch force decreased from resting baseline (100% force) to 99 +/- 0.7% (SEM), 96 +/- 2.7%, 93 +/- 3.1%, 88 +/- 3.2%, and 86 +/- 2.6%. Muscle oxygenation and twitch force at 60 mm Hg tourniquet compression and above were significantly lower (P forearm extensor muscle. Thus, ischemia associated with a modest decline in TO2 causes muscle fatigue.

  20. Muscle contraction and force

    DEFF Research Database (Denmark)

    Brüggemann, Dagmar Adeline; Risbo, Jens; Pierzynowski, Stefan G.;

    2008-01-01

    Muscle contraction studies often focus solely on myofibres and the proteins known to be involved in the processes of sarcomere shortening and cross-bridge cycling, but skeletal muscle also comprises a very elaborate ancillary network of capillaries, which not only play a vital role in terms of...

  1. SMOOTH MUSCLE STEM CELLS

    Science.gov (United States)

    Vascular smooth muscle cells (SMCs) originate from multiple types of progenitor cells. In the embryo, the most well-studied SMC progenitor is the cardiac neural crest stem cell. Smooth muscle differentiation in the neural crest lineage is controlled by a combination of cell intrinsic factors, includ...

  2. Muscle phosphorylase kinase deficiency

    DEFF Research Database (Denmark)

    Preisler, N; Orngreen, M C; Echaniz-Laguna, A; Laforet, P; Lonsdorfer-Wolf, E; Doutreleau, S; Geny, B; Akman, H O; Dimauro, S; Vissing, J

    2012-01-01

    To examine metabolism during exercise in 2 patients with muscle phosphorylase kinase (PHK) deficiency and to further define the phenotype of this rare glycogen storage disease (GSD).......To examine metabolism during exercise in 2 patients with muscle phosphorylase kinase (PHK) deficiency and to further define the phenotype of this rare glycogen storage disease (GSD)....

  3. Turning Marrow into Muscle

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    @@ In unexpected testimony2 to the versatility3 of the body's cells,researchers have found they can make bone marrow cells turn into muscle, causing mice with muscular dystrophy4 to produce correctly working muscle cells. The experiment suggests that a form of bone marrow transplant- - a well established surgical procedure5- - could in principle treat patients with a variety of diseases.

  4. Enzymes and muscle diseases

    Directory of Open Access Journals (Sweden)

    M. Plebani

    2011-09-01

    Full Text Available Skeletal muscle disorders may result in release of muscle enzymes into the circulation and give increased serum enzyme activity. A variety of enzymes routinely determined in the clinical laboratory may be elevated, but creatine kinase is the enzyme present in the highest concentration in muscle, and in every variety of muscle disease is the serum enzyme which shows the greatest incidence and degree of elevation. Aspartate aminotransferase is the enzyme associated most significantly with inflammation. A diagnostic algorithm based on the combined measurement of creatine kinase, aspartate aminotransferase and aldolase has been found to discriminate muscular distrophies from polymyositis and other myopathies. This combination of laboratory tests has diagnostic application and thus allows the clinician to better select patients who need to have a skeletal muscle biopsy as a diagnostic procedure.

  5. Prevalence and intensity of infections of Ascaris lumbricoides and Trichuris trichiura and associated socio-demographic variables in four rural Honduran communities

    Directory of Open Access Journals (Sweden)

    Smith HM

    2001-01-01

    Full Text Available Between January and March 1998, a cross-sectional survey was carried out in four rural communities in Honduras, Central America. We examined the prevalence and intensity of Ascaris lumbricoides and Trichuris trichiura infections among 240 fecal specimens, and the association between selected socio-demographic variables and infection for 62 households. The overall prevalence of A. lumbricoides and T. trichiura was 45% (95% CI 39.0-51.9 and 38% (95% CI 31.8-44.4 respectively. The most intense infections for Ascaris and Trichuris were found in children aged 2-12 years old. By univariate analysis variables associated with infections of A. lumbricoides were: number of children 2-5 years old (p=0.001, level of formal education of respondents (p=0.01, reported site of defecation of children in households (p=0.02, households with children who had a recent history of diarrhea (p=0.002, and the location of households (p=0.03. Variables associated with both A. lumbricoides and T. trichiura infection included: number of children 6-14 years old (p=0.01, p=0.04, respectively, ownership of a latrine (p=0.04, p=0.03, respectively and coinfection with either helminth (p=0.001, p=0.001, respectively. By multivariate analysis the number of children 2-5 years living in the household, (p=0.01, odds ratio (OR=22.2, children with a recent history of diarrhea (p=0.0, OR=39.8, and infection of household members with T. trichiura (p=0.02, OR=16.0 were associated with A. lumbricoides infection. The number of children 6-14 years old in the household was associated with both A. lumbricoides and T. trichiura infection (p=0.04, p=0.01, OR=19.2, OR=5.2, respectively.

  6. Transfected muscle and non-muscle actins are differentially sorted by cultured smooth muscle and non-muscle cells

    OpenAIRE

    Mounier, N.; Perriard, J. C.; Gabbiani, Giulio; Chaponnier, Christine

    1997-01-01

    We have analyzed by immunolabeling the fate of exogenous epitope-tagged actin isoforms introduced into cultured smooth muscle and non-muscle (i.e. endothelial and epithelial) cells by transfecting the corresponding cDNAs in transient expression assays. Exogenous muscle actins did not produce obvious shape changes in transfected cells. In smooth muscle cells, transfected striated and smooth muscle actins were preferentially recruited into stress fibers. In non-muscle cells, exogenous striated ...

  7. Ischemia causes muscle fatigue

    Science.gov (United States)

    Murthy, G.; Hargens, A. R.; Lehman, S.; Rempel, D. M.

    2001-01-01

    The purpose of this investigation was to determine whether ischemia, which reduces oxygenation in the extensor carpi radialis (ECR) muscle, causes a reduction in muscle force production. In eight subjects, muscle oxygenation (TO2) of the right ECR was measured noninvasively and continuously using near infrared spectroscopy (NIRS) while muscle twitch force was elicited by transcutaneous electrical stimulation (1 Hz, 0.1 ms). Baseline measurements of blood volume, muscle oxygenation and twitch force were recorded continuously, then a tourniquet on the upper arm was inflated to one of five different pressure levels: 20, 40, 60 mm Hg (randomized order) and diastolic (69 +/- 9.8 mm Hg) and systolic (106 +/- 12.8 mm Hg) blood pressures. Each pressure level was maintained for 3-5 min, and was followed by a recovery period sufficient to allow measurements to return to baseline. For each respective tourniquet pressure level, mean TO2 decreased from resting baseline (100% TO2) to 99 +/- 1.2% (SEM), 96 +/- 1.9%, 93 +/- 2.8%, 90 +/- 2.5%, and 86 +/- 2.7%, and mean twitch force decreased from resting baseline (100% force) to 99 +/- 0.7% (SEM), 96 +/- 2.7%, 93 +/- 3.1%, 88 +/- 3.2%, and 86 +/- 2.6%. Muscle oxygenation and twitch force at 60 mm Hg tourniquet compression and above were significantly lower (P ischemia leading to a 7% or greater reduction in muscle oxygenation causes decreased muscle force production in the forearm extensor muscle. Thus, ischemia associated with a modest decline in TO2 causes muscle fatigue.

  8. Slipped and lost extraocular muscles.

    Science.gov (United States)

    Lenart, T D; Lambert, S R

    2001-09-01

    A slipped or lost muscle should be considered in the differential diagnosis of a patient presenting with a marked limitation of duction and inability to rotate the eye beyond the midline. Loss of a rectus muscle can occur after strabismus surgery, trauma, paranasal sinus surgery, orbital surgery, or retinal detachment surgery. The extraocular rectus muscle most frequently slipped or lost is the medial rectus muscle. Forced ductions, active force generation, saccadic velocity studies, differential intraocular pressure measurements, and orbital imaging studies may aid in identifying a slipped or lost muscle. However, no single diagnostic test provides absolute reliability for determining a lost muscle. Slipped muscles develop when the muscular capsule is imbricated without including the muscle or muscle tendon during strabismus surgery. When the capsule is reattached to the sclera, the tendon and muscle are then free to slip posteriorally from the site of attachment. Slipped muscles are retrieved by following the thin avascular muscle capsule posteriorally until the muscle is identified. A lost muscle can be found using a traditional conjunctival approach, by an external orbitotomy, or by an endoscopic transnasal approach. Although many diagnostic maneuvers are useful in identifying a lost rectus muscle, the oculocardiac reflex is the most important. Once the lost muscle is identified, the muscle should be imbricated with a nonabsorbable synthetic suture and securely reattached to the globe. PMID:11705143

  9. Polymer artificial muscles

    Directory of Open Access Journals (Sweden)

    Tissaphern Mirfakhrai

    2007-04-01

    Full Text Available The various types of natural muscle are incredible material systems that enable the production of large deformations by repetitive molecular motions. Polymer artificial muscle technologies are being developed that produce similar strains and higher stresses using electrostatic forces, electrostriction, ion insertion, and molecular conformational changes. Materials used include elastomers, conducting polymers, ionically conducting polymers, and carbon nanotubes. The mechanisms, performance, and remaining challenges associated with these technologies are described. Initial applications are being developed, but further work by the materials community should help make these technologies applicable in a wide range of devices where muscle-like motion is desirable.

  10. Skeletal muscle connective tissue

    DEFF Research Database (Denmark)

    Brüggemann, Dagmar Adeline

      The connective tissue content of skeletal muscle is believed to be the major factor responsible for defining the eating quality of different meat cuts, although attempts to correlate quantifications based on traditional histological methods have not as yet been able to prove this relation...... systems of muscle have been visualized in their full complexity, including the ‘neglected' lymphatic capillaries at the level of the endomysium. These findings serve to remind us that muscle contraction is not only about force generation and transmission, but also about nutrient supply and waste removal...

  11. Muscle Fiber Types and Training.

    Science.gov (United States)

    Karp, Jason R.

    2001-01-01

    The specific types of fibers that make up individual muscles greatly influence how people will adapt to their training programs. This paper explains the complexities of skeletal muscles, focusing on types of muscle fibers (slow-twitch and fast-twitch), recruitment of muscle fibers to perform a motor task, and determining fiber type. Implications…

  12. Muscle glycogenolysis during exercise

    DEFF Research Database (Denmark)

    Richter, Erik; Ruderman, N B; Gavras, H;

    1982-01-01

    muscle glycogenolysis during exercise: contractions principally stimulate glycogenolysis early in exercise, and a direct effect of epinephrine on muscle is needed for continued glycogenolysis. In addition, epinephrine increased oxygen consumption and glucose uptake in both resting and electrically......The interaction of epinephrine and contractions on muscle metabolism was studied in the isolated perfused rat hindquarter. Subtetanic contractions (180/min) through 20 min elicited glycogenolysis and increased phosphorylase a activity. In the soleus, a slow-twitch red muscle, these effects were...... transient, but when epinephrine at a physiological concentration (2.4 X 10(-8) M) was added to the perfusate, glycogenolysis and phosphorylase activity were sustained throughout contractions. At this high frequency of contractions, the effect of epinephrine was much smaller in the fast-twitch red fibers and...

  13. Neurogenic muscle cramps.

    Science.gov (United States)

    Katzberg, Hans D

    2015-08-01

    Muscle cramps are sustained, painful contractions of muscle and are prevalent in patients with and without medical conditions. The objective of this review is to present updates on the mechanism, investigation and treatment of neurogenic muscle cramps. PubMed and Embase databases were queried between January 1980 and July 2014 for English-language human studies. The American Academy of Neurology classification of studies (classes I-IV) was used to assess levels of evidence. Mechanical disruption, ephaptic transmission, disruption of sensory afferents and persistent inward currents have been implicated in the pathogenesis of neurogenic cramps. Investigations are directed toward identifying physiological triggers or medical conditions predisposing to cramps. Although cramps can be self-limiting, disabling or sustained muscle cramps should prompt investigation for underlying medical conditions. Lifestyle modifications, treatment of underlying conditions, stretching, B-complex vitamins, diltiezam, mexiletine, carbamazepine, tetrahydrocannabinoid, leveteracitam and quinine sulfate have shown evidence for treatment. PMID:25673127

  14. Muscle biopsy (image)

    Science.gov (United States)

    A muscle biopsy involves removal of a plug of tissue usually by a needle to be later used for examination. Sometimes ... there is a patchy condition expected an open biopsy may be used. Open biopsy involves a small ...

  15. Muscles, exercise and obesity

    DEFF Research Database (Denmark)

    Pedersen, Bente K; Febbraio, Mark A

    2012-01-01

    . The finding that the muscle secretome consists of several hundred secreted peptides provides a conceptual basis and a whole new paradigm for understanding how muscles communicate with other organs, such as adipose tissue, liver, pancreas, bones and brain. However, some myokines exert their effects within...... L cells and pancreatic islets. Other myokines include the osteogenic factors IGF-1 and FGF-2; FSTL-1, which improves the endothelial function of the vascular system; and the PGC-1a-dependent myokine irisin, which drives brown-fat-like development. Studies in the past few years suggest the existence...... of yet unidentified factors, secreted from muscle cells, which may influence cancer cell growth and pancreas function. Many proteins produced by skeletal muscle are dependent upon contraction; therefore, physical inactivity probably leads to an altered myokine response, which could provide a potential...

  16. Muscles and their myokines

    DEFF Research Database (Denmark)

    Pedersen, Bente Klarlund

    2011-01-01

    that a physically active life plays an independent role in the protection against type 2 diabetes, cardiovascular diseases, cancer, dementia and even depression. For most of the last century, researchers sought a link between muscle contraction and humoral changes in the form of an 'exercise factor......, which work in a hormone-like fashion, exerting specific endocrine effects on other organs. Other myokines work via paracrine mechanisms, exerting local effects on signalling pathways involved in muscle metabolism. It has been suggested that myokines may contribute to exercise-induced protection against......', which could be released from skeletal muscle during contraction and mediate some of the exercise-induced metabolic changes in other organs such as the liver and the adipose tissue. We have suggested that cytokines or other peptides that are produced, expressed and released by muscle fibres and exert...

  17. Research on the immune mechanisms of Ascaris lumbricoides infection over the past decade%近10年似蚯蚓线虫感染的免疫机制研究

    Institute of Scientific and Technical Information of China (English)

    王敏; 张冬丽

    2013-01-01

    本文从固有免疫、适应性免疫及疫苗研究等几方面论述似蚯蚓线虫(蛔虫)感染的免疫学研究新进展.%This paper describes recent advances in the induction of innate immunity and acquired immunity against Ascaris lumbricoides and it also discusses the development of vaccines.

  18. ПАТОГИСТОЛОГИЧЕСКИЕ ИЗМЕНЕНИЯ В ОРГАНАХ СВИНЕЙ, ВЫЗВАННЫЕ ПАРАЗИТИРОВАНИЕМ ASCARIS SUUM

    OpenAIRE

    ВОСТРУХИНА А.С.; МАКСИМОВА Е.В.

    2013-01-01

    Сенсибилизация белковым соматическим продуктом из тканей аскарид в суточной дозе 50 мкг/г массы тела крыс на стадии раннего органогенеза эмбрионов (5-8 дни беременности) сопровождается эмбриотоксическим эффектом, который характеризуется достоверным ростом постимплантационной гибели в 4,98 раза, а также уменьшением средней массы эмбрионов и их краниокаудального размера в 1,42-1,44 раза. Белковый соматический продукт из тканей аскарид обладает выраженными генотоксическим и цитотоксическим эф...

  19. Loss of muscle performance in seniors: changes to the dynamic muscle structure and muscle gearing

    OpenAIRE

    Randhawa, Avleen

    2012-01-01

    Muscle structure changes with ageing in a manner that can alter its contractile mechanics, resulting in a reduction in strength and mobility. Fascicles within a muscle can shorten at slower velocities than the muscle belly, in a process known as belly gearing. Belly gearing allows the fascicles to produce a greater force when they contract. However, it may be compromised when we age. The gastrocnemii muscles in the calf were imaged in young adults and seniors using ultrasound. Their muscle st...

  20. Dicty_cDB: SHF635 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VKRIKELLFSLYLPIFNCFEA FLLNTNEKALIENLLWL*ki Frame B: sfssnsiniyicsftstnttnisilpnnnnnntgchnkfriinei**icdii...fggpgqsfggpgqsfgpkpiasggfgstaipfggpgqsfggsgykwwl w*hcsiiwrsktnhnwkqwfw*ycciiwrtrstiwrighkwwfwiinttinssfskfiwn wr*icc*nstis... pieces. 44 0.13 2 BM278816 |BM278816.1 As_tgz_67G12_SKPL Ascaris suum adult male testis... germinal zone from Alan Scott Ascaris suum cDNA clone As_tgz_67G12 5', mRNA sequence. 36 0.48 2 CT18...4508 |pid:none) Plasmodium falciparum strain 3D7,... 35 4.8 AM263198_928( AM263198 |pid:none) Listeri

  1. PDH regulation in skeletal muscle

    DEFF Research Database (Denmark)

    Kiilerich, Kristian

    state is determined by the overall content / activity of the regulatory proteins PDH kinase (PDK), of which there are 4 isoforms, and PDH phosphatase (PDP), of which there are 2 isoforms. The overall aim of the PhD project was to elucidate 4 issues. 1: Role of muscle type in resting and exercise......-induced PDH regulation in human skeletal muscle. 2: Effect of muscle glycogen on PDH regulation in human skeletal muscle at rest and during exercise. 3: The impact of physical inactivity on PDH regulation in human skeletal muscle at rest and during exercise. 4: Elucidating the importance of PGC-1? in PDH...... regulation in mouse skeletal muscle at rest and in response to fasting and during recovery from exercise. The studies indicate that the content of PDH-E1? in human muscle follows the metabolic profile of the muscle, rather than the myosin heavy chain fiber distribution of the muscle. The larger lactate...

  2. Muscle as a secretory organ

    DEFF Research Database (Denmark)

    Pedersen, Bente K

    2013-01-01

    Skeletal muscle is the largest organ in the body. Skeletal muscles are primarily characterized by their mechanical activity required for posture, movement, and breathing, which depends on muscle fiber contractions. However, skeletal muscle is not just a component in our locomotor system. Recent...... evidence has identified skeletal muscle as a secretory organ. We have suggested that cytokines and other peptides that are produced, expressed, and released by muscle fibers and exert either autocrine, paracrine, or endocrine effects should be classified as "myokines." The muscle secretome consists of...... several hundred secreted peptides. This finding provides a conceptual basis and a whole new paradigm for understanding how muscles communicate with other organs such as adipose tissue, liver, pancreas, bones, and brain. In addition, several myokines exert their effects within the muscle itself. Many...

  3. 蛔虫重度流行区人群化疗策略的研究%Research on chemotherapy strategy for population in heavy epidemic areas with ascaris iumbricoides

    Institute of Scientific and Technical Information of China (English)

    谢峰; 陈红根; 曾小军; 林丹丹; 姜唯声; Jong-YilChai

    2014-01-01

    Objective To evaluate the effect of different chemotherapy strategies for Ascaris lumbricoides. Methods Four chemotherapy strategies with Albendazole,which were mass chemotherapy once a year,mass chemotherapy once in two years,se-lective chemotherapy once a year and selective chemotherapy twice a year,were carried out in four control villages,respectively. The effects of strategies on infection control of Ascaris lumbricoides were observed continuously for 4 years ,and compared with the dada of a control village. Results The average positive rate of Ascaris lumbricoides was 44.37%(4850/10931) in 5 pilot villages in 2001. The infection rate of Ascaris lumbricoides was decreased maximally,from 45.2%in 2001 to 6.3%in 2005 with the reduction of 86.1% in villages where the strategy of mass chemotherapy once a year was implemented. Conclusion The strategy of mass chemotherapy once a year has the best effect on infection control of Ascaris lumbricoides.%目的:评价不同化疗措施控制蛔虫的效果。方法在4个控制村用阿苯哒唑分别进行1年1次全民化疗、2年1次全民化疗、1年1次选择性化疗和1年2次选择性化疗措施后,连续4年观察其对控制居民蛔虫的效果,并和对照村进行比较。结果2001年5个试点村蛔虫平均阳性率为44.37%(4850/10931),采取每1次/年全民化疗人群蛔虫感染率下降最大,由2001年的45.2%下降到2004年的6.3%,降幅为86.1%。结论1次/年全民化疗策略对于控制蛔虫感染的效果佳。

  4. Rectus abdominis muscle endometriosis

    International Nuclear Information System (INIS)

    Endometriosis is characterized by an abnormal existence of functional endometrial tissue outside the uterine cavity, typically occuring within the pelvis of women in reproductive age. We report two cases with endometriosis of the abdominal wall; the first one in the rectus abdominis muscle and the second one in the surgical scar of previous caesarean incision along with the rectus abdominis muscle. Pre-operative evaluation included magnetic resonance imaging. The masses were dissected free from the surrounding tissue and excised with clear margins. Diagnosis of the excised lesions were verified by histopathology. (author)

  5. [Muscle-skeletal pain].

    Science.gov (United States)

    Vygonskaya, M V; Filatova, E G

    2016-01-01

    The paper is devoted to the most complicated aspects of low back pain. The differences between specific and nonspecific low back pain using the "red flags" system is highlighted. The authors consider the causes of pain chronification (the "yellow flags" system) and the necessity of using a biopsychosocial model. Main pathogenetic mechanisms of chronic muscle/skeletal pain are considered and the possible involvement of several mechanism in the pathogenesis of chronic pain as well as the use of complex therapy is discussed. The high efficacy and safety of ketorolac in treatment of nonspecific muscle/skeletal pain is demonstrated. PMID:27042717

  6. Ascaris lumbricoides Infection Following School-Based Deworming in Western Kenya: Assessing the Role of Pupils' School and Home Water, Sanitation, and Hygiene Exposures.

