Directory of Open Access Journals (Sweden)
Filip Kolář
Full Text Available Polyploidization is one of the leading forces in the evolution of land plants, providing opportunities for instant speciation and rapid gain of evolutionary novelties. Highly selective conditions of serpentine environments act as an important evolutionary trigger that can be involved in various speciation processes. Whereas the significance of both edaphic speciation on serpentine and polyploidy is widely acknowledged in plant evolution, the links between polyploid evolution and serpentine differentiation have not yet been examined. To fill this gap, we investigated the evolutionary history of the perennial herb Knautia arvensis (Dipsacaceae, a diploid-tetraploid complex that exhibits an intriguing pattern of eco-geographic differentiation. Using plastid DNA sequencing and AFLP genotyping of 336 previously cytotyped individuals from 40 populations from central Europe, we unravelled the patterns of genetic variation among the cytotypes and the edaphic types. Diploids showed the highest levels of genetic differentiation, likely as a result of long term persistence of several lineages in ecologically distinct refugia and/or independent immigration. Recurrent polyploidization, recorded in one serpentine island, seems to have opened new possibilities for the local serpentine genotype. Unlike diploids, the serpentine tetraploids were able to escape from the serpentine refugium and spread further; this was also attributable to hybridization with the neighbouring non-serpentine tetraploid lineages. The spatiotemporal history of K. arvensis allows tracing the interplay of polyploid evolution and ecological divergence on serpentine, resulting in a complex evolutionary pattern. Isolated serpentine outcrops can act as evolutionary capacitors, preserving distinct karyological and genetic diversity. The serpentine lineages, however, may not represent evolutionary 'dead-ends' but rather dynamic systems with a potential to further influence the surrounding
Czech Academy of Sciences Publication Activity Database
Kolář, F.; Štech, M.; Trávníček, Pavel; Rauchová, Jana; Urfus, Tomáš; Vít, Petr; Kubešová, Magdalena; Suda, Jan
2009-01-01
Roč. 103, č. 6 (2009), s. 963-974 ISSN 0305-7364 R&D Projects: GA AV ČR(CZ) KJB601110627 Institutional research plan: CEZ:AV0Z60050516 Keywords : Knautia arvensis * polyploidy * ploidy mixture Subject RIV: EF - Botanics Impact factor: 3.501, year: 2009
Czech Academy of Sciences Publication Activity Database
Martínková, Jana; Klimešová, Jitka; Doležal, Jiří; Kolář, Filip
2015-01-01
Roč. 216, č. 6 (2015), s. 901-911 ISSN 1385-0237 R&D Projects: GA ČR GB14-36079G Institutional support: RVO:67985939 Keywords : root-sprouting * ploidy * Knautia arvensis Subject RIV: EF - Botanics Impact factor: 1.490, year: 2015
Czech Academy of Sciences Publication Activity Database
Kolář, Filip; Fér, T.; Štech, M.; Trávníček, Pavel; Dušková, E.; Schönswetter, P.; Suda, Jan
2012-01-01
Roč. 7, č. 7 (2012), e39988 E-ISSN 1932-6203 R&D Projects: GA AV ČR KJB600050812; GA AV ČR(CZ) KJB601110627 Institutional research plan: CEZ:AV0Z6005908 Institutional support: RVO:67985939 Keywords : serpentine spetiation * Knautia arvensis * polyploidy Subject RIV: EF - Botanics Impact factor: 3.730, year: 2012
Directory of Open Access Journals (Sweden)
Carlson Sara E
2011-11-01
Full Text Available Abstract Background CYCLOIDEA (CYC-like genes have been implicated in the development of capitulum inflorescences (i.e. flowering heads in Asteraceae, where many small flowers (florets are packed tightly into an inflorescence that resembles a single flower. Several rounds of duplication of CYC-like genes have occurred in Asteraceae, and this is hypothesized to be correlated with the evolution of the capitulum, which in turn has been implicated in the evolutionary success of the group. We investigated the evolution of CYC-like genes in Dipsacaceae (Dipsacales, a plant clade in which capitulum inflorescences originated independently of Asteraceae. Two main inflorescence types are present in Dipsacaceae: (1 radiate species contain two kinds of floret within the flowering head (disk and ray, and (2 discoid species contain only disk florets. To test whether a dynamic pattern of gene duplication, similar to that documented in Asteraceae, is present in Dipsacaceae, and whether these patterns are correlated with different inflorescence types, we inferred a CYC-like gene phylogeny for Dipsacaceae based on representative species from the major lineages. Results We recovered within Dipsacaceae the three major forms of CYC-like genes that have been found in most core eudicots, and identified several additional duplications within each of these clades. We found that the number of CYC-like genes in Dipsacaceae is similar to that reported for members of Asteraceae and that the same gene lineages (CYC1-like and CYC2B-like genes have duplicated in a similar fashion independently in both groups. The number of CYC-like genes recovered for radiate versus discoid species differed, with discoid species having fewer copies of CYC1-like and CYC2B-like genes. Conclusions CYC-like genes have undergone extensive duplication in Dipsacaceae, with radiate species having more copies than discoid species, suggesting a potential role for these genes in the evolution of disk and
AGG Maailmameistrivõistluste eel
2008-01-01
12.-14. juunini toimuvad Torontos Aesthetic Group Gymnastics (AGG) maailmameistrivõistlused Toronto Ülikooli võimlemiskeskuses. Nende võistluste korraldamise raske ülesande on võtnud oma õlule Kanada eestlaste võimlemisklubid Kalev Estienne ja Ritmika vastavalt Evelyn Koobi ja Annely Riga juhtimisel
Managing Sonchus arvensis using mechanical and cultural methods
Directory of Open Access Journals (Sweden)
P. VANHALA
2008-12-01
Full Text Available Perennial sow-thistle (Sonchus arvensis L. represents an increasing problem in Finland. Options for mechanical and cultural control of S. arvensis were studied in a field experiment on clay soil under organic production. The experiment consisted of different crop sequences: spring cereal (barley, Hordeum vulgare L., in 2001, oats, Avena sativa L., in 2002 with or without inter-row hoeing and/or stubble cultivation, bare fallow, fibre hemp (Cannabis sativa L., and ley with mowing. In 2003 the entire field was sown to spring wheat. Crop plant and Sonchus shoot density and dry mass prior to cereal harvest and crop yield were assessed. The control effect was rated: bare fallow > ley > cereal with or without inter-row hoeing > poor growth fibre hemp. Bare fallow was an effective but costly way to reduce S. arvensis infestation. Introduction of a regularly mown green fallow or silage ley in the crop rotation is advisable. Mechanical weed control by inter-row hoeing in cereals limits S. arvensis growth. Infestation might also be reduced by stubble cultivation in autumn. When managing S. arvensis using mechanical and cultural methods, appropriate options, including a competitive crop, should be chosen for the specific field and rotation.;
DU-AGG pilot plant design study
International Nuclear Information System (INIS)
Lessing, P.A.; Gillman, H.
1996-07-01
The Idaho National Engineering Laboratory (INEL) is developing new methods to produce high-density aggregate (artificial rock) primarily consisting of depleted uranium oxide. The objective is to develop a low-cost method whereby uranium oxide powder (UO[sub 2], U[sub 3]O[sub ]8, or UO[sub 3]) can be processed to produce high-density aggregate pieces (DU-AGG) having physical properties suitable for disposal in low-level radioactive disposal facilities or for use as a component of high-density concrete used as shielding for radioactive materials. A commercial company, G-M Systems, conducted a design study for a manufacturing pilot plant to process DU-AGG. The results of that study are included and summarized in this report. Also explained are design considerations, equipment capacities, the equipment list, system operation, layout of equipment in the plant, cost estimates, and the proposed plan and schedule
Antibacterial Activity and Mode of Action of Mentha arvensis Ethanol ...
African Journals Online (AJOL)
Antibacterial Activity and Mode of Action of Mentha arvensis Ethanol Extract against ... the antibacterial effect of ethanol extract of Mentha arvensis against multi-drug ... Reactive oxygen species (ROS) generation and protein leakage from the ... A. baumannii and acts by inducing lethal cellular damage to the bacterium.
L’Allgemeine Gleichbehandlungsgesetz (AGG: Lex sum, nihil humani a me alienum puto
Directory of Open Access Journals (Sweden)
Stefano Testa Bappenheim
2011-03-01
Full Text Available SOMMARIO: 1. Introduzione – 2. Il contesto europeo maieuta delle «4 direttive» - 3. Le «4 direttive» - 4. L’ubi consistam costituzionale tedesco - 5. Le discriminazioni vietate – 6. Fenotipi laburistici dell’AGG - 7. Fenotipi civilistici dell’AGG – 8. Le discriminazioni ammesse - 9. Il § 9, extra Ecclesiis nulla exceptio.
Directory of Open Access Journals (Sweden)
Katno Katno
2012-10-01
Full Text Available Plant tissue culture tecnique can be used to produce chemical compound or secondary metabolites from medicinal plant. The chemical compound of medicinal plants sometime produced locally within the callus. These compounds are generally identical with the one produced by medicinal plantgrowth in the field. Sonchus arvensis (tempuyung used as diuretic and anti-kidney stone. The flavonoid compound of Sonchus arvensis related to such activities are Apigenin 7-glucoside and Luteolin 7-glucoside. The both compounds of Sonchus arvensis are active as anti-kidney stone and diuretic by plant tissue culture. The reseach was carried out in plants tisue culture laboratory at BPTO Tawangmangu from June to Jully 2002. The callus of Sonchus arvensis aged of 50 days was analized with spot test and TLC methode. The result was compared to the chemical compounds from Sonchus arvensis which growth in the field. The result showed that chemical compound from the callus and the plant growth in the field were identical.
Morphometry and Distribution of Senecio Nemorensis agg. Species (Asteraceae in Poland
Directory of Open Access Journals (Sweden)
Rola Kaja
2014-07-01
Full Text Available A morphometric analysis based on 316 herbarium specimens of Senecio nemorensis agg. indicated the occurrence of the following four species in Poland: S. germanicus Wallr., S. hercynicus Herborg, S. ovatus (G. Gaertn. et al. Willd. and S. ucranicus Hodálová. Principal component analysis (PCA, analysis of variance (ANOVA/Kruskal-Wallis test and canonical discriminant analysis (CDA were applied. Quantitative characters such as supplementary bract length, leaf base width, ligule length and the supplementary/involucral bract length ratio clearly discriminated taxa within S. nemorensis agg. Included is a distribution map of the investigated species based on the examined material, with particular emphasis on the course of the northeastern boundary of S. hercynicus and the northwestern boundary of S. ucranicus. Also given is a determination key for species within S. nemorensis agg. in Poland, together with morphological descriptions of particular species
Evaluation of flavonoids and diverse antioxidant activities of Sonchus arvensis
Directory of Open Access Journals (Sweden)
Khan Rahmat
2012-10-01
Full Text Available Abstract Background Sonchus arvensis is used in the treatment of various human aliments as a traditional medicine in Pakistan. In the study its various fractions are characterized for scavenging of diverse free radicals. Results Results of the present study revealed that various fractions of Sonchus arvensis significantly scavenged the free radicals (DPPH·, ABTS·+, ·OH, superoxide, however its methanolic fraction is more potent than other fractions. Significant correlation was found between DPPH·, ABTS·+, superoxide radical and total antioxidant activity with total flavonoids and phenolics contents. Phytochmical analysis revealed the presence kaempferol, quercetin, orientin, rutin, hyperoside, catechin and myricetin. Conclusion From the present data it is concluded that various fractions of Sonchus arvensis significantly scavenged the free radical, which might be due the presence of polyphenolic constituent.
A skin burn associated with Ranunculus arvensis (wedding bloom
Directory of Open Access Journals (Sweden)
Orak Murat
2009-01-01
Full Text Available Ranunculus arvensis L-a member of Ranunculaceae family- is grown as a wild plant in productive agriculture lands of the altitude between 1 to 1850 m mainly in the Mediterranean Region and Iran-Turan vegetation in Turkey. Skin burn cases associated with Ranunculaceae family is very limited in literature and according to the authors′ knowledge this is the only report in literature from Turkey. In this report, we have presented a case of skin burn associated with Ranunculus arvensis represented to our emergency service.
Sessile oak (Quercus petraea agg. Ehrendorfer 1967) rare ...
African Journals Online (AJOL)
Sessile oak ( Quercus petraea agg. Ehrendorfer 1967) genetic variability in Serbia was estimated applying cpDNA universal primer pairs. Five different haplotypes were detected in the analyzed sample material from populations in Serbia. The areas in West and Southwest Serbia, with all their specificities, represent an ...
International Nuclear Information System (INIS)
Boesi, R.; Polidori, C.; Andrietti, F.; Gayubo, S.F.; Tormos, J.; Asis, J.D.
2007-01-01
Recently re-named as a sub-species of Mellinus arvensis, Mellinus arvensis obscurus Handlirsch 1888 was investigated ecologically and morphologically in Nepal, in order to underline the most important differences with the well known M. arvensis arvensis. Mellinus arvensis obscurus females nested in clumped aggregations on inclined plains at high altitudes, both on sunny bare soil and on a shaded grassy one. Beginning of monsoon season probably interfered with wasp activity, and females performed few provisioning flights during the day. Prey consisted of a broad range of Diptera, except for one case of a spider. Many females were observed not provisioning a nest but floating on the nesting site, and many intraspecific interactions suggested a high degree of usurpation attempts. At least one species of flies and two of ants probably acted as natural enemies of the wasp. Morphological observations on females showed that the Nepal population shares more similarities (shape of tergite I, body punctation) with the European populations than with the closer Japanese population; melanization is strong, according to west-east and altitudinal cline. The mature larva of M. arvensis obscurus Handlirsch is described, illustrated, and compared with the other mature larva of the genus. The differences between both larvae mainly lie in the presence/absence, and number or differentiation of integumental structures. We conclude that morphological traits are more important than ecological and behavioral ones in distinguishing M. arvensis obscurus from M. arvensis arvensis. (author) [es
Lekovich, Jovana; Man, Limor; Xu, Kangpu; Canon, Chelsea; Lilienthal, Debra; Stewart, Joshua D; Pereira, Nigel; Rosenwaks, Zev; Gerhardt, Jeannine
2017-12-21
PurposeFragile X premutation (PM) carriers may experience difficulties conceiving a child probably due to fragile X-associated diminished ovarian reserve (FXDOR). We investigated which subgroups of carriers with a PM are at higher risk of FXDOR, and whether the number of AGG interruptions within the repeat sequence further ameliorates the risk.MethodsWe compared markers of ovarian reserve, including anti-Müllerian hormone, antral follicle count, and number of oocytes retrieved between different subgroups of patients with a PM.ResultsWe found that carriers with midrange repeats size (70-90 CGG) demonstrate significantly lower ovarian reserve. Additionally, the number of AGG interruptions directly correlated with parameters of ovarian reserve. Patients with longer uninterrupted CGG repeats post-AGG interruptions had the lowest ovarian reserve.ConclusionThis study connects AGG interruptions and certain CGG repeat length to reduced ovarian reserve in carriers with a PM. A possible explanation for our findings is the proposed gonadotoxicity of the FMR1 transcripts. Reduction of AGG interruptions could increase the likelihood that secondary RNA structures in the FMR1 messenger RNA are formed, which could cause cell dysfunction within the ovaries. These findings may provide women with guidance regarding their fertility potential and accordingly assist with their family planning.GENETICS in MEDICINE advance online publication, 21 December 2017; doi:10.1038/gim.2017.220.
Effect of Sulfate on Selenium Uptake And Chemical Speciation in Convolvulus Arvensis L
Energy Technology Data Exchange (ETDEWEB)
Cruz-Jimenez, G.; Peralta-Video, J.R.; Rosa, G.de la; Meitzner, G.; Parson, J.G.; Gardea-Torresdey, J.L.
2007-08-08
Hydroponic experiments were performed to study several aspects of Se uptake by C. arvensis plants. Ten day old seedlings were exposed for eight days to different combinations of selenate (SeO{sub 4}{sup 2-}), sulfate (SO{sub 4}{sup 2-}), and selenite (SeO{sub 3}{sup 2-}). The results showed that in C. arvensis, SO{sub 4}{sup 2-} had a negative effect (P < 0.05) on SeO{sub 4}{sup 2-} uptake. However, a positive interaction produced a significant increase in SO{sub 4}{sup 2-} uptake when SeO{sub 4}{sup 2-} was at high concentration in the media. X-ray absorption spectroscopy studies showed that C. arvensis plants converted more than 70% of the supplied SeO{sub 3}{sup 2-} into organoselenium compounds. However, only approximately 50% of the supplied SeO{sub 4}{sup 2-} was converted into organoselenium species while the residual 50% remained in the inorganic form. Analysis using LC-XANES fittings confirmed that the S metabolic pathway was affected by the presence of Se. The main Se compounds that resembled those Se species identified in C. arvensis were Se-cystine, Se-cysteine, SeO{sub 3}{sup 2-}, and SeO{sub 4}{sup 2-}, whereas for S the main compounds were cysteine, cystine, oxidized glutathione, reduced glutathione, and SO{sub 4}{sup 2-}. The results of these studies indicated that C. arvensis could be considered as a possible option for the restoration of soil moderately contaminated with selenium even in the presence of sulfate.
Directory of Open Access Journals (Sweden)
Teodor RUSU
2007-07-01
Full Text Available The research paper presents the results obtained in the pedoclimatic conditions of Cluj-Napoca, Romania, concerning the control of Convolvulus arvensis L species. To determine or accomplish the relation with soil tillage systems and herbicides applied on soy-bean, wheat and maize crop. Minimum tillage systems determine an increasing percentage of Convolvulus arvensis species at weeding, different depending on experimental variant and on crop: 11.2-39.1% at soy-bean, 0.9-4.2% at wheat and 11.9-24.4% at maize crop. The number of Convolvulus arvensis seeds increases with 169% at tillage variant with disk + rotary harrow, 77% of these being located in the first 10 cm soil depth.
Conversion of woody biomass into fermentable sugars by cellulase from Agaricus arvensis.
Jeya, Marimuthu; Nguyen, Ngoc-Phuong-Thao; Moon, Hee-Jung; Kim, Sang-Hwan; Lee, Jung-Kul
2010-11-01
Agaricus arvensis, a newly isolated basidiomycetous fungus, was found to secrete efficient cellulases. The strain produced the highest endoglucanase (EG), cellobiohydrolase (CBH) and beta-glucosidase (BGL) activities of 0.3, 3.2 and 8U/mg-protein, respectively, with rice straw as the carbon source. Saccharification of the woody biomass with A. arvensis cellulase as the enzyme source released a high level of fermentable sugars. Enzymatic hydrolysis of the poplar biomass was optimized using the response surface methodology in order to study the influence of the variables (pH, temperature, cellulases concentration and substrate concentration). The enzyme and substrate concentrations were identified as the limiting factors for the saccharification of poplar wood biomass. A total reducing sugar level of 29g/L (293mg/g-substrate) was obtained at an enzyme concentration of 65FPU/g-substrate after optimization of the hydrolysis parameters. The model validation showed a good agreement between the experimental results and the predicted responses. A. arvensis could be a good candidate for the production of reducing sugars from a cellulosic biomass.
Determination of the genotoxic effects of Convolvulus arvensis extracts on corn (Zea mays L.) seeds.
Sunar, Serap; Yildirim, Nalan; Aksakal, Ozkan; Agar, Guleray
2013-06-01
In this research, the methanolic extracts of Convolvulus arvensis were tested for genotoxic and inhibitor activity on the total soluble protein content and the genomic template stability against corn Zea mays L. seed. The methanol extracts of leaf, stem and root of C. arvensis were diluted to 50, 75 and 100 μl concentrations and applied to corn seed. The total soluble protein and genomic template stability results were compared with the control. The results showed that especially 100 μl extracts of diluted leaf, stem and root had a strong inhibitory activity on the genomic template stability. The changes occurred in random amplification of polymorphic DNA (RAPD) profiles of C. arvensis extract treatment included variation in band intensity, loss of bands and appearance of new bands compared with control. Also, the results obtained from this study revealed that the increase in the concentrations of C. arvensis extract increased the total soluble protein content in maize. The results suggested that RAPD analysis and total protein analysis could be applied as a suitable biomarker assay for the detection of genotoxic effects of plant allelochemicals.
Electronic structure of Co islands grown on the {radical}3 x {radical}3-Ag/Ge(111) surface
Energy Technology Data Exchange (ETDEWEB)
Huang, Xiao-Lan; Chou, Chi-Hao; Lin, Chun-Liang; Tomaszewska, Agnieszka; Fu, Tsu-Yi, E-mail: phtifu@phy.ntnu.edu.tw
2011-09-30
By means of room temperature scanning tunneling spectroscopy (RT STS), we have studied the electronic structure of two different Ag/Ge(111) phases as well as Co islands grown on the {radical}3 x {radical}3-Ag/Ge (111) forming either {radical}13 x {radical}13 or 2 x 2 patterns. The spectrum obtained from 4 x 4-Ag/Ge(111) structure shows the existence of a shoulder at 0.7 V which is also present in the electronic structure of the Ge(111)-c2 x 8 and indicates donation of Ge electrons to electronic states of the Ag-driven phase. However, this fact is not supported by the electronic spectrum taken from the {radical}3 x {radical}3-Ag/Ge (111). The complexity of the Co-{radical}13 x {radical}13 islands bonding with the substrate is mirrored by a large number of peaks in their electronic spectra. The spectra obtained from the Co-2 x 2 islands which had grown on the step differ from those taken from Co-2 x 2 islands located along the edge of the terrace by a number of peaks at negative sample bias. This discrepancy is elucidated in terms of dissimilarities of Co-substrate interaction accompanying Co islands growth on different areas of the stepped surface.
Mineral constituents of medicinally important herbs mentha arvensis and ocimum basilicum
International Nuclear Information System (INIS)
Sahito, S.; Kazi, G.H.; Kazi, T.; Hafeez-u-Raman Shaikh; Memon, A.N.
2003-01-01
The role of elements particularly trace elements in health and disease are now well established. In this paper we investigate the presence of various elements in very common herbs Mentha arvensis (Mint, vern. Podina) and ocimum basilicum(vern Niazboo or Tulsi). Economically the both herbs have great importance as the source of volatile aromatic oils, medicines. Medicinal drugs like menthol is derived from Mentha arvensis, which is useful in cough and diarrhea. The samples of both plants were collected from surrounding of Hyderabad and vouchers specimens were prepared following the standard Herbarium techniques. The dried parts of each plant were digested with nitric acid and hydrogen peroxide and analysed by atomic absorption spectrophotometer technique using air acetylene flame to estimate various metals present in both herbs. (author)
Mineral constituents of medicinally important herbs mentha arvensis and ocimum basilicum
Energy Technology Data Exchange (ETDEWEB)
Sahito, S; Kazi, G H; Kazi, T [University of Sindh, Jamshoro (Pakistan). Centre of Excellence in Analytical Chemistry; Shar, G Q [Liaquat Univ. of Health and Sciences, Jamshoro (Pakistan); Shaikh, Hafeez-u-Raman [University of Sindh, Jamshoro (Pakistan). Inst. of Biochemistry; Memon, A N [University of Sindh, Jamshoro (Pakistan). Dept. of Botany
2003-06-01
The role of elements particularly trace elements in health and disease are now well established. In this paper we investigate the presence of various elements in very common herbs Mentha arvensis (Mint, vern. Podina) and ocimum basilicum(vern Niazboo or Tulsi). Economically the both herbs have great importance as the source of volatile aromatic oils, medicines. Medicinal drugs like menthol is derived from Mentha arvensis, which is useful in cough and diarrhea. The samples of both plants were collected from surrounding of Hyderabad and vouchers specimens were prepared following the standard Herbarium techniques. The dried parts of each plant were digested with nitric acid and hydrogen peroxide and analysed by atomic absorption spectrophotometer technique using air acetylene flame to estimate various metals present in both herbs. (author)
On the ecology of varieties of Sonchus arvensis L.
Pegtel, Dirk Michiel
1976-01-01
The perennial sowthistle (Sonchus arvensis L.) - a geophytic composite - is found throughout the temperature regions of the world. From the middle of the 19th century dispersal has occured from the origin area of distribution in Europe and western Africa. [...] This study aims to find out by what
Directory of Open Access Journals (Sweden)
Kurnia Retnowati
2014-08-01
Full Text Available Tempuyung (Sonchus arvensis consisted of fiavonoid were effect as obstruct xantine oksidase enzyme, antioxidant captur superoxsidase radical. The fiavonoid total in leave of tempuyung is 0,1044%, in its root have 0,5% fiavonoid and the more is apigenin-7-O-glikosida (3,4,5. This research aim to know effect of infusa root of tempuyung (Sonchus arvensis to lower the uric acid level at blood serum and infusa root of Tempuyung (Sonchus arvensis to lower the uric acid level at mouse blood serum compared to allopurinol.This research is laboratory experimental method. The object were 25 Wistar male mice 2-3 months old, 150-200 gr divided into 5 groups. Negative Control group given potassium oxonate by intraperitoneal, Positive Control group given potassium oxonate by intraperitoneal, added by allopurinol 18mg/kgBB, Infusa Concentrated Group 1 given potassium oxonate by intraperitoneal added by infusa root of tempuyung 1,25g/kgBB, Infusa Concentrated Group 2 given potassium oxonate by intraperitoneal added by infusa root of tempuyung 2,5g/kgBB, Infusa Concentrated Group 3 given potassium oxonate by intraperitoneal added by infuse root of tempuyung 5g/kgBB. Executed until one day, where measurement of uric acid of mouse blood serum done before and after treatment. Measurement of uric acid level is done by using spectrophotometer. Obtained to be data to be analysed with Kolgomorov-Smirnov test, One-Way ANOVA and continued with LSD (Least Significant Difference test with 95% confidence interval (CI. Result of statistical test of research shoe that infusa root of Tempuyung (Sonchus arvensis dose 1,25g/kgBB, 2,5g/ kgBB, 5g/kgBB have effect to lower the uric acid level at mouse blood serum. Infusa root of Tempuyung (Sonchus arvensis concentrated 5g/kgBB proportional wih dose allopurinol 18mg/kgBB to lower the uric acid level at mouse blood serum. Keyword: Infusa, root of Tempuyung (Sonchus arvensis, uric acid
Directory of Open Access Journals (Sweden)
Marija Miljković
2016-09-01
Full Text Available AggLb is the largest (318.6 kDa aggregation-promoting protein of Lactobacillus paracasei subsp. paracasei BGNJ1-64 responsible for forming large cell aggregates, which causes auto-aggregation, collagen binding and pathogen exclusion in vitro. It contains an N-terminus leader peptide, followed by six successive collagen binding domains, 20 successive repeats (CnaB-like domains and an LPXTG sorting signal at the C-terminus for cell wall anchoring. Experimental information about the roles of the domains of AggLb is currently unknown. To define the domain that confers cell aggregation and the key domains for interactions of specific affinity between AggLb and components of the extracellular matrix (ECM, we constructed a series of variants of the aggLb gene and expressed them in Lactococcus lactis subsp. lactis BGKP1-20 using a lactococcal promoter. All of the variants contained a leader peptide, an inter collagen binding-CnaB domain region (used to raise an anti-AggLb antibody, an anchor domain and a different number of collagen binding and CnaB-like domains. The role of the collagen binding repeats of the N-terminus in auto-aggregation and binding to collagen and fibronectin was confirmed. Deletion of the collagen binding repeats II, III and IV resulted in a loss of the strong auto-aggregation, collagen and fibronectin binding abilities whereas the biofilm formation capability was increased. The strong auto-aggregation, collagen and fibronectin binding abilities of AggLb were negatively correlated to biofilm formation.
Directory of Open Access Journals (Sweden)
Nripendra Nath Biswas
2014-10-01
Conclusions: These results suggest that the ethanolic extract of Mentha arvensis L. has potential antioxidant, antibacterial, cytotoxic and analgesic activities that support the ethnopharmacological uses of this plant.
Pb and Cd on growth, leaf ultrastructure and essential oil yield mint (Mentha arvensis L.
Directory of Open Access Journals (Sweden)
Caroline Nery Jezler
2015-03-01
Full Text Available Contamination of medicinal plants with heavy metals as Pb and Cd can affect the growth and the essential oil production of the plants and represent a risk to those who consume as medicine. This study aimed to evaluate the effects of absorption and localization of Pb and Cd on growth, ultrastructural aspects of leaves and essential oil yield and composition of Mentha arvensis, applied on the soil with increasing concentrations (8, 16, 32, 64 and 128mg kg-1. There was a differential absorption of Pb and Cd by M. arvensis mainly concentrated in the roots. Pb was found in small amounts in the leaves while Cd largely exceeded the safety limit without symptoms of toxicity. The ultrastructural analysis revealed the metal accumulation on vesicles surrounding the mitochondria and the presence of electron dense deposits surrounding the mitochondria, nucleus and chloroplasts. Little changes caused by Pb and Cd application were not enough to affect the growth and essential oil yield and composition of M. arvensis
O'Neill, C M; Murata, T; Morgan, C L; Mathias, R J
1996-12-01
The wild crucifer Moricandia arvensis is a potential source of alien genes for the genetic improvement of related Brassica crops. In particular M. arvensis has a C3-C4 intermediate photosynthetic mechanism which results in enhanced recapture of photorespired CO2 and may increase plant water-use efficiency. In order to transfer this trait into Brassica napus, somatic hybridisations were made between leaf mesophyll protoplasts from cultured M. arvensis shoot tips and hypocotyl protoplasts from three Brassica napus cultivars, 'Ariana', 'Cobra' and 'Westar'. A total of 23 plants were recovered from fusion experiments and established in the greenhouse. A wide range of chromosome numbers were observed among the regenerated plants, including some apparent mixoploids. Thirteen of the regenerated plants were identified as nuclear hybrids between B. napus and M. arvensis on the basis of isozyme analysis. The phenotypes of these hybrids were typically rather B. napus-like, but much variability was observed, including variation in flower colour, leaf shape and colour, leaf waxiness, fertility and plant vigour. CO2 compensation point measurements on the regenerated plants demonstrated that 3 of the hybrids express the M. arvensis C3-C4 intermediate character at the physiological level. Semi-thin sections through leaf tissues of these 3 plants revealed the presence of a Kranz-like leaf anatomy characteristic of M. arvensis but not found in B. napus. This is the first report of the expression of this potentially important agronomic trait, transferred from Moricandia, in M. arvensis x B. napus hybrids.
A rare chemical burn due to Ranunculus arvensis: three case reports.
Kocak, Abdullah O; Saritemur, Murat; Atac, Kenan; Guclu, Sibel; Ozlu, Ibrahim
2016-01-01
Ranunculus arvensis, a plant that is a member of Ranunculaceae family, generally used for local treatment of joint pain, muscle pain, burns, lacerations, edema, abscess drainage, hemorrhoids, and warts among the population. In this case report, we presented three patients who developed chemical skin burns after using R. arvensis plant locally for knee pain. The destructive effect of the plant has been reported previously to be more in fresh plants and less in dried plants. Although protoanemonin, which is considered as the main toxic substance, was reported to be absent in dried or boiled plants, the plant was boiled, cooled, and wrapped over the region with pain in our cases. Therefore, we thought that protoanemonin may be considered to be heat resistant. Also, the burn management proceeded up to surgery by using the flap technique in one of our patients in contrast to the cases found in published reports who were treated by antibiotics and dressings.
Wang, Ying-hao; Wei, Wei; Kang, Ding-ming; Ma, Ke-ping
2013-01-01
It has been reported that wild Brassica and related species are widely distributed across Xinjiang, China, and there has been an argument for species identification. Seed coat microsculpturing (SCM) is known to be an excellent character for taxonomic and evolutionary studies. By identifying collections from Xinjiang, China, and combining SCM pattern, flow cytometry, and genome-specific DNA markers as well as sexual compatibility with known species, this study aimed to detect potential relationships between SCM and genomic types in wild Brassica and related species. Three wild collections were found to be tetraploid with a SCM reticulate pattern similar to B. juncea, and containing A and B genome-specific loci, indicating relatively high sexual compatibility with B. juncea. The others were diploid, carrying S-genome-specific DNA markers, and having relatively high sexual compatibility with Sinapis arvensis. Moreover, their SCM was in a rugose pattern similar to that of S. arvensis. It was suggested that SCM, as a morphological characteristic, can reflect genomic type, and be used to distinguish B-genome species such as B. juncea from the related S. arvensis. The relationship between SCM and genomic type can support taxonomic studies of the wild Brassica species and related species.