    Science.gov (United States)

    Garn, Joshua V; Mwandawiro, Charles S; Nikolay, Birgit; Drews-Botsch, Carolyn D; Kihara, Jimmy H; Brooker, Simon J; Simiyu, Elses W; Okoyo, Collins; Freeman, Matthew C

    2016-05-01

    Water, sanitation, and hygiene (WaSH) technologies and behaviors can prevent infection by soil-transmitted helminth species independently, but may also interact in complex ways. However, these interactions are poorly understood. The purpose of this study was to characterize how school and home WaSH exposures were associated with Ascaris lumbricoides infection and to identify relevant interactions between separate WaSH technologies and behaviors. A study was conducted among 4,404 children attending 51 primary schools in western Kenya. We used multivariable mixed effects logistic regression to characterize how various WaSH exposures were associated with A. lumbricoides infection after annual school-based deworming. Few WaSH behaviors and technologies were independently associated with A. lumbricoides infection. However, by considering relevant interdependencies between variables, important associations were elucidated. The association between handwashing and A. lumbricoides depended largely upon the pupils' access to an improved water source. Among pupils who had access to improved water sources, A. lumbricoides prevalence was lower for those who handwashed both at school and home compared with neither place (odds ratio: 0.38, 95% confidence interval: 0.18-0.83; P = 0.01). This study contributes to a further understanding of the impact of WaSH on A. lumbricoides infection and shows the importance of accounting for interactions between WaSH technologies and behaviors. PMID:26903608

  7. Toxic effect of Ascaris lumbricoides body fluid on intestinal epithelial cells%人蛔虫体腔液对人肠上皮细胞的毒性作用

    Institute of Scientific and Technical Information of China (English)

    翁培兰; 袁铿; 彭卫东; 周宪民

    2005-01-01

    目的探讨人蛔虫体腔液(Ascaris bodyfluid,ABF)对人肠上皮细胞株(HCT-8)的毒性作用及作用浓度和时间的关系.方法以体外细胞培养方法观察ABF对HCT-8细胞的毒性作用,比较不同浓度ABF作用下不同时间HCT-8细胞的死亡率和形态结构.结果HE染色显示,当ABF浓度为800μg/ml时,HCT-8细胞的毒性作用最大,除浓度为12.5μg/ml的实验组,各实验组(25~8μg/ml)的毒性均高于对照组.结论ABF对HCT-8细胞所产生毒性作用在一定程度上表现出浓度和作用时间的依赖关系,并诱导细胞凋亡的发生.

  8. Absence of scalenus anterior muscle.

    Directory of Open Access Journals (Sweden)

    Murakami S

    2003-06-01

    Full Text Available A rare anomaly of the scalenus muscles is described. In this case, the right scalenus anterior muscle was absent. As a substitute for this muscle, some aberrant muscle slips arose from the lower vertebrae and descended in front of the ventral rami of the lower cervical nerves. These aberrant slips then ran between the ventral rami of the the eighth cervical and first thoracic nerves, and were fused with the right scalenus medius muscle. Thus, the subclavian artery and vein ran in front of the aberrant slips, together with the ventral ramus of the first thoracic nerve. The aberrant muscle slips issued 2 accessory bundles. One bundle ran between the ventral rami of the fourth and fifth cervical nerves and was fused with the scalenus medius muscle; the other bundle ran between the ventral rami of the fifth and sixth cervical nerves and was fused with the scalenus medius muscle.

  9. Eye muscle repair - series (image)

    Science.gov (United States)

    ... the eyeball to the eye socket. The external muscles of the eye are found behind the conjunctiva. ... The extraocular muscles of the eye (external to the eyeball) control the positioning of the eyes. They coordinate of the eye ...

  10. Genetics Home Reference: rippling muscle disease

    Science.gov (United States)

    ... sudden impact on the muscle causes it to bunch up (percussion-induced muscle mounding) or exhibit repetitive ... potentials in the tubular system of skeletal muscle fibers. Muscle Nerve. 2005 May;31(5):652-8. ...

  11. Muscle function loss

    Science.gov (United States)

    ... nerve injury, or brain damage ( stroke or other brain injury) The loss of muscle function after these types of events can be severe. Often it will not completely return, even with treatment. Paralysis can be temporary or permanent. It can affect ...

  12. Skeletal muscle regulatory factors with alterations in muscle mass

    OpenAIRE

    Litt Miller, Jennifer Michele

    2007-01-01

    Given that maintenance of skeletal muscle mass is essential for overall health, functionality and quality of life, it is critical to elucidate the fundamental mechanisms underlying the maintenance of muscle mass which likely vary as a function of muscle status (i.e. healthy or diseased). This thesis examined key skeletal muscle regulatory factors (smRF’s) that are known to affect skeletal muscle mass, including components of the PI3K/Akt and MAPK(ERK) pathways, calcineurin, the myogenic regul...

  13. Identification of cDNA clones expressing immunodiagnostic antigens from Trichinella spiralis

    Energy Technology Data Exchange (ETDEWEB)

    Zarlenga, D.; Gamble, H.R.

    1987-05-01

    A cDNA expression library was built in lambda gt11 phage using poly A mRNA isolated from Trichinella spiralis muscle stage larvae. This library was screened with rabbit antibodies to parasite excretory-secretory (ES) products and greater than 180 clones were isolated. Thirteen clones producing highly immunogenic protein antigens were plaque purified and rescreened with pig antisera to T.spiralis, Trichuris suis or Ascaris suum to identify clones producing epitopes specific to T.spiralis ES products, only. Two clones, TsAc-2 and TsAc-8, which displayed strong interactions with pig antisera to T. spiralis were lysogenized in E. coli Y1089 and the protein extracted. Western blots of the crude fusion proteins revealed molecular weights of 133 kD and 129 kD, respectively. Northern blot analysis of total RNA with TSP labelled cDNA:lambda gt11 probes indicated single RNA transcripts for each clone with molecular sizes corresponding to 800-850 nucleotides. dscDNA inserts were estimated by southern blot analysis to be 500 bp and 340 bp, respectively, with no cross-hybridization observed between the cloned sequences. Dot blots using pig sera to screen crude fusion protein preparations, total bacterial protein (negative controls) and crude worm extract or ES products from T.spiralis, T.suis and A.suum (positive controls) corroborated the specificity and sensitivity of these clones as potential diagnostic antigens for swine trichinellosis.

  14. Identification of cDNA clones expressing immunodiagnostic antigens from Trichinella spiralis

    International Nuclear Information System (INIS)

    A cDNA expression library was built in lambda gt11 phage using poly A mRNA isolated from Trichinella spiralis muscle stage larvae. This library was screened with rabbit antibodies to parasite excretory-secretory (ES) products and greater than 180 clones were isolated. Thirteen clones producing highly immunogenic protein antigens were plaque purified and rescreened with pig antisera to T.spiralis, Trichuris suis or Ascaris suum to identify clones producing epitopes specific to T.spiralis ES products, only. Two clones, TsAc-2 and TsAc-8, which displayed strong interactions with pig antisera to T. spiralis were lysogenized in E. coli Y1089 and the protein extracted. Western blots of the crude fusion proteins revealed molecular weights of 133 kD and 129 kD, respectively. Northern blot analysis of total RNA with 32P labelled cDNA:lambda gt11 probes indicated single RNA transcripts for each clone with molecular sizes corresponding to 800-850 nucleotides. dscDNA inserts were estimated by southern blot analysis to be 500 bp and 340 bp, respectively, with no cross-hybridization observed between the cloned sequences. Dot blots using pig sera to screen crude fusion protein preparations, total bacterial protein (negative controls) and crude worm extract or ES products from T.spiralis, T.suis and A.suum (positive controls) corroborated the specificity and sensitivity of these clones as potential diagnostic antigens for swine trichinellosis

  15. The cleidosternohyoid: a fifth infrahyoid muscle?

    OpenAIRE

    Wu B; Bluth BE; Stark ME; Wisco JJ

    2010-01-01

    We describe a cleidosternohyoid muscle found bilaterally during routine dissection of a cadaver (92 year-old male of Irish descent). On the right side, the muscle originated from the clavicle with a cleidohyoid muscle. On the left side, the muscle originated from the clavicle and accompanied the inferior belly of an omohyoid muscle. On both sides the muscle inserted into the sternohyoid muscle. Since the muscle variant courses with a cleidohyoid on the right and the inferior belly of an omohy...

  16. Stem cells for skeletal muscle repair

    OpenAIRE

    Shadrach, Jennifer L.; Wagers, Amy J.

    2011-01-01

    Skeletal muscle is a highly specialized tissue composed of non-dividing, multi-nucleated muscle fibres that contract to generate force in a controlled and directed manner. Skeletal muscle is formed during embryogenesis from a subset of muscle precursor cells, which generate both differentiated muscle fibres and specialized muscle-forming stem cells known as satellite cells. Satellite cells remain associated with muscle fibres after birth and are responsible for muscle growth and repair throug...

  17. Evolution of ascariasis in humans and pigs: a multi-disciplinary approach

    OpenAIRE

    Loreille Odile; Bouchet Françoise

    2003-01-01

    The nematode parasite Ascaris lumbricoides infects the digestive tracts of over 1.4 billion people worldwide, and its sister species, Ascaris suum, has infected a countless number of domesticated and feral pigs. It is generally thought that the putative ancestor to these worms infected either humans or pigs, but with the advent of domestication, they had ample opportunity to jump to a new host and subsequently specialize and evolve into a new species. While nuclear DNA markers decisively sepa...

  18. Dicty_cDB: SHF132 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available niyicsftstnttnisilpnnnn nntgchnkfriinei**icdii**yfnw**inlsrrfn*k*i*kiick*s**fkie*fif tl*kgi*k*t...ome. 38 0.34 6 BM278816 |BM278816.1 As_tgz_67G12_SKPL Ascaris suum adult male testis germinal zone from Alan Scott Ascaris...KQHSFSNDIKFKQEWNRFSNNMFDGFNWSNV FI--- ---wwfw*yxsiigrtrsiiwrsrsiirsktnckwwfw*ycytiwrtrsiiwrigykwwl w*hcsiiwrsktnhnwkqwfw*yccii...wrtrstiwrighkwwfwiinttinssfskfiwn wr*icc*nstislypc*wfcpsclkhicnsnwfiqqyptfskkystkygw**cikr...vmiqn*iiyiy ivkrylkvnqpplnyqm*mvsivlwdsmqnnihfqmisslnkngidlviiclmvsigpmy l--- ---GGFGST

  19. Absence of scalenus anterior muscle.

    OpenAIRE

    Murakami S; Horiuchi K; Yamamoto C; Ohtsuka A; Murakami T.

    2003-01-01

    A rare anomaly of the scalenus muscles is described. In this case, the right scalenus anterior muscle was absent. As a substitute for this muscle, some aberrant muscle slips arose from the lower vertebrae and descended in front of the ventral rami of the lower cervical nerves. These aberrant slips then ran between the ventral rami of the the eighth cervical and first thoracic nerves, and were fused with the right scalenus medius muscle. Thus, the subclavian artery and vein ran in front of the...

  20. Skeletal muscle adaptations and muscle genomics of performance horses.

    Science.gov (United States)

    Rivero, José-Luis L; Hill, Emmeline W

    2016-03-01

    Skeletal muscles in horses are characterised by specific adaptations, which are the result of the natural evolution of the horse as a grazing animal, centuries of selective breeding and the adaptability of this tissue in response to training. These adaptations include an increased muscle mass relative to body weight, a great locomotor efficiency based upon an admirable muscle-tendon architectural design and an adaptable fibre-type composition with intrinsic shortening velocities greater than would be predicted from an animal of comparable body size. Furthermore, equine skeletal muscles have a high mitochondrial volume that permits a higher whole animal aerobic capacity, as well as large intramuscular stores of energy substrates (glycogen in particular). Finally, high buffer and lactate transport capacities preserve muscles against fatigue during anaerobic exercise. Many of these adaptations can improve with training. The publication of the equine genome sequence in 2009 has provided a major advance towards an improved understanding of equine muscle physiology. Equine muscle genomics studies have revealed a number of genes associated with elite physical performance and have also identified changes in structural and metabolic genes following exercise and training. Genes involved in muscle growth, muscle contraction and specific metabolic pathways have been found to be functionally relevant for the early performance evaluation of elite athletic horses. The candidate genes discussed in this review are important for a healthy individual to improve performance. However, muscle performance limiting conditions are widespread in horses and many of these conditions are also genetically influenced. PMID:26831154

  1. Mentalis muscle related reflexes.

    Science.gov (United States)

    Gündüz, Ayşegül; Uyanık, Özlem; Ertürk, Özdem; Sohtaoğlu, Melis; Kızıltan, Meral Erdemir

    2016-05-01

    The mentalis muscle (MM) arises from the incisive fossa of the mandible, raises and protrudes the lower lip. Here, we aim to characterize responses obtained from MM by supraorbital and median electrical as well as auditory stimuli in a group of 16 healthy volunteers who did not have clinical palmomental reflex. Reflex activities were recorded from the MM and orbicularis oculi (O.oc) after supraorbital and median electrical as well as auditory stimuli. Response rates over MM were consistent after each stimulus, however, mean latencies of MM response were longer than O.oc responses by all stimulation modalities. Shapes and amplitudes of responses from O.oc and MM were similar. Based on our findings, we may say that MM motoneurons have connections with trigeminal, vestibulocochlear and lemniscal pathways similar to other facial muscles and electrophysiological recording of MM responses after electrical and auditory stimulation is possible in healthy subjects. PMID:26721248

  2. Muscle Motion Solenoid Actuator

    Science.gov (United States)

    Obata, Shuji

    It is one of our dreams to mechanically recover the lost body for damaged humans. Realistic humanoid robots composed of such machines require muscle motion actuators controlled by all pulling actions. Particularly, antagonistic pairs of bi-articular muscles are very important in animal's motions. A system of actuators is proposed using the electromagnetic force of the solenoids with the abilities of the stroke length over 10 cm and the strength about 20 N, which are needed to move the real human arm. The devised actuators are based on developments of recent modern electro-magnetic materials, where old time materials can not give such possibility. Composite actuators are controlled by a high ability computer and software making genuine motions.

  3. Current status of the efficacy and effectiveness of albendazole and mebendazole for the treatment ofAscaris lumbricoides in North-Western Indonesia

    Institute of Scientific and Technical Information of China (English)

    Inke Nadia Diniyanti Lubis; Syahril Pasaribu; Chairuddin Panusunan Lubis

    2012-01-01

    Objective:To investigate the efficacy and effectiveness of albendazole and mebendazole in the treatment ofAscaris lumbricoides (A. lumbricoides) in theNorth-WesternIndonesia.Methods:229 primary school children who were positive forA. lumbricoides in their stool were recruited in the study.123 children received single-dose of400 mg albendazole and106 children received single-dose500 mg of mebendazole.After1 week, their stools were examined for the cure rate (CR) and egg reduction rate(ERR).Egg culture was also performed and observation was made on week-1, -3, -4.Results:have shown a non-significant difference inCR96.7%vs.100%; and ERR of99.3%vs.100.0% for albendazole and mebendazole groups respectively(P>0.05).In-vitro egg culture has shown trends of decrease in the percentage of the unfertilized eggs and in≥2 cell eggs in both treatment groups(P<0.05).The embryonated eggs from the albendazole groups has shown an increase from7.3% on week-1 to13.8% on week-4, whilst the mebendazole group has shown a constant increase during the whole4 weeks of culture from7.5% to28.3%(P<0.01). Conclusions:No evidence of drug resistance is noted so far from the area ofNorth-Western part ofIndonesia.In addition, although both drugs showed incomplete ovicidal effects, single-dose albendazole is better than mebendazole in sterilizingA. lumbricoideseggs.

  4. Parasitismo por Ascaris lumbricoides em crianças menores de dois anos: estudo populacional em comunidade do Estado do Rio de Janeiro

    Directory of Open Access Journals (Sweden)

    Costa-Macedo Lêda Maria da

    1999-01-01

    Full Text Available A prevalência e a intensidade da infecção por Ascaris lumbricoides foram analisadas mediante um estudo transversal em crianças residentes no Município de Duque de Caxias, no Estado do Rio de Janeiro, entre julho e dezembro de 1997. A população do estudo foi constituída por crianças com menos de dois anos de idade e as mães das crianças menores de um ano. As amostras fecais foram recolhidas nos domicílios em frascos contendo solução conservadora de MIF e processadas por meio das técnicas de MIFC e Kato-Katz. As prevalências de infecção por A. lumbricoides observadas foram 3,3% (I.C. 95% 1,0 - 7,8 para os menores de um ano, 30,7% (I.C. 95% 25,4 - 36,4 para as crianças com um ano de idade e 42,3% (I.C. 95% 33,0 - 51,9 para as mães. Infecção com carga parasitária moderada/pesada foi observada em cerca de 38% das crianças com um ano de idade e 36,0% das mães. Estes resultados demonstram a importância da ascariose já no primeiro ano de vida e indicam a necessidade de aprofundamento na investigação desta parasitose na população materno-infantil.

  5. Dismorfia muscular Muscle dysmorphia

    Directory of Open Access Journals (Sweden)

    Sheila Seleri Marques Assunção

    2002-12-01

    Full Text Available Preocupações mórbidas com a imagem corporal eram tidas até recentemente como problemas eminentemente femininos. Atualmente estas preocupações também têm sido encontradas no sexo masculino. A dismorfia muscular é um subtipo do transtorno dismórfico corporal que ocorre principalmente em homens que, apesar da grande hipertrofia muscular, consideram-se pequenos e fracos. Além de estar associada a prejuízos sociais, ocupacionais, recreativos e em outras áreas do funcionamento do indivíduo, a dismorfia muscular é também um fator de risco para o abuso de esteróides anabolizantes. Este artigo aborda aspectos epidemiológicos, etiológicos e padrões clínicos da dismorfia muscular, além de tecer comentários sobre estratégias de tratamento para este transtorno.Morbid concern over body image was considered, until recently, a female issue. Nowadays, it has been viewed as a common male disorder. Muscle dysmorphia, a subtype of a body dysmorphic disorder, affects men who, despite having clear muscular hypertroph,y see themselves as frail and small. Besides being associated to major social, leisure and occupational dysfunction, muscle dysmorphia is also a risk factor for the abuse of steroids. This article describes epidemiological, etiological and clinical characteristics of muscle dysmorphia and comments on its treatment strategy.

  6. El grado de agregación de Ascaris lumbricoides según grupos de edad, después de una intervención antihelmíntica de masas

    OpenAIRE

    Agustín Ruíz; Guadalupe Ocampo; Araceli Soto; José, Marco V.

    1996-01-01

    Objetivo. Describir la heterogeneidad de la reinfección por Ascaris lumbricoides según grupos de edad, en distintos intervalos, después de un primer tratamiento antihelmíntico masivo. Material y métodos. A partir de datos de la prevalencia e intensidad de la infección por A. lumbricoides obtenidos en un estudio epidemiológico de ascariasis, realizado en Coatzacoalcos, Veracruz, México, se deriva el grado de agregación por medio del método de máxima verosimilitud, asumiendo una distribución bi...

  7. Sildenafil increases muscle protein synthesis and reduces muscle fatigue

    OpenAIRE

    SHEFFIELD-MOORE, M.; Wiktorowicz, J E; Soman, K V; Danesi, C.P.; Kinsky, M.P.; Dillon, E.L.; Randolph, K.M.; Casperson, S.L.; Gore, D.C.; Horstman, A.M.; Lynch, J. P.; Doucet, B.M.; Mettler, J.; Ryder, J W; Ploutz-Snyder, L.L.

    2013-01-01

    Reductions in skeletal muscle function occur during the course of healthy aging as well as with bedrest or diverse diseases such as cancer, muscular dystrophy, and heart failure. However, there are no accepted pharmacologic therapies to improve impaired skeletal muscle function. Nitric oxide may influence skeletal muscle function through effects on excitation-contraction coupling, myofibrillar function, perfusion, and metabolism. Here we show that augmentation of nitric oxide-cyclic guanosine...

  8. Reduced Muscle Glycogen Differentially Affects Exercise Performance and Muscle Fatigue

    OpenAIRE

    Simon Lees; Williams, Jay H; Batts, Timothy W.

    2013-01-01

    This investigation examined the effects of reduced muscle glycogen on exercise performance and muscle fatigue. Male rats were assigned to a low glycogen group (LG) that participated in a protocol of exercise and fasting, a high glycogen group (HG) that exercised but were allowed free access to food, or control group (CON) that did not exercise but were allowed free access to food. Following the protocol, muscle glycogen content of the LG animals was reduced by 45%. The LG animals also perform...

  9. Painful Unilateral Temporalis Muscle Enlargement: Reactive Masticatory Muscle Hypertrophy

    OpenAIRE

    Katsetos, Christos D.; Bianchi, Michael A.; Jaffery, Fizza; Koutzaki, Sirma; Zarella, Mark; Slater, Robert

    2013-01-01

    An instance of isolated unilateral temporalis muscle hypertrophy (reactive masticatory muscle hypertrophy with fiber type 1 predominance) confirmed by muscle biopsy with histochemical fiber typing and image analysis in a 62 year-old man is reported. The patient presented with bruxism and a painful swelling of the temple. Absence of asymmetry or other abnormalities of the craniofacial skeleton was confirmed by magnetic resonance imaging and cephalometric analyses. The patient achieved symptoma...

  10. Muscle-specific microRNAs in skeletal muscle development.

    Science.gov (United States)

    Horak, Martin; Novak, Jan; Bienertova-Vasku, Julie

    2016-02-01

    Proper muscle function constitutes a precondition for good heath and an active lifestyle during an individual's lifespan and any deviations from normal skeletal muscle development and its functions may lead to numerous health conditions including e.g. myopathies and increased mortality. It is thus not surprising that there is an increasing need for understanding skeletal muscle developmental processes and the associated molecular pathways, especially as such information could find further uses in therapy. The understanding of complex skeletal muscle developmental networks was broadened with the discovery of microRNA (miRNA) molecules. MicroRNAs are evolutionary conserved small non-coding RNAs capable of negatively regulating gene expression on a post-transcriptional level by means of miRNA-mRNA interaction. Several miRNAs expressed exclusively in muscle have been labeled myomiRs. MyomiRs represent an integral part of skeletal muscle development, i.e. playing a significant role during skeletal muscle proliferation, differentiation and regeneration. The purpose of this review is to provide a summary of current knowledge regarding the involvement of myomiRs in the individual phases of myogenesis and other aspects of skeletal muscle biology, along with an up-to-date list of myomiR target genes and their functions in skeletal muscle and miRNA-related therapeutic approaches and future prospects. PMID:26708096

  11. Muscle strength in myasthenia gravis

    DEFF Research Database (Denmark)

    Cejvanovic, S; Vissing, J

    2014-01-01

    related to disease duration or gender. The aim of this study was to quantify the strength of patients with MG and investigate whether it is related to disease duration. METHODS: Eight muscle groups were tested by manual muscle testing and with a hand-held dynamometer in 38 patients with generalized MG and...... 37 healthy age- and gender-matched controls. The disease duration was recorded and compared with strength measures. RESULTS: On average, muscle strength was decreased by 28% compared with controls (P<0.01). Repeated strength measures in individual patients did not differ, suggesting that the muscle...... force reported was not subject to fatigue, but reflected fixed weakness. The male patients showed a greater reduction in muscle force in all eight muscle groups than women with MG (60% vs 77% of normal, P<0.05). In both men and women with MG, strength in shoulder abductors was most affected (51% vs 62...

  12. : AMPK and skeletal muscle hypertrophy

    OpenAIRE

    Mounier, Rémi; Lantier, Louise; Leclerc, Jocelyne; Sotiropoulos, Athanassia; Pende, Mario; Daegelen, Dominique; Sakamoto, Kei; Foretz, Marc; Viollet, Benoit

    2009-01-01

    10 pages; 6 figures; 49 références bibliographiques International audience Activation of AMP-activated protein kinase (AMPK) inhibits protein synthesis through the suppression of the mammalian target of rapamycin complex 1 (mTORC1), a critical regulator of muscle growth. The purpose of this investigation was to determine the role of the AMPKalpha1 catalytic subunit on muscle cell size control and adaptation to muscle hypertrophy. We found that AMPKalpha1(-/-) primary cultured myotubes a...

  13. Smooth muscle strips for intestinal tissue engineering.

    Directory of Open Access Journals (Sweden)

    Christopher M Walthers

    Full Text Available Functionally contracting smooth muscle is an essential part of the engineered intestine that has not been replicated in vitro. The purpose of this study is to produce contracting smooth muscle in culture by maintaining the native smooth muscle organization. We employed intact smooth muscle strips and compared them to dissociated smooth muscle cells in culture for 14 days. Cells isolated by enzymatic digestion quickly lost maturity markers for smooth muscle cells and contained few enteric neural and glial cells. Cultured smooth muscle strips exhibited periodic contraction and maintained neural and glial markers. Smooth muscle strips cultured for 14 days also exhibited regular fluctuation of intracellular calcium, whereas cultured smooth muscle cells did not. After implantation in omentum for 14 days on polycaprolactone scaffolds, smooth muscle strip constructs expressed high levels of smooth muscle maturity markers as well as enteric neural and glial cells. Intact smooth muscle strips may be a useful component for engineered intestinal smooth muscle.

  14. Hyperammonemia results in reduced muscle function independent of muscle mass.

    Science.gov (United States)

    McDaniel, John; Davuluri, Gangarao; Hill, Elizabeth Ann; Moyer, Michelle; Runkana, Ashok; Prayson, Richard; van Lunteren, Erik; Dasarathy, Srinivasan

    2016-02-01

    The mechanism of the nearly universal decreased muscle strength in cirrhosis is not known. We evaluated whether hyperammonemia in cirrhosis causes contractile dysfunction independent of reduced skeletal muscle mass. Maximum grip strength and muscle fatigue response were determined in cirrhotic patients and controls. Blood and muscle ammonia concentrations and grip strength normalized to lean body mass were measured in the portacaval anastomosis (PCA) and sham-operated pair-fed control rats (n = 5 each). Ex vivo contractile studies in the soleus muscle from a separate group of Sprague-Dawley rats (n = 7) were performed. Skeletal muscle force of contraction, rate of force development, and rate of relaxation were measured. Muscles were also subjected to a series of pulse trains at a range of stimulation frequencies from 20 to 110 Hz. Cirrhotic patients had lower maximum grip strength and greater muscle fatigue than control subjects. PCA rats had a 52.7 ± 13% lower normalized grip strength compared with control rats, and grip strength correlated with the blood and muscle ammonia concentrations (r(2) = 0.82). In ex vivo muscle preparations following a single pulse, the maximal force, rate of force development, and rate of relaxation were 12.1 ± 3.5 g vs. 6.2 ± 2.1 g; 398.2 ± 100.4 g/s vs. 163.8 ± 97.4 g/s; -101.2 ± 22.2 g/s vs. -33.6 ± 22.3 g/s in ammonia-treated compared with control muscle preparation, respectively (P therapeutic target in cirrhotic patients. PMID:26635319

  15. Muscle regeneration in mitochondrial myopathies

    DEFF Research Database (Denmark)

    Krag, T O; Hauerslev, S; Jeppesen, T D;

    2013-01-01

    Mitochondrial myopathies cover a diverse group of disorders in which ragged red and COX-negative fibers are common findings on muscle morphology. In contrast, muscle degeneration and regeneration, typically found in muscular dystrophies, are not considered characteristic features of mitochondrial...... myopathies. We investigated regeneration in muscle biopsies from 61 genetically well-defined patients affected by mitochondrial myopathy. Our results show that the perturbed energy metabolism in mitochondrial myopathies causes ongoing muscle regeneration in a majority of patients, and some were even affected...

  16. Lipoxygenase in chicken muscle

    International Nuclear Information System (INIS)

    The presence of lipoxygenase-type enzymes was demonstrated in chick muscles. Examination of the oxidation products of [14C]arachidonic acid revealed the presence of 15-lipoxygenase. The enzyme was partially purified by affinity chromatography on linoleoyl-aminoethyl-Sepharose. The enzyme was stable on frozen storage, and activity was almost completely preserved after 12-month storage at -20 degree C. During this period the content of cis,cis-1,4-pentadiene fatty acids decreased slightly. It is suggested that lipoxygenase may be responsible for some of the oxidative changes occurring in fatty acids on frozen storage of chicken meat

  17. Modelling functional effects of muscle geometry

    NARCIS (Netherlands)

    Linden, van der B.J.J.J.; Koopman, H.F.J.M.; Grootenboer, H.J.; Huijing, P.A.

    1998-01-01

    Muscle architecture is an important aspect of muscle functioning. Hence, geometry and material properties of muscle have great influence on the force–length characteristics of muscle. We compared experimental results for the gastrocnemius medialis muscle (GM) of the rat to model results of simple ge

  18. Experimental destruction of Ascarid ova in sewage sludge by accelerated electron irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Horak, Petr (Charles Univ., Prague (Czech Republic). Dept. of Parasitology)

    1994-04-01

    Aerobically-treated sewage sludge containing eggs of the nematode Ascaris suum was processed using accelerated electrons. After 8 weeks of incubation the morphological and developmental status of eggs was determined. Inhibition of development and the destruction of nematode embryos within eggs were observed at doses over 1.1 kGy. (author).

  19. Experimental destruction of Ascarid ova in sewage sludge by accelerated electron irradiation

    International Nuclear Information System (INIS)

    Aerobically-treated sewage sludge containing eggs of the nematode Ascaris suum was processed using accelerated electrons. After 8 weeks of incubation the morphological and developmental status of eggs was determined. Inhibition of development and the destruction of nematode embryos within eggs were observed at doses over 1.1 kGy. (author)

  20. Helminth Egg Removal Capacity of UASB Reactors under Subtropical Conditions

    NARCIS (Netherlands)

    Yaya-Beas, R.E.; Ayala-Limaylla, C.; Kujawa-Roeleveld, K.; Van Lier, J.B.; Zeeman, G.

    2015-01-01

    This research was conducted to study the anaerobic sludge filtration capacity regarding helminth egg removal in upflow anaerobic sludge blanket (UASB) reactors. Two 25 L lab-scale UASB reactors were operated at an ambient temperature which varied between 17.1 and 28.6 °C. Ascaris suum egg was select

  1. Myogenin Regulates Denervation-Dependent Muscle Atrophy in Mouse Soleus Muscle

    OpenAIRE

    Macpherson, Peter C. D.; Wang, Xun; Goldman, Daniel

    2011-01-01

    Muscle inactivity due to injury or disease results in muscle atrophy. The molecular mechanisms contributing to muscle atrophy are poorly understood. However, it is clear that expression of atrophy-related genes, like Atrogin-1 and MuRF-1, are intimately tied to loss of muscle mass. When these atrophy-related genes are knocked out, inactive muscles retain mass. Muscle denervation stimulates muscle atrophy and Myogenin (Myog) is a muscle-specific transcription factor that is highly induced foll...

  2. Ocho diferentes especies de parásitos gastrointestinales fueron identificadas en cerdos de traspatio en El Municipio de El Sauce - León. Nicaragua (Eight different species gastrointestinal parasites were identified in free roaming pigs in EL Sauce - Leon. Nicaragua

    Directory of Open Access Journals (Sweden)

    Luz A. Luna

    2005-10-01

    Full Text Available Este trabajo se realizó con cerdos criados en traspatio en el municipio de El Sauce, Departamento de León, Nicaragua En el primer estudio se determinó la prevalencia de Parásitos Gastrointestinales (PGI en 60 cerdos de patio sacrificados en matadero. Se identificaron 6 tipos de especies de parásitos gastrointestinales: Macrachantorinchus hirudinaceu, Oesophagustomun spp, Áscaris suum, Trichuris suis e Hyostrongylus rubidus, siendo este ultimo el de mayor prevalencia. Se determinó la prevalencia de PGI en heces de cerdos en dos grupos de edades. Se identificaron los helmintos Ascaris suum, Hyostrongylus, rubidus, Strongiloides ransomi, Oesophagostomun spp, y Trichuris suis. Los protozoos encontrados fueron Isospora suis y Eimeria sp. Con una mayor frecuencia se encontró Ascaris suum (42.86% e Hyostrongylus (39.80%, en el grupo mayor de seis meses, en el grupos menor de seis meses los más frecuentes eran Áscaris suum (48.98% y Trichuris (45.92%. La intensidad de infestación de H. rubidus fue significativamente más alto en grupo de cerdos mayores de seis y T. suis e Isospora suis tuvieron diferencia significativa en el grupo menor de seis meses. En resumen identificamos ocho especies de parásitos gastrointestinales en los cerdos de traspatio, que son de importancia económica. This work was done with free roaming pigs in El Sauce, Department of Leon, Nicaragua. In the first studies the prevalence of gastrointestinal parasites were found in 60 pigs in the slaughterhouse where there was 6 types of gastrointestinal parasites identified: Macrachantorinchus hirudinaceus, Oesophagostomun spp, Ascaris suum, Trichuris suis, Hyostrongylus rubidus, the last one with the biggest prevalence. Later the prevalence of gastrointestinal parasites in feces was found in two groups with different age, where the helminths Ascaris suum, Hyostrongylus rubidus, Strongyloides ransomi, Oesophagostomun spp, and Trichuris suis were identified. The protozoo that

  3. The interscutularis muscle connectome.

    Directory of Open Access Journals (Sweden)

    Ju Lu

    2009-02-01

    Full Text Available The complete connectional map (connectome of a neural circuit is essential for understanding its structure and function. Such maps have only been obtained in Caenorhabditis elegans. As an attempt at solving mammalian circuits, we reconstructed the connectomes of six interscutularis muscles from adult transgenic mice expressing fluorescent proteins in all motor axons. The reconstruction revealed several organizational principles of the neuromuscular circuit. First, the connectomes demonstrate the anatomical basis of the graded tensions in the size principle. Second, they reveal a robust quantitative relationship between axonal caliber, length, and synapse number. Third, they permit a direct comparison of the same neuron on the left and right sides of the same vertebrate animal, and reveal significant structural variations among such neurons, which contrast with the stereotypy of identified neurons in invertebrates. Finally, the wiring length of axons is often longer than necessary, contrary to the widely held view that neural wiring length should be minimized. These results show that mammalian muscle function is implemented with a variety of wiring diagrams that share certain global features but differ substantially in anatomical form. This variability may arise from the dominant role of synaptic competition in establishing the final circuit.

  4. Muscle GLUT4 in cirrhosis

    DEFF Research Database (Denmark)

    Holland-Fischer, Peter; Andersen, Per Heden; Lund, Sten; Pedersen, Steen Bønnelykke; Vinter-Jensen, Lars; Nielsen, Michael F; Kaal, Andreas; Dall, Rolf; Schmitz, Ole; Vilstrup, Hendrik

    2007-01-01

    test and later a muscle biopsy. Levels of GLUT4 total protein and mRNA content were determined in muscle biopsies by polyclonal antibody labelling and RT-PCR, respectively. RESULTS: GLUT4 protein content in the cirrhosis group was not different from that of the controls, but at variance with the...

  5. The Basis of Muscle Regeneration

    Directory of Open Access Journals (Sweden)

    Antonio Musarò

    2014-01-01

    Full Text Available Muscle regeneration recapitulates many aspects of embryonic myogenesis and is an important homeostatic process of the adult skeletal muscle, which, after development, retains the capacity to regenerate in response to appropriate stimuli, activating the muscle compartment of stem cells, namely, satellite cells, as well as other precursor cells. Moreover, significant evidence suggests that while stem cells represent an important determinant for tissue regeneration, a “qualified” environment is necessary to guarantee and achieve functional results. It is therefore plausible that the loss of control over these cell fate decisions could lead to a pathological transdifferentiation, leading to pathologic defects in the regenerative process. This review provides an overview about the general aspects of muscle development and discusses the cellular and molecular aspects that characterize the five interrelated and time-dependent phases of muscle regeneration, namely, degeneration, inflammation, regeneration, remodeling, and maturation/functional repair.

  6. Effect of cleaning /disinfection strategies on helminth infections in finishing pigs

    OpenAIRE

    Vermeer, Herman M.; Borgsteede, Fred H.M.; Gaasenbeek, Cor P.H.; Blanken, Klaas

    2008-01-01

    Ascaris suum is the most prevalent helminth on organic pig farms (Carstensen et al., 2002) and is transmitted mainly via the faeces. The use of anthelmintics does not fit in the organic principles and preventive measures are promoted. This project focused on assessing the efficacy of a cleaning protocol for the dunging area of pens on Ascaris s. transmission to pigs. In 4 batches with 8 identical pens for 15 pigs each (n=480 pigs) 6 pigs per pen were orally infected with Ascari...

  7. From the twig tips to the deeper branches

    DEFF Research Database (Denmark)

    Betson, Martha; Nejsum, Peter; Stothard, J. Russell

    2013-01-01

    Ascaris lumbricoides and Ascaris suum continues. From an applied perspective, however, molecular markers help to "tag" and "track" worms during their transmission cycle(s), providing new insights into host range, as well as methods for assessing parasite population dynamics through time and contingent...... upon disease control. While useful in determining dynamics at the tips of the evolutionary tree, these molecular tools also provide insights into deeper evolutionary branches. Although Ascaris is found throughout the globe, molecular analysis of worms retrieved from sub-Saharan Africa point towards a...

  8. Bio-inspired Hybrid Carbon Nanotube Muscles

    OpenAIRE

    Tae Hyeob Kim; Cheong Hoon Kwon; Changsun Lee; Jieun An; Tam Thi Thanh Phuong; Sun Hwa Park; Lima, Márcio D.; Baughman, Ray H.; Tong Mook Kang; Seon Jeong Kim

    2016-01-01

    There has been continuous progress in the development for biomedical engineering systems of hybrid muscle generated by combining skeletal muscle and artificial structure. The main factor affecting the actuation performance of hybrid muscle relies on the compatibility between living cells and their muscle scaffolds during cell culture. Here, we developed a hybrid muscle powered by C2C12 skeletal muscle cells based on the functionalized multi-walled carbon nanotubes (MWCNT) sheets coated with p...

  9. Stochastic modelling of muscle recruitment during activity

    OpenAIRE

    Martelli, S.; Calvetti, D.; Somersalo, E.; Viceconti, M.

    2015-01-01

    Muscle forces can be selected from a space of muscle recruitment strategies that produce stable motion and variable muscle and joint forces. However, current optimization methods provide only a single muscle recruitment strategy. We modelled the spectrum of muscle recruitment strategies while walking. The equilibrium equations at the joints, muscle constraints, static optimization solutions and 15-channel electromyography (EMG) recordings for seven walking cycles were taken from earlier studi...

  10. Intermuscular pressure between synergistic muscles correlates with muscle force.

    Science.gov (United States)

    Reinhardt, Lars; Siebert, Tobias; Leichsenring, Kay; Blickhan, Reinhard; Böl, Markus

    2016-08-01

    The purpose of the study was to examine the relationship between muscle force generated during isometric contractions (i.e. at a constant muscle-tendon unit length) and the intermuscular (between adjacent muscles) pressure in synergistic muscles. Therefore, the pressure at the contact area of the gastrocnemius and plantaris muscle was measured synchronously to the force of the whole calf musculature in the rabbit species Oryctolagus cuniculus Similar results were obtained when using a conductive pressure sensor, or a fibre-optic pressure transducer connected to a water-filled balloon. Both methods revealed a strong linear relationship between force and pressure in the ascending limb of the force-length relationship. The shape of the measured force-time and pressure-time traces was almost identical for each contraction (r=0.97). Intermuscular pressure ranged between 100 and 700 mbar (70,000 Pa) for forces up to 287 N. These pressures are similar to previous (intramuscular) recordings within skeletal muscles of different vertebrate species. Furthermore, our results suggest that the rise in intermuscular pressure during contraction may reduce the force production in muscle packages (compartments). PMID:27489217

  11. Muscling out malaria

    DEFF Research Database (Denmark)

    Hughes, David Peter; Boomsma, Jacobus Jan

    2006-01-01

    ) [2] highlighted the back-to-back articles in Science 3 and 4 that demonstrated the potential biocontrol of malaria by targeting mosquitoes with entomopathogenic fungi (Metarhizium and Beauveria spp.). The wide impact of the original articles and the need to find alternatives to pesticidal control are...... where malaria is endemic, humanity cannot afford shortcuts, because any failures owing to poor management or premature implementation will reduce local governmental support rather than enhance it (Andrew Read, pers. commun.). Therefore, if we are to ‘muscle out malaria', well...... key importance, and the new focus on fungal biocontrol of malaria should therefore act as a catalyst for further research on the basic biology of fungal pathogens. Understanding morphological, biochemical or immune system-based resistance to insect pathogenic fungi will be easier if we know their...

  12. Bulk muscles, loose cables.

    Science.gov (United States)

    Liyanage, Chamari R D G; Kodali, Venkata

    2014-01-01

    The accessibility and usage of body building supplements is on the rise with stronger internet marketing strategies by the industry. The dangers posed by the ingredients in them are underestimated. A healthy young man came to the emergency room with palpitations and feeling unwell. Initial history and clinical examination were non-contributory to find the cause. ECG showed atrial fibrillation. A detailed history for any over the counter or herbal medicine use confirmed that he was taking supplements to bulk muscle. One of the components in these supplements is yohimbine; the onset of symptoms coincided with the ingestion of this product and the patient is symptom free after stopping it. This report highlights the dangers to the public of consuming over the counter products with unknown ingredients and the consequential detrimental impact on health. PMID:25326558

  13. Colecistite aguda por ascaris lumbricoides Acute cholecystites for ascaris lumbricoides

    Directory of Open Access Journals (Sweden)

    Amauri Clemente da Rocha

    2006-08-01

    Full Text Available Biliary’s ascariasis is the most often ectopic site of this helminthiasis, but invasion of the worms into the gallbladder is quite rare. The autors report a case of a patient with clinical symptoms, compatible with cholecystitis induced by the worm, as shown by ultrasonography. Treatament was cholecystectomy and antihelmintic drug therapy with a good outcome.

  14. Colecistite aguda por ascaris lumbricoides Acute cholecystites for ascaris lumbricoides

    OpenAIRE

    Amauri Clemente da Rocha; Severino Lourenço da Silva Júnior; Rodrigo Fernando Lourenço de Amorim

    2006-01-01

    Biliary’s ascariasis is the most often ectopic site of this helminthiasis, but invasion of the worms into the gallbladder is quite rare. The autors report a case of a patient with clinical symptoms, compatible with cholecystitis induced by the worm, as shown by ultrasonography. Treatament was cholecystectomy and antihelmintic drug therapy with a good outcome.

  15. Muscle channelopathies and electrophysiological approach

    Directory of Open Access Journals (Sweden)

    Cherian Ajith

    2008-01-01

    Full Text Available Myotonic syndromes and periodic paralyses are rare disorders of skeletal muscle characterized mainly by muscle stiffness or episodic attacks of weakness. Familial forms are caused by mutation in genes coding for skeletal muscle voltage ionic channels. Familial periodic paralysis and nondystrophic myotonias are disorders of skeletal muscle excitability caused by mutations in genes coding for voltage-gated ion channels. These diseases are characterized by episodic failure of motor activity due to muscle weakness (paralysis or stiffness (myotonia. Clinical studies have identified two forms of periodic paralyses: hypokalemic periodic paralysis (hypoKPP and hyperkalemic periodic paralysis (hyperKPP, based on changes in serum potassium levels during the attacks, and three distinct forms of myotonias: paramyotonia congenita (PC, potassium-aggravated myotonia (PAM, and myotonia congenita (MC. PC and PAM have been linked to missense mutations in the SCN4A gene, which encodes α subunit of the voltage-gated sodium channel, whereas MC is caused by mutations in the chloride channel gene (CLCN1. Exercise is known to trigger, aggravate, or relieve symptoms. Therefore, exercise can be used as a functional test in electromyography to improve the diagnosis of these muscle disorders. Abnormal changes in the compound muscle action potential can be disclosed using different exercise tests. Five electromyographic (EMG patterns (I-V that may be used in clinical practice as guides for molecular diagnosis are discussed.