International Nuclear Information System (INIS)
Itam, A.; Shah, A. M.; Majid, A.; Ismail, Z.
2015-01-01
Sonchus arvensis L. (Asteraceae) is one of the medicinal herbs used in traditional medicines, in which the leaf extract was used as a diuretic, lithotriptic and antiurolithiasis agent. The leaves of S. arvensis reported contain several compounds, including a variety of flavonoids, terpenoids and sterol, even this plant also contain silica and potassium. Flavonoids are secondary metabolite compound which have ability as antioxidant. In this study, the aims are to determine of antioxidants and antiangiogenic properties, and phytoconstituents quantitative of aqueous and methanol extracts of S. arvensis leaves. The antioxidant properties were studied using 1,1-Diphenyl-2-picrylhydrazyl (DPPH) free radical, xanthine oxidase and beta-carotene-linoleate models system. Furthermore, the antiangiogenic property was evaluated using ex vivo rat aorta ring assay. Quantitative determination of extracts phytoconstituents were carried out by using Gas Chromatographic-Time of Flight (GC-TOF) mass spectrophotometric methods. The results showed that the aqueous and methanol extracts have ability as antioxidant which is antioxidant activities of aqueous extracts on DPPH radical and inhibition of xanthine oxidase activity are higher than that of methanol extracts. Meanwhile antioxidant activity using beta-carotene-linoleate model system of S. arvensis aqueous extract is lower than that of methanol extracts. Nevertheless, the differences of these antioxidant activities are not significant. Antiangiogenic property of aqueous extract is also higher than that of methanol extract which is measured at 100 meu g mL/sup -1/ of extracts. This indicates that there is correlation between antioxidant activity and antiangigenic property, exhibiting that this plant possesses the potential to prevent or cure the diseases that related to angiogenesis such as cancer. (author)
Directory of Open Access Journals (Sweden)
Ying-hao Wang
Full Text Available It has been reported that wild Brassica and related species are widely distributed across Xinjiang, China, and there has been an argument for species identification. Seed coat microsculpturing (SCM is known to be an excellent character for taxonomic and evolutionary studies. By identifying collections from Xinjiang, China, and combining SCM pattern, flow cytometry, and genome-specific DNA markers as well as sexual compatibility with known species, this study aimed to detect potential relationships between SCM and genomic types in wild Brassica and related species. Three wild collections were found to be tetraploid with a SCM reticulate pattern similar to B. juncea, and containing A and B genome-specific loci, indicating relatively high sexual compatibility with B. juncea. The others were diploid, carrying S-genome-specific DNA markers, and having relatively high sexual compatibility with Sinapis arvensis. Moreover, their SCM was in a rugose pattern similar to that of S. arvensis. It was suggested that SCM, as a morphological characteristic, can reflect genomic type, and be used to distinguish B-genome species such as B. juncea from the related S. arvensis. The relationship between SCM and genomic type can support taxonomic studies of the wild Brassica species and related species.
Directory of Open Access Journals (Sweden)
Francisco Augusto Burkert Del Pino
2012-09-01
Full Text Available In vitro tests could be a valuable tool for the evaluation of medicinal plants’ antimicrobial activity. Mentha arvensis of the Lamiaceae family is one of the most frequently traditional plants used in Brazil. Hydroalcoholic extracts of M. arvensis were analyzed for antimicrobial activity on Streptococcus mutans, Streptococcus sobrinus and Candida albicans. Three different assays (agar diffusion, broth macro- and micro-dilution methods were used to evaluate antimicrobial activity. Although hydroalcoholic extracts of M. arvensis did not show any antibacterial effect, its antifungal activity against C. albicans was revealed. According to the micro-dilution broth assay, MIC of the hydroalcoholic extract from leaves of M. arvensis on Candida albicans strains ranged between 625 and 2500 mg mL-1. Results suggest that M. arvensis hydroalcoholic extract may be considered a potentially antifungal agent against C. albicans, and a possible item for human antibiotic therapy. However, further biological tests on the plant’s efficacy and side-effects are necessary before its use on humans.
Wang, Pei; Song, Fan; Cai, Wanzhi
2014-01-01
Insect mitochondrial genomes are very important to understand the molecular evolution as well as for phylogenetic and phylogeographic studies of the insects. The Miridae are the largest family of Heteroptera encompassing more than 11,000 described species and of great economic importance. For better understanding the diversity and the evolution of plant bugs, we sequence five new mitochondrial genomes and present the first comparative analysis of nine mitochondrial genomes of mirids available to date. Our result showed that gene content, gene arrangement, base composition and sequences of mitochondrial transcription termination factor were conserved in plant bugs. Intra-genus species shared more conserved genomic characteristics, such as nucleotide and amino acid composition of protein-coding genes, secondary structure and anticodon mutations of tRNAs, and non-coding sequences. Control region possessed several distinct characteristics, including: variable size, abundant tandem repetitions, and intra-genus conservation; and was useful in evolutionary and population genetic studies. The AGG codon reassignments were investigated between serine and lysine in the genera Adelphocoris and other cimicomorphans. Our analysis revealed correlated evolution between reassignments of the AGG codon and specific point mutations at the antidocons of tRNALys and tRNASer(AGN). Phylogenetic analysis indicated that mitochondrial genome sequences were useful in resolving family level relationship of Cimicomorpha. Comparative evolutionary analysis of plant bug mitochondrial genomes allowed the identification of previously neglected coding genes or non-coding regions as potential molecular markers. The finding of the AGG codon reassignments between serine and lysine indicated the parallel evolution of the genetic code in Hemiptera mitochondrial genomes. PMID:24988409
Evaluation of in vivo and in vitro biological activities of different extracts of Cuscuta arvensis.
Koca, Ufuk; Küpeli-Akkol, Esra; Sekeroglu, Nazim
2011-10-01
In the present study, the potential effects of extracts from the whole plant of Cuscuta arvensis were studied in mice using the carrageenan-induced hind paw edema model for antiinflammatory activity and the p-benzoquinone-induced writhing reflex for the assessment of antinociceptive activity. In order to obtain the extracts, the whole plant of C. arvensis was extracted with different solvents such as n-hexane, dichloromethane, ethyl acetate, methanol and distilled water. Antioxidant activity was evaluated by the 2,2-diphenyl-1-picrylhydrazyl (DPPH) radical scavenging assay. The methanolic and water extracts inhibited the carrageenan-induced paw edema and p-benzoquinone-induced writhing reflex, whereas the other extracts showed only mild inhibitory antinociceptive and antiinflammatory activities in these in vivo models. Additionally, the methanol and ethyl acetate extracts had higher scavenging ability then the non polar extracts.
Directory of Open Access Journals (Sweden)
Amir Hamzah
2017-04-01
Full Text Available Phytoremediation has been intensively studied due its costs effectiveness and environmentally sound. Studies of heavy metal pollution phytoremediation has been done in develop countries, but still limited in Indonesia. This study aims to explore the potential of wild plant species Eleusine indica L. and Sonchus arvensis L. as an agent of phytoremediation on Cd-contaminated soil. This study was done descriptively in Pujon, Malang, Indonesia, to test the ability of two species of wild plants E. indica and S. arvensis in absorbing Cd. Along this research, plant growth and the concentration of Cd in roots, stems and leaves, was monitored. Plant growth was measured every week for three months. The plant roots, stems, and leaves collected separately, then analyzed its Cd levels. The results showed that both of two species of wild plants grew well on soil contaminated Cd. Plant roots can accumulate higher Cd than the stem part. In addition, E indica has the ability to accumulate Cd higher than S. arvensis, i.e. 57.11% and 35.84%, respectively
[The Swedish ambulance services 1935-1936 of Gunnar Agge].
Gustavsson, Pär; Nilsson, Peter M
2006-01-01
The fact that Sweden has been spared from war on its soil for almost 200 years, has not stopped Swedish citizens from participating in conflicts worldwide during this period. This has been described, especially from the soldiers perspective. The contribution of Swedish physicians has not been written about to the same extent. When Mussolini's Italy in October 1935 invaded the poor and underdeveloped country of Ethiopia (former Abyssinia) an ambulance was immediately organized by the Swedish Red Cross. To lead such an expedition, a great knowledge of Ethiopian culture och maybe most importantly, of the weather and geographical conditions, was undoubtedly demanded. Therefore, the Swedish Red Cross turned to two Ethiopian veterans. Doctor Fride Hylander, a missionary-son who had been working on a hospital project in the Ethiopian province of Harrar and his friend since school years, doctor Gunnar Agge, were assigned the leadership of the ambulance. Dr Agge had also participated in improving the Ethiopian health care both in Harrar and later as civilian and military doctor in the province of Ogaden, where he was medically responsible for the more than 9 000 men strong army that the Ethiopian emperor had stationed there after Italian provocations. Most of the other members of the ambulance were handpicked by these two leaders and many of them had, just like themselves, a stong religious belief. A money-raise was immediately initiated and in less than six weeks 700 000 Swedish crowns had been collected, more then twice the sum the ambulance was calculated to cost. In early november 1935 the ambulance was clear to go. Their primary objective was to travel through British Somaliland and establish a field-hospital in the province of Harrar. However, the Ethiopian emperor had other things in mind. He wanted to reorganize the ambulance and divide it in two and place it closer to the front line. The ambulance decided to go along with his wish. Both groups started eventually
Directory of Open Access Journals (Sweden)
Więcław Helena
2014-03-01
Full Text Available Sedges of Carex flava agg., typical of moist or wet habitats, are difficult to classify because of a lack of clear-cut morphological differences between them and the existence of numerous hybrids. This monograph presents results of research conducted in 2007-2012 in various parts of Poland. The plant material consisted of 1852 living specimens of Carex flava agg., collected from 80 localities, and dried specimens from 26 herbaria and from 7 private collections. The analysis involved 45 morphological characters (34 quantitative and 11 qualitative and 9 soil parameters. Univariate, bivariate, and multivariate statistical methods were used to process the data. The results confirm the taxonomic classification dividing the C. flava group into 4 species: C. flava s.s., C. lepidocarpa, C. demissa, and C. viridula. This classification is based on (i a high observed level of morphological separation of these taxa, resulting mostly from differences in generative characters, i.e. length of the utricle and its beak, and percentage ratio of beak length to total utricle length; (ii integrity of the taxa at the sites where they coexist, although some intermediate forms resulting from hybridization are also present; (iii habitat preferences of the taxa, especially the preference of C. lepidocarpa for calcareous sites and of C. demissa for slightly acidic soils. Thus in Poland the analysed taxa are morphologically well-defined and show clear ecological preferences. Continuous variation of morphological characters was observed among specimens of C. viridula, so it is not justifiable to distinguish its subspecies (sometimes classified even as separate species, described previously in literature. Consequently, the 2 subgroups of C. viridula were treated as local variants (i.e. varieties: var. viridula and var. pulchella, considering their different habitat requirements. Additionally, 5 hybrids were distinguished within C. flava agg.: C. ×alsatica [= C. demissa
Wang, Tao; Zhang, Zhaoshun; Liao, Fan; Cai, Qian; Li, Yanqing; Lee, Shuit-Tong; Shao, Mingwang
2014-02-11
The finite-difference time-domain (FDTD) method was employed to simulate the electric field distribution for noble metal (Au or Ag)/semiconductor (Ge or Si) substrates. The simulation showed that noble metal/Ge had stronger SERS enhancement than noble metal/Si, which was mainly attributed to the different dielectric constants of semiconductors. In order to verify the simulation, Ag nanoparticles with the diameter of ca. 40 nm were grown on Ge or Si wafer (Ag/Ge or Ag/Si) and employed as surface-enhanced Raman scattering substrates to detect analytes in solution. The experiment demonstrated that both the two substrates exhibited excellent performance in the low concentration detection of Rhodamine 6G. Besides, the enhancement factor (1.3 × 10(9)) and relative standard deviation values (less than 11%) of Ag/Ge substrate were both better than those of Ag/Si (2.9 × 10(7) and less than 15%, respectively), which was consistent with the FDTD simulation. Moreover, Ag nanoparticles were grown in-situ on Ge substrate, which kept the nanoparticles from aggregation in the detection. To data, Ag/Ge substrates showed the best performance for their sensitivity and uniformity among the noble metal/semiconductor ones.
Hepatoprotective activity of Mentha arvensis Linn. leaves against CCL4 induced liver damage in rats
Directory of Open Access Journals (Sweden)
Kalpana Patil
2012-05-01
Full Text Available Objective: To study the Hepatoprotective activity of ethanol, chloroform and aqueous extracts of Mentha arvensis leaves against CCL4 induced liver damage in rats. Methods: Hepatotoxicity was induced by CCL4 and the biochemical parameters such as serum glutamate pyruvate transminase (sGPT, serum glutamate oxaloacetate transaminase (sGOT, alkaline phosphatase (sALP, serum bilirubin (sB and histopathological changes in liver were studied along with silymarin as standard Hepatoprotective agents. Results: The Phytochemical investigation of the extracts showed presence of flavonoids, steroids, triterpenoids, alkaloids, glycosides, carbohydrates, tannins, phenolic compounds. Treatment of the rats with chloroform, ethanol and aqueous extract with CCL 4 administration caused a significant reduction in the values of sGOT, sGPT, sALP and sB (P<0.01 almost comparable to the silymarin. The Hepatoprotective was confirmed by histopathological examination of the liver tissue of control and treated animals. Conclusions: From the results it can be concluded that Mentha arvensis possesses Hepatoprotective effect against CCL4 induced liver damage in rats.
Allelopathic effect of ryegrass (lolium persicum) and wild mustard (sinapis arvensis) on barley
International Nuclear Information System (INIS)
Baziar, M.R.; Farahvash, F.; Mirshekari, B.; Rashidi, V.
2014-01-01
Most crop plants and weeds have allelopathic effects and analysis of these effects on plants in crop alteration and successive planting is very important. In this research the allelopathic ability of different parts and concentrations of two weeds, Lolium Persicum (Ryegrass) and Sinapis arvensis (wild mustered), on growth characteristics of two barley varieties was studied in the greenhouse using a completely randomized design with four replications. Test factors consisted of two barley varieties (Valfajr and Rehane), three weed organs (root, stalk, leaf) and four concentrations of extracts of weed organs (25, 50, 75 and control or distilled water). After the preparation of extracts of different weed organs with different concentrations, their effect on growth characteristics of barley plant was evaluated. Finally, seedling length, rootlet length caulicle length, wet weight of seedling, dry weight of seedling were measured. Also, the above two seeds had significant effects on the two strains of barley and could influence growth characteristics of barley. Based on the results of present study, one can argue that Ryegrass (Lolium Persicum) and wild mustard (Sinapis arvensis) can strongly affect germination, growth and performance of barley through production of chemical materials with allelopathic properties, leading unfavorable growth and product yield. (author)
UV-radiation and the flavonoid content in callus culture of Ononis arvensis L
International Nuclear Information System (INIS)
Tumowa, L.; Psotowa, R.
1998-01-01
The paper discussed a possible influence on the production of secondary metabolites - the flavonoids, by the method of elicitation in the callus cultures of Ononis arvensis L., the elicitor employed being the UV 254 and 366 nm and the sun-lamp. In some cases there was an increase in the production of flavonoids particularly 60, 120, 240 and 300 s after sun-lamp irradiation and in case of 15 and 30 min irradiation with UV-254 nm
Directory of Open Access Journals (Sweden)
Muhamet eTopuz
2015-07-01
Full Text Available Biotypes of the broad-leaved wild mustard (Sinapis arvensis L. found in wheat fields of Aegean and Marmara region of Turkey were characterized and shown to have developed resistance to sulfonylurea (chlorsulfuron, an inhibitor of acetolactate synthase (ALS. DNA sequence analysis of the ALS genes from two such resistant (‘R’ biotypes, KNF-R1 and KNF-R2, revealed point mutations, CCT (Pro 197 to TCT (Ser 197 in KNF-R1 and CCT (Pro 197 to ACT (Thr 197 in KNF-R2; these substitutions are consistent with the presence of chlorsulfuron-insensitive ALS enzyme activity in the ‘R’ S. arvensis biotypes. An additional phenotype of chlorsulfuron resistance in the Turkish S. arvensis ‘R’ biotypes was revealed in the form of an altered seed dormancy behavior over 4 to 48 months of dry storage (after-ripening compared to the susceptible (‘S’ biotypes. Seeds of the ‘S’ biotypes dry stored for 4 months had a higher initial germination, which sharply decreased with storage time, while the seeds of the ‘R’ biotypes had lower germination after 4-months storage, rising sharply and peaking thereafter by 24 months’ of dry storage. The ‘R’ biotype seeds continued to maintain a higher germination percentage even after 48 months of after-ripening. The seed weight of ‘R’ and ‘S’ biotypes after-ripened for 4 months was similar but those after-ripened for 48 months differed, ‘R’ seeds were significantly heavier than those of the ‘S’ seeds. Differential seed germinability between ‘S’ and ‘R’ biotypes was found not a case of differential viability, temperature regimen or non-response to pro-germination hormone GA3. These studies are of relevance to ecological fitness of herbicide-resistant biotypes in terms of seed viability and germination.
Topuz, Muhamet; Nemli, Yildiz; Fatima, Tahira; Mattoo, Autar
2015-07-01
Biotypes of the broad-leaved wild mustard (Sinapis arvensis L.) found in wheat fields of Aegean and Marmara region of Turkey were characterized and shown to have developed resistance to sulfonylurea (chlorsulfuron), an inhibitor of acetolactate synthase (ALS). DNA sequence analysis of the ALS genes from two such resistant (‘R’) biotypes, KNF-R1 and KNF-R2, revealed point mutations, CCT (Pro 197) to TCT (Ser 197) in KNF-R1 and CCT (Pro 197) to ACT (Thr 197) in KNF-R2; these substitutions are consistent with the presence of chlorsulfuron-insensitive ALS enzyme activity in the ‘R’ S. arvensis biotypes. An additional phenotype of chlorsulfuron resistance in the Turkish S. arvensis ‘R’ biotypes was revealed in the form of an altered seed dormancy behavior over 4 to 48 months of dry storage (after-ripening) compared to the susceptible (‘S’) biotypes. Seeds of the ‘S’ biotypes dry stored for 4 months had a higher initial germination, which sharply decreased with storage time, while the seeds of the ‘R’ biotypes had lower germination after 4-months storage, rising sharply and peaking thereafter by 24 months’ of dry storage. The ‘R’ biotype seeds continued to maintain a higher germination percentage even after 48 months of after-ripening. The seed weight of ‘R’ and ‘S’ biotypes after-ripened for 4 months was similar but those after-ripened for 48 months differed, ‘R’ seeds were significantly heavier than those of the ‘S’ seeds. Differential seed germinability between ‘S’ and ‘R’ biotypes was found not a case of differential viability, temperature regimen or non-response to pro-germination hormone GA3. These studies are of relevance to ecological fitness of herbicide-resistant biotypes in terms of seed viability and germination.
Mohd Azman A. Nurul; Husni Shafik; Almajano P. Maria; Gallego G. Maria
2013-01-01
The potential of using herbal Betula alba (BA) and Convolvulus arvensis (CA) as a natural antioxidant for food applications were investigated. Each plant extract was prepared by using pure ethanol, different concentration of ethanol aqueous solutions, including 50% and 75%, 50% methanol aqueous and water. Total phenolic content (TPC) was determined using Folin–Ciocalteau method and antioxidant activity were analyzed by 2,2-diphenyl-1-picrylhydrazyl (DPPH) radicals, trolox equivalent antioxida...
Czech Academy of Sciences Publication Activity Database
Havlík, J.; Kokoška, L.; Vašíčková, Soňa; Valterová, Irena
2006-01-01
Roč. 21, č. 4 (2006), s. 713-717 ISSN 0882-5734 R&D Projects: GA ČR(CZ) GA525/02/0257 Institutional research plan: CEZ:AV0Z40550506 Keywords : Nigella arvensis L. * essential oil composition * antimicrobial activity Subject RIV: CC - Organic Chemistry Impact factor: 0.868, year: 2006
Koca-Caliskan, Ufuk; Yilmaz, Ismet; Taslidere, Asli; Yalcin, Funda N; Aka, Ceylan; Sekeroglu, Nazim
2018-05-02
Cuscuta arvensis Beyr. is a parasitic plant, and commonly known as "dodder" in Europe, in the United States, and "tu si zi shu" in China. It is one of the preferred spices used in sweet and savory dishes. Also, it is used as a folk medicine for the treatment particularly of liver problems, knee pains, and physiological hepatitis, which occur notably in newborns and their mothers in the southeastern part of Turkey. The purpose of this study was to investigate the hepatoprotective effects and antioxidant activities of aqueous and methanolic extracts of C. arvensis Beyr. on acetaminophen (APAP)-induced acute hepatotoxicity in rats. The results were supported by subsequent histopathological studies. The hepatoprotective activity of both the aqueous and methanolic extracts at an oral dose of 125 and 250 mg/kg was investigated by observing the reduction levels or the activity of alkaline phosphatase, alkaline transaminase, aspartate aminotransferase, blood urine nitrogen, and total bilirubin content. In vivo antioxidant activity was determined by analyzing the serum superoxide dismutase, malondialdehyde, glutathione, and catalase levels. Chromatographic methods were used to isolate biologically active compounds from the extract, and spectroscopic methods were used for structure elucidation. Both the methanolic and aqueous extracts exerted noticable hepatoprotective and antioxidant effects supporting the folkloric usage of dodder. One of the bioactive compounds was kaempferol-3-O-rhamnoside, isolated and identified from the methanolic extract.
Wei, Wenhui; Li, Yunchang; Wang, Lijun; Liu, Shengyi; Yan, Xiaohong; Mei, Desheng; Li, Yinde; Xu, Yusong; Peng, Pengfei; Hu, Qiong
2010-04-01
An allo-cytoplasmic male sterile line, which was developed through somatic hybridization between Brassica napus and Sinapis arvensis (thus designated as Nsa CMS line), possesses high potential for hybrid production of rapeseed. In order to select for restorer lines, fertile plants derived from the same somatic hybridization combination were self-pollinated and testcrossed with the parental Nsa CMS line for six generations. A novel disomic alien addition line, B. napus-S. arvensis, has been successfully developed. GISH analysis showed that it contains one pair of chromosomes from S. arvensis and 19 pairs from B. napus, and retains stable and regular mitotic and meiotic processes. The addition line displays very strong restoration ability to Nsa CMS line, high resistance to Sclerotinia sclerotiorum and a low incidence of pod shattering. Because the addition line shares these very important agricultural characters, it is a valuable restorer to Nsa CMS line, and is named NR1 here (Nsa restorer no. 1).
Manikandan, R; Sahi, S V; Venkatachalam, P
2015-01-01
The present study was focused on examining the effect of Hg oxidative stress induced physiochemical and genetic changes in M. arvensis seedlings. The growth rate of Hg treated seedlings was decreased to 56.1% and 41.5% in roots and shoots, respectively, compared to the control. Accumulation of Hg level in both roots and shoots was increased with increasing the concentration of Hg. Superoxide dismutase (SOD), catalase (CAT), and ascorbate peroxidase (APX) activities were found to be increased with increasing the Hg concentration up to 20 mg/L; however, it was decreased at 25 mg/L Hg concentration. The POX enzyme activity was positively correlated with Hg dose. The changes occurring in the random amplification of ploymorphic DNA (RAPD) profiles generated from Hg treated seedlings included variations in band intensity, disappearance of bands, and appearance of new bands compared with the control seedlings. It was concluded that DNA polymorphisms observed with RAPD profile could be used as molecular marker for the evaluation of heavy metal induced genotoxic effects in plant species. The present results strongly suggested that Mentha arvensis could be used as a potential phytoremediator plant in mercury polluted environment.
Growth of two-dimensional Ge crystal by annealing of heteroepitaxial Ag/Ge(111) under N2 ambient
Ito, Koichi; Ohta, Akio; Kurosawa, Masashi; Araidai, Masaaki; Ikeda, Mitsuhisa; Makihara, Katsunori; Miyazaki, Seiichi
2018-06-01
The growth of a two-dimensional crystal of Ge atoms on an atomically flat Ag(111) surface has been demonstrated by the thermal annealing of a heteroepitaxial Ag/Ge structure in N2 ambient at atmospheric pressure. The surface morphology and chemical bonding features of heteroepitaxial Ag(111) grown on wet-cleaned Ge(111) after annealing at different temperatures and for various times have been systematically investigated to control the surface segregation of Ge atoms and the planarization of the heteroepitaxial Ag(111) surface.
Identification of the cadmium binding compounds in Agaricus arvensis hyphae using 109Cd
International Nuclear Information System (INIS)
Jackl, G.A.; Kollmer, W.E.; Reidel, G.
1987-01-01
Hyphae from the edible mushroom Agaricus arvensis were grown in a liquid medium supplemented with 1 mg cadmium per litre. The heavy metal had no influence on the growth of the fungus at this concentration. Cell extracts were labeled in vitro with radioactive 109 Cd. Cadmium was found in two main fractions having apparent molecular weights of about 500 and 1500 dalton. These fractions were identified by chemical analysis of cadmium as well as by radioactive labeling. The in vitro labeling procedure with radioactive cadmium is a more rapid procedure than analyzing the element in the original sample. (author)
Doubková, Pavla; Kohout, Petr; Sudová, Radka
2013-10-01
Arbuscular mycorrhizal (AM) symbiosis is among the factors contributing to plant survival in serpentine soils characterised by unfavourable physicochemical properties. However, AM fungi show a considerable functional diversity, which is further modified by host plant identity and edaphic conditions. To determine the variability among serpentine AM fungal isolates in their effects on plant growth and nutrition, a greenhouse experiment was conducted involving two serpentine and two non-serpentine populations of Knautia arvensis plants grown in their native substrates. The plants were inoculated with one of the four serpentine AM fungal isolates or with a complex AM fungal community native to the respective plant population. At harvest after 6-month cultivation, intraradical fungal development was assessed, AM fungal taxa established from native fungal communities were determined and plant growth and element uptake evaluated. AM symbiosis significantly improved the performance of all the K. arvensis populations. The extent of mycorrhizal growth promotion was mainly governed by nutritional status of the substrate, while the effect of AM fungal identity was negligible. Inoculation with the native AM fungal communities was not more efficient than inoculation with single AM fungal isolates in any plant population. Contrary to the growth effects, a certain variation among AM fungal isolates was revealed in terms of their effects on plant nutrient uptake, especially P, Mg and Ca, with none of the AM fungi being generally superior in this respect. Regardless of AM symbiosis, K. arvensis populations significantly differed in their relative nutrient accumulation ratios, clearly showing the plant's ability to adapt to nutrient deficiency/excess.
Tanveer,A; Tasneem,M; Khaliq,A; Javaid,M.M; Chaudhry,M.N
2013-01-01
An understanding of seed germination ecology of weeds can assist in predicting their potential distribution and developing effective management strategies. Influence of environmental factors and seed size on germination and seedling emergence of Convolvulus arvensis (field bindweed) was studied in laboratory and greenhouse conditions. Germination occurred over a wide range of constant temperatures, between 15 and 40 ºC, with optimum germination between 20 and 25 ºC. Time to start germination,...
Nađpal, Jelena D; Lesjak, Marija M; Šibul, Filip S; Anačkov, Goran T; Četojević-Simin, Dragana D; Mimica-Dukić, Neda M; Beara, Ivana N
2016-02-01
The aim of this study was to compare phenolic profile, vitamin C content, antioxidant, anti-inflammatory and cytotoxic activity of rose hips and the preserves (purée and jam) of two Rosa species: renowned Rosa canina L. and unexplored Rosa arvensis Huds. The liquid chromatography-tandem mass spectrometry analysis of 45 phenolics resulted in quantification of 14 compounds, with quercitrin, gallic and protocatechuic acids as the most dominant. High antioxidant potential of R. canina and a moderate activity of R. arvensis extracts were determined through several assays. Purée of both species and methanol extract of air-dried R. canina hips showed some anti-inflammatory (cyclooxygenase-1 and 12-lipooxygense inhibition potency) activity. Purée of R. canina exerted cytotoxic activity only against the HeLa cell line among several others (HeLa, MCF7, HT-29 and MRC-5). The presented results support traditional use of rose hips and their fruit preserves as food with health and nutritional benefits. Copyright © 2015 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Jennifer B Landesmann
Full Text Available Tropospheric ozone is one of the major drivers of global change. This stress factor alters plant growth and development. Ozone could act as a selection pressure on species communities composition, but also on population genetic background, thus affecting life history traits. Our objective was to evaluate the consequences of prolonged ozone exposure of a weed community on phenotypic traits of Spergulaarvensis linked to persistence. Specifically, we predicted that the selection pressure exerted by high ozone concentrations as well as the concomitant changes in the weed community would drive population adaptive changes which will be reflected on seed germination, dormancy and longevity. In order to test seed viability and dormancy level, we conducted germination experiments for which we used seeds produced by S. arvensis plants grown within a weed community exposed to three ozone treatments during four years (0, 90 and 120 ppb. We also performed a soil seed bank experiment to test seed longevity with seeds coming from both the four-year ozone exposure experiment and from a short-term treatment conducted at ambient and added ozone concentrations. We found that prolonged ozone exposure produced changes in seed germination, dormancy and longevity, resulting in three S. arvensis populations. Seeds from the 90 ppb ozone selection treatment had the highest level of germination when stored at 75% RH and 25 °C and then scarified. These seeds showed the lowest dormancy level when being subjected to 5 ºC/5% RH and 25 ºC/75% followed by 5% RH storage conditions. Furthermore, ozone exposure increased seed persistence in the soil through a maternal effect. Given that tropospheric ozone is an important pollutant in rural areas, changes in seed traits due to ozone exposure could increase weed persistence in fields, thus affecting weed-crop interactions, which could ultimately reduce crop production.
Landesmann, Jennifer B; Gundel, Pedro E; Martínez-Ghersa, M Alejandra; Ghersa, Claudio M
2013-01-01
Tropospheric ozone is one of the major drivers of global change. This stress factor alters plant growth and development. Ozone could act as a selection pressure on species communities composition, but also on population genetic background, thus affecting life history traits. Our objective was to evaluate the consequences of prolonged ozone exposure of a weed community on phenotypic traits of Spergulaarvensis linked to persistence. Specifically, we predicted that the selection pressure exerted by high ozone concentrations as well as the concomitant changes in the weed community would drive population adaptive changes which will be reflected on seed germination, dormancy and longevity. In order to test seed viability and dormancy level, we conducted germination experiments for which we used seeds produced by S. arvensis plants grown within a weed community exposed to three ozone treatments during four years (0, 90 and 120 ppb). We also performed a soil seed bank experiment to test seed longevity with seeds coming from both the four-year ozone exposure experiment and from a short-term treatment conducted at ambient and added ozone concentrations. We found that prolonged ozone exposure produced changes in seed germination, dormancy and longevity, resulting in three S. arvensis populations. Seeds from the 90 ppb ozone selection treatment had the highest level of germination when stored at 75% RH and 25 °C and then scarified. These seeds showed the lowest dormancy level when being subjected to 5 ºC/5% RH and 25 ºC/75% followed by 5% RH storage conditions. Furthermore, ozone exposure increased seed persistence in the soil through a maternal effect. Given that tropospheric ozone is an important pollutant in rural areas, changes in seed traits due to ozone exposure could increase weed persistence in fields, thus affecting weed-crop interactions, which could ultimately reduce crop production.