  16. Cardiac, Skeletal, and smooth muscle mitochondrial respiration

    DEFF Research Database (Denmark)

    Park, Song-Young; Gifford, Jayson R; Andtbacka, Robert H I; Hyngstrom, John R; Garten, Ryan S; Diakos, Nikolaos A; Ives, Stephen J; Dela, Flemming; Larsen, Steen; Drakos, Stavros; Richardson, Russell S

    2014-01-01

    Unlike cardiac and skeletal muscle, little is known about vascular smooth muscle mitochondrial function. Therefore, this study examined mitochondrial respiratory rates in the smooth muscle of healthy human feed arteries and compared with that of healthy cardiac and skeletal muscle. Cardiac, skele...

  17. Compensatory Hypertrophy of Skeletal Muscle: Contractile Characteristics

    Science.gov (United States)

    Ianuzzo, C. D.; Chen, V.

    1977-01-01

    Describes an experiment using rats that demonstrates contractile characteristics of normal and hypertrophied muscle. Compensatory hypertrophy of the plantaris muscle is induced by surgical removal of the synergistic gastrocnemium muscle. Includes methods for determination of contractile properties of normal and hypertrophied muscle and…

  18. Skeletal Muscle Hypertrophy after Aerobic Exercise Training

    OpenAIRE

    Konopka, Adam R.; Harber, Matthew P.

    2014-01-01

    Current dogma suggests aerobic exercise training has minimal effect on skeletal muscle size. We and others have demonstrated that aerobic exercise acutely and chronically alters protein metabolism and induces skeletal muscle hypertrophy. These findings promote an antithesis to the status quo by providing novel perspective on skeletal muscle mass regulation and insight into exercise-countermeasures for populations prone to muscle loss.

  19. Muscle glycogen stores and fatigue

    DEFF Research Database (Denmark)

    Ørtenblad, Niels; Westerblad, Håkan; Nielsen, Joachim

    2013-01-01

      Studies performed at the beginning of the last century revealed the importance of carbohydrate as a fuel during exercise, and the importance of muscle glycogen on performance has subsequently been confirmed in numerous studies. However, the link between glycogen depletion and impaired muscle...... function during fatigue is not well understood and a direct cause-and-effect relationship between glycogen and muscle function remains to be established. The use of electron microscopy has revealed that glycogen is not homogeneously distributed in skeletal muscle fibres, but rather localized in distinct...... pools. Furthermore, each glycogen granule has its own metabolic machinery with glycolytic enzymes and regulating proteins. One pool of such glycogenolytic complexes is localized within the myofibrils in close contact with key proteins involved in the excitation-contraction coupling and Ca2+ release from...

  20. Muscle dysfunction in cancer patients

    DEFF Research Database (Denmark)

    Christensen, Jesper Frank; Jones, L W; Andersen, J L;

    2014-01-01

    dysfunction is evident across all stages of the cancer trajectory. The causes of cancer-related muscle dysfunction are complex, but may involve a wide range of tumor-, therapy- and/or lifestyle-related factors, depending on the clinical setting of the individual patient. The main importance of muscle...... dysfunction in cancer patients lies in the correlation to vital clinical end points such as cancer-specific and all-cause mortality, therapy complications and quality of life (QoL). Such associations strongly emphasize the need for effective therapeutic countermeasures to be developed and implemented in...... powered to evaluate clinical outcomes associated with improvements in muscle function, or be promoted in advanced stage settings, aiming to reverse cancer-related muscle dysfunction, and thus potentially improve time-to-progression, treatment toxicity and survival....

  1. Regulation of skeletal muscle proteolysis

    OpenAIRE

    Slee, Adrian

    2005-01-01

    Proteolysis is a component of protein turnover, controlled by multiple proteolytic systems. Alterations in system components within skeletal muscle has been associated with hypertrophy, remodelling, atrophy, apoptosis and metabolic dysregulation. Key components may have novel regulatory roles, e. g. calpain-3 and cathepsin-L. Experiments described within this thesis investigated the hypothesis that the gene expression of specific proteolytic system components within skeletal muscle may be co-...

  2. Simvastatin effects on skeletal muscle

    DEFF Research Database (Denmark)

    Larsen, Steen; Stride, Nis; Hey-Mogensen, Martin;

    2013-01-01

    Glucose tolerance and skeletal muscle coenzyme Q(10) (Q(10)) content, mitochondrial density, and mitochondrial oxidative phosphorylation (OXPHOS) capacity were measured in simvastatin-treated patients (n = 10) and in well-matched control subjects (n = 9).......Glucose tolerance and skeletal muscle coenzyme Q(10) (Q(10)) content, mitochondrial density, and mitochondrial oxidative phosphorylation (OXPHOS) capacity were measured in simvastatin-treated patients (n = 10) and in well-matched control subjects (n = 9)....

  3. Putting muscle in DNA methylation

    Institute of Scientific and Technical Information of China (English)

    James P Reddington; Richard R Meehan

    2011-01-01

    Over 25 years ago seminal experiments from the labs of Peter Jones and Harold Weintraub demonstrated that alteration in the DNA modification state underlie the myogenic conversion of fibroblast cell lines [1,2].This paved the way for the identification of myogenic helix-loop-helix (HLH) proteins in muscle differentiation,but the mechanism by which DNA methylation regulates muscle differentiation has remained elusive [3].

  4. Modified muscle sparing posterolateral thoracotomy.

    OpenAIRE

    Ashour, M

    1990-01-01

    A modified posterolateral thoracotomy is described that combines the advantages of complete muscle sparing through a thoracolumbar fascial slide with excellent exposure. The technique is easy to perform. The procedure was associated with relatively little postoperative pain, coughing was effective, and early ambulation was achieved. Experience with this approach in the first 49 patients suggests that it offers an attractive alternative to the standard muscle cutting posterolateral thoracotomy...

  5. Muscle histochemistry in chronic alcoholism

    Directory of Open Access Journals (Sweden)

    M. L. Ferraz

    1989-06-01

    Full Text Available Twenty-two chronic acoholic patients were assessed by neurologic examination and muscle biopsy. The patients manifested proximal muscular weakness to a variable extent. One case presented as an acute bout of myopathy, according to the Manual Muscle Test, MMT. The most prominent histologic feature observed was muscle atrophy (95.3% better evidenced through the ATPase stain with the predominance of type II A fibers (71.4%. Lack of the mosaic pattern (type grouping seen in 76% of the cases and an important mitochondrial proliferation with intrasarcoplasmatic lipid accumulation in 63% of the patients. In case of acute presentation of muscle weakness the. pathological substrate is quite different, i.e. presence of myositis mainly interstitial characterized by lymphoplasmocytic infiltrate and several spots of necrosis like Zencker degeneration. Based on histologic criteria, our data suggest that: the main determinant of muscle weakness seen in chronic alcoholic patients is neurogenic in origin (alcoholic polineuropathy; the direct toxic action of ethanol under the skeletal muscle is closely related to the mitochondrial metabolism; the so-called acute alcoholic myopathy has probably viral etiology.

  6. Preparation and Identification of a Human Single Chain Fv Antibody Against Ascaris lumbricoides%抗蛔虫人源单链抗体库的构建及鉴定

    Institute of Scientific and Technical Information of China (English)

    何光志; 田维毅; 高英; 王平; 王文佳; 奚锦; 俞琦; 王乾宇; 黄高

    2011-01-01

    Objective To construct humanize phage antibody library against Ascaris lumbricoides and to screen specificity scFv to Ascaris lumbricoides. Methods Total RNA was abstracted from peripheral blood lympho-cytes of 20 persons, and was used to amplify VH and VL gene by RT-PCR. The amplified VH and VL genes were spliced to form scFv gene which was cloned into pCANTAB-SE phagemid, and the constructed recombinant phage-mid was transformed to E. Coli TC1 to construct human natural single-chain antibody library from which positive clones were screened. Results A primary library of 1.5 × 106 and a second library of 1.2 × 106 were constructed. Conclusion This study was to provide us the basis for radionuclide imaging and therapy for ascariasis.%目的:构建抗蛔虫人源单链抗体库,从中筛选建抗蛔虫人源特异性单链抗体.方法:分离10个患蛔虫病人的淋巴细胞,提取总RNA反转录为cDNA,PCR扩增人抗体重链(VH)和轻链(VL)可变区基因,采用SOE-PCR法将VH和VL片段随机拼接成scFv片段,并克隆入噬菌粒载体pCANTAB5E中,构建噬菌体单链抗体库.结果:初级库库容量为1.8×106,在大肠杆菌TG1中重组后得到1.6×106的次级抗体库.结论:本研究成功构建抗蛔虫人源单链抗体库,拟在为蛔虫病的预防、诊断、治疗奠定基础.

  7. Ribosome biogenesis during skeletal muscle hypertrophy

    OpenAIRE

    von Walden, Ferdinand

    2014-01-01

    Muscle adaptation to chronic resistance exercise (RE) is the result of a cumulative effect on gene expression and protein content. Following a bout of RE, muscle protein synthesis increases and, if followed by consecutive bouts (training), protein accretion and muscle hypertrophy develops. The protein synthetic capacity of the muscle is dictated by ribosome content. Therefore, the general aim of this thesis is to investigate the regulation of ribosome biogenesis during skeletal muscle hypertr...

  8. Molecular epidemiology of ascariasis

    DEFF Research Database (Denmark)

    Betson, Martha; Nejsum, Peter; Bendall, Richard P.;

    2014-01-01

    BACKGROUND: The roundworm Ascaris lumbricoides infects 0.8 billion people worldwide, and Ascaris suum infects innumerable pigs across the globe. The extent of natural cross-transmission of Ascaris between pig and human hosts in different geographical settings is unknown, warranting investigation....... METHODS: Adult Ascaris organisms were obtained from humans and pigs in Europe, Africa, Asia, and Latin America. Barcodes were assigned to 536 parasites on the basis of sequence analysis of the mitochondrial cytochrome c oxidase I gene. Genotyping of 410 worms was also conducted using a panel of...... microsatellite markers. Phylogenetic, population genetic, and Bayesian assignment methods were used for analysis. RESULTS: There was marked genetic segregation between worms originating from human hosts and those originating from pig hosts. However, human Ascaris infections in Europe were of pig origin, and...

  9. Effect of acupuncture depth on muscle pain

    Directory of Open Access Journals (Sweden)

    Kitakoji Hiroshi

    2011-06-01

    Full Text Available Abstract Background While evidence supports efficacy of acupuncture and/or dry needling in treating musculoskeletal pain, it is unclear which needling method is most effective. This study aims to determine the effects of depth of needle penetration on muscle pain. Methods A total of 22 healthy volunteers performed repeated eccentric contractions to induce muscle soreness in their extensor digital muscle. Subjects were assigned randomly to four groups, namely control group, skin group (depth of 3 mm: the extensor digital muscle, muscle group (depth of 10 mm: the extensor digital muscle and non-segmental group (depth of 10 mm: the anterior tibial muscle. Pressure pain threshold and electrical pain threshold of the skin, fascia and muscle were measured at a point 20 mm distal to the maximum tender point on the second day after the exercise. Results Pressure pain thresholds of skin group (depth of 3 mm: the extensor digital muscle and muscle group (depth of 10 mm: the extensor digital muscle were significantly higher than the control group, whereas the electrical pain threshold at fascia of muscle group (depth of 10 mm: the extensor digital muscle was a significantly higher than control group; however, there was no significant difference between the control and other groups. Conclusion The present study shows that acupuncture stimulation of muscle increases the PPT and EPT of fascia. The depth of needle penetration is important for the relief of muscle pain.

  10. Skeletal muscle fiber type: using insights from muscle developmental biology to dissect targets for susceptibility and resistance to muscle disease.

    Science.gov (United States)

    Talbot, Jared; Maves, Lisa

    2016-07-01

    Skeletal muscle fibers are classified into fiber types, in particular, slow twitch versus fast twitch. Muscle fiber types are generally defined by the particular myosin heavy chain isoforms that they express, but many other components contribute to a fiber's physiological characteristics. Skeletal muscle fiber type can have a profound impact on muscle diseases, including certain muscular dystrophies and sarcopenia, the aging-induced loss of muscle mass and strength. These findings suggest that some muscle diseases may be treated by shifting fiber type characteristics either from slow to fast, or fast to slow phenotypes, depending on the disease. Recent studies have begun to address which components of muscle fiber types mediate their susceptibility or resistance to muscle disease. However, for many diseases it remains largely unclear why certain fiber types are affected. A substantial body of work has revealed molecular pathways that regulate muscle fiber type plasticity and early developmental muscle fiber identity. For instance, recent studies have revealed many factors that regulate muscle fiber type through modulating the activity of the muscle regulatory transcription factor MYOD1. Future studies of muscle fiber type development in animal models will continue to enhance our understanding of factors and pathways that may provide therapeutic targets to treat muscle diseases. WIREs Dev Biol 2016, 5:518-534. doi: 10.1002/wdev.230 For further resources related to this article, please visit the WIREs website. PMID:27199166

  11. Effects of Massage on Delayed-Onset Muscle Soreness, Swelling, and Recovery of Muscle Function

    OpenAIRE

    Zainuddin, Zainal; Newton, Mike; Sacco, Paul; Nosaka, Kazunori

    2005-01-01

    Context: Delayed-onset muscle soreness (DOMS) describes muscle pain and tenderness that typically develop several hours postexercise and consist of predominantly eccentric muscle actions, especially if the exercise is unfamiliar. Although DOMS is likely a symptom of eccentric-exercise–induced muscle damage, it does not necessarily reflect muscle damage. Some prophylactic or therapeutic modalities may be effective only for alleviating DOMS, whereas others may enhance recovery of muscle functio...

  12. The effect of muscle fatigue on the behavior of single muscle fibre

    OpenAIRE

    Číhalová L.

    2007-01-01

    The aim of this study is to integrate the effect of muscle fatigue into skeletal muscle fibre model. The base of the skeletal muscle model previously developed in our laboratory is the sliding cross bridge theory of contraction. The calcium activation, which is the base stone for the contraction, is integrated. The muscle fatigue is often described as a decline in the muscle ability to generate force. It is the result of the sustained contraction of long duration. Generally, muscle fatigue is...

  13. Muscle synergy space: learning model to create an optimal muscle synergy

    OpenAIRE

    Alnajjar, Fady; Wojtara, Tytus; Kimura, Hidenori; Shimoda, Shingo

    2013-01-01

    Muscle redundancy allows the central nervous system (CNS) to choose a suitable combination of muscles from a number of options. This flexibility in muscle combinations allows for efficient behaviors to be generated in daily life. The computational mechanism of choosing muscle combinations, however, remains a long-standing challenge. One effective method of choosing muscle combinations is to create a set containing the muscle combinations of only efficient behaviors, and then to choose combina...

  14. Regulation of skeletal muscle perfusion during exercise

    Science.gov (United States)

    Delp, M. D.; Laughlin, M. H.

    1998-01-01

    For exercise to be sustained, it is essential that adequate blood flow be provided to skeletal muscle. The local vascular control mechanisms involved in regulating muscle perfusion during exercise include metabolic control, endothelium-mediated control, propagated responses, myogenic control, and the muscle pump. The primary determinant of muscle perfusion during sustained exercise is the metabolic rate of the muscle. Metabolites from contracting muscle diffuse to resistance arterioles and act directly to induce vasodilation, or indirectly to inhibit noradrenaline release from sympathetic nerve endings and oppose alpha-adrenoreceptor-mediated vasoconstriction. The vascular endothelium also releases vasodilator substances (e.g., prostacyclin and nitric oxide) that are prominent in establishing basal vascular tone, but these substances do not appear to contribute to the exercise hyperemia in muscle. Endothelial and smooth muscle cells may also be involved in propagating vasodilator signals along arterioles to parent and daughter vessels. Myogenic autoregulation does not appear to be involved in the exercise hyperemia in muscle, but the rhythmic propulsion of blood from skeletal muscle veins facilitates venous return to the heart and muscle perfusion. It appears that the primary determinants of sustained exercise hyperemia in skeletal muscle are metabolic vasodilation and increased vascular conductance via the muscle pump. Additionally, sympathetic neural control is important in regulating muscle blood flow during exercise.

  15. Choosing a skeletal muscle relaxant.

    Science.gov (United States)

    See, Sharon; Ginzburg, Regina

    2008-08-01

    Skeletal muscle relaxants are widely used in treating musculoskeletal conditions. However, evidence of their effectiveness consists mainly of studies with poor methodologic design. In addition, these drugs have not been proven to be superior to acetaminophen or nonsteroidal anti-inflammatory drugs for low back pain. Systematic reviews and meta-analyses support using skeletal muscle relaxants for short-term relief of acute low back pain when nonsteroidal anti-inflammatory drugs or acetaminophen are not effective or tolerated. Comparison studies have not shown one skeletal muscle relaxant to be superior to another. Cyclobenzaprine is the most heavily studied and has been shown to be effective for various musculoskeletal conditions. The sedative properties of tizanidine and cyclobenzaprine may benefit patients with insomnia caused by severe muscle spasms. Methocarbamol and metaxalone are less sedating, although effectiveness evidence is limited. Adverse effects, particularly dizziness and drowsiness, are consistently reported with all skeletal muscle relaxants. The potential adverse effects should be communicated clearly to the patient. Because of limited comparable effectiveness data, choice of agent should be based on side-effect profile, patient preference, abuse potential, and possible drug interactions. PMID:18711953

  16. Structure–function relationship of skeletal muscle provides inspiration for design of new artificial muscle

    International Nuclear Information System (INIS)

    A variety of actuator technologies have been developed to mimic biological skeletal muscle that generates force in a controlled manner. Force generation process of skeletal muscle involves complicated biophysical and biochemical mechanisms; therefore, it is impossible to replace biological muscle. In biological skeletal muscle tissue, the force generation of a muscle depends not only on the force generation capacity of the muscle fiber, but also on many other important factors, including muscle fiber type, motor unit recruitment, architecture, structure and morphology of skeletal muscle, all of which have significant impact on the force generation of the whole muscle or force transmission from muscle fibers to the tendon. Such factors have often been overlooked, but can be incorporated in artificial muscle design, especially with the discovery of new smart materials and the development of innovative fabrication and manufacturing technologies. A better understanding of the physiology and structure–function relationship of skeletal muscle will therefore benefit the artificial muscle design. In this paper, factors that affect muscle force generation are reviewed. Mathematical models used to model the structure–function relationship of skeletal muscle are reviewed and discussed. We hope the review will provide inspiration for the design of a new generation of artificial muscle by incorporating the structure–function relationship of skeletal muscle into the design of artificial muscle. (topical review)

  17. CORRELATIONS BETWEEN MUSCLE MASS, MUSCLE STRENGTH, PHYSICAL PERFORMANCE, AND MUSCLE FATIGUE RESISTANCE IN COMMUNITY-DWELLING ELDERLY SUBJECTS

    Directory of Open Access Journals (Sweden)

    Elizabeth

    2016-03-01

    Full Text Available Objective: To determine the correlations between muscle mass, muscle strength, physical performance, and muscle fatigue resistance in community-dwelling elderly people in order to elucidate factors which contribute to elderly’s performance of daily activities. Methods: A cross-sectional study was conducted on community-dwelling elderly in Bandung from September to December 2014. One hundred and thirty elderly, 60 years old or above, were evaluated using bioelectrical impedance analysis to measure muscle mass; grip strength to measure muscle strength and muscle fatigue resistance; habitual gait speed to measure physical performance; and Global Physical Activity Questionnaire (GPAQ to assess physical activity. Results: There were significant positive correlations between muscle mass (r=0,27, p=0,0019, muscle strength (r=0,26, p=0,0024, and physical performance (r=0,32, p=0,0002 with muscle fatigue resistance. Physical performance has the highest correlation based on multiple regression test (p=0,0025. In association with muscle mass, the physical activity showed a significant positive correlation (r=0,42, p=0,0000. Sarcopenia was identified in 19 (14.61% of 130 subjects. Conclusions: It is suggested that muscle mass, muscle strength, and physical performance influence muscle fatigue resistance.

  18. Exercise Promotes Healthy Aging of Skeletal Muscle.

    Science.gov (United States)

    Cartee, Gregory D; Hepple, Russell T; Bamman, Marcas M; Zierath, Juleen R

    2016-06-14

    Primary aging is the progressive and inevitable process of bodily deterioration during adulthood. In skeletal muscle, primary aging causes defective mitochondrial energetics and reduced muscle mass. Secondary aging refers to additional deleterious structural and functional age-related changes caused by diseases and lifestyle factors. Secondary aging can exacerbate deficits in mitochondrial function and muscle mass, concomitant with the development of skeletal muscle insulin resistance. Exercise opposes deleterious effects of secondary aging by preventing the decline in mitochondrial respiration, mitigating aging-related loss of muscle mass and enhancing insulin sensitivity. This review focuses on mechanisms by which exercise promotes "healthy aging" by inducing modifications in skeletal muscle. PMID:27304505

  19. Partial muscle carnitine palmitoyltransferase-A deficiency

    Energy Technology Data Exchange (ETDEWEB)

    Ross, N.S.; Hoppel, C.L.

    1987-01-02

    After initiation of ibuprofen therapy, a 45-year-old woman developed muscle weakness and tenderness with rhabdomyolysis, culminating in respiratory failure. A muscle biopsy specimen showed a vacuolar myopathy, and markedly decreased muscle carnitine content and carnitine palmitoyltransferase activity. Following recovery, muscle carnitine content was normal but carnitine palmitoyltransferase activity was still abnormally low. The ratio of palmitoyl-coenzyme A plus carnitine to palmitoylcarnitine oxidation by muscle mitochondria isolated from the patient was markedly decreased. The authors conclude that transiently decreased muscle carnitine content interacted with partial deficiency of carnitine palmitoyltransferase-A to produce rhabdomyolysis and respiratory failure and that ibuprofen may have precipitated the clinical event.