Nova variedade de Menta arvensis
Directory of Open Access Journals (Sweden)
Abelardo Rodrigues Lima
1952-09-01
Full Text Available No quarto ano dos trabalhos de seleção com a menta japonêsa, foi encontrado um "seedling", o M. A. 701, que se destacou pela resistência à ferrugem e pela sua rusticidade. Os caracteres botânicos dessa variedade comercial, principalmente hábito vegetativo, coloração das fôlhas e das hastes, a tornam completa' mente distinta da variedade original. Esta distinção se confirma e acentua quando se compara a natureza dos componentes do óleo essencial da menta "Campinas" M. A. 701, descrita no presente trabalho, com a menta japonêsa comum. A maior produtividade da nova variedade comparada com a da menta japonesa comum foi desde logo também constatada pelos primeiros lavradores, a quem foram enviadas pequenas quantidades de rizomas, para plantio experimental. Foram cultivados em 1949-50 cêrca de 12 hectares; cm 1950-51, cêrca de 900 ha, e o prognóstico é que essa variedade tende a substituir totalmente a menta japonêsa anteriormente cultivada em São Paulo, devido ao seu maior valor econômico.A seedling, designated M.A.701, remarkable for its vigor and resistance to rust, was discovered during the fourth year of selection of Japanese mint (Mentha arvensis L. subsp. haplocalix Briquet var. piperascens Holmes or forma piperascens Malinvaud. The botanical characters of the variety derived from this seedling, especially the vegetative habit and colouring of leaves and stems, make it quite different from the original variety. This difference is enhanced, when we compare the nature of the essential oil components of "Campinas" M.A.701, as described in the present paper, with that of the common Japanese mint. The higher yield of the new variety, compared with that of the common Japanese mint, was soon confirmed by the first cultivators, to whom small quantities of rhizomes were sent for experimental planting. About 12 hectars were cultivated em 1949/50 and about 900 hectars in 1950/51. It is expected that the new variety will, on account
International Nuclear Information System (INIS)
Salam, I.U.; Ahmed, M.; Ali, S.T.
2011-01-01
The green house based experiments were conducted in the Department of Botany FUUAST, Karachi to study the allelopathic effects of root and shoot leachates of Anagallis arvensis on the two test species viz., bajra and mungbean. The percentage of seed germination, speed of germination and radical elongation of the test species were recorded after 10 days. Both leachates have no effect on seed germination and speed of germination of the test species. Radical elongation of two test species showed different response. Mung radical growth was significantly reduced while bajra radical growth was significantly enhanced by the root leachate of weed. (author)
Directory of Open Access Journals (Sweden)
Banerjee PP
2017-04-01
Full Text Available Prajna Paramita Banerjee,1 Arindam Bandyopadhyay,1 Singapura Nagesh Harsha,2 Rudragoud S Policegoudra,3 Shelley Bhattacharya,4 Niranjan Karak,2 Ansuman Chattopadhyay1 1Molecular Genetics Laboratory, Department of Zoology, Visva-Bharati, Santiniketan, West Bengal, 2Advanced Polymer and Nanomaterial Laboratory, Department of Chemical Sciences, Center for Polymer Science and Technology, Tezpur University, Napaam, 3Division of Pharmaceutical Technology, Defence Research Laboratory, Tezpur, Assam, 4Environmental Toxicology Laboratory, Department of Zoology, Visva-Bharati, Santiniketan, West Bengal, India Introduction: Leaf extract of Mentha arvensis or mint plant was used as reducing agent for the synthesis of green silver nanoparticles (GSNPs as a cost-effective, eco-friendly process compared to that of chemical synthesis. The existence of nanoparticles was characterized by ultraviolet–visible spectrophotometry, dynamic light scattering, Fourier transform infrared spectroscopy, X-ray diffraction, energy-dispersive X-ray analysis, atomic-force microscopy and transmission electron microscopy analyses, which ascertained the formation of spherical GSNPs with a size range of 3–9 nm. Anticancer activities against breast cancer cell lines (MCF7 and MDA-MB-231 were studied and compared with those of chemically synthesized (sodium borohydride [NaBH4]-mediated silver nanoparticles (CSNPs. Materials and methods: Cell survival of nanoparticle-treated and untreated cells was studied by 3-[4,5-dimethylthiazol-2-yl]-2,5-diphenyltetrazolium bromide (MTT assay. Cell-cycle analyses were carried out using fluorescence-activated cell sorting. Cell morphology was observed by fluorescence microscopy. Expression patterns of PARP1, P53, P21, Bcl2, Bax and cleaved caspase 9 as well as caspase 3 proteins in treated and untreated MCF7 and MDA-MB-231 cells were studied by Western blot method. Results: MTT assay results showed that Mentha arvensis-mediated GSNPs
International Nuclear Information System (INIS)
Huang, Xiao-Lan; Tomaszewska, Agnieszka; Lin, Chun-Liang; Tsay, Sung-Lin; Chou, Chi-Hao; Fu, Tsu-Yi
2012-01-01
We have examined strain–relaxation of Co-2 × 2 islands grown on the Ag/Ge(111)-√3 × √3 surface by analyzing scanning tunneling microscopy images. We have found that the Co-2 × 2 islands commonly adopt a more compact arrangement as compared to that of the Ge(111) substrate, however they differ in a degree of an atomic compactness. We have not found a distinct relation between strain–relaxation and the island height. Three groups of islands have been identified upon analyzing a correspondence between strain–relaxation and the island size: (i) small islands (not bigger than 80 nm 2 ) with a high atomic compactness, displaying fixed inter-row distances, (ii) small islands with unfixed distances between atomic rows, and (iii) big islands (bigger than 80 nm 2 ) with fixed inter-row distances, but with a less compact atomic arrangement compared to that of the first two groups. We propose a model to account for the relation between the relaxation and the island size. - Highlights: ► We examine strain–relaxation of Co-2 × 2 islands grown on Ag/Ge(111)-√3 × √3 surface. ► The Co-2 × 2 islands are more compact as compared to the substrate. ► No relation between the relaxation and the island height. ► Atomic compactness and atomic order as manifestations of strain–relaxation.
The Effect of Convolvulus arvensis Dried Extract as a Potential Antioxidant in Food Models
Directory of Open Access Journals (Sweden)
Nurul Aini Mohd Azman
2015-03-01
Full Text Available In this study, the antioxidant activity of the Convolvulus arvensis Linn (CA ethanol extract has been evaluated by different ways. The antioxidant activity of the extract assessed by 2,2′-azino-bis-3-ethylbenzothiazoline-6-sulphonic acid (ABTS radical cation, the oxygen radical absorbance capacity (ORAC and the ferric reducing antioxidant power (FRAP was 1.62 mmol Trolox equivalents (TE/g DW, 1.71 mmol TE/g DW and 2.11 mmol TE/g DW, respectively. CA ethanol extract exhibited scavenging activity against the methoxy radical initiated by the Fenton reaction and measured by Electron Paramagnetic Resonance (EPR. The antioxidant effects of lyophilised CA measured in beef patties containing 0.1% and 0.3% (w/w CA stored in modified atmosphere packaging (MAP (80% O2 and 20% CO2 was determined. A preliminary study of gelatine based film containing CA showed a strong antioxidant effect in preventing the degradation of lipid in muscle food. Thus, the present results indicate that CA extract can be used as a natural food antioxidant.
Alfim, Yasri
2015-01-01
Calcium oxalate (CaC2O4) and calcium carbonate (CaCO3) was a precursor of urinary tract stones or kidney stones are poorly soluble in water. Sow thistle (Sonchus arvensis L) was a plant which has efficacy dissolve kidney stone and launch urine (diuretic). This plant could be found easily in all around us. Potassium would eliminate of calcium compounds to join with carbonate, oxalate, or uric which was forming kidney stones so that it will dissolve kidney stones slowly and come out with urine....
AggNet: Deep Learning From Crowds for Mitosis Detection in Breast Cancer Histology Images.
Albarqouni, Shadi; Baur, Christoph; Achilles, Felix; Belagiannis, Vasileios; Demirci, Stefanie; Navab, Nassir
2016-05-01
The lack of publicly available ground-truth data has been identified as the major challenge for transferring recent developments in deep learning to the biomedical imaging domain. Though crowdsourcing has enabled annotation of large scale databases for real world images, its application for biomedical purposes requires a deeper understanding and hence, more precise definition of the actual annotation task. The fact that expert tasks are being outsourced to non-expert users may lead to noisy annotations introducing disagreement between users. Despite being a valuable resource for learning annotation models from crowdsourcing, conventional machine-learning methods may have difficulties dealing with noisy annotations during training. In this manuscript, we present a new concept for learning from crowds that handle data aggregation directly as part of the learning process of the convolutional neural network (CNN) via additional crowdsourcing layer (AggNet). Besides, we present an experimental study on learning from crowds designed to answer the following questions. 1) Can deep CNN be trained with data collected from crowdsourcing? 2) How to adapt the CNN to train on multiple types of annotation datasets (ground truth and crowd-based)? 3) How does the choice of annotation and aggregation affect the accuracy? Our experimental setup involved Annot8, a self-implemented web-platform based on Crowdflower API realizing image annotation tasks for a publicly available biomedical image database. Our results give valuable insights into the functionality of deep CNN learning from crowd annotations and prove the necessity of data aggregation integration.
Directory of Open Access Journals (Sweden)
Budy Wijiyanto
2016-12-01
Full Text Available Tempuyung (Sonchus arvensis L. merupakan tanaman asli Indonesia yang berhkasiat sebagai diuretik dan antioksidan. Untuk mendapatkan efek terapi yang optimal perlu inovasi untuk membuatnya menjadi sediaan nano herbal. Penelitian ini bertujuan membuat sediaan nano herbal tempuyung dalam bentuk Self Nano-Emulsifying Drug Delivery System (SNEDDS. Kandungan zat aktif tempuyung diekstraksi dengan etanol dan berikut diuapkan pelarutnya untuk mendapatkan ekstrak kental. Ekstrak yang diperoleh distandarisasi menurut Farmakope Herbal Indonesia. Berikutnya dibuat SNEDDS tempuyung dengan menggunakan minyak Capryol-90, surfaktan tween 20 dan ko-surfaktan PEG 400. SNEDDS yang diperoleh dikarakterisasi meliputi ukuran partikel dan zeta potensial. Dari ekstraksi diperoleh ekstrak kental sebanyak 77,52 g. Hasil ini telah memenuhi syarat jika dibandingkan dengan Farmakope Herbal yang menyebutkan perolehan rendemen ekstrak kental daun tempuyung adalah tidak kurang dari 7,5%. Formulasi tempuyung dalam bentuk sediaan SNEDDS diperoleh suatu nanoemulsi yang jernih dengan ukuran partikel 16,2 ± 1,06 nm dan nilai zeta potensial -37,48±0,74 mV. Dapat disimpulkan bahwa ekstrak tempuyung menghasilkan suatu nano herbal dalam bentuk sediaan SNEDDS.
Directory of Open Access Journals (Sweden)
A. Derakhshan
2017-01-01
Full Text Available Introduction: Seed germination is one of the key stages in the life cycle of plants that can ultimately affect their fitness in the environment. The temporal pattern of seed germination is extremely depended on the soil water potential (Ψ of the germination medium, as this determines the equilibrium water content of the seed. As for temperature, there is a minimum Ψ that must be exceeded in order for seeds complete germination, and seeds in a population vary in the value of this minimum or base Ψ. The germination of a seed population in response to the reduced water potential is modeled using the hydrotime model. According to this model, the time to germination for a given seed fraction (g is inversely related to the difference between the current seed Ψ and the base water potential (Ψb for that fraction (Ψb(g. The hydrotime model functions are well in matching both the timing and the percentage of germination of seed populations in relation to their Ψ environment. In addition, the model outputs which are significant physiologically and ecologically and the parameters of the model can be used to characterize the properties of seed populations. Normal distribution of Ψb among seeds within a population is one of the assumptions of the hydrotime model. However, this assumption may not be met in many species and thus can result in poor predictions. We tried to investigate empirically the validity of this assumption, to compare the fit of alternative distributions and make recommendations to improve germination modeling procedures. Materials and Methods: Seed germination of Melilotus officinalis, Sinapis arvensis and Hordeum vulgare were tested across a range of water potentials (0, -0.2, -0.4, -0.6 and -0.8 MPa for M. officinalis and S. arvensis and 0, -0.3, -0.6, -0.9, -1.2 and -1.5 MPa for H. vulgare and germination responses were described by the hydrotime models based on twelve statistical functions including Normal, Beta, Gamma
Directory of Open Access Journals (Sweden)
Mario Guilherme Roberto Donalísio
1985-01-01
Full Text Available Foram estudadas no Centro Experimental de Campinas, entre 1973 e 1976, 450 progênies do clone Samby e 295 do clone Valinhos, ambos da espécie Mentha arvensis L. var. piperascens Malinvaud, que apresentavam alguma resistência à ferrugem causada pelo fungo Puccinia menthae Pers., bom desenvolvimento vegetativo e óleo essencial com alto teor em mentol. As progênies foram obtidas de polinização livre. As plantas que apresentavam pulegona foram eliminadas por seleção olfativa, e as restantes, inoculadas com uredosporos de P. menthae Pers. e, posteriormente, classificadas em três notas de resistência à doença. Em pleno florescimento, as plantas foram destiladas em corrente de vapor, e o óleo essencial obtido analisado em cromatógrafo de gás para avaliação quantitativa de seus componentes principais: mentol, mentona e pulegona. Destacaram-se oito progênies do clone Valinhos e catorze do Samby, respectivamente, mentol entre 75,85-85,18% e 77,12-83,74%, e pulegona entre 0,48-1,36% e 0,94-2,05% pela resistência à ferrugem. Três progênies do clone Valinhos e duas do Samby apresentaram baixos teores do mentol: 56,65, 56,94 e 60,11, e 54,26 e 64,93% respectivamente, semelhantes aos verificados nos óleos desmentolados de M. arvensis L.Seedlings froco two clones of M. arvensis L var. piperascens Malinvaud were selected by olfative test to eliminate the plants with high pulegone content in the essencial oil; the selected plants were inoculated with spore suspension of Puccinia menthae Pers., and classified in three classes of susceptibility. The blooming plants were distilled and the obtained samples of essential oil were analysed by gas chromatography to verify its menthol, menthone and pulegone contents. The data showed that the studied material presents high variability to rust resistance and menthol content in its essencial oil. Eight progenies from Valinhos clone presented high rust resistance, 75.80% to 85.18% menthol and 0.48 to
Panda, Pragyanshree; Aiko, Visenuo; Mehta, Alka
2015-06-01
Due to growing concern of consumers about chemical residues in food products, the demand for safe and natural food is increasing greatly. The use of natural additives such as spices and herbal oil as seasoning agents for their antimicrobial activity has been extensively investigated. This paper discusses the efficacy of the aqueous extract of mint (Mentha arvensis) and betel (Piper betle) on the mycelial growth and citrinin production of Penicillium citrinum. The present investigation revealed that mint extract inhibited citrinin production up to 73 % without inhibiting the mycelium growth. The citrinin production decreased with increase in the concentration of mint extract as observed from the data obtained from High pressure liquid chromatography. The samples also showed reduced cytotoxicity on HeLa cells. On the other hand betel extract resulted in stimulatory effect on citrinin production and mycelial growth. The study showed that mint extract has the potential to be used safely for restraining citrinin contamination.
Qian, Chaoju; Wang, Yuanxiu; Guo, Zhichun; Yang, Jianke; Kan, Xianzhao
2013-06-01
The circular mitochondrial genome of Alauda arvensis is 17,018 bp in length, containing 13 protein-coding genes (PCGs), 2 ribosomal RNA genes, 22 transfer RNA (tRNA) genes, and 2 extensive heteroplasmic control regions. All of the genes encoded on the H-strand, with the exceptions of one PCG (nad6) and eight tRNA genes (tRNA(Gln), tRNA(Ala), tRNA(Asn), tRNA(Cys), tRNA(Tyr), tRNA(Ser(UCN)), tRNA(Pro), and tRNA(Glu)), as found in other birds' mitochondrial genomes. All of these PCGs are initiated with ATG, while stopped by six types of stop codons. All tRNA genes have the potential to fold into typical clover-leaf structure. Two extensive heteroplasmic control regions were found, and more interestingly, a minisatellite of 37 nucleotides (5'-TCAATCCCATTGATTTCATTATATTAGTATAAAGAAA-3') with 6 tandem repeats was detected at the end of CR2.
Directory of Open Access Journals (Sweden)
H. Salimi
2016-05-01
Full Text Available In order to study the effect of flaming on seed viability of Sinapis arvensis L., changes in microorganisms population and physicochemical characteristics of soil after canola (Brassica napus L. harvesting, an experiment was carried out based on randomized complete block design with four replications and eight treatments at Karaj Research Center, Iran, during 2005- 2006. After harvesting canola at the end of spring, wild mustard seeds were distributed evenly on the surface of the soil. In some plots, canola stubbles were left on the ground and in some plots canola stubbles were taken off. Under this condition, the following treatments were applied: Flaming under wet and dry soil condition, burning stubbles under wet and dry soil condition. In other plots canola stubbles were taken off the plots and then flaming was applied under wet and dry soil conditions. Check plots did not receive any treatment. Results indicated that all treatments reduced seed viability, and the highest loss in seedling density occurred in the flaming treatment on dry-soil. Flaming did not have any serious affect on soil microorganisms or on its other physiochemical aspects, however dry-soil treatments proved the safest.
Gene and stress history interplay in emergence of PTSD-like features.
Chakraborty, Nabarun; Meyerhoff, James; Gautam, Aarti; Muhie, Seid; Jibitu, Meskerem; De Lima, Thereza C M; Hammamieh, Rasha; Jett, Marti
2015-10-01
Systematically distinguishing genetic liability from other contributing factors is critical for designing a preventive strategy for post-traumatic stress disorder (PTSD). To address this issue, we investigated a murine model exposing C57BL/6j, DBA/2j and BALB/cj mice to repeated stress via exposure to conspecific aggressors (Agg-E). Naïve mice from each strain were subjected to the proximity of aggressor (Agg) mice for 6h using a 'cage-within-a-cage' paradigm, which was repeated for 5 or 10 days with intermittent and unpredictable direct contact with Agg mice. During the Agg-E stress, DBA/2j developed a different strategy to evade Agg mice, which potentially contributed to its phenotypic resilience to Agg-E stress. Although Agg mice inflicted C57BL/6j and BALB/cj with equivalent numbers of strikes, BALB/cj displayed a distinct behavioral phenotype with delayed exhibition of a number of PTSD-like features. By contrast, C57BL/6j mice displayed unique vulnerability to Agg-E stress induced myocardopathy, possibly attributable to their particular susceptibility to hypoxia. A group of genes (Bdnf, Ngf, Zwint, Cckbr, Slc6a4, Fkbp5) linked to PTSD and synaptic plasticity were significantly altered in C57BL/6j and BALB/cj Agg-E mice. Contributions of Agg-E stress history and genotypic heterogeneity emerged as the key mediators of PTSD-like features. Linking genetic components to specific phenotypic and pathological features could have potential clinical implications. Copyright © 2015 Elsevier B.V. All rights reserved.
Huber, Meret; Triebwasser-Freese, Daniella; Reichelt, Michael; Heiling, Sven; Paetz, Christian; Chandran, Jima N; Bartram, Stefan; Schneider, Bernd; Gershenzon, Jonathan; Erb, Matthias
2015-07-01
The secondary metabolites in the roots, leaves and flowers of the common dandelion (Taraxacum officinale agg.) have been studied in detail. However, little is known about the specific constituents of the plant's highly specialized laticifer cells. Using a combination of liquid and gas chromatography, mass spectrometry and nuclear magnetic resonance spectrometry, we identified and quantified the major secondary metabolites in the latex of different organs across different growth stages in three genotypes, and tested the activity of the metabolites against the generalist root herbivore Diabrotica balteata. We found that common dandelion latex is dominated by three classes of secondary metabolites: phenolic inositol esters (PIEs), triterpene acetates (TritAc) and the sesquiterpene lactone taraxinic acid β-D-glucopyranosyl ester (TA-G). Purification and absolute quantification revealed concentrations in the upper mgg(-1) range for all compound classes with up to 6% PIEs, 5% TritAc and 7% TA-G per gram latex fresh weight. Contrary to typical secondary metabolite patterns, concentrations of all three classes increased with plant age. The highest concentrations were measured in the main root. PIE profiles differed both quantitatively and qualitatively between plant genotypes, whereas TritAc and TA-G differed only quantitatively. Metabolite concentrations were positively correlated within and between the different compound classes, indicating tight biosynthetic co-regulation. Latex metabolite extracts strongly repelled D. balteata larvae, suggesting that the latex constituents are biologically active. Copyright © 2015 Elsevier Ltd. All rights reserved.
DEFF Research Database (Denmark)
López, Víctor; Jäger, Anna Katharina; Akerreta, Silvia
2011-01-01
=0.31mg/ml). Inhibition of COX-1 and -2 was also stronger for methanolic extracts whereas aqueous were revealed as better free radical scavengers. CONCLUSIONS: The study reveals that both species posses antimicrobial and anti-inflammatory activities related to their ethnomedicinal uses....... OF STUDY: : Due to lack of studies, we decided to evaluate the potential of the plants as wound healing remedies measuring antimicrobial and anti-inflammatory properties using in vitro procedures. MATERIALS AND METHODS: Antimicrobial effects were studied against four bacteria and one fungus. Anti......-inflammatory properties were measured in terms of COX-1 and -2 inhibition as well as superoxide radical scavenging capacity. RESULTS: Both species exerted antimicrobial and anti-inflammatory effects. The methanolic extract obtained from Anagallis arvensis seemed to produce the highest inhibition in Candida albicans (MIC...
Directory of Open Access Journals (Sweden)
mehdi rastgoo
2009-06-01
Full Text Available In order to study the effects of amount and timing of nitrogen application and weed density on wild mustard (Sinapis arvensis seed production in winter wheat, an experiment was conducted in 2001 at Research station of college of agriculture, Ferdowsi University of Mashhad. A Split plot design with three replications were used with factorial combination of weed density (0, 8, 16, and 32 plant/m2 and nitrogen (low=100, optimum= 150, and high= 225 Kg/ha as main plots.The sub plot factor included nitrogen splitting pattern (P1=1/3 at planting time+2/3 at tillering, P2= 1/3 at planting time + 1/3 at tillering + 1/3 at shooting. According to the results, wild mustard seed production increased with increasing wild mustard density and nitrogen rates, due to high wild mustard biomass production. Seed production of wild mustard was 161, 311, and 488 million/ha in low, optimum and high nitrogen rates, respectively. In the other hand, density and nitrogen rates had a significant effect on wild mustard fecundity. However, nitrogen splitting pattern showed no significant effect on wild mustard seed production.
DEFF Research Database (Denmark)
Hebbelstrup Jensen, Betina; Poulsen, Anja; Hebbelstrup Rye Rasmussen, Stig
2017-01-01
targeting the genes sat, sepA, pic, sigA, pet, astA, aatA, aggR, aaiC, aap, agg3/4C, ORF3, aafA, aggA, agg3A, agg4A, and agg5A. Furthermore, the distribution of EAEC genes in strains collected from cases of bloody, mucoid, and watery diarrhea was investigated. The classification and regression tree analysis...... was associated with the combination of the genes aatA and astA (p = 0.03). Non-mucoid diarrhea was associated with strains lacking the aatA gene (p = 0.004). Acute diarrhea was associated with the genes aggR, aap, and aggA by individual odds ratios. Resistance toward gentamicin and ciprofloxacin was observed......-negative-to identify additional factors predisposing to disease. The duration of breastfeeding was positively correlated with the likelihood of belonging to the EAEC-negative group of children....
Lactococcus lactis Subsp. Lactis Suşlarında Yüksek Sıklıkta Konjugal Transfer Sistemlerinin Analizi
Directory of Open Access Journals (Sweden)
Çağla Tükel
2015-02-01
Full Text Available Bu çalışmada L. lactis subsp. lactis suşlarında laktoz fermentasyonu özelliğini kodlayan altı farklı plazmidin yüksek sıklıkta konjugal aktarım yeteneği araştırıldı. Bu plazmidlerin konjugal transfer sıklıkları; iki seks faktörünün interaksiyonuna bağlı olarak (Clu ve Agg, Clu-/Agg-, Agg+ x Clu-/Agg+, Agg- ya da Clu+/Agg- x Clu-/Agg- konjugasyon eşleri için 1.5x10-5–1.0x10-7 ve Clu+/Agg- x Clu-/Agg+ konjugasyon eşleri için 7.1x10-2-2.7x10-3 oranlarında değişim gösterdi. Laktoz plazmidlerinin stabiliteleri ise; doğal suşlarda %82-96, MG1390 alıcı suşu için tanımlanan konjugantlarda %77-98 ve MCL8060 alıcı suşu için tanımlanan konjugantlarda ise %44-67 arasında saptandı.
Directory of Open Access Journals (Sweden)
Marta Simone Mendonça Freitas
2004-09-01
Full Text Available O objetivo deste trabalho foi avaliar os efeitos de diferentes espécies de fungos micorrízicos arbusculares (FMA na produção e qualidade de óleos essenciais de Mentha arvensis L., cultivada com diferentes doses de fósforo. O trabalho foi realizado em casa de vegetação e o delineamento estatístico utilizado foi de blocos ao acaso com 20 tratamentos, constituídos pela combinação de cinco tratamentos microbiológicos (Glomus clarum Nicolson & Schenck, Glomus etunicatum Becker & Gerdemann, Gigaspora margarita Becker & Hall, Acaulospora scrobiculata Trappe e controle e quatro doses de P (0, 50, 100 e 200 mg kg-1, com quatro repetições. As plantas foram colhidas 65 dias após o plantio. Sem adubação fosfatada, os fungos Gigaspora margarita e Glomus clarum aumentaram em 206 e 198%, respectivamente, a produção de matéria fresca em relação ao tratamento controle. A maior produção de matéria fresca (90 g por vaso foi observada no tratamento de A. scrobiculata com 133 mg kg-1 de fósforo. Na ausência de adubação fosfatada, teores de óleos essenciais e de mentol no óleo foram menores em plantas sem inoculação, e os tratamentos com inoculação proporcionaram incrementos de até 89% nos teores de óleos e de mentol, em relação ao tratamento sem inoculação. Com o incremento da adubação fosfatada, não foram observados incrementos dos teores de óleos essenciais e mentol em razão dos FMA. As maiores produtividades de óleos essenciais e de mentol nos óleos, 0,69 g e 0,48 g por vaso, respectivamente, foram encontradas em plantas com inoculação de Acaulospora scrobiculata nas doses de P de 126 e 123 mg kg-1 de solo, respectivamente.The objective of this work was to evaluate the effects of different species of arbuscular mycorrhizal fungi on the vegetative growth, production and composition of essential oil of Mentha arvensis L., grown in different phosphorus levels. The work was carried out under greenhouse conditions and
Sinha, Niharika; Panda, Prashanta K; Naik, Prajna P; Das, Durgesh N; Mukhopadhyay, Subhadip; Maiti, Tapas K; Shanmugam, Muthu K; Chinnathambi, Arunachalam; Zayed, M E; Alharbi, Sulaiman A; Sethi, Gautam; Agarwal, Rajesh; Bhutia, Sujit K
2017-11-01
Oral cancer, a type of head and neck cancer, is ranked as one of the top most malignancies in India. Herein, we evaluated the anticancer efficacy of Abrus agglutinin (AGG), a plant lectin, in oral squamous cell carcinoma. AGG selectively inhibited cell growth, and caused cell cycle arrest and mitochondrial apoptosis through a reactive oxygen species (ROS)-mediated ATM-p73 dependent pathway in FaDu cells. AGG-induced ROS accumulation was identified as the major mechanism regulating apoptosis, DNA damage and DNA-damage response, which were significantly reversed by ROS scavenger N-acetylcysteine (NAC). Moreover, AGG was found to interact with mitochondrial manganese-dependent superoxide dismutase that might inhibit its activity and increase ROS in FaDu cells. In oral cancer p53 is mutated, thus we focused on p73; AGG resulted in p73 upregulation and knock down of p73 caused a decrease in AGG-induced apoptosis. Interestingly, AGG-dependent p73 expression was found to be regulated by ROS, which was reversed by NAC treatment. A reduction in the level of p73 in AGG-treated shATM cells was found to be associated with a decreased apoptosis. Moreover, administration of AGG (50 μg/kg body weight) significantly inhibited the growth of FaDu xenografts in athymic nude mice. In immunohistochemical analysis, the xenografts from AGG-treated mice displayed a decrease in PCNA expression and an increase in caspase-3 activation as compared to the controls. In conclusion, we established a connection among ROS, ATM and p73 in AGG-induced apoptosis, which might be useful in enhancing the therapeutic targeting of p53 deficient oral squamous cell carcinoma. © 2017 Wiley Periodicals, Inc.
Directory of Open Access Journals (Sweden)
Mahmudur Rahman
2015-01-01
Full Text Available Cnicus arvensis is used by many ethnic groups for inflammation, pain, and other ailments. In this study, reducing sugar, carbohydrate, alkaloid, steroid, tannin, flavonoid, and saponin groups were identified using standard chromogenic method. In high-performance liquid chromatography, vanillic acid and epicatechin were identified in the extract. Antinociceptive test by acetic acid induced writhing inhibition resulted 43.17 and 95.08% inhibition for 100 and 200 mg/kg body weight, comparing with standard diclofenac Na with 74.86% inhibition for 25 mg/kg body weight. In formalin induced paw licking test for antinociceptive activity, the extract inhibited 69.87 and 75.55% licking for 150 and 300 mg/kg body weight comparing with the inhibition (68.56% of diclofenac Na for 10 mg/kg body weight at first phase. At late phase, the extract showed 73.12 and 87.46% licking comparing with licking inhibition (71.69% by diclofenac Na at the same dose. In open field test for CNS depressant activity, the extract showed depression of locomotor activity for 150 and 300 mg/kg body weight comparing with diazepam for 10 mg/kg body weight. All results were statistically significant (P<0.01. The identified polyphenols are reputed for antinociceptive and CNS depressant activity. The present findings support the use of this plant in pain.
Belabbes, Rania; Dib, Mohammed El Amine; Djabou, Nassim; Ilias, Faiza; Tabti, Boufeldja; Costa, Jean; Muselli, Alain
2017-05-01
The chemical composition of the essential oils and hydrosol extract from aerial parts of Calendula arvensis L. was investigated using GC-FID and GC/MS. Intra-species variations of the chemical compositions of essential oils from 18 Algerian sample locations were investigated using statistical analysis. Chemical analysis allowed the identification of 53 compounds amounting to 92.3 - 98.5% with yields varied of 0.09 - 0.36% and the main compounds were zingiberenol 1 (8.7 - 29.8%), eremoligenol (4.2 - 12.5%), β-curcumene (2.1 - 12.5%), zingiberenol 2 (4.6 - 19.8%) and (E,Z)-farnesol (3.5 - 23.4%). The study of the chemical variability of essential oils allowed the discrimination of two main clusters confirming that there is a relation between the essential oil compositions and the harvest locations. Different concentrations of essential oil and hydrosol extract were prepared and their antioxidant activity were assessed using three methods (2,2-diphenyl-1-picrylhydrazyl, Ferric-Reducing Antioxidant Power Assay and β-carotene). The results showed that hydrosol extract presented an interesting antioxidant activity. The in vitro antifungal activity of hydrosol extract produced the best antifungal inhibition against Penicillium expansum and Aspergillus niger, while, essential oil was inhibitory at relatively higher concentrations. Results showed that the treatments of pear fruits with essential oil and hydrosol extract presented a very interesting protective activity on disease severity of pears caused by P. expansum. © 2017 Wiley-VHCA AG, Zurich, Switzerland.
Directory of Open Access Journals (Sweden)
Zuzana Pavlíková
Full Text Available Understanding the consequences of polyploidization is a major step towards assessing the importance of this mode of speciation. Most previous studies comparing different cytotypes, however, did so only within a single environment and considered only one group of traits. To take a step further, we need to explore multiple environments and a wide range of traits. The aim of this study was to assess response of diploid and autotetraploid individuals of Knautia arvensis (Dipsacaceae to two stress conditions, shade or drought.We studied eleven photosynthetic, morphological and fitness parameters of the plants over three years in a common garden under ambient conditions and two types of stress.The results indicate strong differences in performance and physiology between cytotypes in ambient conditions. Interestingly, higher fitness in diploids contrasted with more efficient photosynthesis in tetraploids in ambient conditions. However, stress, especially drought, strongly reduced fitness and disrupted function of the photosystems in both cytotypes reducing the between cytotype differences. The results indicate that drought stress reduced function of the photosynthetic processes in both cytotypes but particularly in tetraploids, while fitness reduction was stronger in diploids.The photosynthesis related traits show higher plasticity in polyploids as theoretically expected, while the fitness related traits show higher plasticity in diploids especially in response to drought. This suggests that between cytotype comparisons need to consider multiple traits and multiple environments to understand the breath of possible responses of different cytotypes to stress. They also show that integrating results based on different traits is not straightforward and call for better mechanistic understanding of the relationships between species photosynthetic activity and fitness. Still, considering multiple environments and multiple species traits is crucial for
New floristic records in the Balkans: 16
DEFF Research Database (Denmark)
Zarkos, G.; Christodoulou, V.; Tan, Kit
2011-01-01
), Berberidaceae (81), Boraginaceae (1–3, 82), Brassicaceae (4, 5, 26, 27), Campanulaceae (6, 28, 29, 83), Caprifoliaceae (30), Chenopodiaceae (7), Cistaceae (8), Cornaceae (31), Crassulaceae (32–34), Dipsacaceae (84), Euphorbiaceae (64), Fabaceae (9–13, 35, 36, 65, 74), Gentianaceae (37, 38), Geraniaceae (39, 72...
New floristic records in the Balkans: 10
DEFF Research Database (Denmark)
2009-01-01
-67, 92), Dipsacaceae (61), Dryopteridaceae (6, 51), Euphorbiaceae (40), Fabaceae (80, 81, 99, 100, 112, 113), Gentianaceae (82), Guttiferae (101, 114), Hypolepidaceae (7), Iridaceae (42), Isoetaceae (8), Lamiaceae (83, 84), Liliaceae s.l. (43, 44, 104), Onagraceae (7), (42), (8), (83, 84), s.l. (43, 44...
Jankovics, T.; Kiss, L.; Niks, R.E.; Daughtrey, M.L.
2009-01-01
Scabiosa columbaria (Dipsacaceae) is a popular perennial ornamental in the United States. It is native to Europe and was introduced to North America by nursery trade only recently. In the spring of 2006, symptoms of powdery mildew infection were observed on overwintered plants of S. columbaria cv.
New floristic records in the Balkans: 12
DEFF Research Database (Denmark)
2009-01-01
), Crassulaceae (6, 76-78), Cucurbitaceae (87), Dipsacaceae (7), Ericaceae (64), Euphorbiaceae (22, 100), Fabaceae (46, 61, 65-68, 70, (87), (7), (64), (22, 100), (46, 61, 65-68, 70, 79, 88), Gentianaceae (62), Grossulariaceae (71), Iridaceae (72), Juncaceae (12, 91), Lamiaceae (80), Liliaceae s.l. (13, 33-35, 51...
Directory of Open Access Journals (Sweden)
E Zeidali
2012-02-01
Full Text Available Abstract Field bindweed is an important perinial weed of agricultural crops word-wide. There are plant pathogen fungus which could cause necrotic spots on the leaves and stems of convolvulus arvensis under natural coditions. In order to evaluate the effects of weed growth stage and length of dew period on disease development causes by Aletrnaria alternata and Fusarium sp. two expriments were performed in the greenhouse based on a completely randomized design in factorial arrangement with four replications during 2006-2007. Spore concentration for both experiments was 107 spores per ml of distilled water. In the first experiment, treatments were different growth stages of field bindweed (cotyledon, 4-leaf, 6-leaf, 9-11-leaf stages. Results showed that disease development in the fungus of A. alternata was higher than Fusarium sp. The most susceptable growth stage of field bindweed plants to A. alternata was 2-4-leave stage. The second expriment was performed in order to study the effect of dew period length (6, 12, 24 and 48 hour dew periods on disease development at 4-leaf growth stage of field bindweed. The maximum disease development and minimum weed dry weight were observed with application of the fungus of A. alternata at dew periods of 24 and 48 hour, however, plant damage was also observed with a length of 6 hours dew period.
Bagheri, Seyyed Majid; Keyhani, Leila; Heydari, Mehrangiz; Dashti-R, Mohammad Hossein
2015-01-01
In Iranian traditional medicine, gum obtained from Astragalus gummifer and some other species of Astragalus was used as analgesic agent. In this study, we investigated the antinociceptive effect of several concentrations (125, 250, and 500 μg/kg body weight) of Astragalus gummifer gum (AGG) on thermal and acetic acid induced pain in mice. AGG was dissolved in distillated water and injected i.p to male mice 15 minute before the onset of experiment. Writhing and hot-plate tests were applied to study the analgesic effect of AGG and compared with that of diclofenac sodium (30 mg/kg, i.p.) or morphine (8 mg/kg, i.p). To investigate the mechanisms involved in antinociception, yohimbine, naloxone, glibenclamide, and theophylline were used in writhing test. These drugs were injected intraperitoneally 15 min before the administration of AGG. The number of writhes were counted in 30 minutes and analyzed. AGG exhibited a significant antinociceptive effect and the most effective dose of AGG was 500 μg/kg. The most maximum possible effect (%MPE) was observed (117.4%) 15 min after drug administration. The %inhibition of acetic acid-induced writhing in AGG 125, 250 and 500 was 47%, 50% and 54% vs %15 of control and 66.3% of diclofenac sodium group. The antinociceptive effect induced by this gum in the writhing test was reversed by the systemic administration of yohimbine (α2-adrenergic antagonist), but naloxone, glibenclamide, and theophylline did not reverse this effect. The findings of this study indicated that AGG induced its antinociceptive through the adrenergic system.
Directory of Open Access Journals (Sweden)
Seyyed Majid Bagheri
2015-01-01
Full Text Available Background: In Iranian traditional medicine, gum obtained from Astragalus gummifer and some other species of Astragalus was used as analgesic agent. Objective: In this study, we investigated the antinociceptive effect of several concentrations (125, 250, and 500 μg/kg body weight of Astragalus gummifer gum (AGG on thermal and acetic acid induced pain in mice. Materials and Methods: AGG was dissolved in distillated water and injected i.p to male mice 15 minute before the onset of experiment. Writhing and hot-plate tests were applied to study the analgesic effect of AGG and compared with that of diclofenac sodium (30 mg/kg, i.p. or morphine (8 mg/kg, i.p. To investigate the mechanisms involved in antinociception, yohimbine, naloxone, glibenclamide, and theophylline were used in writhing test. These drugs were injected intraperitoneally 15 min before the administration of AGG. The number of writhes were counted in 30 minutes and analyzed. Results: AGG exhibited a significant antinociceptive effect and the most effective dose of AGG was 500 μg/kg. The most maximum possible effect (%MPE was observed (117.4% 15 min after drug administration. The %inhibition of acetic acid-induced writhing in AGG 125, 250 and 500 was 47%, 50% and 54% vs %15 of control and 66.3% of diclofenac sodium group. The antinociceptive effect induced by this gum in the writhing test was reversed by the systemic administration of yohimbine (α2 -adrenergic antagonist, but naloxone, glibenclamide, and theophylline did not reverse this effect. Conclusions: The findings of this study indicated that AGG induced its antinociceptive through the adrenergic system.
New floristic records in the Balkans: 17
DEFF Research Database (Denmark)
Zarkos, G.; Christodolou, V.; Tan, Kit
2011-01-01
(13, 87), Dipsacaceae (138), Fabaceae (1–3, 41, 81, 82, 98, 139), Iridaceae (64, 65, 88), Juncaceae (14, 15), Lamiaceae (8, 42–45, 99, 100), Liliaceae s.l. (66–69, 104, 105, 113, 142), Linaceae (9), Loranthaceae (46), Monotropaceae (83, 110), Moraceae (129), Onagraceae (47), Orchidaceae (89, 90, 106...
Directory of Open Access Journals (Sweden)
Jesse P. Gates
2018-05-01
Full Text Available Jiāng Lì. 2015. A Grammar of Guìqióng: A Language of Sichuan. Leiden: Brill. xiv + 452 pp. ISBN 9789004292093 (hardback 213USD - E-ISBN 9789004293045 (electronic 217USD. Jiang Li's A Grammar of Guìqióng (henceforth, AGG is a revision of her PhD dissertation at the University of Berne under the supervision of George Van Driem. It is a most welcome contribution to our understanding of this under-described language. The primary dialects of Guiqiong described in AGG are spoken in Changma Village of Maibeng Township and Qianxi Village of Qianxi Township, both in Kangding County, Ganzi Tibetan Autonomous Prefecture, Sichuan Province, China. Some praiseworthy aspects of AGG include a plethora of examples sentences; a total of about 1500 example sentences are in the book. Included in the list of abbreviations are the linguistic forms from Guiqiong. The inclusion of photographs of the Guiqiong people and their geographic setting adds interest and appeal to the book. Appendix 1 (321-347 contains six texts of "sayings, stories, and recollections." This review is divided into sections similar to the divisions that the chapters of AGG provide: Introduction to AGG, Phonology, Morphology, Syntax, Errata, and Conclusion. Comments on AGG's chapter on pragmatics will be incorporated into the section on syntax since AGG's chapter on pragmatics is very short. Back-matter will also be briefly overviewed in the syntax section. ...
Recoding method that removes inhibitory sequences and improves HIV gene expression
Energy Technology Data Exchange (ETDEWEB)
Rabadan, Raul; Krasnitz, Michael; Robins, Harlan; Witten, Daniela; Levine, Arnold
2016-08-23
The invention relates to inhibitory nucleotide signal sequences or "INS" sequences in the genomes of lentiviruses. In particular the invention relates to the AGG motif present in all viral genomes. The AGG motif may have an inhibitory effect on a virus, for example by reducing the levels of, or maintaining low steady-state levels of, viral RNAs in host cells, and inducing and/or maintaining in viral latency. In one aspect, the invention provides vaccines that contain, or are produced from, viral nucleic acids in which the AGG sequences have been mutated. In another aspect, the invention provides methods and compositions for affecting the function of the AGG motif, and methods for identifying other INS sequences in viral genomes.
Gut gemeint ist nicht gleich gut gemacht! Meant Well is not the Same as Well Done!
Directory of Open Access Journals (Sweden)
Sandra Lewalter
2008-07-01
Full Text Available Der Beitrag von Manfred Becker lässt sich wohlmeinend als Plädoyer für einen pragmatischen Umgang mit dem AGG lesen. Er möchte Personaler/-innen zeigen, wie die Vorgaben des AGG im Rahmen eines Human Resources Diversity Managements positiv umgesetzt werden können. In weiten Teilen überzeugen die Ausführungen des Autors aber nicht. Gerade die Darstellung der Inhalte des AGG ist stark von seiner skeptischen Grundhaltung gegenüber dessen Zielsetzung geprägt. Auch wenn die Ausführungen zu konkreten Betriebs- und Personalmaßnahmen gelungener sind, stellt dieser Beitrag insgesamt kein überzeugendes und lesenswertes Werk dar.With the best intention, the work by Manfred Becker can be read as a plea for a pragmatic approach to the AGG. He wishes to show personnel how the guidelines of the AGG can be put into practice within the framework of Human Resources Diversity Management. However, the author’s work is often unconvincing. In particular, the presentation of the contents of the AGG is strongly influenced by his skeptical attitude toward its goals. Even when his approach to concrete company and personnel measures is more successful, the book is neither convincing nor a worthwhile read.
Directory of Open Access Journals (Sweden)
F. Soleymani
2016-04-01
Full Text Available To evaluate the effect of different levels of nitrogen fertilizer on growth indices and competitive ability of canola (Brassica napus L. against wild mustard (Sinapis arvensis L., a split plot trial based on a randomized complete block design with three replications, was carried out at Agricultural Faculty of Bu-Ali Sina University, during 2008-2009. Experimental factors were amounts of nitrogen fertilizer of urea at four levels (100, 150, 200 and 250 kgN.ha-1 and five wild mustard plant densities (0, 4, 8, 16 and 32 plants.m-2. The results showed that wild mustard interference led to reduction of leaf area index (LAI, dry matter accumulation, crop growth rate (CGR, leaf area index duration (LAID, dry matter duration (BMD and seed yield of canola, while these characteristics were increased with more nitrogen fertilizer application. The maximum indices were obtained at 250 kg N.ha-1 and weed-free condition, but generally, the least reduction in maximum LAI, CGR, LAID and BMD of canola affected by wild mustard competition occurred at 200 kg N.ha-1. In conclusion, the results showed that optimum level of fertilizer 200 kg N.ha-1, increased competitive ability of canola against wild mustard and improved yield and growth indices.
Fiedler, Kathrin
2015-01-01
Functional morphology and biomechanical properties of hook structures functioning as attachment devices in the leaning climbers Rosa arvensis, Rosa arvensis ‘Splendens‘, Asparagus falcatus and Asparagus setaceus are analysed in order to investigate the variability in closely related species as well as convergent developments of hook structure and properties in distant systematic lineages (monocots and dicots). Prickles and spines were characterised by their size, orientation and the maximum force measured at failure in mechanical tests performed with traction forces applied at different angles. In Rosa arvensis and Rosa arvensis ‘Splendens‘ three types of prickles differing largely in geometrical and mechanical properties are identified (prickles of the wild species and two types of prickles in the cultivar). In prickles of Rosa arvensis no particular orientation of the prickle tip is found whereas in the cultivar Rosa arvensis ‘Splendens‘ prickles gradually gain a downward-orientation due to differential growth in the first weeks of their development. Differences in mechanical properties and modes of failure are correlated to geometrical parameters. In Asparagus falcatus and Asparagus setaceus spines are composed of leaf tissue, stem tissue and tissue of the axillary bud. Between species spines differ in size, orientation, distribution along the stem, tissue contributions and mechanical properties. The prickles of Rosa arvensis and its cultivar and the spines of the studied Asparagus species have several traits in common: (1) a gradual change of cell size and cell wall thickness, with larger cells in the centre and smaller thick-walled cells at the periphery of the hooks, (2) occurrence of a diversity of shape and geometry within one individual, (3) failure of single hooks when submitted to moderate mechanical stresses (Fmax/basal area < 35 N/mm²) and (4) failure of the hooks without severe stem damage (at least in the tested wild species). PMID
Gallenmüller, Friederike; Feus, Amélie; Fiedler, Kathrin; Speck, Thomas
2015-01-01
Functional morphology and biomechanical properties of hook structures functioning as attachment devices in the leaning climbers Rosa arvensis, Rosa arvensis 'Splendens', Asparagus falcatus and Asparagus setaceus are analysed in order to investigate the variability in closely related species as well as convergent developments of hook structure and properties in distant systematic lineages (monocots and dicots). Prickles and spines were characterised by their size, orientation and the maximum force measured at failure in mechanical tests performed with traction forces applied at different angles. In Rosa arvensis and Rosa arvensis 'Splendens' three types of prickles differing largely in geometrical and mechanical properties are identified (prickles of the wild species and two types of prickles in the cultivar). In prickles of Rosa arvensis no particular orientation of the prickle tip is found whereas in the cultivar Rosa arvensis 'Splendens' prickles gradually gain a downward-orientation due to differential growth in the first weeks of their development. Differences in mechanical properties and modes of failure are correlated to geometrical parameters. In Asparagus falcatus and Asparagus setaceus spines are composed of leaf tissue, stem tissue and tissue of the axillary bud. Between species spines differ in size, orientation, distribution along the stem, tissue contributions and mechanical properties. The prickles of Rosa arvensis and its cultivar and the spines of the studied Asparagus species have several traits in common: (1) a gradual change of cell size and cell wall thickness, with larger cells in the centre and smaller thick-walled cells at the periphery of the hooks, (2) occurrence of a diversity of shape and geometry within one individual, (3) failure of single hooks when submitted to moderate mechanical stresses (Fmax/basal area < 35 N/mm²) and (4) failure of the hooks without severe stem damage (at least in the tested wild species).
Directory of Open Access Journals (Sweden)
Friederike Gallenmüller
Full Text Available Functional morphology and biomechanical properties of hook structures functioning as attachment devices in the leaning climbers Rosa arvensis, Rosa arvensis 'Splendens', Asparagus falcatus and Asparagus setaceus are analysed in order to investigate the variability in closely related species as well as convergent developments of hook structure and properties in distant systematic lineages (monocots and dicots. Prickles and spines were characterised by their size, orientation and the maximum force measured at failure in mechanical tests performed with traction forces applied at different angles. In Rosa arvensis and Rosa arvensis 'Splendens' three types of prickles differing largely in geometrical and mechanical properties are identified (prickles of the wild species and two types of prickles in the cultivar. In prickles of Rosa arvensis no particular orientation of the prickle tip is found whereas in the cultivar Rosa arvensis 'Splendens' prickles gradually gain a downward-orientation due to differential growth in the first weeks of their development. Differences in mechanical properties and modes of failure are correlated to geometrical parameters. In Asparagus falcatus and Asparagus setaceus spines are composed of leaf tissue, stem tissue and tissue of the axillary bud. Between species spines differ in size, orientation, distribution along the stem, tissue contributions and mechanical properties. The prickles of Rosa arvensis and its cultivar and the spines of the studied Asparagus species have several traits in common: (1 a gradual change of cell size and cell wall thickness, with larger cells in the centre and smaller thick-walled cells at the periphery of the hooks, (2 occurrence of a diversity of shape and geometry within one individual, (3 failure of single hooks when submitted to moderate mechanical stresses (Fmax/basal area < 35 N/mm² and (4 failure of the hooks without severe stem damage (at least in the tested wild species.
Brain Aggregates: An Effective In Vitro Cell Culture System Modeling Neurodegenerative Diseases.
Ahn, Misol; Kalume, Franck; Pitstick, Rose; Oehler, Abby; Carlson, George; DeArmond, Stephen J
2016-03-01
Drug discovery for neurodegenerative diseases is particularly challenging because of the discrepancies in drug effects between in vitro and in vivo studies. These discrepancies occur in part because current cell culture systems used for drug screening have many limitations. First, few cell culture systems accurately model human aging or neurodegenerative diseases. Second, drug efficacy may differ between dividing and stationary cells, the latter resembling nondividing neurons in the CNS. Brain aggregates (BrnAggs) derived from embryonic day 15 gestation mouse embryos may represent neuropathogenic processes in prion disease and reflect in vivo drug efficacy. Here, we report a new method for the production of BrnAggs suitable for drug screening and suggest that BrnAggs can model additional neurological diseases such as tauopathies. We also report a functional assay with BrnAggs by measuring electrophysiological activities. Our data suggest that BrnAggs could serve as an effective in vitro cell culture system for drug discovery for neurodegenerative diseases. © 2016 American Association of Neuropathologists, Inc. All rights reserved.
Tayon, Wesley A.; Domack, Marcia S.; Hoffman, Eric K.; Hales, Stephen J.
2013-01-01
In order to improve manufacturing efficiency and reduce structural mass and costs in the production of launch vehicle structures, NASA is pursuing a wide-range of innovative, near-net shape manufacturing technologies. A technology that combines friction stir welding (FSW) and spin-forming has been applied to manufacture a single-piece crew module using Aluminum-Lithium (AL-Li) Alloy 2195. Plate size limitations for Al-Li alloy 2195 require that two plates be FSW together to produce a spin-forming blank of sufficient size to form the crew module. Subsequent forming of the FSW results in abnormal grain growth (AGG) within the weld region upon solution heat treatment (SHT), which detrimentally impacts strength, ductility, and fracture toughness. The current study seeks to identify microstructural factors that contribute to the development of AGG. Electron backscatter diffraction (EBSD) was used to correlate driving forces for AGG, such as stored energy, texture, and grain size distributions, with the propensity for AGG. Additionally, developmental annealing treatments prior to SHT are examined to reduce or eliminate the occurrence of AGG by promoting continuous, or uniform, grain growth
International Nuclear Information System (INIS)
Maqbool, M.; Ajaib, M.; Ishtiaq, M.; Mushtaq, W.; Azam, S.
2017-01-01
Plants are part and parcel of human life. The current research was designed to explore ethnomedicinal importance of ''Cirsium arvensis (L.) Scop.'' (family Asteraceae) from Samahni area of District Bhimber Azad Kashmir, Pakistan. The maceration protocol was applied using four solvents of different polarity and highest yield was found in water extract for leaf (9.85 mg) and for stem (8.50 mg) from 250 g dry wt of sample. Leaf extract produced significant quantity of biochemicals: saponin, terpnoids, alkaloids and tannins. The antimicrobial activity was explored using four bacterial strains and four fungal species. Petroleum extract (P.E.) macerate depicted the highest antibacterial and antimycotic activity. P.E. extract of leaf showed significant zone of inhibition (Z.I.) nearly 76+-0.4 mm which was the most promising. For antimycotic, highest ZI was calculated for cholorformic extract of leaf (79+-0.2 mm) against Aspergillus niger, followed by 77+-0.7 mm for Fusarium oxysporum. Minimum inhibitory concentration (M.I.C.) was also determined for different bacterial and fungal strains. It was found 0.12+-0.05 M.I.C. for E. coli and followed by 0.2 0.3 mm for B. subtilis. For antimycotic analysis, M.I.C. was determined significant for Aspergillus niger (0.05+-0.3). In the study, activity index (A.I.) for bacteria was highest (4.22) for P.E. of leaf extract against E. coli and for fungi it was highest (3.59) for leaf chloroform extract against A. niger. The plant crude extract was also tested for total antioxidant activity (TAA) and it depicted 4.70+-10.8 value for aqueous macerate. Other fractions also do have good range of TAA. In total phenolic content (TPC) analysis, highest TPC was determined for methanol extract of stem of for concentration of 125 mL with value of 78.93+-0.3. These findings proved that plant is good source of herbal medication and it might be good source of novel drug discovery and development against bacteria and fungi. (author)
Effect of Deforming Temperature and Strain on Abnormal Grain Growth of Extruded FGH96 Superalloy
Directory of Open Access Journals (Sweden)
WANG Chaoyuan
2016-10-01
Full Text Available Based on the experiments of isothermal forging wedge-shaped samples, Deform-3D numerical simulation software was used to confirm the strain distribution in the wedge-shaped samples. The effect of deforming temperature and strain on abnormal grain growth(AGG in extruded FGH96 superalloy was examined. It is found that when the forging speed is 0.04 mm/s,the critical AGG occurring temperature is 1100℃,and the critical strain is 2%.AGG does not occur within 1000-1070℃,but still shows the feature of ‘critical strain’,and the region with strain of 5%-10% has the largest average grain size.AGG can be avoided and the uniform fine grains can be gained when the strain is not less than 15%.
Hebbelstrup Jensen, Betina; Poulsen, Anja; Hebbelstrup Rye Rasmussen, Stig; Struve, Carsten; Engberg, Jørgen H.; Friis-Møller, Alice; Boisen, Nadia; Jønsson, Rie; Petersen, Randi F.; Petersen, Andreas M.; Krogfelt, Karen A.
2017-01-01
Enteroaggregative Escherichia coli (EAEC) is frequently found in diarrheal stools worldwide. It has been associated with persistent diarrhea, weight loss, and failure to thrive in children living in developing countries. A number of important EAEC virulence genes are identified; however, their roles in acute and persistent diarrhea have not been previously investigated. The aim of this study was to identify specific EAEC virulence genes associated with duration and type of diarrhea in Danish children. We aimed to improve the current diagnostics of EAEC and enable targeting of strains with an expected severe disease course. Questionnaires answered by parents provided information regarding duration of diarrhea and presence of blood or mucus. A total of 295 EAEC strains were collected from children with acute (≤7 days) and persistent diarrhea (≥14 days) and were compared by using multiplex PCR targeting the genes sat, sepA, pic, sigA, pet, astA, aatA, aggR, aaiC, aap, agg3/4C, ORF3, aafA, aggA, agg3A, agg4A, and agg5A. Furthermore, the distribution of EAEC genes in strains collected from cases of bloody, mucoid, and watery diarrhea was investigated. The classification and regression tree analysis (CART) was applied to investigate the relationship between EAEC virulence genes and diarrheal duration and type. Persistent diarrhea was associated with strains lacking the pic gene (p = 0.002) and with the combination of the genes pic, sat, and absence of the aggA gene (p = 0.05). Prolonged diarrhea was associated with the combination of the genes aatA and astA (p = 0.03). Non-mucoid diarrhea was associated with strains lacking the aatA gene (p = 0.004). Acute diarrhea was associated with the genes aggR, aap, and aggA by individual odds ratios. Resistance toward gentamicin and ciprofloxacin was observed in 7.5 and 3% of strains, respectively. Multi-drug resistance was observed in 38% of strains. Genetic host factors have been associated with an increased risk of EAEC
Hebbelstrup Jensen, Betina; Poulsen, Anja; Hebbelstrup Rye Rasmussen, Stig; Struve, Carsten; Engberg, Jørgen H; Friis-Møller, Alice; Boisen, Nadia; Jønsson, Rie; Petersen, Randi F; Petersen, Andreas M; Krogfelt, Karen A
2017-01-01
Enteroaggregative Escherichia coli (EAEC) is frequently found in diarrheal stools worldwide. It has been associated with persistent diarrhea, weight loss, and failure to thrive in children living in developing countries. A number of important EAEC virulence genes are identified; however, their roles in acute and persistent diarrhea have not been previously investigated. The aim of this study was to identify specific EAEC virulence genes associated with duration and type of diarrhea in Danish children. We aimed to improve the current diagnostics of EAEC and enable targeting of strains with an expected severe disease course. Questionnaires answered by parents provided information regarding duration of diarrhea and presence of blood or mucus. A total of 295 EAEC strains were collected from children with acute (≤7 days) and persistent diarrhea (≥14 days) and were compared by using multiplex PCR targeting the genes sat, sepA, pic, sigA, pet, astA, aatA, aggR, aaiC, aap, agg3/4C, ORF3, aafA, aggA, agg3A, agg4A , and agg5A . Furthermore, the distribution of EAEC genes in strains collected from cases of bloody, mucoid, and watery diarrhea was investigated. The classification and regression tree analysis (CART) was applied to investigate the relationship between EAEC virulence genes and diarrheal duration and type. Persistent diarrhea was associated with strains lacking the pic gene ( p = 0.002) and with the combination of the genes pic, sat , and absence of the aggA gene ( p = 0.05). Prolonged diarrhea was associated with the combination of the genes aatA and astA ( p = 0.03). Non-mucoid diarrhea was associated with strains lacking the aatA gene ( p = 0.004). Acute diarrhea was associated with the genes aggR, aap , and aggA by individual odds ratios. Resistance toward gentamicin and ciprofloxacin was observed in 7.5 and 3% of strains, respectively. Multi-drug resistance was observed in 38% of strains. Genetic host factors have been associated with an increased risk of
Directory of Open Access Journals (Sweden)
Betina Hebbelstrup Jensen
2017-05-01
Full Text Available Enteroaggregative Escherichia coli (EAEC is frequently found in diarrheal stools worldwide. It has been associated with persistent diarrhea, weight loss, and failure to thrive in children living in developing countries. A number of important EAEC virulence genes are identified; however, their roles in acute and persistent diarrhea have not been previously investigated. The aim of this study was to identify specific EAEC virulence genes associated with duration and type of diarrhea in Danish children. We aimed to improve the current diagnostics of EAEC and enable targeting of strains with an expected severe disease course. Questionnaires answered by parents provided information regarding duration of diarrhea and presence of blood or mucus. A total of 295 EAEC strains were collected from children with acute (≤7 days and persistent diarrhea (≥14 days and were compared by using multiplex PCR targeting the genes sat, sepA, pic, sigA, pet, astA, aatA, aggR, aaiC, aap, agg3/4C, ORF3, aafA, aggA, agg3A, agg4A, and agg5A. Furthermore, the distribution of EAEC genes in strains collected from cases of bloody, mucoid, and watery diarrhea was investigated. The classification and regression tree analysis (CART was applied to investigate the relationship between EAEC virulence genes and diarrheal duration and type. Persistent diarrhea was associated with strains lacking the pic gene (p = 0.002 and with the combination of the genes pic, sat, and absence of the aggA gene (p = 0.05. Prolonged diarrhea was associated with the combination of the genes aatA and astA (p = 0.03. Non-mucoid diarrhea was associated with strains lacking the aatA gene (p = 0.004. Acute diarrhea was associated with the genes aggR, aap, and aggA by individual odds ratios. Resistance toward gentamicin and ciprofloxacin was observed in 7.5 and 3% of strains, respectively. Multi-drug resistance was observed in 38% of strains. Genetic host factors have been associated with an increased risk
Adjusting particle-size distributions to account for aggregation in tephra-deposit model forecasts
Mastin, Larry G.; Van Eaton, Alexa; Durant, A.J.
2016-01-01
Volcanic ash transport and dispersion (VATD) models are used to forecast tephra deposition during volcanic eruptions. Model accuracy is limited by the fact that fine-ash aggregates (clumps into clusters), thus altering patterns of deposition. In most models this is accounted for by ad hoc changes to model input, representing fine ash as aggregates with density ρagg, and a log-normal size distribution with median μagg and standard deviation σagg. Optimal values may vary between eruptions. To test the variance, we used the Ash3d tephra model to simulate four deposits: 18 May 1980 Mount St. Helens; 16–17 September 1992 Crater Peak (Mount Spurr); 17 June 1996 Ruapehu; and 23 March 2009 Mount Redoubt. In 192 simulations, we systematically varied μagg and σagg, holding ρagg constant at 600 kg m−3. We evaluated the fit using three indices that compare modeled versus measured (1) mass load at sample locations; (2) mass load versus distance along the dispersal axis; and (3) isomass area. For all deposits, under these inputs, the best-fit value of μagg ranged narrowly between ∼ 2.3 and 2.7φ (0.20–0.15 mm), despite large variations in erupted mass (0.25–50 Tg), plume height (8.5–25 km), mass fraction of fine ( discrete process that is insensitive to eruptive style or magnitude. This result offers the potential for a simple, computationally efficient parameterization scheme for use in operational model forecasts. Further research may indicate whether this narrow range also reflects physical constraints on processes in the evolving cloud.
Ducharme, Simon; Hudziak, James J; Botteron, Kelly N; Ganjavi, Hooman; Lepage, Claude; Collins, D Louis; Albaugh, Matthew D; Evans, Alan C; Karama, Sherif
2011-08-01
The anterior cingulate cortex (ACC), orbitofrontal cortex (OFC), and basal ganglia have been implicated in pathological aggression. This study aimed at identifying neuroanatomical correlates of impulsive aggression in healthy children. Data from 193 representative 6- to 18-year-old healthy children were obtained from the National Institutes of Health Magnetic Resonance Imaging Study of Normal Brain Development after a blinded quality control. Cortical thickness and subcortical volumes were obtained with automated software. Aggression levels were measured with the Aggressive Behavior scale (AGG) of the Child Behavior Checklist. AGG scores were regressed against cortical thickness and basal ganglia volumes using first- and second-order linear models while controlling for age, gender, scanner site, and total brain volume. Gender by AGG interactions were analyzed. There were positive associations between bilateral striatal volumes and AGG scores (right: r = .238, p = .001; left: r = .188, p = .01). A significant association was found with right ACC and subgenual ACC cortical thickness in a second-order linear model (p right ACC cortex. An AGG by gender interaction trend was found in bilateral OFC and ACC associations with AGG scores. This study shows the existence of relationships between impulsive aggression in healthy children and the structure of the striatum and right ACC. It also suggests the existence of gender-specific patterns of association in OFC/ACC gray matter. These results may guide research on oppositional-defiant and conduct disorders. Copyright © 2011 Society of Biological Psychiatry. Published by Elsevier Inc. All rights reserved.
The evolution of the mitochondrial genetic code in arthropods revisited.
Abascal, Federico; Posada, David; Zardoya, Rafael
2012-04-01
A variant of the invertebrate mitochondrial genetic code was previously identified in arthropods (Abascal et al. 2006a, PLoS Biol 4:e127) in which, instead of translating the AGG codon as serine, as in other invertebrates, some arthropods translate AGG as lysine. Here, we revisit the evolution of the genetic code in arthropods taking into account that (1) the number of arthropod mitochondrial genomes sequenced has triplicated since the original findings were published; (2) the phylogeny of arthropods has been recently resolved with confidence for many groups; and (3) sophisticated probabilistic methods can be applied to analyze the evolution of the genetic code in arthropod mitochondria. According to our analyses, evolutionary shifts in the genetic code have been more common than previously inferred, with many taxonomic groups displaying two alternative codes. Ancestral character-state reconstruction using probabilistic methods confirmed that the arthropod ancestor most likely translated AGG as lysine. Point mutations at tRNA-Lys and tRNA-Ser correlated with the meaning of the AGG codon. In addition, we identified three variables (GC content, number of AGG codons, and taxonomic information) that best explain the use of each of the two alternative genetic codes.