  20. Partial muscle carnitine palmitoyltransferase-A deficiency

    International Nuclear Information System (INIS)

    After initiation of ibuprofen therapy, a 45-year-old woman developed muscle weakness and tenderness with rhabdomyolysis, culminating in respiratory failure. A muscle biopsy specimen showed a vacuolar myopathy, and markedly decreased muscle carnitine content and carnitine palmitoyltransferase activity. Following recovery, muscle carnitine content was normal but carnitine palmitoyltransferase activity was still abnormally low. The ratio of palmitoyl-coenzyme A plus carnitine to palmitoylcarnitine oxidation by muscle mitochondria isolated from the patient was markedly decreased. The authors conclude that transiently decreased muscle carnitine content interacted with partial deficiency of carnitine palmitoyltransferase-A to produce rhabdomyolysis and respiratory failure and that ibuprofen may have precipitated the clinical event

  1. Cricopharyngeal muscle hypertrophy: radiologic-anatomic correlation.

    Science.gov (United States)

    Torres, W E; Clements, J L; Austin, G E; Knight, K

    1984-05-01

    There is a divergence of opinion concerning the cricopharyngeal muscle defect commonly seen in the pharyngoesophageal area on barium esophagram. Some observers believe this defect is the result of neuromuscular dysfunction with the demonstration of the unrelaxed muscle bundle; however, others believe it is the result of actual hypertrophy of the cricopharyngeal muscle. Radiologic and pathologic study of 24 unselected autopsy cases revealed cricopharyngeal hypertrophy in 13 cases by radiologic criteria. Histologic examination revealed that the cricopharyngeal muscle thickness was uniformly greater in these cases than in the radiographically normal cases. The cricopharyngeal muscle defect is associated with actual hypertrophy of the cricopharyngeal muscle in many cases. PMID:6609574

  2. [Myalgia of the masticatory muscles].

    Science.gov (United States)

    Schindler, H J; Türp, J C

    2009-06-01

    Masticatory muscle pain can be regarded as a regional manifestation of musculoskeletal disorders similar to those observed in other body regions. Along with temporomandibular joint pain and some painless disturbances related to mandibular mobility they are subsumed under the term temporomandibular disorders (TMD). Masticatory muscle pain is assumed to be associated with a variety of biophysiological risk factors. Valid diagnostic instruments make it possible to differentiate between the various TMD subgroups. In most cases, masticatory muscle pain can be treated/managed successfully. In a considerable number of patients, however, the pain persists over a long period of time despite therapeutic interventions. Understanding of the underlying neurobiological background of acute and chronic pain may help in therapeutic decision-making and evaluation of the therapeutic effects. PMID:19551421

  3. Spontaneous waves in muscle fibres

    International Nuclear Information System (INIS)

    Mechanical oscillations are important for many cellular processes, e.g. the beating of cilia and flagella or the sensation of sound by hair cells. These dynamic states originate from spontaneous oscillations of molecular motors. A particularly clear example of such oscillations has been observed in muscle fibers under non-physiological conditions. In that case, motor oscillations lead to contraction waves along the fiber. By a macroscopic analysis of muscle fiber dynamics we find that the spontaneous waves involve non-hydrodynamic modes. A simple microscopic model of sarcomere dynamics highlights mechanical aspects of the motor dynamics and fits with the experimental observations

  4. Leaky channels make weak muscles

    OpenAIRE

    George, Alfred L.

    2012-01-01

    Mutations in the skeletal muscle voltage-gated calcium channel (CaV1.1) have been associated with hypokalemic periodic paralysis, but how the pathogenesis of this disorder relates to the functional consequences of mutations was unclear. In this issue of the JCI, Wu and colleagues recapitulate the disease by generating a novel knock-in CaV1.1 mutant mouse and use this model to investigate the cellular and molecular features of pathogenesis. They demonstrated an aberrant muscle cell current con...

  5. Spontaneous waves in muscle fibres

    CERN Document Server

    Gunther, Stefan; 10.1088/1367-2630/9/11/417

    2009-01-01

    Mechanical oscillations are important for many cellular processes, e.g. the beating of cilia and flagella or the sensation of sound by hair cells. These dynamic states originate from spontaneous oscillations of molecular motors. A particularly clear example of such oscillations has been observed in muscle fibers under non-physiological conditions. In that case, motor oscillations lead to contraction waves along the fiber. By a macroscopic analysis of muscle fiber dynamics we find that the spontaneous waves involve non-hydrodynamic modes. A simple microscopic model of sarcomere dynamics highlights mechanical aspects of the motor dynamics and fits with the experimental observations.

  6. Therapeutic approaches for muscle wasting disorders.

    Science.gov (United States)

    Lynch, Gordon S; Schertzer, Jonathan D; Ryall, James G

    2007-03-01

    Muscle wasting and weakness are common in many disease states and conditions including aging, cancer cachexia, sepsis, denervation, disuse, inactivity, burns, HIV-acquired immunodeficiency syndrome (AIDS), chronic kidney or heart failure, unloading/microgravity, and muscular dystrophies. Although the maintenance of muscle mass is generally regarded as a simple balance between protein synthesis and protein degradation, these mechanisms are not strictly independent, but in fact they are coordinated by a number of different and sometimes complementary signaling pathways. Clearer details are now emerging about these different molecular pathways and the extent to which these pathways contribute to the etiology of various muscle wasting disorders. Therapeutic strategies for attenuating muscle wasting and improving muscle function vary in efficacy. Exercise and nutritional interventions have merit for slowing the rate of muscle atrophy in some muscle wasting conditions, but in most cases they cannot halt or reverse the wasting process. Hormonal and/or other drug strategies that can target key steps in the molecular pathways that regulate protein synthesis and protein degradation are needed. This review describes the signaling pathways that maintain muscle mass and provides an overview of some of the major conditions where muscle wasting and weakness are indicated. The review provides details on some therapeutic strategies that could potentially attenuate muscle atrophy, promote muscle growth, and ultimately improve muscle function. The emphasis is on therapies that can increase muscle mass and improve functional outcomes that will ultimately lead to improvement in the quality of life for affected patients. PMID:17258813

  7. Lack of CFTR in Skeletal Muscle Predisposes to Muscle Wasting and Diaphragm Muscle Pump Failure in Cystic Fibrosis Mice

    OpenAIRE

    Maziar Divangahi; Haouaria Balghi; Gawiyou Danialou; Comtois, Alain S.; Alexandre Demoule; Sheila Ernest; Christina Haston; Renaud Robert; Hanrahan, John W.; Danuta Radzioch; Petrof, Basil J

    2009-01-01

    Cystic fibrosis (CF) patients often have reduced mass and strength of skeletal muscles, including the diaphragm, the primary muscle of respiration. Here we show that lack of the CF transmembrane conductance regulator (CFTR) plays an intrinsic role in skeletal muscle atrophy and dysfunction. In normal murine and human skeletal muscle, CFTR is expressed and co-localized with sarcoplasmic reticulum-associated proteins. CFTR-deficient myotubes exhibit augmented levels of intracellular calcium aft...

  8. A Case Report of the Angiosarcoma Involving Epicranial Muscle and Fascia : Is the Occipitofrontalis Muscle Composed of Two Different Muscles?

    OpenAIRE

    Kim, Ho Kyun; Lee, Hui Joong

    2016-01-01

    The occipitofrontalis muscle is generally regarded as one muscle composed of two muscle bellies joined through the galea aponeurotica. However, two muscle bellies have different embryological origin, anatomical function and innervations. We report a case of angiosarcoma of the scalp in a 63-year-old man whose MR showed that the superficial fascia overlying the occipital belly becomes the temporoparietal fascia and ends at the superior end of the frontal belly. Beneath the superficial fascia, ...

  9. Increased skeletal muscle capillarization enhances insulin sensitivity

    DEFF Research Database (Denmark)

    Åkerström, Thorbjörn; Laub, Lasse; Vedel, Kenneth;

    2014-01-01

    Increased skeletal muscle capillarization is associated with improved glucose tolerance and insulin sensitivity. However, a possible causal relationship has not previously been identified. We therefore investigated whether increased skeletal muscle capillarization increases insulin sensitivity. S...

  10. Bones, Muscles, and Joints: The Musculoskeletal System

    Science.gov (United States)

    ... Story" 5 Things to Know About Zika & Pregnancy Bones, Muscles, and Joints KidsHealth > For Parents > Bones, Muscles, ... able to stand, walk, run, or even sit. Bones and What They Do From our head to ...

  11. Magnetic resonance imaging of facial muscles

    Energy Technology Data Exchange (ETDEWEB)

    Farrugia, M.E. [Department of Clinical Neurology, University of Oxford, Radcliffe Infirmary, Oxford (United Kingdom)], E-mail: m.e.farrugia@doctors.org.uk; Bydder, G.M. [Department of Radiology, University of California, San Diego, CA 92103-8226 (United States); Francis, J.M.; Robson, M.D. [OCMR, Department of Cardiovascular Medicine, University of Oxford, John Radcliffe Hospital, Oxford (United Kingdom)

    2007-11-15

    Facial and tongue muscles are commonly involved in patients with neuromuscular disorders. However, these muscles are not as easily accessible for biopsy and pathological examination as limb muscles. We have previously investigated myasthenia gravis patients with MuSK antibodies for facial and tongue muscle atrophy using different magnetic resonance imaging sequences, including ultrashort echo time techniques and image analysis tools that allowed us to obtain quantitative assessments of facial muscles. This imaging study had shown that facial muscle measurement is possible and that useful information can be obtained using a quantitative approach. In this paper we aim to review in detail the methods that we applied to our study, to enable clinicians to study these muscles within the domain of neuromuscular disease, oncological or head and neck specialties. Quantitative assessment of the facial musculature may be of value in improving the understanding of pathological processes occurring within facial muscles in certain neuromuscular disorders.

  12. STRUCTURAL ALTERATIONS OF SKELETAL MUSCLE IN COPD

    Directory of Open Access Journals (Sweden)

    Sunita eMathur

    2014-03-01

    Full Text Available Background: Chronic obstructive pulmonary disease (COPD is a respiratory disease associated with a systemic inflammatory response. Peripheral muscle dysfunction has been well characterized in individuals with COPD and results from a complex interaction between systemic and local factors. Objective: In this narrative review, we will describe muscle wasting in people with COPD, the associated structural changes, muscle regenerative capacity and possible mechanisms for muscle wasting. We will also discuss how structural changes relate to impaired muscle function and mobility in people with COPD. Key Observations: Approximately 30-40% of individuals with COPD experience muscle mass depletion. Furthermore, muscle atrophy is a predictor of physical function and mortality in this population. Associated structural changes include a decreased proportion and size of type-I fibers, reduced oxidative capacity and mitochondrial density mainly in the quadriceps. Observations related to impaired muscle regenerative capacity in individuals with COPD include a lower proportion of central nuclei in the presence or absence of muscle atrophy and decreased maximal telomere length, which has been correlated with reduced muscle cross-sectional area. Potential mechanisms for muscle wasting in COPD may include excessive production of reactive oxygen species, altered amino acid metabolism and lower expression of peroxisome proliferator-activated receptors-gamma-coactivator 1-alpha mRNA. Despite a moderate relationship between muscle atrophy and function, impairments in oxidative metabolism only seems weakly related to muscle function. Conclusion: This review article demonstrates the cellular modifications in the peripheral muscle of people with COPD and describes the evidence of its relationship to muscle function. Future research will focus on rehabilitation strategies to improve muscle wasting and maximize function.

  13. Asymmetric deformation of contracting human gastrocnemius muscle

    OpenAIRE

    Kinugasa, Ryuta; Hodgson, John A.; Edgerton, V. Reggie; Sinha, Shantanu

    2011-01-01

    Muscle fiber deformation is related to its cellular structure, as well as its architectural arrangement within the musculoskeletal system. While playing an important role in aponeurosis displacement, and efficiency of force transmission to the tendon, such deformation also provides important clues about the underlying mechanical structure of the muscle. We hypothesized that muscle fiber cross section would deform asymmetrically to satisfy the observed constant volume of muscle during a contra...

  14. Hydrostatic compression in glycerinated rabbit muscle fibers.

    OpenAIRE

    Ranatunga, K.W.; Fortune, N S; Geeves, M A

    1990-01-01

    Glycerinated muscle fibers isolated from rabbit psoas muscle, and a number of other nonmuscle elastic fibers including glass, rubber, and collagen, were exposed to hydrostatic pressures of up to 10 MPa (100 Atm) to determine the pressure sensitivity of their isometric tension. The isometric tension of muscle fibers in the relaxed state (passive tension) was insensitive to increased pressure, whereas the muscle fiber tension in rigor state increased linearly with pressure. The tension of all o...

  15. Collagen quantification across human skeletal muscles

    OpenAIRE

    Lin, Evie Ya Hui

    2011-01-01

    Intramuscular connective tissue provides structural stability and facilitates force transmission in skeletal muscle. Additionally, it contains extracellular matrix that is crucial for muscle development and regeneration¹. Alterations of collagen content within intramuscular connective tissue have been associated with aging or diseased muscle ²,³. Data of baseline collagen content among different muscles, to provide deeper understanding of normal muscular functions, does not exist. Hence the a...

  16. Finger Muscle Control in Children with Dystonia

    OpenAIRE

    Young, Scott J.; Van Doornik, Johan; Terence D Sanger

    2011-01-01

    Childhood dystonia is a disorder that involves inappropriate muscle activation during attempts at voluntary movement. Few studies have investigated the muscle activity associated with dystonia in children, and none have done so in the hands. In this study, we measured surface electromyographic activity in four intrinsic hand muscles while participants attempted to perform an isometric tracking task using one of the muscles. Children with dystonia had greater tracking error with the task-relat...

  17. Common muscle synergies for balance and walking

    OpenAIRE

    Chvatal, Stacie A.; Ting, Lena H.

    2013-01-01

    Little is known about the integration of neural mechanisms for balance and locomotion. Muscle synergies have been studied independently in standing balance and walking, but not compared. Here, we hypothesized that reactive balance and walking are mediated by a common set of lower-limb muscle synergies. In humans, we examined muscle activity during multidirectional support-surface perturbations during standing and walking, as well as unperturbed walking at two speeds. We show that most muscle ...

  18. Muscle after spinal cord injury

    DEFF Research Database (Denmark)

    Biering-Sørensen, Bo; Kristensen, Ida Bruun; Kjaer, Michael;

    2009-01-01

    The morphological and contractile changes of muscles below the level of the lesion after spinal cord injury (SCI) are dramatic. In humans with SCI, a fiber-type transformation away from type I begins 4-7 months post-SCI and reaches a new steady state with predominantly fast glycolytic IIX fibers...

  19. Skeletal muscle involvement in cardiomyopathies.

    Science.gov (United States)

    Limongelli, Giuseppe; D'Alessandro, Raffaella; Maddaloni, Valeria; Rea, Alessandra; Sarkozy, Anna; McKenna, William J

    2013-12-01

    The link between heart and skeletal muscle disorders is based on similar molecular, anatomical and clinical features, which are shared by the 'primary' cardiomyopathies and 'primary' neuromuscular disorders. There are, however, some peculiarities that are typical of cardiac and skeletal muscle disorders. Skeletal muscle weakness presenting at any age may indicate a primary neuromuscular disorder (associated with creatine kinase elevation as in dystrophinopathies), a mitochondrial disease (particularly if encephalopathy, ocular myopathy, retinitis, neurosensorineural deafness, lactic acidosis are present), a storage disorder (progressive exercise intolerance, cognitive impairment and retinitis pigmentosa, as in Danon disease), or metabolic disorders (hypoglycaemia, metabolic acidosis, hyperammonaemia or other specific biochemical abnormalities). In such patients, skeletal muscle weakness usually precedes the cardiomyopathy and dominates the clinical picture. Nevertheless, skeletal involvement may be subtle, and the first clinical manifestation of a neuromuscular disorder may be the occurrence of heart failure, conduction disorders or ventricular arrhythmias due to cardiomyopathy. ECG and echocardiogram, and eventually, a more detailed cardiovascular evaluation may be required to identify early cardiac involvement. Paediatric and adult cardiologists should be proactive in screening for neuromuscular and related disorders to enable diagnosis in probands and evaluation of families with a focus on the identification of those at risk of cardiac arrhythmia and emboli who may require specific prophylactic treatments, for example, pacemaker, implantable cardioverter-defibrillator and anticoagulation. PMID:24149064

  20. Novel Analog For Muscle Deconditioning

    Science.gov (United States)

    Ploutz-Snyder, Lori; Ryder, Jeff; Buxton, Roxanne; Redd. Elizabeth; Scott-Pandorf, Melissa; Hackney, Kyle; Fiedler, James; Ploutz-Snyder, Robert; Bloomberg, Jacob

    2011-01-01

    Existing models (such as bed rest) of muscle deconditioning are cumbersome and expensive. We propose a new model utilizing a weighted suit to manipulate strength, power, or endurance (function) relative to body weight (BW). Methods: 20 subjects performed 7 occupational astronaut tasks while wearing a suit weighted with 0-120% of BW. Models of the full relationship between muscle function/BW and task completion time were developed using fractional polynomial regression and verified by the addition of pre-and postflightastronaut performance data for the same tasks. Splineregression was used to identify muscle function thresholds below which task performance was impaired. Results: Thresholds of performance decline were identified for each task. Seated egress & walk (most difficult task) showed thresholds of leg press (LP) isometric peak force/BW of 18 N/kg, LP power/BW of 18 W/kg, LP work/BW of 79 J/kg, isokineticknee extension (KE)/BW of 6 Nm/kg, and KE torque/BW of 1.9 Nm/kg.Conclusions: Laboratory manipulation of relative strength has promise as an appropriate analog for spaceflight-induced loss of muscle function, for predicting occupational task performance and establishing operationally relevant strength thresholds.

  1. Metabolic Adaptation to Muscle Ischemia

    Science.gov (United States)

    Cabrera, Marco E.; Coon, Jennifer E.; Kalhan, Satish C.; Radhakrishnan, Krishnan; Saidel, Gerald M.; Stanley, William C.

    2000-01-01

    Although all tissues in the body can adapt to varying physiological/pathological conditions, muscle is the most adaptable. To understand the significance of cellular events and their role in controlling metabolic adaptations in complex physiological systems, it is necessary to link cellular and system levels by means of mechanistic computational models. The main objective of this work is to improve understanding of the regulation of energy metabolism during skeletal/cardiac muscle ischemia by combining in vivo experiments and quantitative models of metabolism. Our main focus is to investigate factors affecting lactate metabolism (e.g., NADH/NAD) and the inter-regulation between carbohydrate and fatty acid metabolism during a reduction in regional blood flow. A mechanistic mathematical model of energy metabolism has been developed to link cellular metabolic processes and their control mechanisms to tissue (skeletal muscle) and organ (heart) physiological responses. We applied this model to simulate the relationship between tissue oxygenation, redox state, and lactate metabolism in skeletal muscle. The model was validated using human data from published occlusion studies. Currently, we are investigating the difference in the responses to sudden vs. gradual onset ischemia in swine by combining in vivo experimental studies with computational models of myocardial energy metabolism during normal and ischemic conditions.

  2. Integrated expression analysis of muscle hypertrophy identifies Asb2 as a negative regulator of muscle mass

    Science.gov (United States)

    Davey, Jonathan R.; Watt, Kevin I.; Parker, Benjamin L.; Chaudhuri, Rima; Ryall, James G.; Cunningham, Louise; Qian, Hongwei; Sartorelli, Vittorio; Sandri, Marco; Chamberlain, Jeffrey; James, David E.; Gregorevic, Paul

    2016-01-01

    The transforming growth factor-β (TGF-β) signaling network is a critical regulator of skeletal muscle mass and function and, thus, is an attractive therapeutic target for combating muscle disease, but the underlying mechanisms of action remain undetermined. We report that follistatin-based interventions (which modulate TGF-β network activity) can promote muscle hypertrophy that ameliorates aging-associated muscle wasting. However, the muscles of old sarcopenic mice demonstrate reduced response to follistatin compared with healthy young-adult musculature. Quantitative proteomic and transcriptomic analyses of young-adult muscles identified a transcription/translation signature elicited by follistatin exposure, which included repression of ankyrin repeat and SOCS box protein 2 (Asb2). Increasing expression of ASB2 reduced muscle mass, thereby demonstrating that Asb2 is a TGF-β network–responsive negative regulator of muscle mass. In contrast to young-adult muscles, sarcopenic muscles do not exhibit reduced ASB2 abundance with follistatin exposure. Moreover, preventing repression of ASB2 in young-adult muscles diminished follistatin-induced muscle hypertrophy. These findings provide insight into the program of transcription and translation events governing follistatin-mediated adaptation of skeletal muscle attributes and identify Asb2 as a regulator of muscle mass implicated in the potential mechanistic dysfunction between follistatin-mediated muscle growth in young and old muscles.

  3. Impaired muscle glycogen resynthesis after a marathon is not caused by decreased muscle GLUT-4 content

    DEFF Research Database (Denmark)

    Asp, S; Rohde, T; Richter, Erik

    1997-01-01

    Our purpose was to investigate whether the slow rate of muscle glycogen resynthesis after a competitive marathon is associated with a decrease in the total muscle content of the muscle glucose transporter (GLUT-4). Seven well-trained marathon runners participated in the study, and muscle biopsies...

  4. Muscle fatigue in fibromyalgia is in the brain, not in the muscles

    DEFF Research Database (Denmark)

    Bandak, Elisabeth; Amris, Kirstine; Bliddal, Henning;

    2013-01-01

    To investigate relationships between perceived and objectively measured muscle fatigue during exhausting muscle contractions in women with fibromyalgia (FM) compared with healthy controls (HC).......To investigate relationships between perceived and objectively measured muscle fatigue during exhausting muscle contractions in women with fibromyalgia (FM) compared with healthy controls (HC)....