Riccobono, Luana; Maggio, Antonella; Bruno, Maurizio; Spadaro, Vivienne; Raimondo, Francesco Maria
2017-12-01
The chemical composition of the essential oils isolated from the aerial parts of Anthemis arvensis L. subsp. arvensis, Anthemis cretica subsp. messanensis (Brullo) Giardina & Raimondo and from flowers and leaves of Anthemis cretica subsp. columnae (Ten.) Frezén were determinated by GC-FID and GC-MS analyses. Torreyol (85.4%) was recognised as the main constituent of the Anthemis arvensis subsp. arvensis essential oil, while in the essential oils of Anthemis cretica subsp. messanensis, collected on the rock and cultivated in Hortus Botanicus Panormitanus, (E)-chrysanthenyl acetate (28.8 and 24.2% resp.), 14-hydroxy-α-humulene (8.1 and 5.3% resp.), santolina triene (8 and 5.8% resp.) and α-pinene (6.7 and 5.4% resp.) prevailed. 18-cineole (13.3 and 12.2% resp.), was the main component of both flower and leaf oils of Anthemis cretica subsp. columnae together with δ-cadinene (9.0 and 8.2% resp.) and (E)-caryophyllene (8.3 and 5.6% resp.).
NN,
1962-01-01
Een merkwaardige vorm van Convolvulus arvensis L. Van Convolvulus arvensis werd op 27 juli 1960 te Rotterdam, aan de weg naar Schiedam, aan de rand van het spoorwegemplacement, windend om de spijlen van een daar ter plaatse aanwezig hek, een aantal exemplaren gevonden, die aan de hoofdstengels, in
Directory of Open Access Journals (Sweden)
Koszałka Joanna
2015-03-01
Full Text Available The paper presents the results of research of plant macrofossils from the grain deposit deriving from the 18th/19th centuries. The analysed material included 24760 diaspores representing 73 taxa. The majority were cultivated cereal crop species, and there was also abundance of accompanying segetal weed species. About 95% of the gathered crop material was Secale cereale. Another important crop was Hordeum vulgare and there were also some remains of Avena sativa, Triticum aestivum, Fagopyrum esculentum. Cannabis sativa and Linum usitatissimum were found as well. Weeds competing with these crops were, among others, the following species: Agrostemma githago, Raphanus raphanistrum, Apera spica-venti, Bromus secalinus, Centaurea cyanus, Spergula arvensis, Thlaspi arvense, Viola arvensis/tricolor, Fallopia convolvulus, Polygonum persicaria, Mentha arvensis, Anthemis arvensis, Papaver rhoeas, Rumex acetosella, Scleranthus annuus, Aphanes arvensis, Setaria pumila, Setaria viridis/verticilata. Extremely large presence of wild plant diaspores in the material allowed conducting economic and environmental interpretations. Reconstruction methods applied, used primarily in the case of macroremains from granaries, were fully applicable to the analysed plant residues. Weed species composition in the analysed material showed that they were mostly typical for the main winter crop. Some amount of species typical for other habitats were also found and they probably came from the near-by rye field. The presence of perennial diaspores indicated that the field was probably set aside
Novel Aggregative Adherence Fimbria Variant of Enteroaggregative Escherichia coli
DEFF Research Database (Denmark)
Jønsson, Rie; Struve, Carsten; Boisen, Nadia
2015-01-01
the stools of Danish adults with traveler’s diarrhea. We evaluated the presence of the aggregative adherence fimbriae (AAFs) by a multiplex PCR, targeting the four known major subunit variants as well as their usher-encoding genes. Almost one-half (49/118) of the clinical isolates did not possess any known...... AAF major fimbrial subunit, despite the presence of other AggR-related loci. Further investigation revealed the presence of an AAF-related gene encoding a yet-uncharacterized adhesin, termed agg5A. The sequence of the agg5DCBA gene cluster shared fimbrial accessory genes (usher, chaperone, and minor...
Wang, Chen; Weiss, Emily A
2017-09-13
Fast energy transfer (EnT) among quantum dots (QDs) with near-infrared (NIR) emission is essential for fully exploiting their light harvesting and photon downconversion (multiexciton generation) abilities. This paper demonstrates a relayed EnT mechanism that accelerates the migration of NIR excitons between PbS QDs by a factor of 20 from that of one-step EnT through a polyelectrolyte and even a factor of ∼2 from that of one-step EnT between QDs in direct contact, by employing a J-aggregate (J-agg) of a cyanine dye as an exciton bridge. The donor QDs, acceptor QDs, and J-agg are electrostatically assembled into a sandwich structure with layer-by-layer deposition. Estimates of EnT rate and yield from transient and steady-state absorption and photoluminescence spectroscopies show that the rate-limiting step in the relay is EnT from the donor QD to the J-agg, while EnT from the J-agg to the acceptor QD occurs in J-agg with more intermolecular order. This work demonstrates the viability of relayed EnT through a molecular bridge as a strategy for accelerating long-distance exciton migration in assemblies of QDs, in particular in the near-infrared.
Directory of Open Access Journals (Sweden)
Marta Ziemińska-Smyk
2013-12-01
Full Text Available The study on weed infestation of root crops in different soils in the protective zone of Roztocze National Park was conducted in the years 1991-1995. As many as 240 phytosociological records, made with the use of Braun-Blanquet method, were taken in potato and sugar beet fields. The number of weed species in sugar beet and potato in the area depended on the soil and type of root crop. In the same environment conditions. the iiuinber of weed species was higher in potato than in sugar beet. The most difficult weed species iii all types of soil were: Chenopodium album, Stellaria media and Convolvulus arvensis. Podsolic soils were highly infested by two acidophylic species: Spergula arvensis and Raphanus raphanistum. Potato in loess soil and brown soil made of loamy sands were highly infested by Echinochloa crus-galli, Equisetum arvense and Galinsoga parviflora. Root crop plantations in brown soils formed from gaizes of granulometric loam texture and limestone soils were infested by: Galium aparine, Sonchus arvensis, Sinapis arvensis and Veronica persica.
Huang, Po-Hsien; Weng, Li-Jen
2012-01-01
A procedure for estimating the reliability of test scores in the context of ecological momentary assessment (EMA) was proposed to take into account the characteristics of EMA measures. Two commonly used test scores in EMA were considered: the aggregated score (AGGS) and the within-person centered score (WPCS). Conceptually, AGGS and WPCS represent…
Burt, S. Alexandra; Klump, Kelly L.
2012-01-01
A recent meta-analysis of 103 studies Burt ("Clinical Psychology Review," 29:163-178, 2009a) highlighted the presence of etiological distinctions between aggressive (AGG) and non-aggressive rule-breaking (RB) dimensions of antisocial behavior, such that AGG was more heritable than was RB, whereas RB was more influenced by the shared…
Landa, Premysl; Marsik, Petr; Havlik, Jaroslav; Kloucek, Pavel; Vanek, Tomas; Kokoska, Ladislav
2009-04-01
Seed extracts from six species of the genus Nigella (Family Ranunculaceae)-Nigella arvensis, Nigella damascena, Nigella hispanica, Nigella nigellastrum, Nigella orientalis, and Nigella sativa-obtained by successive extraction with n-hexane, chloroform, and methanol, were tested for their antimicrobial activity against 10 strains of pathogenic bacteria and yeast using the microdilution method as well as for anti-inflammatory properties by in vitro cyclooxygenase (COX)-1 and COX-2 assay. Chemical characterization of active extracts was carried out including free and fixed fatty acid analysis. Comparison of antimicrobial activity showed that N. arvensis chloroform extract was the most potent among all species tested, inhibiting Gram-positive bacterial and yeast strains with minimum inhibitory concentration (MIC) values ranging from 0.25 to 1 mg/mL. With the exception of selective inhibitory action of n-hexane extract of N. orientalis on growth of Bacteroides fragilis (MIC = 0.5 mg/mL), we observed no antimicrobial activity for other Nigella species. Anti-inflammatory screening revealed that N. sativa, N. orientalis, N. hispanica, N. arvensis n-hexane, and N. hispanica chloroform extracts had strong inhibitory activity (more than 80%) on COX-1 and N. orientalis, N. arvensis, and N. hispanica n-hexane extracts were most effective against COX-2, when the concentration of extracts was 100 microg/mL in both COX assays. In conclusion, N. arvensis, N. orientalis, and N. hispanica seeds, for the first time examined for antimicrobial and anti-inflammatory effects, revealed their significant activity in one or both assays.
Directory of Open Access Journals (Sweden)
Marta Ziemińska-Smyk
2013-12-01
Full Text Available The study on weed infestation of crops in different soils in the protective zone of RPN was conducted in the years 1991-1995. The characterization of weed infestation of winter and spring cereals was based on 306 phytosociological records. made with the use of Braun-Blanquet method. The degree of weed infestation in the fields in the protective zone of RPN depended on environment conditions. Both winter and spring cereals in majority of soils were most infested by: Cenaturea cyanus, Apera spica-venti and Vicia hirsta. In the lightest podsolic soils, made of loose sand and slightly loamy sand. winter and spring cereals were additionally infested by Equisetum arvense and two acidophylic species: Seleranthus annuus and Spergula arvensis. The crops in brown loess soil were infested by Matricaria maritima subsp. inodora. The most difficult weed species in brown soil formed from gaizes and limestone soil were: Convolvulus arvensis, Papaver rhoeas and Galium aparine. Moreover winter cercals in limestone soil showed high or medium infestation with Consolida regalis, Aethusa cynapium, Lathyrus tuberosus and low infestation with Apera spica-venti and Centaurea cyanus. Spring cereals were less infested than winter cereals. Apera spica-venti and Centaurea cyanus were less common with spring cereals than with winter cereals. Also, spring cereals showed high or medium infestation with Convolvulus arvensis. Spring cereals in some soil units were infested by Chenopodium album and Stellaria media. There was also higher infestation of spring cereals in limestone soils with Avena fatua, Veronica persica, Sinapis arvensis and Sonchus arvensis, compared to winter cereals in limestone soils.
Friction-Stir-Welded and Spin-Formed End Domes for Cryogenic Tanks
Hales, S. J.; Tayon, W. A.; Domack, M. S.
2012-01-01
Manufacturing of single-piece end domes for cryogenic tanks employing spin forming of tailored, friction-stir-welded blanks of Al-Li alloy 2195 plate offers cost and reliability benefits. The introduction of plastic deformation into a friction stir weld is a unique feature of the proposed manufacturing route. This investigation addressed abnormal grain growth [AGG] within the friction stir weldments during postfabrication processing of a prototype dome. The phenomenon of AGG was observed during the solution heat treatment [SHT] phase of T8 tempering and is a major concern for meeting specifications. Such abrupt microstructural transitions can be detrimental to notch-sensitive mechanical properties, such as ductility and/or fracture toughness. If the issue of AGG cannot be resolved, then the acceptance of this approach as a viable manufacturing route may be in jeopardy. The innovative approach adopted in this investigation was the insertion of a stand-alone, Intermediate Annealing Treatment [IAT] between the spin forming and T8 processing operations. A simple, recovery annealing step was deemed to be the most readily-scalable solution when fabricating thin-walled, ellipsoidal domes. The research effort culminated in the development of an effective IAT, which resulted in a significant decrease in AGG following SHT. The processing philosophy adopted in designing the IAT is outlined and the microstructural reasons for success are discussed. The analytical results presented are consistent with promoting continuous grain growth during the IAT, thereby suppressing AGG during the SHT.
Chen, J; Yu, J; Zhang, J; Li, X; McGue, M
2015-07-01
Little is known about the etiology of adolescents' externalizing behavior (Ext) in collectivistic cultures. We aimed to fill this gap by investigating the genetic and environmental influences on Ext in Chinese adolescents. The etiological heterogeneity of aggression (AGG) and rule breaking (RB) was also examined. The study sample included 908 pairs of same-sex twins aged from 10 to 18 years (mean = 13.53 years, s.d. = 2.26). Adolescents' Ext were assessed with the Achenbach System of Empirically Based Assessment including Child Behavior Checklist, Teacher Report Form, and Youth Self-Report. Univariate genetic analyses showed that genetic influences on all measures were moderate ranging from 34% to 50%, non-shared environmental effects ranged from 23% to 52%, and shared environmental effects were significant in parent- and teacher-reported measures ranging from 29% to 43%. Bivariate genetic analyses indicated that AGG and RB shared large genetic influences (r g = 0.64-0.79) but moderate non-shared environmental factors (r e = 0.34-0.52). Chinese adolescents' Ext was moderately influenced by genetic factors. AGG and RB had moderate independent genetic and non-shared environmental influences, and thus constitute etiologically distinct dimensions within Ext in Chinese adolescents. The heritability of AGG, in particular, was smaller in Chinese adolescents than suggested by previous data obtained on Western peers. This study suggests that the collectivistic cultural values and Confucianism philosophy may attenuate genetic potential in Ext, especially AGG.
African Journal of Biotechnology Vol
African Journals Online (AJOL)
Gaga E Tonukari
List of the random primers used, their nucleotide sequence and annealing temperatures. Primers. Sequence 5`- 3`. Annealing. Temperature. °C/time (s). 1. ATG ACG TTG A. 2. GGG CTA GGG T. 3. ACC GGG AAC G. 4. AGC AGG TGG A. 45/30. 5. AGG CCC CTG T. 6. ATG CCC CTG T. 7. AAA GCT GCG G. 8. ACC GCC GAA ...
Mudgil, Yashwanti; Uhrig, Joachm F; Zhou, Jiping; Temple, Brenda; Jiang, Kun; Jones, Alan M
2009-11-01
Root architecture results from coordinated cell division and expansion in spatially distinct cells of the root and is established and maintained by gradients of auxin and nutrients such as sugars. Auxin is transported acropetally through the root within the central stele and then, upon reaching the root apex, auxin is transported basipetally through the outer cortical and epidermal cells. The two Gbetagamma dimers of the Arabidopsis thaliana heterotrimeric G protein complex are differentially localized to the central and cortical tissues of the Arabidopsis roots. A null mutation in either the single beta (AGB1) or the two gamma (AGG1 and AGG2) subunits confers phenotypes that disrupt the proper architecture of Arabidopsis roots and are consistent with altered auxin transport. Here, we describe an evolutionarily conserved interaction between AGB1/AGG dimers and a protein designated N-MYC DOWNREGULATED-LIKE1 (NDL1). The Arabidopsis genome encodes two homologs of NDL1 (NDL2 and NDL3), which also interact with AGB1/AGG1 and AGB1/AGG2 dimers. We show that NDL proteins act in a signaling pathway that modulates root auxin transport and auxin gradients in part by affecting the levels of at least two auxin transport facilitators. Reduction of NDL family gene expression and overexpression of NDL1 alter root architecture, auxin transport, and auxin maxima. AGB1, auxin, and sugars are required for NDL1 protein stability in regions of the root where auxin gradients are established; thus, the signaling mechanism contains feedback loops.
Mudgil, Yashwanti; Uhrig, Joachm F.; Zhou, Jiping; Temple, Brenda; Jiang, Kun; Jones, Alan M.
2009-01-01
Root architecture results from coordinated cell division and expansion in spatially distinct cells of the root and is established and maintained by gradients of auxin and nutrients such as sugars. Auxin is transported acropetally through the root within the central stele and then, upon reaching the root apex, auxin is transported basipetally through the outer cortical and epidermal cells. The two Gβγ dimers of the Arabidopsis thaliana heterotrimeric G protein complex are differentially localized to the central and cortical tissues of the Arabidopsis roots. A null mutation in either the single β (AGB1) or the two γ (AGG1 and AGG2) subunits confers phenotypes that disrupt the proper architecture of Arabidopsis roots and are consistent with altered auxin transport. Here, we describe an evolutionarily conserved interaction between AGB1/AGG dimers and a protein designated N-MYC DOWNREGULATED-LIKE1 (NDL1). The Arabidopsis genome encodes two homologs of NDL1 (NDL2 and NDL3), which also interact with AGB1/AGG1 and AGB1/AGG2 dimers. We show that NDL proteins act in a signaling pathway that modulates root auxin transport and auxin gradients in part by affecting the levels of at least two auxin transport facilitators. Reduction of NDL family gene expression and overexpression of NDL1 alter root architecture, auxin transport, and auxin maxima. AGB1, auxin, and sugars are required for NDL1 protein stability in regions of the root where auxin gradients are established; thus, the signaling mechanism contains feedback loops. PMID:19948787
Mitigating Abnormal Grain Growth for Friction Stir Welded Al-Li 2195 Spun Formed Domes
Chen, Po-Shou; Russell, Carolyn
2012-01-01
Formability and abnormal grain growth (AGG) are the two major issues that have been encountered for Al alloy spun formed dome development using friction stir welded blanks. Material properties that have significant influence on the formability include forming range and strain hardening exponent. In this study, tensile tests were performed for two 2195 friction stir weld parameter sets at 400 F to study the effects of post weld anneal on the forming range and strain hardening exponent. It was found that the formability can be enhanced by applying a newly developed post weld anneal to heat treat the friction stir welded panels. This new post weld anneal leads to a higher forming range and much improved strain hardening exponent. AGG in the weld nugget is known to cause a significant reduction of ductility and fracture toughness. This study also investigated how AGG may be influenced by the heating rate to the solution heat treatment temperature. After post-weld annealing, friction stir welds were strained to 15% and 39% by compression at 400 F before they were subjected to SHT at 950 F for 1 hour. Salt bath SHT is very effective in reducing the grain size as it helps arrest the onset of AGG and promote normal recrystallization and grain growth. However, heat treating a 18 ft dome using a salt bath is not practical. Efforts are continuing at Marshall Space Flight Center to identify the welding parameters and heat treating parameters that can help mitigate the AGG in the friction stir welds.
Directory of Open Access Journals (Sweden)
Toni Wendt
Full Text Available Heterotrimeric G proteins are intracellular membrane-attached signal transducers involved in various cellular processes in both plants and animals. They consist of three subunits denoted as α, β and γ. The γ-subunits of the so-called AGG3 type, which comprise a transmembrane domain, are exclusively found in plants. In model species, these proteins have been shown to participate in the control of plant height, branching and seed size and could therefore impact the harvestable yield of various crop plants. Whether AGG3-type γ-subunits influence yield in temperate cereals like barley and wheat remains unknown. Using a transgenic complementation approach, we show here that the Scottish malting barley cultivar (cv. Golden Promise carries a loss-of-function mutation in HvDep1, an AGG3-type subunit encoding gene that positively regulates culm elongation and seed size in barley. Somewhat intriguingly, agronomic field data collected over a 12-year period reveals that the HvDep1 loss-of-function mutation in cv. Golden Promise has the potential to confer either a significant increase or decrease in harvestable yield depending on the environment. Our results confirm the role of AGG3-type subunit-encoding genes in shaping plant architecture, but interestingly also indicate that the impact HvDep1 has on yield in barley is both genotypically and environmentally sensitive. This may explain why widespread exploitation of variation in AGG3-type subunit-encoding genes has not occurred in temperate cereals while in rice the DEP1 locus is widely exploited to improve harvestable yield.
Large-scale grain growth in the solid-state process: From "Abnormal" to "Normal"
Jiang, Minhong; Han, Shengnan; Zhang, Jingwei; Song, Jiageng; Hao, Chongyan; Deng, Manjiao; Ge, Lingjing; Gu, Zhengfei; Liu, Xinyu
2018-02-01
Abnormal grain growth (AGG) has been a common phenomenon during the ceramic or metallurgy processing since prehistoric times. However, usually it had been very difficult to grow big single crystal (centimeter scale over) by using the AGG method due to its so-called occasionality. Based on the AGG, a solid-state crystal growth (SSCG) method was developed. The greatest advantages of the SSCG technology are the simplicity and cost-effectiveness of the technique. But the traditional SSCG technology is still uncontrollable. This article first summarizes the history and current status of AGG, and then reports recent technical developments from AGG to SSCG, and further introduces a new seed-free, solid-state crystal growth (SFSSCG) technology. This SFSSCG method allows us to repeatedly and controllably fabricate large-scale single crystals with appreciable high quality and relatively stable chemical composition at a relatively low temperature, at least in (K0.5Na0.5)NbO3(KNN) and Cu-Al-Mn systems. In this sense, the exaggerated grain growth is no longer 'Abnormal' but 'Normal' since it is able to be artificially controllable and repeated now. This article also provides a crystal growth model to qualitatively explain the mechanism of SFSSCG for KNN system. Compared with the traditional melt and high temperature solution growth methods, the SFSSCG method has the advantages of low energy consumption, low investment, simple technique, composition homogeneity overcoming the issues with incongruent melting and high volatility. This SFSSCG could be helpful for improving the mechanical and physical properties of single crystals, which should be promising for industrial applications.
Energy Technology Data Exchange (ETDEWEB)
Zhang, Guozhu, E-mail: gzhang6@ncsu.edu [Bioinformatics Research Center, North Carolina State University, Raleigh, NC (United States); Roell, Kyle R., E-mail: krroell@ncsu.edu [Bioinformatics Research Center, North Carolina State University, Raleigh, NC (United States); Truong, Lisa, E-mail: lisa.truong@oregonstate.edu [Department of Environmental and Molecular Toxicology, Sinnhuber Aquatic Research Laboratory, Oregon State University, Corvallis, OR (United States); Tanguay, Robert L., E-mail: robert.tanguay@oregonstate.edu [Department of Environmental and Molecular Toxicology, Sinnhuber Aquatic Research Laboratory, Oregon State University, Corvallis, OR (United States); Reif, David M., E-mail: dmreif@ncsu.edu [Bioinformatics Research Center, North Carolina State University, Raleigh, NC (United States); Department of Biological Sciences, Center for Human Health and the Environment, North Carolina State University, Raleigh, NC (United States)
2017-01-01
Zebrafish have become a key alternative model for studying health effects of environmental stressors, partly due to their genetic similarity to humans, fast generation time, and the efficiency of generating high-dimensional systematic data. Studies aiming to characterize adverse health effects in zebrafish typically include several phenotypic measurements (endpoints). While there is a solid biomedical basis for capturing a comprehensive set of endpoints, making summary judgments regarding health effects requires thoughtful integration across endpoints. Here, we introduce a Bayesian method to quantify the informativeness of 17 distinct zebrafish endpoints as a data-driven weighting scheme for a multi-endpoint summary measure, called weighted Aggregate Entropy (wAggE). We implement wAggE using high-throughput screening (HTS) data from zebrafish exposed to five concentrations of all 1060 ToxCast chemicals. Our results show that our empirical weighting scheme provides better performance in terms of the Receiver Operating Characteristic (ROC) curve for identifying significant morphological effects and improves robustness over traditional curve-fitting approaches. From a biological perspective, our results suggest that developmental cascade effects triggered by chemical exposure can be recapitulated by analyzing the relationships among endpoints. Thus, wAggE offers a powerful approach for analysis of multivariate phenotypes that can reveal underlying etiological processes. - Highlights: • Introduced a data-driven weighting scheme for multiple phenotypic endpoints. • Weighted Aggregate Entropy (wAggE) implies differential importance of endpoints. • Endpoint relationships reveal developmental cascade effects triggered by exposure. • wAggE is generalizable to multi-endpoint data of different shapes and scales.
Cai, Yuhang; Lapitsky, Yakov
2017-05-15
Chitosan/tripolyphosphate (TPP) micro- and nanogels are widely explored as vehicles for protein drug and vaccine delivery. Yet, aside from the consensus that protein uptake into these particles is enhanced by stronger protein/particle binding, factors that control their uptake performance, such as differences in the chitosan, TPP and protein concentrations, remain poorly understood. Here, we show that many of the differences in the reported association efficiencies (AE-values) for protein uptake likely reflect the largely-ignored variability in the particle yield (X Agg ), which is the fraction of the added chitosan that self-assembles into particles and (like the AE) varies with the chitosan, TPP and protein concentrations. Factors affecting X Agg are first systematically explored. The AE is then shown to scale almost linearly with the X Agg (which increases with the TPP and protein-to-chitosan ratios) until all chitosan aggregates into particles. Remarkably, the data collected at variable TPP and protein concentrations collapses onto a single AE∝X Agg curve for each protein type. Further analysis of protein/particle binding reveals this rise in AE with X Agg to reflect: (1) an increase in binding sites within the particles; and (2) a decrease in soluble (non-particulate) chitosan molecules, which form soluble protein/chitosan complexes and compete with the chitosan/TPP particles for the unassociated protein. These findings highlight the need to carefully analyze the effects of formulation parameters on chitosan/TPP particle yields and can likely be extended to other ionically crosslinked colloidal drug carriers. Copyright © 2017 Elsevier Inc. All rights reserved.
Characterization of anthropogenic influence on the soil cover on selected localities of Prague
Czech Academy of Sciences Publication Activity Database
Žigová, Anna; Šťastný, Martin; Krejčová, J.; Hájek, Pavel
2007-01-01
Roč. 4, č. 3 (2007), s. 39-49 ISSN 1214-9705 R&D Projects: GA AV ČR IAA300130504 Institutional research plan: CEZ:AV0Z30130516; CEZ:AV0Z30460519 Keywords : soil development * clay mineralogy * anthropogenically affected areas of Prague * loess * hot-water extractable carbon Subject RIV: DF - Soil Science http://www.irsm.cas.cz/abstracts/AGG/AGG3_147/5_Zigova.pdf
New Chorological Data for Rare Vascular Plants from Romania
Directory of Open Access Journals (Sweden)
Anastasiu Paulina
2015-11-01
Full Text Available New chorological data about seven rare vascular plant taxa are reported in the present paper: Conringia austriaca, Jurinea multiflora, Linaria arvensis, Nonea pallens, Ophrys apifera, Ophrys scolopax subsp. cornuta, Saponaria officinalis. For Linaria arvensis, previously considered doubtful in the absence of the herbarium material, we confirm its presence in Romania. The report of Nonea pallens is the first for Dobrogea, while the report of Jurinea multiflora is the first for Muntenia region of Romania.
Microsatellite association with seed protein content and flowering ...
African Journals Online (AJOL)
use
2011-12-12
Dec 12, 2011 ... 5'-ATA AAG GAG GGC ATA GGG AGG TAT-3'. VM19. 5'-TAT TCA TGC GCC GTG ACA CTA-3'. (AC).(AC). 241. 5'-TCG TGG CAC CCC CTA TC-3'. VM 31. 5'-CGC TCT TCG TTG ATG GTT ATG-3'. (CT). 200. 5'-GTG TTC TAG AGG GTG TGA TGG TA-3'. VM 35. 5'-GGT CAA TAG AAT AAT GGA AAG TGT-3'.
The effect of intercropping on weed infestation of a spring barley crop cultivated in monoculture
Directory of Open Access Journals (Sweden)
Ewa Kwiecińska-Poppe
2012-12-01
Full Text Available This paper presents the results of a study carried out in the years 2005-2007 in the Bezek Experimental Farm near the city of Chełm, Poland, on heavy mixed rendzina soil. The effect of intercropping, using red clover (cv. Dajana and white clover (cv. Astra, on weed infestation of a spring barley crop was studied. The species composition of weeds in the spring barley crop changed to a small extent under the influence of the application of clover intercropping, whereas the population size of particular species showed large fluctuations. In the spring barley crop with the red clover intercrop, Sonchus arvensis occurred in greatest numbers among dicotyledonous weed species. In the barley crop with white clover and without intercrop, Viola arvensis and Sonchus arvensis were the dominant dicotyledonous species. Setaria pumila was the dominant monocotyledonous species in all the treatments. Intercropping using red and white clover clearly limited the growth and development of weeds. The red clover intercrop in the spring barley crop better reduced the infestation with dicotyledonous weeds and also significantly reduced the number of monocotyledonous weeds and the total number of weeds, whereas the white clover intercrop limited only the number of monocotyledonous weeds. The application of the herbicide Chwastox Extra 300 SL significantly reduced the fresh weight of weeds found in the spring barley crop. The presence of the intercrop resulted in different total numbers of weeds in particular treatments. Intercropping distinctly limited the occurrence of the following weed species: Sonchus arvensis, Fallopia convolvulus, Melandrium album, Amaranthus retroflexus, Veronica arvensis and Medicago lupulina. The investigated intercrop species also reduced the biomass of weeds. The application of the herbicide did not differentiate the number of monocotyledonous weeds, which resulted from the application of Chwastox Extra 300 SL that controls only
Zhang, Shaohua; Yan, Han; Zhao, Mingwei; Zheng, Liqiang
2012-04-15
Three gemini pyrrolidine-based ionic liquids, 1,1'-(butane-1,4-diyl)bis(1-alkylpyrrolidinium) bromide ([C(n)py-4-C(n)py][Br(2)], n=10, 12, 14), were synthesized. Their aggregation behavior in aqueous solution was systematically investigated by surface tension, electrical conductivity, and steady-state fluorescence. Compared with their corresponding monomers, N-alkyl-N-methylpyrrolidinium bromide (C(n)MPB), [C(n)py-4-C(n)py][Br(2)], have higher surface activity. The special structure of [C(n)py-4-C(n)py][Br(2)] that has a spacer in their hydrophilic head groups results in a lower surface excess concentration (Γ(max)) and a larger molecular cross-sectional area (A(min)). Electrical conductivity studies show a lower degree of counter-ion binding to the aggregates. A smaller aggregation number (N(agg)) is observed by the pyrene fluorescence quenching method. A series of thermodynamic parameters (ΔG(agg)(0),ΔH(agg)(0),-TΔS(agg)(0)) of aggregation derived from electrical conductivity indicate that the aggregation of [C(n)py-4-C(n)py][Br(2)] is enthalpy-driven, while aggregation of C(n)MPB is entropy-driven at low temperatures but enthalpy-driven at high temperatures. Copyright © 2012 Elsevier Inc. All rights reserved.
Salida de campo a Fuensaldaña (Valladolid) el 19 de agosto de 1953
Valverde Gómez, José Antonio, 1926-2003
2008-01-01
Salida de campo a Fuensaldaña, en Valladolid, el 19 de agosto de 1953, de la que se anotaron observaciones sobre las siguientes aves: Alauda arvensis (Alondra común), Calandrella sp. (Terrera), Galerida sp. (Cogujada), Locustella naevia (Buscarla Pintoja), Pterocles alchata (Ganga ibérica) y Saxicola rubetra (Tarabilla norteña). Field trip to Fuensaldaña, at Valladolid, the 19th of August of 1953, of which there were noted observations about the following birds: Alauda arvensis (Eurasian S...
Antioxidant and antibacterial activity of six edible wild plants (Sonchus spp.) in China.
Xia, Dao-Zong; Yu, Xin-Fen; Zhu, Zhuo-Ying; Zou, Zhuang-Dan
2011-12-01
The total phenolic and flavonoid, antioxidant and antibacterial activities of six Sonchus wild vegetables (Sonchus oleraceus L., Sonchus arvensis L., Sonchus asper (L.) Hill., Sonchus uliginosus M.B., Sonchus brachyotus DC. and Sonchus lingianus Shih) in China were investigated. The results revealed that S. arvensis extract and S. oleraceus extract contained the highest amount of phenolic and flavonoid, respectively. Among the methanol extracts of six Sonchus species, S. arvensis extract exhibited the highest radical (DPPH and ABTS+ scavenging power and lipid peroxidation inhibitory power. It also exhibited the highest reducing power at 500 µg mL⁻¹ by A (700) = 0.80. The results of antibacterial test indicated that the S. oleraceus extract showed higher activity than the other five Sonchus wild vegetables extracts, both in Gram-negative bacteria (Escherichia coli, Salmonella enterica and Vibrio parahaemolyticus) and in a Gram-positive bacterium (Staphylococcus aureus). These results indicate that Sonchus wild food plants might be applicable in natural medicine and healthy food.
Cutting weeds with a CO2 laser
DEFF Research Database (Denmark)
Heisel, T.; Schou, Jørgen; Christensen, S.