  5. Distribution of veterinary drug residues among muscles

    Science.gov (United States)

    The U.S. Food and Drug Administration sets tolerances for veterinary drug residues in muscle, but does not specify which muscle should be sampled for analysis. The goal of this research was to determine if antibiotic residue levels are dependent on muscle type. In this study, penicillin G (Pen G) d...

  6. Muscle MRI findings in facioscapulohumeral muscular dystrophy

    International Nuclear Information System (INIS)

    Facioscapulohumeral muscular dystrophy (FSHD) is characterized by extremely variable degrees of facial, scapular and lower limb muscle involvement. Clinical and genetic determination can be difficult, as molecular analysis is not always definitive, and other similar muscle disorders may have overlapping clinical manifestations. Whole-body muscle MRI examination for fat infiltration, atrophy and oedema was performed to identify specific patterns of muscle involvement in FSHD patients (30 subjects), and compared to a group of control patients (23) affected by other myopathies (NFSHD). In FSHD patients, we detected a specific pattern of muscle fatty replacement and atrophy, particularly in upper girdle muscles. The most frequently affected muscles, including paucisymptomatic and severely affected FSHD patients, were trapezius, teres major and serratus anterior. Moreover, asymmetric muscle involvement was significantly higher in FSHD as compared to NFSHD patients. In conclusion, muscle MRI is very sensitive for identifying a specific pattern of involvement in FSHD patients and in detecting selective muscle involvement of non-clinically testable muscles. Muscle MRI constitutes a reliable tool for differentiating FSHD from other muscular dystrophies to direct diagnostic molecular analysis, as well as to investigate FSHD natural history and follow-up of the disease. (orig.)

  7. Mechanical modeling of skeletal muscle functioning.

    NARCIS (Netherlands)

    Linden, van der Bart Jochem Julius Joost

    1998-01-01

    For movement of body or body segments is combined effort needed of the central nervous system and the muscular-skeletal system. This thesis deals with the mechanical functioning of skeletal muscle. That muscles come in a large variety of geometries, suggest the existence of a relation between muscle

  8. Immunity to Trichinella spiralis muscle infection

    OpenAIRE

    Fabre, M.V.; Beiting, D.P.; Bliss, S.K.; Appleton, J. A.

    2008-01-01

    Trichinella spiralis larvae establish chronic infections in skeletal muscles of immunocompetent hosts. Muscle infection is crucial to transmission and survival of the parasite in nature. Chronic infections by this highly immunogenic parasite are associated with modulation or escape from potentially destructive immune responses. This review summarizes our current knowledge of immunity to muscle infection with T. spiralis.

  9. Calcium dynamics in vascular smooth muscle

    OpenAIRE

    Amberg, Gregory C.; Navedo, Manuel F.

    2013-01-01

    Smooth muscle cells are ultimately responsible for determining vascular luminal diameter and blood flow. Dynamic changes in intracellular calcium are a critical mechanism regulating vascular smooth muscle contractility. Processes influencing intracellular calcium are therefore important regulators of vascular function with physiological and pathophysiological consequences. In this review we discuss the major dynamic calcium signals identified and characterized in vascular smooth muscle cells....

  10. Intramuscular variation in fresh ham muscle color

    Science.gov (United States)

    This experiment was conducted to characterize a defect involving pale muscle tissue in the superficial, ventral portion of ham muscles, resulting in two-toned appearance of cured ham products. Biceps femoris muscles (n = 200), representing 3 production systems, were obtained from the ham-boning lin...

  11. Muscle MRI findings in facioscapulohumeral muscular dystrophy

    Energy Technology Data Exchange (ETDEWEB)

    Gerevini, Simonetta; Caliendo, Giandomenico; Falini, Andrea [IRCCS San Raffaele Scientific Institute, Neuroradiology Unit, Head and Neck Department, Milan (Italy); Scarlato, Marina; Previtali, Stefano Carlo [IRCCS San Raffaele Scientific Institute, Department of Neurology, INSPE and Division of Neuroscience, Milan (Italy); Maggi, Lorenzo; Pasanisi, Barbara; Morandi, Lucia [Fondazione IRCCS Istituto Neurologico ' ' Carlo Besta' ' , Neuromuscular Diseases and Neuroimmunology Unit, Milan (Italy); Cava, Mariangela [IRCCS San Raffaele Scientific Institute, Department of Radiology and Center for Experimental Imaging, Milan (Italy)

    2016-03-15

    Facioscapulohumeral muscular dystrophy (FSHD) is characterized by extremely variable degrees of facial, scapular and lower limb muscle involvement. Clinical and genetic determination can be difficult, as molecular analysis is not always definitive, and other similar muscle disorders may have overlapping clinical manifestations. Whole-body muscle MRI examination for fat infiltration, atrophy and oedema was performed to identify specific patterns of muscle involvement in FSHD patients (30 subjects), and compared to a group of control patients (23) affected by other myopathies (NFSHD). In FSHD patients, we detected a specific pattern of muscle fatty replacement and atrophy, particularly in upper girdle muscles. The most frequently affected muscles, including paucisymptomatic and severely affected FSHD patients, were trapezius, teres major and serratus anterior. Moreover, asymmetric muscle involvement was significantly higher in FSHD as compared to NFSHD patients. In conclusion, muscle MRI is very sensitive for identifying a specific pattern of involvement in FSHD patients and in detecting selective muscle involvement of non-clinically testable muscles. Muscle MRI constitutes a reliable tool for differentiating FSHD from other muscular dystrophies to direct diagnostic molecular analysis, as well as to investigate FSHD natural history and follow-up of the disease. (orig.)

  12. Anthelmintic activity of chicory (Cichorium intybus): in vitro effects on swine nematodes and relationship to sesquiterpene lactone composition

    DEFF Research Database (Denmark)

    Williams, Andrew; Pena-Espinoza, Miguel Angel; Boas, Ulrik;

    2016-01-01

    Chicory is a perennial crop that has been investigated as a forage source for outdoor-reared ruminants and pigs, and has been reported to have anthelmintic properties. Here, we investigated in vitro anthelmintic effects of forage chicory-extracts against the highly prevalent swine parasites Ascaris...... suum and Oesophagostomum dentatum. Methanol extracts were prepared and purified from two different cultivars of chicory (Spadona and Puna II). Marked differences were observed between the anthelmintic activity of extracts from the two cultivars. Spadona extracts had potent activity against A. suum...... anthelmintic activity of forage chicory towards swine nematodes. Our results indicate a significant anthelmintic effect, which may possibly be related to SL composition....

  13. The presence of serum anti-Ascaris lumbricoides IgE antibodies and of Trichuris trichiura infection are risk factors for wheezing and/or atopy in preschool-aged Brazilian children

    Directory of Open Access Journals (Sweden)

    Alcântara-Neves Neuza M

    2010-08-01

    Full Text Available Abstract Background The elucidation of factors that trigger the development of transient wheezing in early childhood may be an important step toward understanding the pathogenesis of asthma and other allergic diseases later in life. Transient wheezing has been mainly attributed to viral infections, although sensitisation to aeroallergens and food allergens may occur at an early age. In developing countries, intestinal helminthic infections have also been associated with allergy or atopy-related disorders. Objective The aim of this study was to explore the association of Trichuris trichiura and Ascaris lumbricoides infections with wheezing and atopy in early childhood. Study design A cross-sectional study using a Portuguese-language ISAAC phase I questionnaire, adapted for preschool-aged children, nested in a cohort study of childhood diarrhoea, was conducted on 682 children. Two faecal samples per child were examined for the presence of intestinal helminthic infection. IgE antibodies against three allergenic preparations (Dermatophagoides pteronyssinus, Blomia tropicalis and common child food, as well as against A. lumbricoides antigens, were measured in a sub-sample of these children, whose parents allowed the procedure. Atopy was defined by the presence of levels of serum IgE antibodies ≥0.35 kU/L against at least one of the three tested allergenic preparations. Results Active T. trichiura infection but not A. lumbricoides infection was positively associated with wheezing in the total studied children population [adjusted OR = 2.60; CI = 1.54;4.38] and in the atopic children sub-population [adjusted OR = 3.07; CI = 1.00;9.43]. The association with atopy was also positive and statistically significant only in the brute analysis [OR = 2.13; CI = 1.03;4.40]. Anti-A. lumbricoides IgE antibodies, but not current A. lumbricoides infection, were positively associated with wheezing in atopic children [adjusted OR = 2.01; CI = 1.00;4.50] and in non

  14. Investigation on contamination of Ascaris lumbricoides eggs in the different soil of three counties in Ganso Province%甘肃省三县土壤中人蛔虫卵污染状况调查

    Institute of Scientific and Technical Information of China (English)

    李凡; 杨成明; 陈生邦; 杨俊克; 令晓兰; 华红玲

    2009-01-01

    目的 了解甘肃省农村居民生活环境中人蛔虫卵污染的现状. 方法 分别采集武山县、凉州区、岷县3个调查点10~20户居民4类环境中的土壤,应用饱和硝酸钠漂浮镜检法检查土样中人蛔虫卵,计算土壤样品的蛔虫卵阳性检出率,并对3地居民蛔虫感染率进行分析比较. 结果 土壤中人蛔虫卵总检出率为28%,菜园、厕所周边、庭院、厨房土壤的人蛔虫卵检出率依次为30%、36%、30%和16%. 结论 调查点环境蛔虫卵污染严重,应采取措施改善环境卫生,减少居民感染蛔虫.%Objective To investigate the different soil contamination of Ascaris lumbricoides eggs at liv-ing environments in rural areas. Methods Wushan County, Liangzhou District and Min County were select-ed as 3 pilots for investigation. Ten samples of soil including 4 different environments from Min County and 20 samples from the others were randomly collected. A. lumbricoides eggs in the different soil were floated with sat-urated nitrate and counted by microscopy. Positive rate of A. lumbricoides eggs in the soils was then calculated and A. lumbricoides infection rates of inhabitants at 3 pilots were compared and analysed. Results The over-all positive rate of A. lumbricoides eggs in the soils was 28%, and among them the rates at the vegetable gar-dens, lavatory surroundings, courtyards in the countryside and kitchens were 30% ,36% ,30% and 16%, re-spectively. Conclusion The pilots were badly contaminated by A. lumbricoides eggs. Measures should be taken to improve the living environments and decrease the infection rate of Ascaris in the residents.

  15. 38 CFR 4.56 - Evaluation of muscle disabilities.

    Science.gov (United States)

    2010-07-01

    ... muscle tissue. Some loss of deep fascia or muscle substance or impairment of muscle tonus and loss of... palpation of loss of deep fascia, muscle substance, or normal firm resistance of muscles compared with sound... indicating wide damage to muscle groups in missile track. Palpation shows loss of deep fascia or...

  16. Resistance training induces qualitative changes in muscle morphology, muscle architecture, and muscle function in elderly postoperative patients

    DEFF Research Database (Denmark)

    Suetta, Charlotte; Andersen, Jesper L; Dalgas, Ulrik;

    2008-01-01

    beneficial qualitative changes in muscle fiber morphology and muscle architecture in elderly postoperative patients. In contrast, rehabilitation regimes based on functional exercises and neuromuscular electrical stimulation had no effect. The present data emphasize the importance of resistance training in......Although the negative effects of bed rest on muscle strength and muscle mass are well established, it still remains a challenge to identify effective methods to restore physical capacity of elderly patients recovering from hospitalization. The present study compared different training regimes with...... respect to muscle strength, muscle fiber size, muscle architecture, and stair walking power in elderly postoperative patients. Thirty-six patients (60-86 yr) scheduled for unilateral hip replacement surgery due to hip osteoarthritis were randomized to either 1) resistance training (RT: 3/wk x 12 wk), 2...

  17. Three Intermittent Sessions of Cryotherapy Reduce the Secondary Muscle Injury in Skeletal Muscle of Rat

    OpenAIRE

    Oliveira, Nuno M. L.; Elaine P. Rainero; Salvini, Tania F.

    2006-01-01

    Although cryotherapy associated to compression is recommended as immediate treatment after muscle injury, the effect of intermittent sessions of these procedures in the area of secondary muscle injury is not established. This study examined the effect of three sessions of cryotherapy (30 min of ice pack each 2h) and muscle compression (sand pack) in the muscle-injured area. Twenty-four Wistar rats (312 ± 20g) were evaluated. In three groups, the middle belly of tibialis anterior (TA) muscle w...

  18. Muscle hypertrophy induced by myostatin inhibition : a new therapeutic approach of muscle atrophy

    OpenAIRE

    Gilson, Hélène

    2009-01-01

    Increasing size and strength of skeletal muscle represents a promising therapeutic strategy for muscular disorders. One possible new tool is Myostatin (Mstn) because it plays a crucial role in regulating skeletal muscle mass. The first goal of our work was to determine whether Mstn inhibition could prevent muscle atrophy in catabolic states. As glucocorticoids play a major role in most muscle atrophy models, we assessed whether muscle atrophy caused by glucocorticoids in excess could be preve...

  19. Associations of Sarcopenia and Sarcopenic Obesity With Metabolic Syndrome Considering Both Muscle Mass and Muscle Strength

    OpenAIRE

    Lee, Jihye; Hong, Yeon-Pyo; Shin, Hyun Ju; Lee, Weonyoung

    2015-01-01

    Objectives: We investigated the associations of sarcopenia-defined both in terms of muscle mass and muscle strength-and sarcopenic obesity with metabolic syndrome. Methods: Secondary data pertaining to 309 subjects (85 men and 224 women) were collected from participants in exercise programs at a health center in a suburban area. Muscle mass was measured using bioelectrical impedance analysis, and muscle strength was measured via handgrip strength. Sarcopenia based on muscle mass alone was def...

  20. Muscle phosphofructokinase deficiency. Biochemical and immunological studies of phosphofructokinase isozymes in muscle culture.

    OpenAIRE

    Davidson, M; Miranda, A. F.; Bender, A N; DiMauro, S.; Vora, S.

    1983-01-01

    Muscle cultures from three unrelated patients with muscle phosphofructokinase (PFK; EC 2.7.1.11) deficiency (Glycogenosis type VII; Tarui disease) had normal PFK activity and normal morphology. Chromatographic and immunological studies showed that normal muscle cultures express all three PFK subunits, M (muscle-type), L (liver-type), and P (platelet-type) and contain multiple homotetrameric and heterotetrameric isozymes. Muscle cultures from patients lack catalytically active M subunit-contai...

  1. Bone marrow mesenchymal cells improve muscle function in a skeletal muscle re-injury model.

    Directory of Open Access Journals (Sweden)

    Bruno M Andrade

    Full Text Available Skeletal muscle injury is the most common problem in orthopedic and sports medicine, and severe injury leads to fibrosis and muscle dysfunction. Conventional treatment for successive muscle injury is currently controversial, although new therapies, like cell therapy, seem to be promise. We developed a model of successive injuries in rat to evaluate the therapeutic potential of bone marrow mesenchymal cells (BMMC injected directly into the injured muscle. Functional and histological assays were performed 14 and 28 days after the injury protocol by isometric tension recording and picrosirius/Hematoxilin & Eosin staining, respectively. We also evaluated the presence and the fate of BMMC on treated muscles; and muscle fiber regeneration. BMMC treatment increased maximal skeletal muscle contraction 14 and 28 days after muscle injury compared to non-treated group (4.5 ± 1.7 vs 2.5 ± 0.98 N/cm2, p<0.05 and 8.4 ± 2.3 vs. 5.7 ± 1.3 N/cm2, p<0.05 respectively. Furthermore, BMMC treatment increased muscle fiber cross-sectional area and the presence of mature muscle fiber 28 days after muscle injury. However, there was no difference in collagen deposition between groups. Immunoassays for cytoskeleton markers of skeletal and smooth muscle cells revealed an apparent integration of the BMMC within the muscle. These data suggest that BMMC transplantation accelerates and improves muscle function recovery in our extensive muscle re-injury model.

  2. Synchronous monitoring of muscle dynamics and muscle force for maximum isometric tetanus

    Science.gov (United States)

    Zakir Hossain, M.; Grill, Wolfgang

    2010-03-01

    Skeletal muscle is a classic example of a biological soft matter . At both macro and microscopic levels, skeletal muscle is exquisitely oriented for force generation and movement. In addition to the dynamics of contracting and relaxing muscle which can be monitored with ultrasound, variations in the muscle force are also expected to be monitored. To observe such force and sideways expansion variations synchronously for the skeletal muscle a novel detection scheme has been developed. As already introduced for the detection of sideways expansion variations of the muscle, ultrasonic transducers are mounted sideways on opposing positions of the monitored muscle. To detect variations of the muscle force, angle of pull of the monitored muscle has been restricted by the mechanical pull of the sonic force sensor. Under this condition, any variation in the time-of-flight (TOF) of the transmitted ultrasonic signals can be introduced by the variation of the path length between the transducers. The observed variations of the TOF are compared to the signals obtained by ultrasound monitoring for the muscle dynamics. The general behavior of the muscle dynamics and muscle force shows almost an identical concept. Since muscle force also relates the psychological boosting-up effects, the influence of boosting-up on muscle force and muscle dynamics can also be quantified form this study. Length-tension or force-length and force-velocity relationship can also be derived quantitatively with such monitoring.

  3. Cytokines: muscle protein and amino acid metabolism

    DEFF Research Database (Denmark)

    van Hall, Gerrit

    2012-01-01

    raises TNF-α and IL-6 to moderate levels, has only identified IL-6 as a potent cytokine, decreasing systemic amino acid levels and muscle protein metabolism. The marked decrease in circulatory and muscle amino acid concentrations was observed with a concomitant reduction in both the rates of muscle...... IL-6 on the regulation of muscle protein metabolism but indirectly via IL-6 reducing amino acid availability. SUMMARY: Recent studies suggest that the best described cytokines TNF-α and IL-6 are unlikely to be the major direct mediators of muscle protein loss in inflammatory diseases. However, these...

  4. Emerin increase in regenerating muscle fibers

    Directory of Open Access Journals (Sweden)

    S Squarzoni

    2009-06-01

    Full Text Available The fate of emerin during skeletal muscle regeneration was investigated in an animal model by means of crush injury. Immunofluorescence, immunoblotting and mRNA analysis demonstrated that emerin level is increased in regenerating rat muscle fibers with respect to normal mature myofibers. This finding suggests an involvement of emerin during the muscle fiber regeneration process, in analogy with its reported involvement in muscle cell differentiation in vitro. The impairment of skeletal muscle physiological regeneration or reorganization could be a possible pathogenetic mechanism for Emery Dreifuss muscular dystrophy.

  5. Adaptive Filters for Muscle Response Suppression

    DEFF Research Database (Denmark)

    Sennels, Søren; Biering-Soerensen, Fin; Hansen, Steffen Duus;

    1996-01-01

    are proposed, based on the observation that the shape of the muscle responses only exhibits moderate changes during a time window of up to 300 ms. The filters are derived and compared with a conventional fixed comb filter on both simulated and real data. For variations in amplitude of the muscle responses......To be able to use the voluntary EMG-signal from an electrically stimulated muscle as control signal for FES-applications, it is necessary to eliminate the muscle response evoked by the stimulation. The muscle response is a non-stationary signal, therefore a set of linear adaptive prediction filters...

  6. Impact of weightlessness on muscle function

    Science.gov (United States)

    Tischler, M. E.; Slentz, M.

    1995-01-01

    The most studied skeletal muscles which depend on gravity, "antigravity" muscles, are located in the posterior portion of the legs. Antigravity muscles are characterized generally by a different fiber type composition than those which are considered nonpostural. The gravity-dependent function of the antigravity muscles makes them particularly sensitive to weightlessness (unweighting) resulting in a substantial loss of muscle protein, with a relatively greater loss of myofibrillar (structural) proteins. Accordingly alpha-actin mRNA decreases in muscle of rats exposed to microgravity. In the legs, the soleus seems particularly responsive to the lack of weight-bearing associated with space flight. The loss of muscle protein leads to a decreased cross-sectional area of muscle fibers, particularly of the slow-twitch, oxidative (SO) ones compared to fast-twitch glycolytic (FG) or oxidative-glycolytic (FOG) fibers. In some muscles, a shift in fiber composition from SO to FOG has been reported in the adaptation to spaceflight. Changes in muscle composition with spaceflight have been associated with decreased maximal isometric tension (Po) and increased maximal shortening velocity. In terms of fuel metabolism, results varied depending on the pathway considered. Glucose uptake, in the presence of insulin, and activities of glycolytic enzymes are increased by space flight. In contrast, oxidation of fatty acids may be diminished. Oxidation of pyruvate, activity of the citric acid cycle, and ketone metabolism in muscle seem to be unaffected by microgravity.

  7. Proteomic profiling of skeletal muscle plasticity.

    Science.gov (United States)

    Ohlendieck, Kay

    2011-10-01

    One of the most striking physiological features of skeletal muscle tissues are their enormous capacity to adapt to changed functional demands. Muscle plasticity has been extensively studied by histological, biochemical, physiological and genetic methods over the last few decades. With the recent emergence of high-throughput and large-scale proteomic techniques, mass spectrometry-based surveys have also been applied to the global analysis of the skeletal muscle protein complement during physiological modifications and pathophysiological alterations. This review outlines and discusses the impact of recent proteomic profiling studies of skeletal muscle transitions, including the effects of chronic electro-stimulation, physical exercise, denervation, disuse atrophy, hypoxia, myotonia, motor neuron disease and age-related fibre type shifting. This includes studies on the human skeletal muscle proteome, animal models of muscle plasticity and major neuromuscular pathologies. The biomedical importance of establishing reliable biomarker signatures for the various molecular and cellular transition phases involved in muscle transformation is critically examined. PMID:23738259

  8. Abdominal muscle training in sport.

    OpenAIRE

    Norris, C M

    1993-01-01

    This paper evaluates several abdominal exercises, and highlights factors which are important for their safe prescription and effective use. The function of the abdominal muscles and hip flexors is considered, and the importance of the infra-umbilical portion of the rectus abdominis is emphasized. The effects of flexion on the lumbar spine are outlined. The trunk curl, sit-up, and straight leg raise are analysed, together with modifications of these exercises. The effect of foot fixation and h...

  9. Influence of muscle hypertrophy on the moment arm of the triceps brachii muscle.

    Science.gov (United States)

    Sugisaki, Norihide; Wakahara, Taku; Murata, Koichiro; Miyamoto, Naokazu; Kawakami, Yasuo; Kanehisa, Hiroaki; Fukunaga, Tetsuo

    2015-04-01

    Although the moment arm of the triceps brachii muscle has been shown to be associated with the muscle's anatomical cross-sectional area, whether training-induced muscle hypertrophy alters the moment arm of the muscle remains unexplored. Therefore, the current study aimed to examine this. Eleven men underwent a 12-week resistance training program for the triceps brachii muscle. The maximum muscle anatomical cross-sectional area (ACSAmax), the moment arm of the triceps brachii muscle, and the anterior-posterior dimension of the olecranon were measured using a magnetic resonance imaging system before and after intervention. The ACSAmax (33.6 ± 11.9%, P .05). The change in moment arm was smaller than that expected from the relationship between the ACSAmax and the moment arm before the intervention. The present results indicate that training-induced triceps brachii muscle hypertrophy could increase the muscle moment arm, but its impact can be small or negligible. PMID:25411895

  10. Postinjection Muscle Fibrosis from Lupron

    Directory of Open Access Journals (Sweden)

    Erica Everest

    2015-01-01

    Full Text Available We describe the case of a 6.5-year-old girl with central precocious puberty (CPP, which signifies the onset of secondary sexual characteristics before the age of eight in females and the age of nine in males as a result of stimulation of the hypothalamic-pituitary-gonadal axis. Her case is likely related to her adoption, as children who are adopted internationally have much higher rates of CPP. She had left breast development at Tanner Stage 2, adult body odor, and mildly advanced bone age. In order to halt puberty and maximize adult height, she was prescribed a gonadotropin releasing hormone analog, the first line treatment for CPP. She was administered Lupron (leuprolide acetate Depot-Ped (3 months intramuscularly. After her second injection, she developed swelling and muscle pain at the injection site on her right thigh. She also reported an impaired ability to walk. She was diagnosed with muscle fibrosis. This is the first reported case of muscle fibrosis resulting from Lupron injection.

  11. An allometric analysis of the number of muscle spindles in mammalian skeletal muscles.

    Science.gov (United States)

    Banks, R W

    2006-06-01

    An allometric analysis of the number of muscle spindles in relation to muscle mass in mammalian (mouse, rat, guinea-pig, cat, human) skeletal muscles is presented. It is shown that the trend to increasing number as muscle mass increases follows an isometric (length) relationship between species, whereas within a species, at least for the only essentially complete sample (human), the number of spindles scales, on average, with the square root rather than the cube root of muscle mass. An attempt is made to reconcile these apparently discrepant relationships. Use of the widely accepted spindle density (number of spindles g(-1) of muscle) as a measure of relative abundance of spindles in different muscles is shown to be grossly misleading. It is replaced with the residuals of the linear regression of ln spindle number against ln muscle mass. Significant differences in relative spindle abundance as measured by residuals were found between regional groups of muscles: the greatest abundance is in axial muscles, including those concerned with head position, whereas the least is in muscles of the shoulder girdle. No differences were found between large and small muscles operating in parallel, or between antigravity and non-antigravity muscles. For proximal vs. distal muscles, spindles were significantly less abundant in the hand than the arm, but there was no difference between the foot and the leg. PMID:16761976

  12. Muscle activity characterization by laser Doppler Myography

    Science.gov (United States)

    Scalise, Lorenzo; Casaccia, Sara; Marchionni, Paolo; Ercoli, Ilaria; Primo Tomasini, Enrico

    2013-09-01

    Electromiography (EMG) is the gold-standard technique used for the evaluation of muscle activity. This technique is used in biomechanics, sport medicine, neurology and rehabilitation therapy and it provides the electrical activity produced by skeletal muscles. Among the parameters measured with EMG, two very important quantities are: signal amplitude and duration of muscle contraction, muscle fatigue and maximum muscle power. Recently, a new measurement procedure, named Laser Doppler Myography (LDMi), for the non contact assessment of muscle activity has been proposed to measure the vibro-mechanical behaviour of the muscle. The aim of this study is to present the LDMi technique and to evaluate its capacity to measure some characteristic features proper of the muscle. In this paper LDMi is compared with standard superficial EMG (sEMG) requiring the application of sensors on the skin of each patient. sEMG and LDMi signals have been simultaneously acquired and processed to test correlations. Three parameters has been analyzed to compare these techniques: Muscle activation timing, signal amplitude and muscle fatigue. LDMi appears to be a reliable and promising measurement technique allowing the measurements without contact with the patient skin.

  13. Redox control of skeletal muscle atrophy.

    Science.gov (United States)

    Powers, Scott K; Morton, Aaron B; Ahn, Bumsoo; Smuder, Ashley J

    2016-09-01

    Skeletal muscles comprise the largest organ system in the body and play an essential role in body movement, breathing, and glucose homeostasis. Skeletal muscle is also an important endocrine organ that contributes to the health of numerous body organs. Therefore, maintaining healthy skeletal muscles is important to support overall health of the body. Prolonged periods of muscle inactivity (e.g., bed rest or limb immobilization) or chronic inflammatory diseases (i.e., cancer, kidney failure, etc.) result in skeletal muscle atrophy. An excessive loss of muscle mass is associated with a poor prognosis in several diseases and significant muscle weakness impairs the quality of life. The skeletal muscle atrophy that occurs in response to inflammatory diseases or prolonged inactivity is often associated with both oxidative and nitrosative stress. In this report, we critically review the experimental evidence that provides support for a causative link between oxidants and muscle atrophy. More specifically, this review will debate the sources of oxidant production in skeletal muscle undergoing atrophy as well as provide a detailed discussion on how reactive oxygen species and reactive nitrogen species modulate the signaling pathways that regulate both protein synthesis and protein breakdown. PMID:26912035

  14. Muscle activity characterization by laser Doppler Myography

    International Nuclear Information System (INIS)

    Electromiography (EMG) is the gold-standard technique used for the evaluation of muscle activity. This technique is used in biomechanics, sport medicine, neurology and rehabilitation therapy and it provides the electrical activity produced by skeletal muscles. Among the parameters measured with EMG, two very important quantities are: signal amplitude and duration of muscle contraction, muscle fatigue and maximum muscle power. Recently, a new measurement procedure, named Laser Doppler Myography (LDMi), for the non contact assessment of muscle activity has been proposed to measure the vibro-mechanical behaviour of the muscle. The aim of this study is to present the LDMi technique and to evaluate its capacity to measure some characteristic features proper of the muscle. In this paper LDMi is compared with standard superficial EMG (sEMG) requiring the application of sensors on the skin of each patient. sEMG and LDMi signals have been simultaneously acquired and processed to test correlations. Three parameters has been analyzed to compare these techniques: Muscle activation timing, signal amplitude and muscle fatigue. LDMi appears to be a reliable and promising measurement technique allowing the measurements without contact with the patient skin

  15. Engineering skeletal muscle tissue in bioreactor systems

    Institute of Scientific and Technical Information of China (English)

    An Yang; Li Dong

    2014-01-01

    Objective To give a concise review of the current state of the art in tissue engineering (TE) related to skeletal muscle and kinds of bioreactor environment.Data sources The review was based on data obtained from the published articles and guidelines.Study selection A total of 106 articles were selected from several hundred original articles or reviews.The content of selected articles is in accordance with our purpose and the authors are authorized scientists in the study of engineered muscle tissue in bioreactor.Results Skeletal muscle TE is a promising interdisciplinary field which aims at the reconstruction of skeletal muscle loss.Although numerous studies have indicated that engineering skeletal muscle tissue may be of great importance in medicine in the near future,this technique still represents a limited degree of success.Since tissue-engineered muscle constructs require an adequate connection to the vascular system for efficient transport of oxygen,carbon dioxide,nutrients and waste products.Moreover,functional and clinically applicable muscle constructs depend on adequate neuromuscular junctions with neural calls.Third,in order to engineer muscle tissue successfully,it may be beneficial to mimic the in vivo environment of muscle through association with adequate stimuli from bioreactors.Conclusion Vascular system and bioreactors are necessary for development and maintenance of engineered muscle in order to provide circulation within the construct.

  16. Are muscle synergies useful for neural control ?

    Directory of Open Access Journals (Sweden)

    Aymar de Rugy

    2013-03-01

    Full Text Available The observation that the activity of multiple muscles can be well approximated by a few linear synergies is viewed by some as a sign that such low-dimensional modules constitute a key component of the neural control system. Here, we argue that the usefulness of muscle synergies as a control principle should be evaluated in terms of errors produced not only in muscle space, but also in task space. We used data from a force-aiming task in two dimensions at the wrist, using an EMG-driven virtual biomechanics technique that overcomes typical errors in predicting force from recorded EMG, to illustrate through simulation how synergy decomposition inevitably introduces substantial task space errors. Then, we computed the optimal pattern of muscle activation that minimizes summed-squared muscle activities, and demonstrated that synergy decomposition produced similar results on real and simulated data. We further assessed the influence of synergy decomposition on aiming errors in a more redundant system, using the optimal muscle pattern computed for the elbow-joint complex (i.e., 13 muscles acting in two dimensions. Because EMG records are typically not available from all contributing muscles, we also explored reconstructions from incomplete sets of muscles. The redundancy of a given set of muscles had opposite effects on the goodness of muscle reconstruction and on task achievement; higher redundancy is associated with better EMG approximation (lower residuals, but with higher aiming errors. Finally, we showed that the number of synergies required to approximate the optimal muscle pattern for an arbitrary biomechanical system increases with task-space dimensionality, which indicates that the capacity of synergy decomposition to explain behaviour depends critically on the scope of the original database. These results have implications regarding the viability of muscle synergy as a putative neural control mechanism, and also as a control algorithm to

  17. Evaluation of Muscle Function of the Extensor Digitorum Longus Muscle Ex vivo and Tibialis Anterior Muscle In situ in Mice

    OpenAIRE

    Hakim, Chady H.; Wasala, Nalinda B.; Duan, Dongsheng

    2013-01-01

    Body movements are mainly provided by mechanical function of skeletal muscle. Skeletal muscle is composed of numerous bundles of myofibers that are sheathed by intramuscular connective tissues. Each myofiber contains many myofibrils that run longitudinally along the length of the myofiber. Myofibrils are the contractile apparatus of muscle and they are composed of repeated contractile units known as sarcomeres. A sarcomere unit contains actin and myosin filaments that are spaced by the Z disc...

  18. CORRELATIONS BETWEEN MUSCLE MASS, MUSCLE STRENGTH, PHYSICAL PERFORMANCE, AND MUSCLE FATIGUE RESISTANCE IN COMMUNITY-DWELLING ELDERLY SUBJECTS

    OpenAIRE

    Dell, Elizabeth; Vitriana; Irma Ruslina Defi

    2016-01-01

    Objective: To determine the correlations between muscle mass, muscle strength, physical performance, and muscle fatigue resistance in community-dwelling elderly people in order to elucidate factors which contribute to elderly’s performance of daily activities. Methods: A cross-sectional study was conducted on community-dwelling elderly in Bandung from September to December 2014. One hundred and thirty elderly, 60 years old or above, were evaluated using bioelectrical impedance analysis to...

  19. THREE INTERMITTENT SESSIONS OF CRYOTHERAPY REDUCE THE SECONDARY MUSCLE INJURY IN SKELETAL MUSCLE OF RAT

    Directory of Open Access Journals (Sweden)

    Nuno M. L. Oliveira

    2006-06-01

    Full Text Available Although cryotherapy associated to compression is recommended as immediate treatment after muscle injury, the effect of intermittent sessions of these procedures in the area of secondary muscle injury is not established. This study examined the effect of three sessions of cryotherapy (30 min of ice pack each 2h and muscle compression (sand pack in the muscle-injured area. Twenty-four Wistar rats (312 ± 20g were evaluated. In three groups, the middle belly of tibialis anterior (TA muscle was injured by a frozen iron bar and received one of the following treatments: a three sessions of cryotherapy; b three sessions of compression; c not treated. An uninjured group received sessions of cryotherapy. Frozen muscles were cross- sectioned (10 µm and stained for the measurement of injured and uninjured muscle area. Injured muscles submitted to cryotherapy showed the smallest injured area (29.83 ± 6.6%, compared to compressed (39.2 ± 2.8%, p= 0.003 and untreated muscles (41.74 ± 4.0%, p = 0.0008. No difference was found between injured compressed and injured untreated muscles. In conclusion, three intermittent sessions of cryotherapy applied immediately after muscle damage was able to reduce the secondary muscle injury, while only the muscle compression did not provide the same effectiveness

  20. Muscle dynamics in fish during steady swimming

    DEFF Research Database (Denmark)

    Shadwick, RE; Steffensen, JF; Katz, SL;

    1998-01-01

    position in swimming fish. Quantification of muscle contractile properties in cyclic contractions relies on in vitro experiments using strain and activation data collected in vivo. In this paper we discuss the relation between these parameters and body kinematics. Using videoradiographic data from swimming...... contraction, suggesting that the phase relation between the muscle strain cycle and its activation must vary along the body. Since this phase relation is critical in determining how the muscle performs in cyclic contractions, the possibility has emerged that dynamic muscle function may change with axial...... mackerel we demonstrate that red muscle strain can be accurately predicted from midline curvature but not from lateral displacement. Electromyographic recordings show neuronal activation patterns that are consistent with red muscle performing net positive work at all axial positions. The relatively...

  1. Pelvic floor muscle rehabilitation using biofeedback.

    Science.gov (United States)

    Newman, Diane K

    2014-01-01

    Pelvic floor muscle exercises have been recommended for urinary incontinence since first described by obstetrician gynecologist Dr. Arnold Kegel more than six decades ago. These exercises are performed to strengthen pelvic floor muscles, provide urethral support to prevent urine leakage, and suppress urgency. In clinical urology practice, expert clinicians also teach patients how to relax the muscle to improve bladder emptying and relieve pelvic pain caused by muscle spasm. When treating lower urinary tract symptoms, an exercise training program combined with biofeedback therapy has been recommended as first-line treatment. This article provides clinical application of pelvic floor muscle rehabilitation using biofeedback as a technique to enhance pelvic floor muscle training. PMID:25233622

  2. Epigenetic regulation of skeletal muscle metabolism.

    Science.gov (United States)

    Howlett, Kirsten F; McGee, Sean L

    2016-07-01

    Normal skeletal muscle metabolism is essential for whole body metabolic homoeostasis and disruptions in muscle metabolism are associated with a number of chronic diseases. Transcriptional control of metabolic enzyme expression is a major regulatory mechanism for muscle metabolic processes. Substantial evidence is emerging that highlights the importance of epigenetic mechanisms in this process. This review will examine the importance of epigenetics in the regulation of muscle metabolism, with a particular emphasis on DNA methylation and histone acetylation as epigenetic control points. The emerging cross-talk between metabolism and epigenetics in the context of health and disease will also be examined. The concept of inheritance of skeletal muscle metabolic phenotypes will be discussed, in addition to emerging epigenetic therapies that could be used to alter muscle metabolism in chronic disease states. PMID:27215678

  3. The exercised skeletal muscle: a review

    Directory of Open Access Journals (Sweden)

    Marina Marini

    2010-09-01

    Full Text Available The skeletal muscle is the second more plastic tissue of the body - second to the nervous tissue only. In fact, both physical activity and inactivity contribute to modify the skeletal muscle, by continuous signaling through nerve impulses, mechanical stimuli and humoral clues. In turn, the skeletal muscle sends signals to the body, thus contributing to its homeostasis. We'll review here the contribute of physical exercise to the shaping of skeletal muscle, to the adaptation of its mass and function to the different needs imposed by different physical activities and to the attainment of the health benefits associated with active skeletal muscles. Focus will primarily be on the molecular pathways and on gene regulation that result in skeletal muscle adaptation to exercise.

  4. Gene and cell therapy for muscle regeneration

    OpenAIRE

    Stilhano, Roberta Sessa; Martins, Leonardo; Ingham, Sheila Jean McNeill; Pesquero, João Bosco; Huard, Johnny

    2015-01-01

    Skeletal muscle injury and healing are multifactorial processes, involving three steps of healing: (1) degeneration and inflammation, (2) regeneration, and (3) fibrosis. Fibrous tissue hinders the muscle’s complete recovery and current therapies fail in achieving total muscle recovery. Gene and cell therapy (or both) are potential future treatments for severe muscular injuries. Stem cells’ properties associated with growth factors or/and cytokines can improve muscle healing and permit long-te...

  5. Forever young: rejuvenating muscle satellite cells

    OpenAIRE

    Madaro, Luca; Latella, Lucia

    2015-01-01

    A hallmark of aging is alteration of organismal homeostasis and progressive decline of tissue functions. Alterations of both cell intrinsic functions and regenerative environmental cues contribute to the compromised stem cell activity and reduced regenerative capability occurring in aged muscles. In this perspective, we discuss the new evidence supporting the hypothesis that skeletal muscle stem cells (MuSCs) are intrinsically defective in elderly muscles. In particular, we review three recen...

  6. Skeletal Muscle Autophagy: A New Metabolic Regulator

    OpenAIRE

    Neel, Brian A.; Lin, Yuxi; Pessin, Jeffrey E.

    2013-01-01

    Autophagy classically functions as a physiological process to degrade cytoplasmic components, protein aggregates, and/or organelles, as a mechanism for nutrient breakdown, and as a regulator of cellular architecture. Proper autophagic flux is vital for both functional skeletal muscle, which controls support and movement of the skeleton, and muscle metabolism. The role of autophagy as a metabolic regulator in muscle has been previously studied; however, the underlying molecular mechanisms that...

  7. Muscle function in COPD: a complex interplay

    OpenAIRE

    Donaldson, Anna V; Maddocks, Matthew; Martolini, Dario; Polkey, Michael I; Man, William D-C

    2012-01-01

    The skeletal muscles play an essential role in life, providing the mechanical basis for respiration and movement. Skeletal muscle dysfunction is prevalent in all stages of chronic obstructive pulmonary disease (COPD), and significantly influences symptoms, functional capacity, health related quality of life, health resource usage and even mortality. Furthermore, in contrast to the lungs, the skeletal muscles are potentially remedial with existing therapy, namely exercise-training. This review...

  8. Proteomic profiling of skeletal muscle plasticity

    OpenAIRE

    Ohlendieck, Kay

    2012-01-01

    One of the most striking physiological features of skeletal muscle tissues are their enormous capacity to adapt to changed functional demands. Muscle plasticity has been extensively studied by histological, biochemical, physiological and genetic methods over the last few decades. With the recent emergence of high-throughput and large-scale proteomic techniques, mass spectrometry-based surveys have also been applied to the global analysis of the skeletal muscle protein complement during physio...

  9. Etiological factors for muscle tension dysphonia

    OpenAIRE

    Kušar, Rozalija

    2012-01-01

    This thesis discusses muscle tension dysphonia and etiological factors for its emergence. Muscle tension dysphonia is a consequence of irregular formation of the sound and is connected to increased and unnecessary muscle tension and phonation, and is usually without any anatomical and peripheral neurological irregularities and also without any changes on the mucous membrane. In the theoretical part of this thesis voice disorders and various classifications of voice disorders that occur in the...

  10. Human Muscle Fatigue Model in Dynamic Motions

    OpenAIRE

    Ma, Ruina; Chablat, Damien; Bennis, Fouad; Ma, Liang

    2012-01-01

    Human muscle fatigue is considered to be one of the main reasons for Musculoskeletal Disorder (MSD). Recent models have been introduced to define muscle fatigue for static postures. However, the main drawbacks of these models are that the dynamic effect of the human and the external load are not taken into account. In this paper, each human joint is assumed to be controlled by two muscle groups to generate motions such as push/pull. The joint torques are computed using Lagrange's formulation ...

  11. Muscle fibre ontogenesis in farm animal species

    OpenAIRE

    Picard, Brigitte; Lefaucheur, Louis; Berri, Cécile; Duclos, Michel

    2002-01-01

    International audience In farm animals (bovine, ovine, swine, rabbit and poultry), muscle fibre characteristics play a key role in meat quality. The present review summarises the knowledge on muscle fibre characteristics and ontogenesis in these species. Myofibre ontogenesis begins very early during embryonic life, with the appearance of two or three successive waves of myoblasts which constitute the origin of the different types of muscle fibres. In small animals (rodents and poultry), a ...

  12. Insulin binding to individual rat skeletal muscles

    International Nuclear Information System (INIS)

    Studies of insulin binding to skeletal muscle, performed using sarcolemmal membrane preparations or whole muscle incubations of mixed muscle or typical red (soleus, psoas) or white [extensor digitorum longus (EDL), gastrocnemius] muscle, have suggested that red muscle binds more insulin than white muscle. We have evaluated this hypothesis using cryostat sections of unfixed tissue to measure insulin binding in a broad range of skeletal muscles; many were of similar fiber-type profiles. Insulin binding per square millimeter of skeletal muscle slice was measured by autoradiography and computer-assisted densitometry. We found a 4.5-fold range in specific insulin tracer binding, with heart and predominantly slow-twitch oxidative muscles (SO) at the high end and the predominantly fast-twitch glycolytic (FG) muscles at the low end of the range. This pattern reflects insulin sensitivity. Evaluation of displacement curves for insulin binding yielded linear Scatchard plots. The dissociation constants varied over a ninefold range (0.26-2.06 nM). Binding capacity varied from 12.2 to 82.7 fmol/mm2. Neither binding parameter was correlated with fiber type or insulin sensitivity; e.g., among three muscles of similar fiber-type profile, the EDL had high numbers of low-affinity binding sites, whereas the quadriceps had low numbers of high-affinity sites. In summary, considerable heterogeneity in insulin binding was found among hindlimb muscles of the rat, which can be attributed to heterogeneity in binding affinities and the numbers of binding sites. It can be concluded that a given fiber type is not uniquely associated with a set of insulin binding parameters that result in high or low binding

  13. MICROSTIMULATION ACTIVATES A HANDFUL OF MUSCLE SYNERGIES

    OpenAIRE

    Overduin, Simon A.; d’Avella, Andrea; Carmena, Jose M.; Bizzi, Emilio

    2012-01-01

    Muscle synergies have been proposed as a mechanism to simplify movement control. Whether these coactivation patterns have any physiological reality within the nervous system remains unknown. Here we applied electrical microstimulation to motor cortical areas of rhesus macaques to evoke hand movements. Movements tended to converge towards particular postures, driven by synchronous bursts of muscle activity. Across stimulation sites, the muscle activations were reducible to linear sums of a few...