2001-01-01
Stems of Chenopodium album. and Sinapis arvensis. and leaves of Lolium perenne. were cut with a CO2 laser or with a pair of scissors. Treatments were carried out on greenhouse-grown pot plants at three different growth stages and at two heights. Plant dry matter was measured 2 to 5 weeks after...... treatment. The relationship between dry weight and laser energy was analysed using a non-linear dose-response regression model. The regression parameters differed significantly between the weed species. At all growth stages and heights S. arvensis was more difficult to cut with a CO2 laser than C. album....... When stems were cut below the meristems, 0.9 and 2.3 J mm(-1) of CO2 laser energy dose was sufficient to reduce by 90% the biomass of C. album and S. arvensis respectively. Regrowth appeared when dicotyledonous plant stems were cut above meristems, indicating that it is important to cut close...
2017-10-09
for AGG should be minimal. For this purpose, the seeds for AGG may also be provided externally. This process is called the solid-state single...bonding process . Figure 31 shows (a) the growth of one large single crystal from one small single crystal seed as well as (b) the growth of one...one bi-crystal seed : One large bi-crystal can be grown from one small bi-crystal by SSCG process . Fig. 32. Diffusion bonding process for
A New Iridoid Glycoside from the Roots of Dipsacus asper
Directory of Open Access Journals (Sweden)
Zhonglin Yang
2012-02-01
Full Text Available A new iridoid glycoside, named loganic acid ethyl ester (1, together with five known compounds: chlorogenic acid (2, caffeic acid (3, loganin (4, cantleyoside (5 and syringaresinol-4′,4′′-O-bis-β-D-glucoside (6 were isolated from the roots of Dipsacus asper. The structure of compound 1 was elucidated on the basis of detailed spectroscopic analyses. Lignan is isolated from Dipsacaceae species for the first time. Compounds 1, 4 and 5 had moderate neuroprotective effects against the Aβ25–35 induced cell death in PC12 cells.
Directory of Open Access Journals (Sweden)
Plamen S. Stoyanov
2016-06-01
Full Text Available The study presents data on the diversity of grass species in the region of the village of Mugla (the Western Rhodopes. One hundred forty-one species of higher plants belonging to 40families were registered. (Apiaceae, Aspleniaceae, Asteraceae, Boraginaceae, Brassicaceae,Campanulaceae, Caryophyllaceae, Cistaceae, Cyperaceae, Dipsacaceae, Equisetaceae, Ericaceae,Euphorbiaceae, Fabaceae, Gentianaceae, Geraniaceae, Gesneriaceae, Hypericaceae, Juncaceae,Lamiaceae, Lemnaceae, Liliaceae, Linaceae, Menyanthaceae, Oleacea, Onagraceae, Orchidaceae,Parnassiaceae, Plantaginaceae, Plumbaginaceae, Poaceae, Polygalaceae, Primulaceae,Ranunculaceae, Rosaceae, Rubiaceae, Saxifragaceae, Scrophulariaceae, Valerianaceae andViolaceae. Their conservation status was presented, as well as medicinal plants.
Fruiting phenology of some weed species in sowing of chosen cultivar plants
Directory of Open Access Journals (Sweden)
Marian Wesołowski
2012-12-01
Full Text Available In the paper, the percentage shares of the phases of fruiting and diaspore shedding of some weed species during fodder beet, spring wheat and faba bean harvest are presented. The results of the study were gathered in the years 2000-2003 on river alluvial soil made from light loam. The experimental scheme included mechanical and chemical control of the cultivated plants. On weed-free objects treated with herbicides, the following herbicides were used: fodder beet - Buracyl 80 WP (lenacyl 80% in dose 1 kg.ha-1; spring wheat - Chwastox Turbo 340 SL (MCPA + dicamba in dose 2l.ha-1; faba-bean - Afalon (linuron 50% in dose 1,5 kg.ha-1. Phenological observations were carried out at 10-day intervals beginning from the day of sowing the cultivated plant. It was proven that weeds had the most favourable conditions of fruiting and seed shedding in fodder beet and faba bean. Fruiting and shedding of most weed species were limited by herbicides, as well as cold years. The following weed species: fodder beet without herbicides - Lamium amplexicaule, Chenopodium polyspermum, Anagallis arvensis i Echinochloa crus-galli; fodder beet with herbicides - Convolvulus arvensis, Lamium purpureum i Echinochloa crus-galli; spring wheat without herbicides - Capsella bursa-pastoris i Fallopia convolvulus; spring wheat with herbicides - Avena fatua; faba been without herbicides - Galium aparine, Anagallis arvensis i Convolvulus arvensis; faba been with herbicides - Galium aparine, shed diaspores in the greatest degree.
Uptake of more important mineral components by common field weeds on loess soils
Directory of Open Access Journals (Sweden)
Leszek Malicki
2013-12-01
Full Text Available We have determined the contents of N, P, K, Ca, Mg, Na, Fe, Cu, Mn and Zn in winter wheat, spring barley, sugar beets and winter rape, as well as in the most common weed species infesting these crops. It was established that the percentage of mineral components in the dry matter of the majority of weeds is higher than in that of the cultivated plants. The most dangerous weed species competing with plants for the investigated nutrients were: Chenopodium album, Cirsium arvense, Convolvulus arvensis, Polygonum convolvulus, Sonchus arvensis and Stellaria media.
Some Quality Traits of Different Wild Plants
Directory of Open Access Journals (Sweden)
Mustafa AVCI
2009-12-01
Full Text Available This research was carried out to determine quality properties of some pasture plant species. In this research, 10 different pasture plant species were used as materials which were collected from Diyarbakir pasture areas of Turkey. At the end of research, quality properties of pasture plants were ranged from lowest to highest for average dry matter 11.5-30.9%, average crude protein 12.6-26.6%, crude ash 5.5-21.2%, acid detergent fiber 22.0-43.0%, neutral detergent fiber 20.5-56.1%, digestible dry matter 55.4-71.8%, dry matter intake 2.1-5.9% and relative feed value 90.2-327.0. Among the pasture plants studied, higher crude protein level than averages of species following plants may have importance, respectively: Centaurea iberica, Sinapsis arvensis, Convolvulus arvensis, Rumex conglomeratus, Crambe orientalis, Amaranthus retroflexus, Polygonum aviculare, Anchusa strigosa and Malva neglecta. For relative feed value has been remarked: Sinapsis arvensis, Rumex conglomeratus, Amaranthus retroflexus, Crambe orientalis, Centaurea iberica and Hypecoum imberbe.
Some Quality Traits of Different Wild Plants
Directory of Open Access Journals (Sweden)
Mehmet BASBAG
2010-03-01
Full Text Available This research was carried out to determine quality properties of some pasture plant species. In this research, 10 different pasture plant species were used as materials which were collected from Diyarbakir pasture areas of Turkey. At the end of research, quality properties of pasture plants were ranged from lowest to highest for average dry matter 11.5-30.9%, average crude protein 12.6-26.6%, crude ash 5.5-21.2%, acid detergent fiber 22.0-43.0%, neutral detergent fiber 20.5-56.1%, digestible dry matter 55.4-71.8%, dry matter intake 2.1-5.9% and relative feed value 90.2-327.0. Among the pasture plants studied, higher crude protein level than averages of species following plants may have importance, respectively: Centaurea iberica, Sinapsis arvensis, Convolvulus arvensis, Rumex conglomeratus, Crambe orientalis, Amaranthus retroflexus, Polygonum aviculare, Anchusa strigosa and Malva neglecta. For relative feed value has been remarked: Sinapsis arvensis, Rumex conglomeratus, Amaranthus retroflexus, Crambe orientalis, Centaurea iberica and Hypecoum imberbe.
DEFF Research Database (Denmark)
Jønsson, Rie; Struve, Carsten; Boll, Erik J.
2017-01-01
phylogenetically distinct, strains harboring the major pilin subunits from both AAF/III and AAF/V. Whole-genome and plasmid sequencing revealed that in these six strains the agg3A and agg5A genes were located on a novel pAA plasmid variant. Moreover, the plasmid also encoded several other virulence genes including...... some not previously found on pAA plasmids. Thus, this plasmid endows the host strains with a remarkably high number of EAEC associated virulence genes hereby likely promoting strain pathogenicity....
Varietal Response of Chickpea (Cicer arietinum L.) Towards the Allelopathy of Different Weeds
International Nuclear Information System (INIS)
Rahamdad, K.; Ijaz, A.K.
2015-01-01
In a laboratory trial three chickpea varieties viz, Karak-I, Karak-III and Shenghar were tested against the phytotoxicity of five weed species: Parthenium hysterophorus L., Phragmites australis (Cav.) Trin., Datura alba L., Cyperus rotundus L. and Convolvulus arvensis L.in January 2013. The weed extracts were prepared at the rate of 120 g/L (w/v) after shade dry. The results indicated highly significant inhibitory effect of all the tested weed species on the chickpea varieties. The results also showed that the chickpea variety Karak-III was more susceptible to the phototoxicity of the tested weed extracts. Among the extract, C. arvensis proved much toxic in term of inhibition of germination by giving only 43.33% germination in comparison with control where 97.50% germination was recorded. On the other hand, the effect of P. australis extract was found a little stimulator by speeding the seed germination in all varieties and giving a low (2.21) mean germination time (MGT) value. From the current results it can be concluded that the infestation of C. arvensis can pollute the soil by accumulating toxic chemicals that leads to the germination failure and growth suppression in chickpea. Therefore, the prevention and removal of C. arvensis in the chickpea growing areas could be recommended. In addition, P. australis must be tested against chickpea weeds (chickpea varieties withstand against its phototoxicity), so that it can be popularized as bio herbicide in chickpea if it gave promising results in controlling chickpea weeds. (author)
Directory of Open Access Journals (Sweden)
Araceli E Santiago
2014-05-01
Full Text Available We have reported that transcription of a hypothetical small open reading frame (orf60 in enteroaggregative E. coli (EAEC strain 042 is impaired after mutation of aggR, which encodes a global virulence activator. We have also reported that the cryptic orf60 locus was linked to protection against EAEC diarrhea in two epidemiologic studies. Here, we report that the orf60 product acts as a negative regulator of aggR itself. The orf60 protein product lacks homology to known repressors, but displays 44-100% similarity to at least fifty previously undescribed small (<10 kDa hypothetical proteins found in many gram negative pathogen genomes. Expression of orf60 homologs from enterotoxigenic E. coli (ETEC repressed the expression of the AraC-transcriptional ETEC regulator CfaD/Rns and its regulon in ETEC strain H10407. Complementation in trans of EAEC 042orf60 by orf60 homologs from ETEC and the mouse pathogen Citrobacter rodentium resulted in dramatic suppression of aggR. A C. rodentium orf60 homolog mutant showed increased levels of activator RegA and increased colonization of the adult mouse. We propose the name Aar (AggR-activated regulator for the clinically and epidemiologically important orf60 product in EAEC, and postulate the existence of a large family of homologs among pathogenic Enterobacteriaceae and Pasteurellaceae. We propose the name ANR (AraC Negative Regulators for this family.
The Importance of some weeds for the survival of Fusarium oxysporum Schl. f.sp. lini (Boll. Snyd.
Directory of Open Access Journals (Sweden)
Barbara Łacicowa
2014-08-01
Full Text Available The studies were caried out to determine the importance of some weeds occurrence in the flax monoculture the survival of Fusarium oxysporum f. sp. lini. It appearet that the roots of Veronica persica, Stellaria media, Lamium purpureum, Capsella bursa-pastoris and Sonchus arvensis were colonized by Fusarium oxysporum f. sp. lini. V. persica especially has, a profitable influence on the survival of F. oxysporum f. sp. lini. However. C. hursa-pastoris and S. arvensis stimulate the growth of fungi of the genera Trichoderma. which limites the occurrence of F. oxysporum f. sp. lini in the soil.
Rechtsmissbrauch durch „AGG-Hopping“ / Steffen Krieger
Krieger, Steffen
2016-01-01
Euroopa Kohtu otsusest, mis puudutab töökohale kandideerija staatust eesmärgiga esitada kahju hüvitamise nõudeid kui teda ei valita tööle ja sellise teguviisi käsitlemist õiguse kuritarvitamisena. Vt. ka lk. 699-700
Development of DU-AGG (Depleted Uranium Aggregate)
Energy Technology Data Exchange (ETDEWEB)
Lessing, P.A.
1995-09-01
Depleted uranium oxide (UO{sub 2} or U0{sub 3}) powder was mixed with fine mineral additives, pressed, and heated to about 1,250{degree}C. The additives were chemically constituted to result in an iron-enriched basalt (IEB). Melting and wetting of the IEB phase caused the urania powder compact to densify (sinter) via a liquid phase sintering mechanism. An inorganic lubricant was found to aid in green-forming of the body. Sintering was successful in oxidizing (air), inert (argon), or reducing (dry hydrogen containing) atmospheres. The use of ground U0{sub 3} powders (93 vol %) followed by sintering in a dry hydrogen-containing atmosphere significantly increased the density of samples (bulk density of 8.40 g/cm{sup 3} and apparent density of 9.48 g/cm{sup 3}, open porosity of 11.43%). An improvement in the microstructure (reduction in open porosity) was achieved when the vol % of U0{sub 3} was decreased to 80%. The bulk density increased to 8.59 g/cm{sup 3}, the apparent density decreased slightly to 8.82 g/cm{sup 3} (due to increase of low density IEB content), while the open porosity decreased to an excellent number of 2.78%. A representative sample derived from 80 vol % U0{sub 3} showed that most pores were closed pores and that, overall, the sample achieved the excellent relative density value of 94.1% of the estimated theoretical density (composite of U0{sub 2} and IEB). It is expected that ground powders of U0{sub 3} could be successfully used to mass produce lowcost aggregate using the green-forming technique of briquetting.
Abnormal growth of faceted (WC) grains in a (Co) liquid matrix
International Nuclear Information System (INIS)
Park, Y.J.; Yoon, D.Y.
1996-01-01
If the grains dispersed in a liquid matrix are spherical, their surface atomic structure is expected to be rough (diffuse), and their coarsening has been observed to be controlled by diffusion in the matrix. They do not, furthermore, undergo abnormal growth. On the other hand, in some compound material systems, the grains in liquid matrices are faceted and often show abnormal coarsening behavior. Their faceted surface planes are expected to be singular (atomically flat) and therefore grow by a defect-assisted process and two-dimensional (2-D) nucleation. Contrary to the usual coarsening theories, their growth velocity is not linearly dependent on the driving force arising from the grain size difference. If the growth of the faceted grains occurs by 2-D nucleation, the rate is expected to increase abruptly at a critical supersaturation, as has been observed in crystal growth in melts and solutions. It is proposed that this growth mechanism leads to the abnormal grain coarsening. The 2-D nucleation theory predicts that there is a threshold initial grain size for the abnormal grain growth (AGG), and the propensity for AGG will increase with the heat-treatment temperature. The AGG behavior will also vary with the defects in the grains. These predictions are qualitatively confirmed in the sintered WC-Co alloy prepared from fine (0.85-microm) and coarse (5.48-microm) WC powders and their mixtures. The observed dependence of the AGG behavior on the sintering temperature and the milling of the WC powder is also qualitatively consistent with the predicted behavior
de Sousa Guedes, Jossana Pereira; da Costa Medeiros, José Alberto; de Souza E Silva, Richard Sidney; de Sousa, Janaína Maria Batista; da Conceição, Maria Lúcia; de Souza, Evandro Leite
2016-12-05
This study evaluated the ability of the essential oil from Mentha arvensis L. (MAEO) and M. piperita L. (MPEO) to induce ≥5-log reductions in counts (CFU/mL) of E. coli, L. monocytogenes, and Salmonella enterica serovar Enteritidis in Brain-Heart Infusion broth (BHIB) and cashew, guava, mango, and pineapple juices during refrigerated storage (4±0.5°C). The effects of the incorporation of these essential oils on some physicochemical and sensory parameters of juices were also evaluated. The incorporation of 5, 2.5, 1.25, or 0.625μL/mL of MAEO in BHIB caused a ≥5-log reduction in counts of E. coli and Salmonella Enteritidis after 24h of storage; but only 5μL/mL was able to cause the same reduction in counts of L.monocytogenes. The incorporation of 10μL/mL of MPEO in BHIB caused a ≥5-log reduction in counts of E. coli, Salmonella Enteritidis, and L. monocytogenes after 24h of storage; smaller reductions were observed in BHIB containing 5, 2.5, and 1.25μL/mL of MPEO. Similar reductions were observed when the MAEO or MPEO was incorporated at the same concentrations in mango juice. The incorporation of MAEO or MPEO at all tested concentrations in cashew, guava, and pineapple juices resulted in a ≥5-log reduction in pathogen counts within 1h. The incorporation of MAEO and MPEO (0.625 and 1.25μL/mL, respectively) in fruit juices did not induce alterations in °Brix, pH, and acidity, but negatively affected the taste, aftertaste, and overall acceptance. The use of MAEO or MPEO at low concentrations could constitute an interesting tool to achieve the required 5-log reduction of pathogenic bacteria in cashew, guava, mango, and pineapple fruit juices. However, new methods combining the use of MAEO or MPEO with other technologies are necessary to reduce their negative impacts on specific sensory properties of these juices. Copyright © 2016 Elsevier B.V. All rights reserved.
Intraarterial 9-beta-methyl carbacyclin improves canine polytetrafluoroethylene graft patency
International Nuclear Information System (INIS)
Dacey, L.J.; Hees, P.S.; Cronenwett, J.L.
1988-01-01
This study examined the effect of 9-beta-methyl carbacyclin, a synthetic, stable prostacyclin analog, on canine polytetrafluoroethylene (PTFE) graft patency. Twenty-five dogs had 4 mm x 7 cm PTFE grafts implanted bilaterally into the femoral arteries. A subcutaneous infusion pump was used to deliver either saline solution (control) or 9-beta-methyl carbacyclin (Ciprostine) at 100 (CARB-100) or 200 ng/kg/min (CARB-200) through a femoral artery branch just proximal to one of the femoral grafts, with the contralateral graft serving as a noninfused control. Graft-platelet deposition (with 111 In-labeled platelets) was measured between the fifth and seventh days, with patency determined on the seventh day. Dogs were classified as aggregators (AGG [+]) if the preoperative epinephrine-enhanced sodium arachidonate platelet aggregation was greater than 20%. CARB-200 infusion significantly improved ipsilateral graft patency (80%) compared with noninfused grafts (50%, p less than 0.05), or grafts in control and CARB-100 dogs (43%, p less than 0.05). Anastomotic platelet deposition was decreased bilaterally in CARB-200 dogs by 45% to 59% compared with CARB-100 and control dogs (p less than 0.05). With the exception of grafts infused with CARB-200, AGG (+) dogs had significantly lower graft patency (26%) than nonaggregator AGG (-) dogs (71%, p less than 0.01). CARB-200 infusion significantly improved graft patency in AGG (+) dogs (71%), compared with control and CARB-100-infused grafts (19%, p less than 0.025). Intra-arterial 9-beta-methyl carbacyclin improved early PTFE graft patency and inhibited platelet deposition in a severe canine model, independent of baseline platelet aggregation status, which also had an important effect on graft patency
TGFβ1 polymorphisms and late clinical radiosensitivity in patients treated for gynecologic tumors
International Nuclear Information System (INIS)
Ruyck, Kim de; Van Eijkeren, Marc; Claes, Kathleen; Bacher, Klaus; Vral, Anne; Neve, Wilfried de; Thierens, Hubert
2006-01-01
Purpose: To investigate the association between six transforming growth factor β1 gene (TGFβ1) polymorphisms (-1.552delAGG, -800G>A, -509C>T, Leu10Pro, Arg25Pro, Thr263Ile) and the occurrence of late normal tissue reactions after gynecologic radiotherapy (RT). Methods and Materials: Seventy-eight women with cervical or endometrial cancer and 140 control individuals were included in the study. According to the Common Terminology Criteria for Adverse Events version 3.0 (CTCAEv3.0) scale, 25 patients showed late adverse RT reactions (CTC2+), of whom 11 had severe complications (CTC3+). Polymerase chain reaction-restriction fragment length polymorphism (PCR-RFLP), single base extension and genotyping assays were performed to examine the polymorphic sites in TGFβ1. Results: Homozygous variant -1.552delAGG, -509TT, and 10Pro genotypes were associated with the risk of developing late severe RT reactions. Triple (variant) homozygous patients had a 3.6 times increased risk to develop severe RT reactions (p = 0.26). Neither the -800A allele, nor the 25Pro allele or the 263Ile allele were associated with clinical radiosensitivity. There was perfect linkage disequilibrium (LD) between the -1.552delAGG and the -509C>T polymorphisms, and tight LD between the -1.552/-509 and the Leu10Pro polymorphisms. Haplotype analysis revealed two major haplotypes but could not distinguish radiosensitive from nonradiosensitive patients. Conclusions: The present study shows that homozygous variant TGFβ1 -1.552delAGG, -509TT, and 10Pro genotypes may be associated with severe clinical radiosensitivity after gynecologic RT
7 CFR 201.17 - Noxious-weed seeds in the District of Columbia.
2010-01-01
...), Canada thistle (Cirsium arvense), field bindweed (Convolvulus arvensis), bermudagrass (Cynodon dactylon), giant bermudagrass (Cynodon dactylon var. aridus), annual bluegrass (Poa annua), and wild garlic or wild...
Effects of lower cobalt binder concentrations in sintering of tungsten carbide
International Nuclear Information System (INIS)
Li Tao; Li Qingfa; Fuh, J.Y.H.; Yu, P.C.; Wu, C.C.
2006-01-01
Cemented tungsten carbides have received much attention because of their superior characteristics. Traditional cemented tungsten carbides usually contain 3-30 wt% binder phase. In this paper, WC with low Co concentration less than 3 wt% is studied using traditional powder metallurgy. The binder phase has tremendous effect on sinterability of WC. High sinterability and high hardness can be achieved for the WC (0.7 μm) with 0.5 wt% Co. Abnormal grain growth (AGG) is often observed in sintering WC with small amount of Co. It seems that AGG is affected by the concentration of Co and a range of Co concentrations may exist for the large amount of AGG. To control the grain size, VC is added to inhibit the grain growth of WC. It is observed that the hardness is affected by the amount of addition of VC. Controlling the ratio of C/W less than unity at low Co concentrations will result in the production of W 2 C phase. The hardness of WC-Co is affected by the amount of W 2 C phase in the sample and W 2 C is stable during the normal cooling process
Directory of Open Access Journals (Sweden)
Guo Yan-Ping
2012-01-01
Full Text Available Abstract Background Species complexes or aggregates consist of a set of closely related species often of different ploidy levels, whose relationships are difficult to reconstruct. The N Hemisphere Achillea millefolium aggregate exhibits complex morphological and genetic variation and a broad ecological amplitude. To understand its evolutionary history, we study sequence variation at two nuclear genes and three plastid loci across the natural distribution of this species complex and compare the patterns of such variations to the species tree inferred earlier from AFLP data. Results Among the diploid species of A. millefolium agg., gene trees of the two nuclear loci, ncpGS and SBP, and the combined plastid fragments are incongruent with each other and with the AFLP tree likely due to incomplete lineage sorting or secondary introgression. In spite of the large distributional range, no isolation by distance is found. Furthermore, there is evidence for intragenic recombination in the ncpGS gene. An analysis using a probabilistic model for population demographic history indicates large ancestral effective population sizes and short intervals between speciation events. Such a scenario explains the incongruence of the gene trees and species tree we observe. The relationships are particularly complex in the polyploid members of A. millefolium agg. Conclusions The present study indicates that the diploid members of A. millefolium agg. share a large part of their molecular genetic variation. The findings of little lineage sorting and lack of isolation by distance is likely due to short intervals between speciation events and close proximity of ancestral populations. While previous AFLP data provide species trees congruent with earlier morphological classification and phylogeographic considerations, the present sequence data are not suited to recover the relationships of diploid species in A. millefolium agg. For the polyploid taxa many hybrid links and
Souza, Lucéia Fátima; de Barros, Ingrid Bergman Inchausti; Mancini, Emilia; De Martino, Laura; Scandolera, Elia; De Feo, Vincenzo
2014-07-01
The chemical composition of the essential oil of Anredera cordifolia (Ten.) Steenis (Basellaceae), grown in Brazil, was studied by means of GC and GC-MS analysis. In all, 19 compounds were identified, accounting for 91.6% of the total oil; hydrocarbons were the main constituents (67.7%). The essential oil was evaluated for its in vitro potential phytotoxic activity against germination and initial radicle growth of Raphanus sativus L., Sinapis arvensis L., and Phalaris canariensis L. seeds. At 1.25 microg/mL and 0.625 microg/mL, the oil significantly promoted the germination of S. arvensis. Moreover, the antimicrobial activity of the essential oil was assayed against ten bacterial strains. The essential oil showed a weak inhibitory activity against the Gram-positive pathogens.
Regenerative Medicine and Restoration of Joint Function
2013-10-01
hydrophilic anionic polymer (poly-2-sulfoethyl aspartamide, 200Å pore size, 5 µm diameter). Fractionation was performed using an Agilent 1100 HPLC ...AGT CCC AGT GT-3’ 3’-C TGT AGG ACC GGG ACT GTG-5’ Collagen III 5’-AAA TGG GTC CTG CTG GCA TT-3’ 3’- CG TCC ACT TGG GCC ATT CTT-5’ Collagen XII 5’-CAT...GTC AAG CTT CCG AGT GA-3’ 3’-GT TGG GAA AGG CTG TGT TGA-5’ Collagen XV 5’-AAC CTG GAC TTG ATG GAG CG -3’ 3’-GA CCG TTG TCT CCG AAT GGT-5’ 18S 5’-GTA
DEFF Research Database (Denmark)
Gonzalez de Valdivia, Ernesto I; Isaksson, Leif A
2005-01-01
In Escherichia coli the codons CGG, AGG, UGG or GGG (NGG codons) but not GGN or GNG (where N is non-G) are associated with low expression of a reporter gene, if located at positions +2 to +5. Induction of a lacZ reporter gene with any one of the NGG codons at position +2 to +5 does not influence......-type or the mutant strain. The inhibitory effect on the pth mutant strain by NGG codons at location +5 was suppressed by overexpression of the Pth enzyme from a plasmid. However, the overexpression of cognate tRNAs for AGG or GGG did not rescue from the growth inhibition associated with these codons early...
Sessile oak (Quercus petraea agg. Ehrendorfer 1967) rare ...
African Journals Online (AJOL)
STORAGESEVER
2009-09-01
Sep 1, 2009 ... African Journal of Biotechnology Vol. 8 (17), pp. ... Liebl.), Balkan (Quercus dalechampii Ten.) and .... west Serbia; that is on the mountains Goč and Zlatibor. (Map 1 ... supported by the Ministry of Agriculture, Forestry and.
Seismic structure and tectonics of the Alasehir--Gediz Graben, Western Turkey
Turk, Sezer
The Aegean Extensional Province (AEP) in Western Anatolia includes three major graben systems that have formed as a result of N-S tectonic extension in the latest Cenozoic. The 6 to 30-km-wide Alasehir--Gediz Graben (AGG) in the north contains ˜3-km-thick Miocene and Plio-Quaternary, alluvial--fluvial and lacustrine sedimentary rocks. I have used seismic profiles, well-log data and the regional stratigraphy to identify the key stratigraphic units, their bounding surfaces and vertical thicknesses, and to document the subsurface structural architecture of the AGG. A north-dipping detachment fault exposed in the southern shoulder of the AGG basin occurs at 2--2.5 km at depth beneath the graben fill, and is dissected by ˜E--W--striking, synthetic to antithetic, high-angle normal faults. The graben system is crosscut by NNE-oriented cross faults, showing several km of recurrence interval and 10s of meters of vertical displacement. These faults divide the graben into several sub-basins and display positive and negative flower structures. The structural architecture in the sub-basins shows important variations in stratigraphic thicknesses, fault geometry-displacement and deformation patterns, indicating that cross faulting played a critical role in the evolution of the AAG.
Fei, Minghui; Harvey, Jeffrey A; Yin, Yi; Gols, Rieta
2017-06-01
The effects of temporal variation in the quality of short-lived annual plants on oviposition preference and larval performance of insect herbivores has thus far received little attention. This study examines the effects of plant age on female oviposition preference and offspring performance in the large cabbage white butterfly Pieris brassicae. Adult female butterflies lay variable clusters of eggs on the underside of short-lived annual species in the family Brassicaceae, including the short-lived annuals Brassica nigra and Sinapis arvensis, which are important food plants for P. brassicae in The Netherlands. Here, we compared oviposition preference and larval performance of P. brassicae on three age classes (young, mature, and pre-senescing) of B. nigra and S. arvensis plants. Oviposition preference of P. brassicae declined with plant age in both plant species. Whereas larvae performed similarly on all three age classes in B. nigra, preference and performance were weakly correlated in S. arvensis. Analysis of primary (sugars and amino acids) and secondary (glucosinolates) chemistry in the plant shoots revealed that differences in their quality and quantity were more pronounced with respect to tissue type (leaves vs. flowers) than among different developmental stages of both plant species. Butterflies of P. brassicae may prefer younger and smaller plants for oviposition anticipating that future plant growth and size is optimally synchronized with the final larval instar, which contributes >80% of larval growth before pupation.
ORF Alignment: NC_002929 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available a ... bronchiseptica RB50] ... Length = 249 ... Query: 32 ... RPVRLIVPYGAGGAADVLARIMAEKLSAIWKQPVIVEN...KPGGVGTIGIMATVQAEPDGYT 91 ... +PVR++V + AGG ... DV+ARIMA++L+ ... Q ... +VENKPGG ... ... I ... +A PDGYT Sbjct: 1 ... KPVRIVVGFSAGGTTDVIARIMAKELTEALGQSFVVENKPGGGSNIATDYVARATPDGYT 60 ... Query: 152 KPGY
ORF Alignment: NC_002927 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available a ... bronchiseptica RB50] ... Length = 249 ... Query: 32 ... RPVRLIVPYGAGGAADVLARIMAEKLSAIWKQPVIVEN...KPGGVGTIGIMATVQAEPDGYT 91 ... +PVR++V + AGG ... DV+ARIMA++L+ ... Q ... +VENKPGG ... ... I ... +A PDGYT Sbjct: 1 ... KPVRIVVGFSAGGTTDVIARIMAKELTEALGQSFVVENKPGGGSNIATDYVARATPDGYT 60 ... Query: 152 KPGY
Antibiosis in Ascia monuste orseis Godart (Lepidoptera: Pieridae ...
African Journals Online (AJOL)
Flávio Gonçalves
(Sinapis arvensis), wild radish (Raphanus raphanistrum), cabbage (Brassica oleracea var. capitata), cauliflower. (Brassica oleracea var. botrytis) and Chinese ..... seeds: Phytochemical characterization and antioxidant potential. Food Chem. 101: 549-558. Filgueira FAR (2008). Novo manual de olericultura: Agrotecnologia.
Abnormal grain growth in Eurofer-97 steel in the ferrite phase field
Energy Technology Data Exchange (ETDEWEB)
Oliveira, V.B. [Lorena School of Engineering, University of Sao Paulo, Lorena, SP, 12602-810 (Brazil); Sandim, H.R.Z., E-mail: hsandim@demar.eel.usp.br [Lorena School of Engineering, University of Sao Paulo, Lorena, SP, 12602-810 (Brazil); Raabe, D. [Max-Planck-Institut für Eisenforschung, Düsseldorf, D-40237 (Germany)
2017-03-15
Reduced-activation ferritic-martensitic (RAFM) Eurofer-97 steel is a candidate material for structural applications in future fusion reactors. Depending on the amount of prior cold rolling strain and annealing temperature, important solid-state softening reactions such as recovery, recrystallization, and grain growth occur. Eurofer-97 steel was cold rolled up to 70, 80 and 90% reductions in thickness and annealed in the ferrite phase field (below ≈ 800 °C). Changes in microstructure, micro-, and mesotexture were followed by orientation mappings provided by electron backscatter diffraction (EBSD). Eurofer-97 steel undergoes abnormal grain growth above 650 °C and this solid-state reaction seems to be closely related to the high mobility of a few special grain boundaries that overcome pinning effects caused by fine particles. This solid-state reaction promotes important changes in the microstructure and microtexture of this steel. Abnormal grain growth kinetics for each condition was determined by means of quantitative metallography. - Highlights: • Abnormal grain growth (AGG) occurs in Eurofer-97 steel deformed to several strains. • Kinetics of abnormal grain growth has been determined at 750 and 800 °C. • Significant changes in crystallographic texture take place during AGG. • Grain boundaries with misorientations above 45° may explain abnormal grain growth. • Local microstructural instabilities (coarsening of M23C6 carbides) also explain AGG.