  14. Microstimulation Activates a Handful of Muscle Synergies

    OpenAIRE

    Overduin, Simon A.; d’Avella, Andrea; Carmena, Jose M.; Bizzi, Emilio

    2012-01-01

    Muscle synergies have been proposed as a mechanism to simplify movement control. Whether these coactivation patterns have any physiological reality within the nervous system remains unknown. Here we applied electrical microstimulation to motor cortical areas of rhesus macaques to evoke hand movements. Movements tended to converge toward particular postures, driven by synchronous bursts of muscle activity. Across stimulation sites, the muscle activations were reducible to linear sums of a few ...

  15. Traumatic avulsion of extraocular muscles: case reports

    Directory of Open Access Journals (Sweden)

    Nilza Minguini

    2013-04-01

    Full Text Available We described the clinical, surgical details and results (motor and sensory of the retrieving procedure of traumatically avulsed muscles in three patients with no previous history of strabismus or diplopia seen in the Department of Ophthalmology, State University of Campinas, Brazil. The slipped muscle portion was reinserted at the original insertion and under the remaining stump, which was sutured over the reinserted muscle. For all three cases there was recovery of single binocular vision and stereopsis.

  16. The Effects of Lactate on Skeletal Muscle

    OpenAIRE

    Willkomm, Lena

    2014-01-01

    Regular exercise and physical activity are cornerstones in the prevention and treatment of numerous chronic conditions, such as type 2 diabetes, coronary heart disease, and age-related sarcopenia. The associated health benefits arise from a number of tissues but due to its high plasticity skeletal muscle plays a pivotal role. The resident stem cells of skeletal muscle tissue, so called Satellite cells (SCs), contribute significantly to skeletal muscle adaptation and hence, maintenance of heal...

  17. Nutrient and energy sensing in skeletal muscle

    OpenAIRE

    Deshmukh, Atul S.

    2009-01-01

    Nutrient overload and physical inactivity often leads to the development of obesity and type 2 diabetes. Acute over-nutrition can induce insulin resistance, while physical exercise enhances skeletal muscle insulin sensitivity. Like every living cell, skeletal muscle senses nutrient and energy signals and to adjust metabolic flux. This thesis focuses on some of the key nutrient and energy sensing (exercise/contraction-induced) pathways in skeletal muscle that regulate metabol...

  18. Physical activity, muscle function, falls and fractures

    OpenAIRE

    Karlsson, Magnus K; Nordqvist, Anders; Karlsson, Caroline

    2008-01-01

    Study design: A thematic review. Objectives: To evaluate if physical activity enhances muscle strength, improves balance, and reduces the fall frequency and the fracture incidence. Background: One of the major medical problems of today is the increasing incidence of fragility fractures. Muscle strength and fall is one of the major determinants of a fracture. If physical activity could increase muscle strength, improve balance and reduce the fall frequency, then training could be recommended a...

  19. Aging, exercise, and muscle protein metabolism.

    Science.gov (United States)

    Koopman, René; van Loon, Luc J C

    2009-06-01

    Aging is accompanied by a progressive loss of skeletal muscle mass and strength, leading to the loss of functional capacity and an increased risk of developing chronic metabolic disease. The age-related loss of skeletal muscle mass is attributed to a disruption in the regulation of skeletal muscle protein turnover, resulting in an imbalance between muscle protein synthesis and degradation. As basal (fasting) muscle protein synthesis rates do not seem to differ substantially between the young and elderly, many research groups have started to focus on the muscle protein synthetic response to the main anabolic stimuli, i.e., food intake and physical activity. Recent studies suggest that the muscle protein synthetic response to food intake is blunted in the elderly. The latter is now believed to represent a key factor responsible for the age-related decline in skeletal muscle mass. Physical activity and/or exercise stimulate postexercise muscle protein accretion in both the young and elderly. However, the latter largely depends on the timed administration of amino acids and/or protein before, during, and/or after exercise. Prolonged resistance type exercise training represents an effective therapeutic strategy to augment skeletal muscle mass and improve functional performance in the elderly. The latter shows that the ability of the muscle protein synthetic machinery to respond to anabolic stimuli is preserved up to very old age. Research is warranted to elucidate the interaction between nutrition, exercise, and the skeletal muscle adaptive response. The latter is needed to define more effective strategies that will maximize the therapeutic benefits of lifestyle intervention in the elderly. PMID:19131471

  20. Heat stress inhibits skeletal muscle hypertrophy

    OpenAIRE

    Frier, Bruce C.; Locke, Marius

    2007-01-01

    Heat shock proteins (Hsps) are molecular chaperones that aid in protein synthesis and trafficking and have been shown to protect cells/tissues from various protein damaging stressors. To determine the extent to which a single heat stress and the concurrent accumulation of Hsps influences the early events of skeletal muscle hypertrophy, Sprague-Dawley rats were heat stressed (42°C, 15 minutes) 24 hours prior to overloading 1 plantaris muscle by surgical removal of the gastrocnemius muscle. The...

  1. Magnetic stimulation of muscle evokes cerebral potentials in assessment of paraspinal muscle spasm.

    Institute of Scientific and Technical Information of China (English)

    1998-01-01

    Objectlve: To assess the muscle spasm by magnetic stimulation of muscle evokes cerebral potentials (MMSEP). Methods: Paraspinal MMSEP and function assessment was recorded in detail before and after treat-

  2. Importance of mind-muscle connection during progressive resistance training

    DEFF Research Database (Denmark)

    Calatayud, Joaquin; Vinstrup, Jonas; Jakobsen, Markus Due; Sundstrup, Emil; Brandt, Mikkel; Jay, Kenneth; Colado, Juan Carlos; Andersen, Lars L.

    2016-01-01

    electromyography (EMG) signals were recorded for the triceps brachii and pectoralis major muscles. Subsequently, peak EMG of the filtered signals were normalized to maximum maximorum EMG of each muscle. RESULTS: In both muscles, focusing on using the respective muscles increased muscle activity at relative loads...... activating the triceps muscle the activity of the pectoralis muscle did not decrease. On the contrary, focusing on using the triceps muscle also increased pectoralis EMG at 50 and 60 % of 1RM. CONCLUSION: Resistance-trained individuals can increase triceps brachii or pectarilis major muscle activity during...

  3. Cellular and molecular mechanisms of muscle atrophy

    Directory of Open Access Journals (Sweden)

    Paolo Bonaldo

    2013-01-01

    Full Text Available Skeletal muscle is a plastic organ that is maintained by multiple pathways regulating cell and protein turnover. During muscle atrophy, proteolytic systems are activated, and contractile proteins and organelles are removed, resulting in the shrinkage of muscle fibers. Excessive loss of muscle mass is associated with poor prognosis in several diseases, including myopathies and muscular dystrophies, as well as in systemic disorders such as cancer, diabetes, sepsis and heart failure. Muscle loss also occurs during aging. In this paper, we review the key mechanisms that regulate the turnover of contractile proteins and organelles in muscle tissue, and discuss how impairments in these mechanisms can contribute to muscle atrophy. We also discuss how protein synthesis and degradation are coordinately regulated by signaling pathways that are influenced by mechanical stress, physical activity, and the availability of nutrients and growth factors. Understanding how these pathways regulate muscle mass will provide new therapeutic targets for the prevention and treatment of muscle atrophy in metabolic and neuromuscular diseases.

  4. Interleukin-6 myokine signaling in skeletal muscle

    DEFF Research Database (Denmark)

    Muñoz-Cánoves, Pura; Scheele, Camilla; Pedersen, Bente K; Serrano, Antonio L

    2013-01-01

    been associated with stimulation of hypertrophic muscle growth and myogenesis through regulation of the proliferative capacity of muscle stem cells. Additional beneficial effects of IL-6 include regulation of energy metabolism, which is related to the capacity of actively contracting muscle to...... synthesize and release IL-6. Paradoxically, deleterious actions for IL-6 have also been proposed, such as promotion of atrophy and muscle wasting. We review the current evidence for these apparently contradictory effects, the mechanisms involved and discuss their possible biological implications....

  5. Markov Process of Muscle Motors

    CERN Document Server

    Kondratiev, Yu; Pirogov, S

    2007-01-01

    We study a Markov random process describing a muscle molecular motor behavior. Every motor is either bound up with a thin filament or unbound. In the bound state the motor creates a force proportional to its displacement from the neutral position. In both states the motor spend an exponential time depending on the state. The thin filament moves at its velocity proportional to average of all displacements of all motors. We assume that the time which a motor stays at the bound state does not depend on its displacement. Then one can find an exact solution of a non-linear equation appearing in the limit of infinite number of the motors.

  6. Truncated dystrophins reduce muscle stiffness in the extensor digitorum longus muscle of mdx mice

    OpenAIRE

    Hakim, Chady H.; Duan, Dongsheng

    2012-01-01

    Muscle stiffness is a major clinical feature in Duchenne muscular dystrophy (DMD). DMD is the most common lethal inherited muscle-wasting disease in boys, and it is caused by the lack of the dystrophin protein. We recently showed that the extensor digitorum longus (EDL) muscle of mdx mice (a DMD mouse model) exhibits disease-associated muscle stiffness. Truncated micro- and mini-dystrophins are the leading candidates for DMD gene therapy. Unfortunately, it has never been clear whether these t...

  7. Evaluating Swallowing Muscles Essential for Hyolaryngeal Elevation by Using Muscle Functional Magnetic Resonance Imaging

    OpenAIRE

    Pearson, William G.; Hindson, David F.; Langmore, Susan E.; Zumwalt, Ann C.

    2012-01-01

    Elevation of the larynx is critical to swallowing function, an observation supported by the fact that radiation therapy-induced dysphagia is associated with reduced laryngeal elevation. We investigated muscles underlying hyolaryngeal elevation by using muscle functional MRI. We acquired scans from 11 healthy subjects to determine whole-muscle T2 signal profiles pre-swallowing, post-swallowing, and after performing swallowing exercises. Results demonstrate muscles essential to laryngeal elevat...

  8. Evaluation of the influence of muscle deactivation on other muscles and joints during gait motion.

    Science.gov (United States)

    Komura, Taku; Prokopow, Przemyslaw; Nagano, Akinori

    2004-04-01

    When any muscle in the human musculoskeletal system is damaged, other muscles and ligaments tend to compensate for the role of the damaged muscle by exerting extra effort. It is beneficial to clarify how the roles of the damaged muscles are compensated by other parts of the musculoskeletal system from the following points of view: From a clinical point of view, it will be possible to know how the abnormal muscle and joint forces caused by the acute compensations lead to further physical damage to the musculoskeletal system. From the viewpoint of rehabilitation, it will be possible to know how the role of the damaged muscle can be compensated by extra training of the other muscles. A method to evaluate the influence of muscle deactivation on other muscles and joints is proposed in this report. Methodology based on inverse dynamics and static optimization, which is applicable to arbitrary motion was used in this study. The evaluation method was applied to gait motion to obtain matrices representing (1) the dependence of muscle force compensation and (2) the change to bone-on-bone contact forces. These matrices make it possible to evaluate the effects of deactivation of one of the muscles of the musculoskeletal system on the forces exerted by other muscles as well as the change to the bone-on-bone forces when the musculoskeletal system is performing the same motion. Through observation of this matrix, it was found that deactivation of a muscle often results in increment/decrement of force developed by muscles with completely different primary functions and bone-on-bone contact force in different parts of the body. For example, deactivation of the iliopsoas leads to a large reduction in force by the soleus. The results suggest that acute deactivation of a muscle can result in damage to another part of the body. The results also suggest that the whole musculoskeletal system must go through extra retraining in the case of damage to certain muscles. PMID:14996554

  9. Transdifferentiation of chicken embryonic cells into muscle cells by the 3' untranslated region of muscle tropomyosin.

    OpenAIRE

    L'Ecuyer, T J; Tompach, P C; Morris, E.; Fulton, A B

    1995-01-01

    Transfection with a plasmid encoding the 3' untranslated region (3' UTR) of skeletal muscle tropomyosin induces chicken embryonic fibroblasts to express skeletal tropomyosin. Such cells become spindle shaped, fuse, and express titin, a marker of striated muscle differentiation. Skeletal muscle tropomyosin and titin organize in sarcomeric arrays. When the tropomyosin 3' UTR is expressed in osteoblasts, less skeletal muscle tropomyosin is expressed, and titin expression is delayed. Some transfe...

  10. The number and choice of muscles impact the results of muscle synergy analyses

    Directory of Open Access Journals (Sweden)

    Katherine Muterspaugh Steele

    2013-08-01

    Full Text Available One theory for how humans control movement is that muscles are activated in weighted groups or synergies. Studies have shown that electromyography (EMG from a variety of tasks can be described by a low-dimensional space thought to reflect synergies. These studies use algorithms, such as nonnegative matrix factorization, to identify synergies from EMG. Due to experimental constraints, EMG can rarely be taken from all muscles involved in a task. However, it is unclear if the choice of muscles included in the analysis impacts estimated synergies. The aim of our study was to evaluate the impact of the number and choice of muscles on synergy analyses. We used a musculoskeletal model to calculate muscle activations required to perform an isometric upper-extremity task. Synergies calculated from the activations from the musculoskeletal model were similar to a prior experimental study. To evaluate the impact of the number of muscles included in the analysis, we randomly selected subsets of between 5 and 29 muscles and compared the similarity of the synergies calculated from each subset to a master set of synergies calculated from all muscles. We determined that the structure of synergies is dependent upon the number and choice of muscles included in the analysis. When five muscles were included in the analysis, the similarity of the synergies to the master set was only 0.57 ± 0.54; however, the similarity improved to over 0.8 with more than ten muscles. We identified two methods, selecting dominant muscles from the master set or selecting muscles with the largest maximum isometric force, which significantly improved similarity to the master set and can help guide future experimental design. Analyses that included a small subset of muscles also over-estimated the variance accounted for (VAF by the synergies compared to an analysis with all muscles. Thus, researchers should use caution using VAF to evaluate synergies when EMG is measured from a small

  11. Increased fatigue resistance of respiratory muscles during exercise after respiratory muscle endurance training

    OpenAIRE

    Verges, S; Lenherr, O; Haner, A C; Schulz, C.; Spengler, C M

    2007-01-01

    Respiratory muscle fatigue develops during exhaustive exercise and can limit exercise performance. Respiratory muscle training, in turn, can increase exercise performance. We investigated whether respiratory muscle endurance training (RMT) reduces exercise-induced inspiratory and expiratory muscle fatigue. Twenty-one healthy, male volunteers performed twenty 30-min sessions of either normocapnic hyperpnoea (n = 13) or sham training (CON, n = 8) over 4-5 wk. Before and after training, subjects...

  12. Creatine supplementation enhances muscle force recovery after eccentrically-induced muscle damage in healthy individuals

    OpenAIRE

    Cribb Paul J; Williams Andrew D; Rybalka Emma; Cooke Matthew B; Hayes Alan

    2009-01-01

    Abstract Background Eccentric exercise-induced damage leads to reductions in muscle force, increased soreness, and impaired muscle function. Creatine monohydrate's (Cr) ergogenic potential is well established; however few studies have directly examined the effects of Cr supplementation on recovery after damage. We examined the effects of Cr supplementation on muscle proteins and force recovery after eccentrically-induced muscle damage in healthy individuals. Methods Fourteen untrained male pa...

  13. Muscle organizers in Drosophila: the role of persistent larval fibers in adult flight muscle development

    Science.gov (United States)

    Farrell, E. R.; Fernandes, J.; Keshishian, H.

    1996-01-01

    In many organisms muscle formation depends on specialized cells that prefigure the pattern of the musculature and serve as templates for myoblast organization and fusion. These include muscle pioneers in insects and muscle organizing cells in leech. In Drosophila, muscle founder cells have been proposed to play a similar role in organizing larval muscle development during embryogenesis. During metamorphosis in Drosophila, following histolysis of most of the larval musculature, there is a second round of myogenesis that gives rise to the adult muscles. It is not known whether muscle founder cells organize the development of these muscles. However, in the thorax specific larval muscle fibers do not histolyze at the onset of metamorphosis, but instead serve as templates for the formation of a subset of adult muscles, the dorsal longitudinal flight muscles (DLMs). Because these persistent larval muscle fibers appear to be functioning in many respects like muscle founder cells, we investigated whether they were necessary for DLM development by using a microbeam laser to ablate them singly and in combination. We found that, in the absence of the larval muscle fibers, DLMs nonetheless develop. Our results show that the persistent larval muscle fibers are not required to initiate myoblast fusion, to determine DLM identity, to locate the DLMs in the thorax, or to specify the total DLM fiber volume. However, they are required to regulate the number of DLM fibers generated. Thus, while the persistent larval muscle fibers are not obligatory for DLM fiber formation and differentiation, they are necessary to ensure the development of the correct number of fibers.

  14. Effects of Reduced Muscle Glycogen on Sarcoplasmic Reticulum (SR), Muscle and Exercise Performance

    OpenAIRE

    Batts, Timothy W.

    2002-01-01

    Fatigue during exercise is associated with reduced muscle glycogen. However, evidence linking glycogen content to fatigue is lacking. In this study we examined whether reduced muscle glycogen content limited SR function or muscle performance. Two groups of female Sprague-Dawley rats were fasted for 24 hr and exercised for 90 min to reduce muscle glycogen; rats fasted after exercise formed the low glycogen (LG) group. Rats in the high glycogen (HG) group were allowed free access to food and...

  15. Dietary nitrate reduces skeletal muscle oxygenation response to physical exercise: a quantitative muscle functional MRI study

    OpenAIRE

    Bentley, Rachel; Gray, Stuart R.; Schwarzbauer, Christian; Dawson, Dana; Frenneaux, Michael; He, Jiabao

    2014-01-01

    Abstract Dietary inorganic nitrate supplementation (probably via conversion to nitrite) increases skeletal muscle metabolic efficiency. In addition, it may also cause hypoxia‐dependent vasodilation and this has the potential to augment oxygen delivery to exercising skeletal muscle. However, direct evidence for the latter with spatial localization to exercising muscle groups does not exist. We employed quantitative functional MRI (fMRI) to characterize skeletal muscle oxygen utilization and re...

  16. Dietary nitrate reduces skeletal muscle oxygenation response to physical exercise: a quantitative muscle functional MRI study

    OpenAIRE

    Bentley, R; Gray, S. R.; Schwarzbauer, C.; Dawson, D; Frenneaux, M; He, J.

    2014-01-01

    Dietary inorganic nitrate supplementation (probably via conversion to nitrite) increases skeletal muscle metabolic efficiency. In addition, it may also cause hypoxia‐dependent vasodilation and this has the potential to augment oxygen delivery to exercising skeletal muscle. However, direct evidence for the latter with spatial localization to exercising muscle groups does not exist. We employed quantitative functional MRI (fMRI) to characterize skeletal muscle oxygen utilization and replenishme...

  17. Effects of skeletal muscle lipotoxicity on muscle protein synthesis: implications for athletic and ageing populations

    OpenAIRE

    Guillet, Christelle

    2015-01-01

    Ectopic lipid accumulation in skeletal muscle is linked to reduced insulin sensitivity in various groups of subjects. The increased lipid content within muscle in older people is independently associated with insulin resistance. Physical exercise improves muscle lipid infiltration and insulin resistance in postmenopausal women. Beside the consequence of muscle fat accumulation on insulin sensitivity, some evidences clearly show that high fat feeding in young mice influences the ability of mus...

  18. Chronic Stimulation-Induced Changes in the Rodent Thyroarytenoid Muscle

    Science.gov (United States)

    McMullen, Colleen A.; Butterfield, Timothy A.; Dietrich, Maria; Andreatta, Richard D.; Andrade, Francisco H.; Fry, Lisa; Stemple, Joseph C.

    2011-01-01

    Purpose: Therapies for certain voice disorders purport principles of skeletal muscle rehabilitation to increase muscle mass, strength, and endurance. However, applicability of limb muscle rehabilitation to the laryngeal muscles has not been tested. In this study, the authors examined the feasibility of the rat thyroarytenoid muscle to remodel as a…

  19. The physiological roles of Sirt1 in skeletal muscle

    OpenAIRE

    Pardo, Patricia S.; Boriek, Aladin M.

    2011-01-01

    Skeletal muscle aging is associated with increased inflammation and oxidative stress, a decrease in the ability to rebuild muscle after injury and in response to exercise. In this perspective, we discuss the mechanisms regulating Sirt1 activity and expression in skeletal muscles, emphasizing their implications in muscle physiology and the impairment of muscle function with age.

  20. Muscle activation during selected strength exercises in women with chronic neck muscle pain

    DEFF Research Database (Denmark)

    Andersen, Lars L; Kjaer, Michael; Andersen, Christoffer H;

    2008-01-01

    BACKGROUND AND PURPOSE: Muscle-specific strength training has previously been shown to be effective in the rehabilitation of chronic neck muscle pain in women. The aim of this study was to determine the level of activation of the neck and shoulder muscles using surface electromyography (EMG) duri...