Alijani, Samira; Balaghi, Sima; Mohammadifar, Mohammad Amin
2011-11-01
In this study, Iranian gum tragacanth (GT) exudates from Astragalus fluccosus (AFG) and Astragalus gossypinus (AGG) were irradiated at 3, 7, 10 and 15 kGy. Fourier transform infrared spectroscopy (FTIR) data showed that irradiation did not induce changes in the chemical structure of either type of gum. Although particle size distribution and both steady shear and dynamic rheological properties were considerably affected by the irradiation process, the magnitude of the effect of irradiation on each of the rheological and size variables was different for the hydrocolloids. For instance, for AGG, increasing the irradiation dose from 3 to 10 kGy, the d(0.5) and D[3,2] values were reduced by one-sixth to one-eighth fold. Colour measurement revealed that the radiation process led to an increase in the yellow index and b* values for both types of GT in powder form, but it was more pronounced for AGG samples. Irradiation led to an approximate 13-fold increase in redness in AFG. Surface and shape changes of the gum crystals were studied by scanning electron microscope (SEM) and a smoother surface for irradiated samples was detected. The notable changes in functional properties of each variety of irradiated gum should be taken into consideration before using the radiation technology as a commercial tool for sterilisation. Copyright © 2011 Elsevier B.V. All rights reserved.
Benefit-Cost Analysis of Integrated Paratransit Systems : Volume 6. Technical Appendices.
1979-09-01
This last volume, includes five technical appendices which document the methodologies used in the benefit-cost analysis. They are the following: Scenario analysis methodology; Impact estimation; Example of impact estimation; Sensitivity analysis; Agg...
Allelopathic Effect of Eucalyptus citriodora Essential Oil and its Potential Use as Bioherbicide.
Benchaa, Sara; Hazzit, Mohamed; Abdelkrim, Hacène
2018-06-12
The current study aimed to evaluate the negative allelopathic effect of Eucalyptus citriodora essential oil on some of the most noxious weeds in Algeria (Sinapis arvensis, Sonchus oleraceus, Xanthium strumarium and Avena fatua). Gas chromatography-flame ionization detector (GC-FID) and GC-mass spectrometry (MS) were used to define the chemical composition of the oil. Citronellal (64.7%) and citronellol (10.9%) were the major essential oil compounds. Three concentrations of the oil were used for laboratory (0.01, 0.02 and 0.03%) and greenhouse (1, 2 and 3%) experiments. Seed germination and seedling's growth were drastically reduced in response to the oil concentrations where at 0.01 and 0.02% the oil drastically affects the seed germination of the tested weeds and at 0.03% the oil suppresses completely the germination of S. arvensis. The oil also exhibited strong allelopathic effect on the 3-4 leaf stage plants 1 and 6 days after treatment. A completely death of S. arvensis, S. oleraceus and A. fatua and severe injuries on X. strumarium appeared at 3% of the oil. Chlorophyll content and membrane integrity were significantly affected after treatment of the plant weeds representing a severe reduction in total chlorophyll and cell membrane disruption. The study concludes that E. citriodora essential oil might have the potential use as bioherbicide and can constitute an alternative process of weed control. This article is protected by copyright. All rights reserved. This article is protected by copyright. All rights reserved.
Diversité des communautés de mauvaises herbes des cultures annuelles de Côte-d'Or (France
Directory of Open Access Journals (Sweden)
Dessaint F.
2001-01-01
Full Text Available Diversity of weed communities of annual crops in Cote-d'Or, France. Weed flora of annual crops in Cote-d'Or, France, were characterized in three successive growing seasons by measuring species frequencies and abundance over 245 fields. A total of 210 species in 143 genera were recorded representing a total of 43 families with Asteraceae, Poaceae, Fabaceae, Scrophulariaceae, Brassicaceae, Lamiaceae and Caryophyllaceae predominating. More than half of the species occurred in less than 5/ of the sampled plots (fields x years and only 9 species (namely Galium aparine L., Polygonum aviculare L., Fallopia convolvulus (L. A. Loeve, Alopecurus myosuroides Hudson, Stellaria media (L. Vill., Convolvulus arvensis L., Sinapis arvensis L., Veronica persica Poiret and Anagallis arvensis L. occurred in more than 50/ of the plots. The maximum plot density was greater than 20 plants per square metre for more than one third of the species. Meanwhile, the plots where the density exceeded 20 plants per square metre, were rare and represented, for the most abundant species (A. myosuroides, less than 16/ of the plots. The total number of weed species per plots varied from 4 to 65 with a median species number of 20. In most of the plots, the weed community was mainly composed of species having a small density (less than one plant per square metre and was dominated by only one or two species in half of the plots.
Directory of Open Access Journals (Sweden)
fatemeh abdolahi
2018-02-01
Full Text Available Introduction: The crop competitive ability is an important and profitable factor for increment impact on the weeds, and decreasing their yield loss. Characteristics such as height, leaf area, growth rate and tillering ability could be effective on competitive ability of cultivar ability. Primary growth rate is important on competitiveness, and any other factors that provides fast establishment of crops growth can be effective too. Thus, utilization of cultivars with height competitiveness ability is one of the considerable strategies for integrated weed managements. Many studies had shown that there are high correlation between crop height and its competitiveness ability. Asef et al (2 reported that tall cultivars reduced weed biomass more than dwarf cultivars due to light intercept and shading. Safahani- langrodi et al (32 in competition condition tall cultivars had high weed tolerance and cause to decrease weed biomass and set seed. There are an important relationship between LAI and weed competition. Hiffle et al. (13 showed cultivars with higher leaf area index had a greater yield stability. Dianat et al. (10 reported that in weed competitive conditions, there are significant difference in the number of tillers among wheat cultivars, while competitor and non-competitor cultivars have most and lowest tiller numbers respectively. Nadery and Ghadiri (25 showed that increasing wild mustard density decreased tiller number and more yield loss in weed competition have caused by decreased number of tillers. Materials and Methods: Experiment was conducted in order to study morphological characteristics and yield of wheat (T. aestivum cultivars in wild mustard (Sinapis arvensis L. competition in greenhouse, University of Mohaghegh Ardabili, during 2013-2014. Treatments were 18 wheat cultivars [Karkheh, Alborz, Azadi, Shahpasand, Sepahan, Flat, Ghods, Roshan, Sorkh¬tokhm, Moghan3, Alvand, MS-81-14, Yarvarus, Shahriyar, Golestn, Bam, Niknajad, Karaj3
Fei, Minghui; Gols, Rieta; Harvey, Jeffrey A
2014-01-01
Spatial-temporal realism is often missing in many studies of multitrophic interactions, which are conducted at a single time frame and/or involving interactions between insects with a single species of plant. In this scenario, an underlying assumption is that the host-plant species is ubiquitous throughout the season and that the insects always interact with it. We studied interactions involving three naturally occurring wild species of cruciferous plants, Brassica rapa, Sinapis arvensis and Brassica nigra, that exhibit different seasonal phenologies, and a multivoltine herbivore, the large cabbage white butterfly, Pieris brassicae, and its gregarious endoparasitoid wasp, Cotesia glomerata. The three plants have very short life cycles. In central Europe, B. rapa grows in early spring, S. arvensis in late spring and early summer, and B. nigra in mid to late summer. P. brassicae generally has three generations per year, and C. glomerata at least two. This means that different generations of the insects must find and exploit different plant species that may differ in quality and which may be found some distance from one another. Insects were either reared on each of the three plant species for three successive generations or shifted between generations from B. rapa to S. arvensis to B. nigra. Development time from neonate to pupation and pupal fresh mass were determined in P. brassicae and egg-to-adult development time and body mass in C. glomerata. Overall, herbivores performed marginally better on S. arvensis and B. nigra plants than on B. rapa plants. Parasitoids performance was closely tailored with that of the host. Irrespective as to whether the insects were shifted to a new plant in successive generations or not, development time of P. brassicae and C. glomerata decreased dramatically over time. Our results show that there were some differences in insect development on different plant species and when transferred from one species to another. However, all three
Directory of Open Access Journals (Sweden)
T. S. PEREIRA
2015-12-01
Full Text Available RESUMOO objetivo desse trabalho foi verificar o efeito do solo pré-cultivado com plantas aromáticas na germinação e no desenvolvimento inicial de plântulas de alface cv. Simpson. A pesquisa foi realizada na Embrapa Hortaliças, Brasília, em bandejas mantidas em casa de vegetação. O experimento foi conduzido em delineamento experimental inteiramente casualizado, com três repetições e onze tratamentos: solo pré-cultivado com hortelã-comum (Mentha x villosa, hortelã-brava (Mentha arvensis, hortelã-pimenta (Mentha piperita, Mentha spp., capim-citronela (Cymbopogon winterianus, capim-limão (Cymbopogon citratus, manjericão de folha larga (Ocimum basilicum, manjericão de folha roxa (Ocimum gratissimun, tomilho (Thymus vulgaris, sálvia (Salvia officinalis e solo da mesma área sem cultivo prévio de planta aromática (controle. Aos 30 dias após o semeio, foram avaliadas: índice de velocidade de emergência (IVE, taxa de sobrevivência (TS, número de folhas (NF, comprimento da raiz principal (CRP e da parte aérea (CPA, massa fresca da raiz (MFR e da parte aérea (MFPA e massa seca da raiz (MSR e da parte aérea (MSPA. Os dados foram submetidos à análise de variância e teste de Tukey a 5% de probabilidade. Houve diferença significativa em relação ao IVE, sendo que o tratamento com C. citratus afetou negativamente a emergência das plântulas. O tratamento com M. arvensis apresentou uma TS de apenas 16% das plantas aos 30 dias após a semeadura. O NF foi menor no tratamento com M. arvensis, diferentemente de todos os demais, exceto S. officinalis. A MRF e MFF foram estimuladas pelo tratamento com T. vulgaris sendo superior a todos os outros tratamentos. Os resultados obtidos permitem concluir que houve efeito negativo de M. arvensis e positivo de T. vulgaris no desenvolvimento inicial de plântulas de alface.
Lectotypification of three Iberian endemic species belonging to monotypic genera described by Cosson
Directory of Open Access Journals (Sweden)
Buira, Antoni
2015-12-01
Full Text Available Three lectotypes are here designated for Euzomodendron bourgaeanum Coss., Guiraoa arvensis Coss. and Laserpitium scabrum Cav. (Guillonea scabra (Cav. Coss., whose genera are monospecific and endemic to the Iberian Peninsula. The selected types of the two former species are kept at P and belong to Cosson’s personal herbarium, whilst the last one is kept at MA and belongs to the historical herbarium of Cavanilles.Se designan los lectótipos de Euzomodendron bourgaeanum Coss., Guiraoa arvensis Coss. y Laserpitium scabrum Cav. (Guillonea scabra (Cav. Coss., cuyos géneros son monoespecíficos y endémicos de la Península Ibérica. Los tipos seleccionados para las dos primeras especies se encuentran en P y pertenecen al herbario personal de Cosson, mientras que el de la última se encuentra en MA y pertenece al herbario histórico de Cavanilles.
Directory of Open Access Journals (Sweden)
Janusz Lipecki
2013-12-01
Full Text Available From 1993 to 1997 a study of spatial distribution of most important weeds in apple orchard herbicide strips was performed. This study was continued in 1998, once the trees were cut down. As the time progressed, Epilobium adenocaulon Hausskn., Chenopodium album L., Polygonum aviculare L. and Atriplex patulum L. showed an increase in their occurrence. An opposite tendency was found with Erigeron canadensis L., Convolvulus arvensis L. and Taraxacum fficinale Web. Some species grew in patches (Convolvulus arvensis L., Chenopodium album L., Atriplex patulum L., while the others appeared sporadically throughout the orchard. In 1998, the decrease of occurrence of Epilobium Haussk. was observed. Simultaneously, this was coupled with an increase of occurrence of Taraxacum officinale Web., Erigeron caanadensis L. and Chenopodium album L. The predominating species in 1998 was Cerastium vulgatum L., followed by Lolium perenne L., Poa annua L. and Bromus mollis L.
Segetal flora of cereal crop agrocenoses in the Suwałki Landscape Park
Directory of Open Access Journals (Sweden)
Matusiewicz Marta
2016-06-01
Full Text Available Segetal flora of cereal crop agrocenoses in the Suwałki Landscape Park was studied in between the years 2012 and 2013. One hundred phytosociological Braun-Blanquet releves were taken, documenting the occurrence of 152 species of vascular plants that represented 29 botanic families. Analysis of the contributions of geographic-historical groups revealed the dominance of the native species, apophytes (87 species, making 57.2%, over anthropophytes (65 species, 42.8%. The number of short-lived species was twice greater (103 species, 67.8% than the perennial ones (49 species, 32.2%. As regards the lifeforms, the therophytes were dominant (96 species, 63.2% over hemicryptophytes (44 species, 28.9% and geophytes (12 species, 7.9%. Among the species of segetal flora in the area studied, 23 valuable species classified to different categories of protection, were identified. The presence of Consolida regalis, Centaurea cyanus and Bromus secalinus, belonging to threatened species in other regions of Poland, was abundant. Also the species: Anthemis tinctoria, Echium vulgare and Anchusa officinalis were met with high frequency. The species: Agrostemma githago, Papaver argemone and Papaver dubium were represented by single plants, which can suggest their dying out. In the Park area, expansive species, threatening the biodiversity, such as Myosotis arvensis, Viola arvensis, Galeopsis tetraehit, Stellaria media, Artemisia vulgaris, Galinsoga parviflora, Elymus repens, Capsella bursa pastoris, Erodium cicutarium, Chamomilla recutita, Matricaria maritima subsp. inodora, Convolvulus arvensis, Polygonum persicaria, Polygonum lapathifolium subsp. pallidum and Polygonum lapathifolium subsp. lapathifolium, were commonly seen in the crop land.
1981-05-01
casts for iron ore within the GL/SLS region. A recent downturn in the economic health of the domestic steel industry has probably deferred any major...emergents: Swamp rose mallow Hibiscus palustris Nettle Urtica sp. Nightshade Solanum dulcamara Hedge bindweed Convolvulus sepium Peppermint Mentha arvensis
Nielsen, J.K.; Jong, de P.W.
2005-01-01
The flea beetle, Phyllotreta nemorum L. (Coleoptera: Chrysomelidae), is an intermediate specialist feeding on a small number of plants within the family Brassicaceae. The most commonly used host plant is Sinapis arvensis L., whereas the species is found more rarely on Cardaria draba (L.) Desv.,
Czech Academy of Sciences Publication Activity Database
Pavlíková, Z.; Holá, D.; Vlasáková, Blanka; Procházka, T.; Münzbergová, Zuzana
2017-01-01
Roč. 12, č. 11 (2017), s. 1-22, č. článku e0188795. E-ISSN 1932-6203 Institutional support: RVO:67985939 Keywords : Knautia arvensis * polyploid * stress conditions Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany Impact factor: 2.806, year: 2016
Development of new test procedures for measuring fine and coarse aggregates specific gravity.
2009-09-01
The objective of the research is to develop and evaluate new test methods at determining the specific gravity and absorption of both fine and coarse aggregates. Current methods at determining the specific gravity and absorption of fine and coarse agg...
M.H.F. Deutz (Marike); S.B. Geeraert (Sanne Barbara); A.L. Van Baar (Anneloes); M. Deković (Maja); P.J. Prinzie (Peter)
2016-01-01
textabstractRecently, a phenotype of severe dysregulation, the Dysregulation Profile (DP), has been identified. DP consists of elevated scores on the Anxious/Depressed (AD), Aggressive Behavior (AGG) and Attention Problems (AP) scales of the Child Behavior Checklist (CBCL), Teacher Report Form
1993-02-01
ROSACEAE Acaena californica: C-S, CPI Adenostoma fasciculctmm: CH-, CS, C-L Aichemilla arvensis: CP Fragaria vesca ssp. cabjfomica: NP, LO, M-LI Hetermeles...Thamnophis elegans * Western Aquatic Garter Snake T. couchi * Common Garter Snake T. sinalis * Western Rattlesnake Crotalus viridis TOTAL 22 8 3 3 BIRDS
Anti-inflammatory and Antinociceptive Effects of the Alcoholic Extract ...
African Journals Online (AJOL)
The alcoholic extract of Polygala arvensis (family Polygalaceae) was screened for antinociceptive and anti-inflammatory activities in experimental animals. The extract was administered for three consecutive days. Following an oral dose of 25 - 100 mg/kg, the extract exhibited graded dose response equivalent to 16.24% ...
Palyonological studies of the semi-desert plant species from Pakistan
African Journals Online (AJOL)
USER
2010-06-14
Jun 14, 2010 ... arvensis L., Salvia aegyptica, Melia azedarrach tetracolporate pollens were observed, in Carum copticum. (L.) Bth, the pollens were bicolpate; in Cynoglosum lanceolatum Forssk., it was fenestrate while in. Bougainvillea glabra Choisy., it was periporate. Thus, the present study was fruitful as it avoids the.
Genome to Phenome: A Systems Biology Approach to PTSD Using an Animal Model.
Chakraborty, Nabarun; Meyerhoff, James; Jett, Marti; Hammamieh, Rasha
2017-01-01
Post-traumatic stress disorder (PTSD) is a debilitating illness that imposes significant emotional and financial burdens on military families. The understanding of PTSD etiology remains elusive; nonetheless, it is clear that PTSD is manifested by a cluster of symptoms including hyperarousal, reexperiencing of traumatic events, and avoidance of trauma reminders. With these characteristics in mind, several rodent models have been developed eliciting PTSD-like features. Animal models with social dimensions are of particular interest, since the social context plays a major role in the development and manifestation of PTSD.For civilians, a core trauma that elicits PTSD might be characterized by a singular life-threatening event such as a car accident. In contrast, among war veterans, PTSD might be triggered by repeated threats and a cumulative psychological burden that coalesced in the combat zone. In capturing this fundamental difference, the aggressor-exposed social stress (Agg-E SS) model imposes highly threatening conspecific trauma on naïve mice repeatedly and randomly.There is abundant evidence that suggests the potential role of genetic contributions to risk factors for PTSD. Specific observations include putatively heritable attributes of the disorder, the cited cases of atypical brain morphology, and the observed neuroendocrine shifts away from normative. Taken together, these features underscore the importance of multi-omics investigations to develop a comprehensive picture. More daunting will be the task of downstream analysis with integration of these heterogeneous genotypic and phenotypic data types to deliver putative clinical biomarkers. Researchers are advocating for a systems biology approach, which has demonstrated an increasingly robust potential for integrating multidisciplinary data. By applying a systems biology approach here, we have connected the tissue-specific molecular perturbations to the behaviors displayed by mice subjected to Agg-E SS. A
Discovery of a cosmological, relativistic outburst via its rapidly fading optical emission
International Nuclear Information System (INIS)
Cenko, S. Bradley; Nugent, Peter E.; Miller, Adam A.; Bloom, Joshua S.; Filippenko, Alexei V.; Kulkarni, S. R.; Horesh, Assaf; Carpenter, John; Perley, Daniel A.; Groot, Paul J.; Hallinan, G.; Corsi, Alessandra; Fox, Derek B.; Frail, Dale A.; Gruber, D.; Rau, Arne; Gal-Yam, Avishay; Ofek, Eran O.; MacLeod, Chelsea L.; Kasliwal, Mansi M.
2013-01-01
We report the discovery by the Palomar Transient Factory (PTF) of the transient source PTF11agg, which is distinguished by three primary characteristics: (1) bright (R peak = 18.3 mag), rapidly fading (ΔR = 4 mag in Δt = 2 days) optical transient emission; (2) a faint (R = 26.2 ± 0.2 mag), blue (g' – R = 0.17 ± 0.29 mag) quiescent optical counterpart; and (3) an associated year-long, scintillating radio transient. We argue that these observed properties are inconsistent with any known class of Galactic transients (flare stars, X-ray binaries, dwarf novae), and instead suggest a cosmological origin. The detection of incoherent radio emission at such distances implies a large emitting region, from which we infer the presence of relativistic ejecta. The observed properties are all consistent with the population of long-duration gamma-ray bursts (GRBs), marking the first time such an outburst has been discovered in the distant universe independent of a high-energy trigger. We searched for possible high-energy counterparts to PTF11agg, but found no evidence for associated prompt emission. We therefore consider three possible scenarios to account for a GRB-like afterglow without a high-energy counterpart: an 'untriggered' GRB (lack of satellite coverage), an 'orphan' afterglow (viewing-angle effects), and a 'dirty fireball' (suppressed high-energy emission). The observed optical and radio light curves appear inconsistent with even the most basic predictions for off-axis afterglow models. The simplest explanation, then, is that PTF11agg is a normal, on-axis long-duration GRB for which the associated high-energy emission was simply missed. However, we have calculated the likelihood of such a serendipitous discovery by PTF and find that it is quite small (≈2.6%). While not definitive, we nonetheless speculate that PTF11agg may represent a new, more common (>4 times the on-axis GRB rate at 90% confidence) class of relativistic
Discovery of a cosmological, relativistic outburst via its rapidly fading optical emission
Energy Technology Data Exchange (ETDEWEB)
Cenko, S. Bradley; Nugent, Peter E.; Miller, Adam A.; Bloom, Joshua S.; Filippenko, Alexei V. [Department of Astronomy, University of California, Berkeley, CA 94720-3411 (United States); Kulkarni, S. R.; Horesh, Assaf; Carpenter, John; Perley, Daniel A.; Groot, Paul J.; Hallinan, G. [Cahill Center for Astrophysics, California Institute of Technology, Pasadena, CA 91125 (United States); Corsi, Alessandra [LIGO Laboratory, California Institute of Technology, MS 100-36, Pasadena, CA 91125 (United States); Fox, Derek B. [Department of Astronomy and Astrophysics, Pennsylvania State University, University Park, PA 16802 (United States); Frail, Dale A. [National Radio Astronomy Observatory, P.O. Box O, Socorro, NM 87801 (United States); Gruber, D.; Rau, Arne [Max Planck Institute for Extraterrestrial Physics, Giessenbachstrasse, Postfach 1312, D-85748 Garching (Germany); Gal-Yam, Avishay; Ofek, Eran O. [Benoziyo Center for Astrophysics, Weizmann Institute of Science, 76100 Rehovot (Israel); MacLeod, Chelsea L. [Physics Department, United States Naval Academy, 572c Holloway Road, Annapolis, MD 21402 (United States); Kasliwal, Mansi M., E-mail: cenko@astro.berkeley.edu [Observatories of the Carnegie Institution for Science, 813 Santa Barbara St., Pasadena, CA 91101 (United States); and others
2013-06-01
We report the discovery by the Palomar Transient Factory (PTF) of the transient source PTF11agg, which is distinguished by three primary characteristics: (1) bright (R {sub peak} = 18.3 mag), rapidly fading (ΔR = 4 mag in Δt = 2 days) optical transient emission; (2) a faint (R = 26.2 ± 0.2 mag), blue (g' – R = 0.17 ± 0.29 mag) quiescent optical counterpart; and (3) an associated year-long, scintillating radio transient. We argue that these observed properties are inconsistent with any known class of Galactic transients (flare stars, X-ray binaries, dwarf novae), and instead suggest a cosmological origin. The detection of incoherent radio emission at such distances implies a large emitting region, from which we infer the presence of relativistic ejecta. The observed properties are all consistent with the population of long-duration gamma-ray bursts (GRBs), marking the first time such an outburst has been discovered in the distant universe independent of a high-energy trigger. We searched for possible high-energy counterparts to PTF11agg, but found no evidence for associated prompt emission. We therefore consider three possible scenarios to account for a GRB-like afterglow without a high-energy counterpart: an 'untriggered' GRB (lack of satellite coverage), an 'orphan' afterglow (viewing-angle effects), and a 'dirty fireball' (suppressed high-energy emission). The observed optical and radio light curves appear inconsistent with even the most basic predictions for off-axis afterglow models. The simplest explanation, then, is that PTF11agg is a normal, on-axis long-duration GRB for which the associated high-energy emission was simply missed. However, we have calculated the likelihood of such a serendipitous discovery by PTF and find that it is quite small (≈2.6%). While not definitive, we nonetheless speculate that PTF11agg may represent a new, more common (>4 times the on-axis GRB rate at 90% confidence) class of relativistic
Premilinary Studies on Phytochemical Screening of Ulam and Fruit from Malaysia
Directory of Open Access Journals (Sweden)
Liliwirianis N.
2011-01-01
Full Text Available Alkaloids, saponins, steroid, terpenoid, flavonoids, phenolic distribution in 14 Malaysian favourite ulam and fruit belonging to different families were assessed and compared. The plants investigated were parkia speciosa (petai, solanum torvum (terung pipit, pithecellobium bubalinum (kerdas, moringa oleifera (kacang kelor, dryobalanops oblongifolia (keladan, cosmos caudatus (ulam raja, mentha arvensis (pudina, ocimum sp. (selasih, cymbopogon nardus (serai wangi, eugenia polyantha (serai kayu, Barringtonia scortechinii, (Putat, musa sp. (pisang, talinum paniculatum (akar som and phyllanthus acidus (cermai. Moringa oleifera leaf and dryobalanops oblongifolia fruit were found contain positive reactions of alkaloids. All the samples studied also show high content of saponin except in bark and seed of parkia speciosa and stem of phyllanthus acidus. Meanwhile, results of the phytochemical screening on saponins, steroids, terpenoids, phenolic and flavonoids showed that cosmos caudatus, ocimum sp., mentha arvensis, barringtonia scortechinii and moringa oleifera were the active compounds present in the leaves of the plant.
Weed flora in organically grown spring cereals in Finland
Directory of Open Access Journals (Sweden)
J. SALONEN
2008-12-01
Full Text Available The weed flora in organically grown spring cereals was investigated in southern and central Finland in 1997-1999 with the primary purpose of determining the species composition and the level of weed infestation. Altogether 165 fields were surveyed in the middle of the growing season. A total of 126 weed species were found, of which 42 exceeded the frequency level of 10%. The most frequent weed species were Chenopodium album, Stellaria media, Galeopsis spp. and Viola arvensis. Elymus repens was the most frequent grass species. The average density of weeds was 469 plants m-2 (median 395, and the air-dry biomass was 678 kg ha-1 (median 567 which accounted for 17% of the total biomass of the crop stand. Infestation by Chenopodium album and the perennial species Elymus repens, Cirsium arvense and Sonchus arvensis is of major concern. Weed control strategies should include direct control measures to overcome weed problems related to the conversion period from conventional to organic growing.
Waar, Karola; van der Mei, Henderina; Harmsen, Hermie JM; de Vries, Jacob; Atema-Smit, Jelly; Degener, John E; Busscher, Hendrik
Enterococcus faecalis is one of the leading causes of hospital-acquired infections, and indwelling medical devices are especially prone to infection. E faecalis expressing aggregation substance (Agg) adheres to biomaterial surfaces by means of positive cooperativity, i.e. the ability of one adhering
Althoff, R.; Rettew, D.C.; Faraone, S.V.; Boomsma, D.I.; Hudziak, J.
2006-01-01
Background: The Child Behavior Checklist (CBCL) has been used to provide a quantitative description of childhood bipolar disorder (BPAD). Many have reported that children in the clinical range on the Attention Problems (AP), Aggressive Behavior (AGG), and Anxious-Depressed (A/D) syndromes
Deutz, Marike; Geeraerts, Sanne; van Baar, Anneloes; Dekovic, Maja; Prinzie, Peter
2016-01-01
Recently, a phenotype of severe dysregulation, the Dysregulation Profile (DP), has been identified. DP consists of elevated scores on the Anxious/Depressed (AD), Aggressive Behavior (AGG) and Attention Problems (AP) scales of the Child Behavior Checklist (CBCL), Teacher Report Form (TRF), or Youth
Indian Academy of Sciences (India)
mukesh
, GGT, CCC, TCT, GGC, CAG, TAC, ACC, CAG, GAA, TTT, GAT, GGA, GAC, GAG, ATG, TTT, TAT, GTG, GAC, CTG, GGG, AAG, AAG, GAG, ACT, GTC, TGG, AGG, CTG, CCT, ATG, TTT, AGC, CAG, TTT, GCA, GGT, TTT, GAC, CCA, CAG, GCT ...
Effects of selective serotonin antagonism on central neurotransmission
Serotonergic and dopaminergic mediation of aggression has been evidenced in numerous studies. However, these studies have met with varying and sometimes conflicting results. Here we test the hypothesis that hens with genetic propensity for high and low aggressiveness exhibit distinctly different agg...
Enteroaggregative Escherichia coli O78:H10, the cause of an outbreak of urinary tract infection
DEFF Research Database (Denmark)
Olesen, Bente; Scheutz, Flemming; Andersen, Rebecca L
2012-01-01
to these traits and resistance profiles, are unknown. Accordingly, we extensively characterized 51 archived E. coli O78:H10 isolates (48 human isolates from seven countries, including 19 Copenhagen outbreak isolates, and 1 each of calf, avian, and unknown-source isolates), collected from 1956 through 2000. E...... by molecular methods as enteroaggregative E. coli (EAEC) (P 90% of outbreak isolates included fimH (type 1 fimbriae; ubiquitous in E. coli); fyuA, traT, and iutA (associated with extraintestinal pathogenic E. coli [ExPEC]); and sat, pic, aatA, aggR, aggA, ORF61, aaiC, aap, and ORF3......In 1991, multiresistant Escherichia coli O78:H10 strains caused an outbreak of urinary tract infections in Copenhagen, Denmark. The phylogenetic origin, clonal background, and virulence characteristics of the outbreak isolates, and their relationship to nonoutbreak O78:H10 strains according...
Müller, Holger S. P.; Christen, Dines
2004-12-01
The rotation-tunneling spectrum of the second most stable gGg' conformer of ethylene glycol (1,2-ethanediol) in its ground vibrational state has been studied in selected regions between 77 and 579 GHz. Compared to the study of the more stable aGg' conformer, a much larger frequency range was studied, resulting in a much extended frequency list covering similar quantum numbers, J⩽55 and Ka⩽19. While the input data were reproduced within experimental uncertainties up to moderately high values of J and Ka larger residuals remain at higher quantum numbers. The severe mixing of the states caused by the Coriolis interaction between the two tunneling substates is suggested to provide a considerable part of the explanation. In addition, a Coriolis interaction of the gGg' ground vibrational state with an excited state of the aGg' conformer may also contribute. Relative intensities of closely spaced lines have been investigated to determine the signs of the Coriolis constants between the two tunneling substates relative to the dipole moment components and to estimate the magnitudes of the dipole moment components and the energy difference between the gGg' and the aGg' conformers. Results of ab initio calculations on the total dipole moment and the vibrational spectrum were needed for these estimates. The current analysis is limited to transitions with quantum numbers J⩽40 and Ka⩽6 plus those having J⩽22 and Ka⩽17 which could be reproduced within experimental uncertainties. The results are aimed at aiding radioastronomers to search for gGg' ethylene glycol in comets and in interstellar space.
Palyonological studies of the semi-desert plant species from Pakistan
African Journals Online (AJOL)
In case of Calendula arvensis L., Salvia aegyptica, Melia azedarrach tetracolporate pollens were observed, in Carum copticum (L.) Bth, the pollens were bicolpate; in Cynoglosum lanceolatum Forssk., it was fenestrate while in Bougainvillea glabra Choisy., it was periporate. Thus, the present study was fruitful as it avoids the ...
Tropical Journal of Pharmaceutical Research - Vol 14, No 11 (2015)
African Journals Online (AJOL)
Antibacterial Activity and Mode of Action of Mentha arvensis Ethanol Extract against Multidrug-Resistant Acinetobacter baumannii · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Ling Zhang, Shu-gen Xu, Wei Liang, Jun Mei, Yue-ying Di, Hui-hua Lan, Yan Yang, ...
Gugole Ottaviano, María F; Cédola, Claudia V; Sánchez, Norma E; Greco, Nancy M
2015-12-01
Wild vegetation surrounding crops may provide temporary habitat and potential food sources for phytoseiids in different seasons. Monthly vegetation samples of wild plants adjacent to strawberry plants and wild plants in a vegetation strip close to the crop were taken. The frequency of Neoseiulus californicus, Tetranychus urticae and other mites and insects was recorded. In addition, in a laboratory assay, the survival, developmental time and fecundity of females fed on pollen of strawberry and pollen of wild plants where N. californicus was recorded during their flowering, were estimated. Pollen from Urtica urens, Lamium amplexicaule, Convolvulus arvensis, Sonchus oleraceous, Galega officinalis, and Fragaria x ananassa (strawberry) allowed development of N. californicus to adult, but not reproduction. Survival was 70-80 % when fed on pollen from S. oleraceus, G. officinalis and C. arvensis, 80-90 % when fed on pollen from U. urens and F. x ananassa, and more than 90 % when fed on T. urticae and on pollen from L. amplexicaule. In autumn and winter, U. urens, L. amplexicaule and S. oleraceous could promote the persistence of N. californicus when prey density in strawberry is low, offering T. urticae, thrips and pollen. In summer, pollen of C. arvensis and G. officinalis would contribute to the persistence of N. californicus when the strawberry crop is ending and offers scarce food resources. Although the pollen of these plants would not enable the predator population to increase, the presence of these plants in the vicinity of strawberry could contribute to the persistence of N. californicus population and help to limit T. urticae growth when this pest begins to colonize the crop.
African Journals Online (AJOL)
SERVER
2008-03-04
Mar 4, 2008 ... protein SPAM1, (or PH-20), located on both the plasma membrane ... binding to the egg plasma membrane. .... tct gct tct aca aac tga cag agg cac g. 72 ..... Eller CD, Regelson M, Merriman B, Nelson S, Horvath S, Marahrens Y.
Directory of Open Access Journals (Sweden)
Malek Besbes Hlila
2017-11-01
Full Text Available Objective: To determine the larvicidal activity of sixteen extracts of Scabiosa arenaria Forssk. (S. arenaria against the third instar larvae of Culex pipiens L. (C. pipiens. Methods: Larvicidal activity of S. arenaria extracts was determined according to World Health Organization. Twenty third instars of the C. pipiens were exposed to different concentrations (15 µg/mL to 60 µg/mL of extracts. Mortality was recorded after 24 h of exposure. Results: The roots ethyl acetate fraction of S. arenaria had a significant toxic effect on larvae of C. pipiens, with high mortality percentage (100.0% ± 2.2% at 60 µg/mL, and 50% lethal concentration value of LC50 = (15.00 ± 0.09 µg/mL. Conclusions: Results show that roots ethyl acetate could be used for the production of natural bio-pesticides which could decrease our dependence on chemical pesticides.
Effect of solarization and vesicular arbuscular mychorrizal on weed ...
African Journals Online (AJOL)
mustard (Sinapsis arvensis L.) as observed in the experiment because mustrad has no symbiosis life with this fungus. Also the laboratory findings supported this; the number of spores, number of VAM infected and infection rate were higher both in main parcel of solarized and in the subplot parcel planted with VAM ...
Cytotaxonomic studies in the genus Mentha in the Netherlands
Ouweneel, W.J.
1968-01-01
1) 148 Dutch mints were assembled, partly from botanical gardens and partly from 12 sources throughout the country, and were cytologically investigated. 2) New chromosome numbers were found for M. arvensis (2n=24) and for M.x dumetorum (2n=72), and fourteen counts were in agreement with the
Caracterización química y propiedades bioactivas de hongos silvestres portugeses comestibles
Barros, Lillian Bouçada de
2008-01-01
Nineteen different mushroom species (Agaricus arvensis, Agaricus bisporus, Agaricusromagnesii, Agaricus silvaticus, Agaricus silvicola, Cantharellus cibarius, Hypholomafasciculare, Lactarius deliciosus, Lactarius piperatus, Lepista nuda, Leucopaxillusgiganteus, Lycoperdon molle, Lycoperdon perlatum, Macrolepiota mastoidea,Macrolepiota procera, Ramaria botrytis, Sarcodon imbricatus, Tricholoma acerbum and Tricholoma portentosum) from Northeast of Portugal, one of the European regions with high...
Het geslacht Alchemilla in Nederland
Jaspars-Schrader, T.W.
1983-01-01
Fifty years ago Kloos (1933) described the species of the Alchemilla vulgaris i agg. for the Netherlands. He based his work on a publication by Lindberg (1908). Since then much more material of the genus was collected and several comprehensive treatments of it have appeared in neighbouring
Kuster, M.; Cebrian, S.; Davenport, M.; Elefteriadis, C.; Englhauser, J.; Fischer, H.; Franz, J.; Friedrich, P.; Hartmann, R.; Heinsius, F.H.; Hoffmann, D.H.H.; Hoffmeister, G.; Joux, J.N.; Kang, D.; Konigsmann, Kay; Kotthaus, R.; Papaevangelou, T.; Lasseur, C.; Lippitsch, A.; Lutz, G.; Morales, J.; Rodriguez, A.; Struder, L.; Vogel, J.; Zioutas, K.
2007-01-01
The Cern Axion Solar Telescope (CAST) is in operation and taking data since 2003. The main objective of the CAST experiment is to search for a hypothetical pseudoscalar boson, the axion, which might be produced in the core of the sun. The basic physics process CAST is based on is the time inverted Primakoff effect, by which an axion can be converted into a detectable photon in an external electromagnetic field. The resulting X-ray photons are expected to be thermally distributed between 1 and 7 keV. The most sensitive detector system of CAST is a pn-CCD detector combined with a Wolter I type X-ray mirror system. With the X-ray telescope of CAST a background reduction of more than 2 orders off magnitude is achieved, such that for the first time the axion photon coupling constant g_agg can be probed beyond the best astrophysical constraints g_agg < 1 x 10^-10 GeV^-1.
Cennimo, David; Abbas, Atif; Huang, David B; Chiang, Tom
2009-04-01
This case-control study examined the prevalence of enteroaggregative Escherichia coli (EAEC), its genes and elicited inflammatory response, and the stool characteristics of adult patients with and without acute diarrhoeal illness presenting to an urgent-care clinic in the USA. A total of 1004 individual stool specimens (253 from patients with acute diarrhoeal illness and 751 from patients without diarrhoeal illness) were collected between 1 June 2003 and 30 June 2008. EAEC was identified as the sole cause of acute diarrhoeal illness in 6 % (n=15) of patients and in 2 % (n=15) without diarrhoeal illness. Control patients (n=15) were similar to case patients (n=15) for age, gender and co-morbidities. The EAEC genes aggR, aap, aat, astA and/or set1A were identified more frequently in case patients compared with control patients (P clinic in the USA and suggest that aggR, aap, aatA, astA and set1A may be markers for virulence.
Comparative cytogenetic analysis of diploid and hexaploid Chenopodium album Agg
Directory of Open Access Journals (Sweden)
Bożena Kolano
2011-01-01
Full Text Available Two cytotypes of Chenopodium album, diploid (2n=2x=18 and hexaploid (2n=6x=54, were analysed using flow cytometry and a FISH experiment. The genome size was indicated as 1.795 pg for the diploid and 3.845 pg for the hexaploid plants which suggested genome downsizing in the evolution of hexaploid cytotype. Double FISH with 25S rDNA and 5S rDNA allowed three to five homologue chromosome pairs to be distinguished depending on the cytotype. The Variation in size and number of rDNA sites between the polyploid C. album and its putative diploid ancestor indicated that rDNA loci underwent rearrangements after polyploidization. Flow cytometry measurements of the relative nuclear DNA content in the somatic tissue of C. album revealed extensive endopolyploidization resulting in tissues comprising a mixture of cells with a different DNA content (from 2C to 32C in varying proportions. The pattern of endopolyploidy was characteristic for the developmental stage of the plant and for the individual organ. Polysomaty was not observed in the embryo tissues however endopolyploidization had taken place in most tested organs of seedlings. The endopolyploidy in diploid and hexaploid C. album was compared to find any relationship between the pattern of polysomaty and polyploidy level in this species. This revealed that polyploid plants showed a decline in the number of endocycles as well as in the frequency of endopolyploidy cells compared to diploid plants.
Towards the biocontrol of bindweeds with a mycoherbicide
Czech Academy of Sciences Publication Activity Database
Défago, G.; Ammon, H. U.; Cagán, L.; Draeger, B.; Greaves, M. P.; Guntli, D.; Hoeke, D.; Klimeš, Leoš; Lawrie, J.; Moenne-Loccoz, Y.; Nicolet, B.; Pfirter, H. A.; Tabacchi, R.; Tóth, P.
2001-01-01
Roč. 46, - (2001), s. 157-173 ISSN 1386-6141 R&D Projects: GA AV ČR KSK6005114 Institutional research plan: CEZ:AV0Z6005908 Keywords : calystegines * DNA maker * integrated weed management system * living mulch * phytotoxins * Calystegia sepium * Convolvulus arvensis Subject RIV: EF - Botanics Impact factor: 0.857, year: 2001
Absolute configuration of alpha- and beta-pinene in essential oils of two Nigella species
Czech Academy of Sciences Publication Activity Database
Valterová, Irena; Klouček, P.; Kokoška, L.
2009-01-01
Roč. 75, č. 9 (2009), s. 1020-1020 ISSN 0032-0943. [International Congress and Annual Meeting of the Society for Medicinal Plant and Natural Product Research /57./. 16.08.2009-20.08.2009, Geneva] Institutional research plan: CEZ:AV0Z40550506 Keywords : Ranunculaceae * monoterpenes * Nigella nigellastrum * Nigella arvensis Subject RIV: CC - Organic Chemistry
African Journals Online (AJOL)
Items 201 - 250 of 2037 ... Vol 14, No 11 (2015), Antibacterial Activity and Mode of Action of Mentha arvensis Ethanol Extract against Multidrug-Resistant Acinetobacter baumannii, Abstract PDF. Ling Zhang, Shu-gen Xu, Wei Liang, Jun Mei, Yue-ying Di, Hui-hua Lan, Yan Yang, Wei-wei Wang, Yuan-yuan Luo, Hou-zhao Wang.
on Lymphoblastic Leukemia Jurkat Cells
African Journals Online (AJOL)
human tumor cell line (Hela) by using MTT assay. [13]. In the present study, we have observed the cytotoxic effect of ethanolic extract of C. arvensis against Jurkat cells, a human lymphoblastic leukemia cell line, by using Trypan blue, MTS assay and FACS analysis. It was shown from the trypan blue exclusion assay that ...
Chapman, C E; Hill, T M; Elder, D R; Erickson, P S
2017-01-01
Studies have shown that calves fed milk replacers (MR) with crude protein (CP) concentrations greater than 20%, as typically found in conventional MR, have higher dry matter intakes (DMI) and greater average daily gains (ADG) but consume less starter, which can lead to stress during weaning and reduced rumen development. The greater amount of CP being fed to preweaned calves may alter their nitrogen (N) balance, and excess N may be excreted in the urine. The objective of this study was to determine N utilization in preweaned calves fed diets varying in the amount of CP and MR fed. This study used 24 newborn dairy heifer calves blocked by birth and randomly assigned to 1 of 3 treatments: (1) 446g dry matter (DM) of a conventional MR (CON; 20% CP, 20% fat), (2) 669g DM of a moderately high protein MR (moderate; MOD; 26% CP, 18% fat), or (3) 892g DM of a moderately high protein MR (aggressive; AGG; 26% CP, 18% fat). All calves had ad libitum access to starter and water. Both MR and starter were medicated with decoquinate. During weaning (d 43-49), the morning MR feeding ceased. On d 50, all MR feedings ended; however, starter and water intakes were continuously recorded until d 56. At 5wk of age, urine was collected using urinary catheters for 3d and chromium oxide was administered by bolus at 2g/d for 7d to estimate N efficiency. Calves fed MOD and AGG had similar starter intakes, feed efficiencies, and ADG, with the combined treatments having reduced starter intakes (258 vs. 537g/d), greater ADG (674 vs. 422g/d), and improved feed efficiency (0.57 vs. 0.45 gain:feed) compared with CON calves preweaning. However, DMI and water intake were similar across all treatments. Results from the N utilization phase showed that MOD and AGG treatments had similar but lower N efficiency compared with CON calves (45.5 vs. 52.7%). This could be due to MOD- and AGG-fed calves having greater urine volume and thereby, greater combined urine N output compared with CON calves (17.6 vs
Alu'datt, Muhammad H; Rababah, Taha; Alhamad, Mohammad N; Alodat, Moh'd; Al-Mahasneh, Majdi A; Gammoh, Sana; Ereifej, Khalil; Almajwal, Ali; Kubow, Stan
2017-09-01
This study aimed to investigate the molecular and bio-functional properties of protein fractions from Nigella damascena and Nigella arvensis, including the albumin, globulin, glutein-1, glutein-2 and prolamin fractions. Protein subunits were not observed in globulin and prolamin fractions. No peaks appeared in RP-HPLC chromatograms of globulin for either species. Two predominant peaks were observed in the RP-HPLC profiles of all protein fractions. Proteins separated by RP-HPLC have potential inhibitory and antioxidant activities in all fractions. Optimum ACE-inhibitory and antioxidant activities of proteins separated by RP-HPLC were observed in glutein-2 and albumin, respectively, for both species. For pepsin and combined pepsin-trypsin hydrolyses, the highest degree of hydrolysis (DH) was obtained in glutein-2 fraction of Nigella arvensis. Highest ACE-inhibitory activity of hydrolyzed protein fractions was found at 4h via pepsin hydrolysis in globulin fraction of Nigella damascena. Highest antioxidant activities of hydrolyzed protein fractions were found in glutelin-2 for both species. Copyright © 2017 Elsevier Ltd. All rights reserved.
Localization of oestrogen hormone receptors in the reproductive ...
African Journals Online (AJOL)
Primers sequence used were the forward and reverse β oestrogen primer which was designed to detect the expression of the gene encoding oestrogen receptor in the reproductive tract of the giant African Land Snail (Archachatina marginata) were: Forward: 5'-GCT TCG AGC TCA GCC TG-3' Reverse: 5'-AGG ATC ATG ...
Composition of gypsum from the Koběřice quarry (Czech Republic)
Czech Academy of Sciences Publication Activity Database
Konečný, Pavel; Plevová, Eva; Vaculíková, Lenka; Kožušníková, Alena; Peterková, J.; Hundáková, M.
2011-01-01
Roč. 8, č. 2 (2011), s. 145-156 ISSN 1214-9705 Institutional research plan: CEZ:AV0Z30860518 Keywords : gypsum * Kobeřice quarry * spectroscopy Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.530, year: 2011 http://www.irsm.cas.cz/abstracts/AGG/02_11/5_Konecny.pdf
Czech Academy of Sciences Publication Activity Database
Žežulka, Václav; Straka, Pavel
2011-01-01
Roč. 8, č. 1 (2011), s. 89-97 ISSN 1214-9705 Institutional research plan: CEZ:AV0Z30460519 Keywords : magnetic separation * magnetic separators * magnetic circuits Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.530, year: 2011 http://www.irsm.cas.cz/abstracts/AGG/01_11/8_Zezulka.pdf
Czech Academy of Sciences Publication Activity Database
Štrunc, Jaroslav; Brož, Milan
2011-01-01
Roč. 8, č. 4 (2011), s. 469-477 ISSN 1214-9705 Institutional research plan: CEZ:AV0Z30460519 Keywords : weak earthquakes * seismic array * small aperture Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 0.530, year: 2011 http://www.irsm.cas.cz/abstracts/AGG/04_11/8_Strunc.pdf
Czech Academy of Sciences Publication Activity Database
Gosar, A.; Šebela, S.; Košťák, Blahoslav; Stemberk, Josef
2011-01-01
Roč. 8, č. 4 (2011), s. 389-402 ISSN 1214-9705 Institutional research plan: CEZ:AV0Z30460519 Keywords : geodynamics * TM 71 extensometer * micro-tectonic displacements Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 0.530, year: 2011 http://www.irsm.cas.cz/abstracts/AGG/04_11/2_Gosar.pdf
Akagi, Takami; Piyapakorn, Phassamon; Akashi, Mitsuru
2012-03-20
Amphiphilic block or graft copolymers have been demonstrated to form a variety of self-assembled nano/microstructures in selective solvents. In this study, the self-association behavior of biodegradable graft copolymers composed of poly(γ-glutamic acid) (γ-PGA) as the hydrophilic segment and L-phenylalanine (Phe) as the hydrophobic segment in aqueous solution was investigated. The association behavior and unimer nanoparticle formation of these γ-PGA-graft-Phe (γ-PGA-Phe) copolymers in aqueous solution were characterized with a focus on the effect of the Phe grafting degree on the intra- and interpolymer association of γ-PGA-Phe. The particle size and number of polymer aggregates (N(agg)) in one particle of the γ-PGA-Phe depended on the Phe grafting degree. The size of γ-PGA-Phe with 12, 27, 35, or 42% Phe grafting (γ-PGA-Phe-12, -27, -35, or -42) was about 8-14 nm and the N(agg) was about 1, supporting the presence of a unimolecular graft copolymer in PBS. The pyrene fluorescence data indicated that γ-PGA-Phe-35 and -42 have hydrophobic domains formed by the intrapolymer association of Phe attached to γ-PGA. These results suggest that the Phe grafting degree is critical to the association behavior of γ-PGA-Phe and that γ-PGA-Phe-35 and -42 could form unimer nanoparticles. Moreover, when γ-PGA-Phe-42 dissolved in DMSO was added to various concentrations of NaCl solution, the particle size and N(agg) could be easily controlled by changing the NaCl concentration during the formation of the particles. These results suggest that biodegradable γ-PGA-Phe is useful for the fabrication of very small nanoparticles. It is expected that γ-PGA-Phe nanoparticles, including unimer particles, will have great potential as multifunctional carriers for pharmaceutical and biomedical applications, such as drug and vaccine delivery systems.
Ag on Ge(111): 2D x-ray structure analysis of the #sq root#3 x #sq root#3 superstructure
DEFF Research Database (Denmark)
Dornisch, D.; Moritz, W.; Schulz, H.
1992-01-01
We have studied the Ag/Ge(111) square-root 3 x square-root 3 superstructure by grazing-incidence X-ray diffraction. In our structural analysis we find striking similarities to the geometry of Au on Si(111). The Ag atoms form trimer clusters with an Ag-Ag distance of 2.94 +/- 0.04 angstrom...
DEFF Research Database (Denmark)
Ramskov, Tina; Forbes, Valery E; Gilliland, Douglas
2015-01-01
are in high demand. Here, we examine the effects of exposure to sediment mixed with either aqueous Ag (administered as AgNO3) or Ag NPs (13 nm, citrate-capped) at a nominal exposure concentration of 100 μg Ag/g dry weight sediment on four benthic invertebrates: two clones of the gastropod Potamopyrgus...
DEFF Research Database (Denmark)
Plesner, Bitten; Westh, Peter; Hvidt, Søren
2011-01-01
The effects of calcium chloride on the structural, kinetic and thermal stability of recombinant human factor VIIa (rFVIIa) were investigated using rFVIIa and two GlycoPEGylated recombinant human FVIIa derivatives, a linear 10 kDa PEG and a branched 40 kDa PEG, respectively. Three different CaCl(2......) concentrations were used: 10mM, 35 mM and 100mM. The secondary structure and tertiary structure of rFVIIa at 25C, measured by circular dichroism (CD), were maintained upon GlycoPEGylation as well as CaCl(2) content. In contrast, the thermal stability of the three rFVIIa compounds, measured by differential......FVIIa, whereas the concentration of CaCl(2) has to be raised to 100mM in order to see the same effect on the GlycoPEGylated rFVIIa compounds. The temperature of aggregation of rFVIIa, T(agg), increased as the CaCl(2) concentration increased from 35 mM to 100 mM, while T(agg) for the GlycoPEGylated r...
Long-term development of seismic monitoring networks in the Ostrava-Karviná coal mine district
Czech Academy of Sciences Publication Activity Database
Holub, Karel; Holečko, J.; Rušajová, Jana; Dombková, Anna
2012-01-01
Roč. 166, č. 2 (2012), s. 115-132 ISSN 1214-9705 Institutional research plan: CEZ:AV0Z30860518 Keywords : Ostrava _Karviná Coal Basin * seismoacoustic and seismological monitoring * geomechanical service Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 0.530, year: 2011 http://www.irsm.cas.cz/abstracts/AGG/02_12/1_Holub.pdf
Czech Academy of Sciences Publication Activity Database
Sitek, Libor; Bodnárová, L.; Souček, Kamil; Staš, Lubomír; Gurková, Lucie
2015-01-01
Roč. 12, č. 1 (2015), s. 78-89 ISSN 1214-9705 R&D Projects: GA ČR GAP104/12/1988 Institutional support: RVO:68145535 Keywords : concrete * cement paste * aggregate * high temperature Subject RIV: JQ - Machines ; Tools Impact factor: 0.561, year: 2015 https://www.irsm.cas.cz/materialy/acta_content/2015_doi/Sitek_AGG_2015_0009.pdf
Czech Academy of Sciences Publication Activity Database
Hartvich, Filip; Valenta, Jan
2011-01-01
Roč. 8, č. 4 (2011), s. 425-441 ISSN 1214-9705 R&D Projects: GA AV ČR KJB300460803 Institutional research plan: CEZ:AV0Z30460519 Keywords : geophysical profiling * morphostructural analysis * cave Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.530, year: 2011 http://www.irsm.cas.cz/abstracts/AGG/04_11/5_Hartvich.pdf
Indian Academy of Sciences (India)
mukesh
2, GAC, CAC, ATT, GGC, ACC, TAT, GGC, GTA, AGC, TTC, TAC, CAC, TCT, TAT, GGT, CCC, TCT, GGC, TAC, TAT, ATC, CAT, GAA, TTT, GAT, GGA, GAT, GAA, GAG, TTT, TAT, GTG, GAC, CTG, GAG, AAG, AGG, GAG, ACT, GTC, TGG, CAT, CTG, CCT, GTG, TTT, AGT, GAA, TTT, GCA, AGT, TTT, GAC, CCT, CAG, GAT, GGG ...
Geodynamic risk zone at northern part of the Boskovice Furrow
Czech Academy of Sciences Publication Activity Database
Pospíšil, L.; Švábenský, O.; Roštínský, Pavel; Nováková, Eva; Weigel, J.
2017-01-01
Roč. 14, č. 1 (2017), s. 113-129 ISSN 1214-9705 Institutional support: RVO:68145535 Keywords : Boskovice Furrow * Nectava – Konice Fault * horizontal and vertical velocities Subject RIV: DE - Earth Magnetism, Geodesy, Geography OBOR OECD: Geology Impact factor: 0.699, year: 2016 https://www.irsm.cas.cz/materialy/acta_content/2016_doi/Pospisil_AGG_2016_0033.pdf
Quadruplex-forming properties of FRAXA (CGG) repeats interrupted by (AGG) triplets
Czech Academy of Sciences Publication Activity Database
Renčiuk, Daniel; Zemánek, Michal; Kejnovská, Iva; Vorlíčková, Michaela
2009-01-01
Roč. 91, č. 3 (2009), s. 416-422 ISSN 0300-9084 R&D Projects: GA ČR(CZ) GA204/07/0057; GA AV ČR(CZ) IAA100040701 Institutional research plan: CEZ:AV0Z50040507; CEZ:AV0Z50040702 Keywords : fragile X-chromosome * quadruplex * CD spectroscopy Subject RIV: BO - Biophysics Impact factor: 3.897, year: 2009
Directory of Open Access Journals (Sweden)
Teófilo Herrera
2006-06-01
Full Text Available Se citan 8 especies de macromicetos recolectados en el área poniente de la Reserva Ecológica del Pedregal de San Ángel, D.F., México, de las cuales 5 son lignícolas y 3 humícolas, Se desarrollan a la sombra y entre hojarasca de plantas superiores. Entre los agaricales la familia Agaricaceae es la mejor representada. Se citan por primera vez en la micobiota del Pedregal de San Ángel: Gymnopus confluens, Agrocybe pediades, Agaricus arvensis y A. silvaticus, Setchelliogaster rheophyllus y Coprinus truncorumse citan por primera vez para México.Eight species of macromycetes were collected from the Ecological Reserve of the Pedregal de San Angel D.F. Mexico. Five of them are lignicolous, and 3 are humicolous developing under the shade of trees and among the litter of vascular plants. In the Agaricales the family Agaricaceae is the best represented. Gymnopus confluens, Agrocybe pediades, Agaricus arvensis and A. silvaticus, are first records in the mycobiota of the Pedregal de San Ángel. Setchelliogaster rheophyllus and Coprinus truncorum first records for Mexico are presented in this paper.
International Nuclear Information System (INIS)
Fielitz, U.
2001-01-01
Since 1988, within the scope of several research projects, in 7,000 samples of soil, plants, mushrooms and game from forest ecosystems, the 137 Cs activity concentration was measured, in order to investigate the dynamics of the nuclide. The investigation sites are a spruce mountain forest near the village Bodenmais (Bavaria) and an oak forest close to Fuhrberg (Lower Saxony). In both forests, unfavourable location conditions cause a relativ high transfer of 137 Cs into plants and game. Typifying for the 3 forest sites was the high intra- and interspecies variablilty of the 137 Cs activity concentration. Even 14 years after the Chernobyl-fallout at the 3 investigation sites, the average 137 Cs inventory, contained in the top 10 cm of soil was 56% and 93% in the top 20 cm. From 1987 till 1994, in the leaves of the investigated plant species the 137 Cs activity concentration decreased significant, during the following years there was little change. The effective half life of 137 Cs varies between -3 years for raspberry and -24 years for the fern Pteridium aquillinum, whereas most of the plant species show half lifes of about -5 years. In 2000, as usual mushrooms from the Bodenmais investigation site showed the highest 137 Cs contaminations. The aggregated transfer factors (T agg ) for soil → plant and soil → flesh varied with several orders of magnitude. T agg values for Soil → autotroph plant species reached from 0,0001 m 2 .kg -1 to 0,41 m 2 .kg -1 . While at the permanent study plots in Bodenmais and Fuhrberg the T agg values were of comparable quantity, at Goettingen, they were lower than two orders of magnitude. For example T agg for Cs-137 in wild boar from Bodenmais was 392 times higher than for wild boar from Goettingen. From 1987 till 2000, the 137 Cs activity in roe-deer from Bodenmais varied according to the seasons, with highest values in autumn, and lowest values in spring. In consequence of the decrease of the 137 Cs activity concentration in
Energy Technology Data Exchange (ETDEWEB)
Wick, Carson A.; McClellan, James H. [School of Electrical and Computer Engineering, Georgia Institute of Technology, 777 Atlantic Drive Northwest, Atlanta, Georgia 30332 (United States); Arepalli, Chesnal D. [Department of Radiology, University of British Columbia, 3350-950 West 10th Avenue, Vancouver, British Columbia V5Z 4E3 (Canada); Auffermann, William F.; Henry, Travis S. [Department of Radiology and Imaging Sciences, Emory University, Division of Cardiothoracic Imaging, 1364 Clifton Road Northeast, Suite 309, Atlanta, Georgia 30322 (United States); Khosa, Faisal [Department of Radiology and Imaging Sciences, Emory University, Division of Emergency Radiology, 550 Peachtree Street Northeast, Atlanta, Georgia 30308 (United States); Coy, Adam M. [School of Medicine, Emory University, 100 Woodruff Circle, Atlanta, Georgia 30322 (United States); Tridandapani, Srini, E-mail: stridan@emory.edu [Department of Radiology and Imaging Sciences, Emory University, Winship Cancer Institute, 1701 Uppergate Drive Northeast, Suite 5018, Atlanta, Georgia 30322 and School of Electrical and Computer Engineering, Georgia Institute of Technology, 777 Atlantic Drive Northwest, Atlanta, Georgia 30332 (United States)
2015-02-15
Purpose: Accurate knowledge of cardiac quiescence is crucial to the performance of many cardiac imaging modalities, including computed tomography coronary angiography (CTCA). To accurately quantify quiescence, a method for detecting the quiescent periods of the heart from retrospective cardiac computed tomography (CT) using a correlation-based, phase-to-phase deviation measure was developed. Methods: Retrospective cardiac CT data were obtained from 20 patients (11 male, 9 female, 33–74 yr) and the left main, left anterior descending, left circumflex, right coronary artery (RCA), and interventricular septum (IVS) were segmented for each phase using a semiautomated technique. Cardiac motion of individual coronary vessels as well as the IVS was calculated using phase-to-phase deviation. As an easily identifiable feature, the IVS was analyzed to assess how well it predicts vessel quiescence. Finally, the diagnostic quality of the reconstructed volumes from the quiescent phases determined using the deviation measure from the vessels in aggregate and the IVS was compared to that from quiescent phases calculated by the CT scanner. Three board-certified radiologists, fellowship-trained in cardiothoracic imaging, graded the diagnostic quality of the reconstructions using a Likert response format: 1 = excellent, 2 = good, 3 = adequate, 4 = nondiagnostic. Results: Systolic and diastolic quiescent periods were identified for each subject from the vessel motion calculated using the phase-to-phase deviation measure. The motion of the IVS was found to be similar to the aggregate vessel (AGG) motion. The diagnostic quality of the coronary vessels for the quiescent phases calculated from the aggregate vessel (P{sub AGG}) and IVS (P{sub IV} {sub S}) deviation signal using the proposed methods was comparable to the quiescent phases calculated by the CT scanner (P{sub CT}). The one exception was the RCA, which improved for P{sub AGG} for 18 of the 20 subjects when compared to P
Belz, Regina G.
2007-01-01
Parthenium hysterophorus L. is an invasive weed that biosynthesizes several phytochemi-cals. The sesquiterpene lactone parthenin receives most attention regarding allelopathy of the plant or potential herbicidal properties. Since parthenin exhibits dose-dependent phy-totoxicity with low dose stimulation, this study investigated the occurrence and temporal features of parthenin hormesis in Sinapis arvensis L. sprayed with parthenin under semi-natural conditions. Dose/response studies showed th...
TEMPUYUNG SEBAGAI ALTERNATIF PENGHANCUR BATU GINJAL
Directory of Open Access Journals (Sweden)
Martuti Budiharto
2012-09-01
Full Text Available Sonchus arvensis L, atau yang lebih dikenal di Indonesia dengan sebutan tempuyung, adalah salah satu tanaman yang sudah banyak digunakan oleh masyarakat untuk penghancur batu ginjal baik dalam bentuk rebusan maupun bentuk preparat farmasi seperti kapsul ataupun serbuk biasa.Dalam makalah ini dikemukakan tentang review hasil uji toksisitas akut dan uji aktivitas farmakodinamik efek anti kalkuli tanaman Sonchus arvensiss L dari beberapa penelitian
Vitality structure of the populations of some weed species in crop sowings
Directory of Open Access Journals (Sweden)
E. M. Tikhonova
2010-11-01
Full Text Available Features of development of populations of weed species (Cirsium arvense (L. Scop., Sonchus arvensis L., Melandium album (Mill. Garke, Setaria glauca (L. Beauv., Fallopia convolvulus (L. А. Lоve in most typical crops in the forest-steppe zone of the Sumy region. It was studied the crop sowings (winter wheat, rye, barley, buckwheat, pea which was not subjected to the herbicide treatment.
Material properties of frc with recycled aggregate
Czech Academy of Sciences Publication Activity Database
Trčková, Jiřina; Procházka, P.
2011-01-01
Roč. 8, č. 2 (2011), s. 105-113 ISSN 1214-9705 R&D Projects: GA ČR GA103/08/1197 Institutional research plan: CEZ:AV0Z30460519 Keywords : recycled aggregate * concrete composite * pullout test Subject RIV: JM - Building Engineering Impact factor: 0.530, year: 2011 http://www.irsm.cas.cz/abstracts/AGG/02_11/1_Trckova.pdf
Evaluation of granite weathering in the Jeroným Mine using non-destructive methods
Czech Academy of Sciences Publication Activity Database
Lednická, Markéta; Kaláb, Zdeněk
2012-01-01
Roč. 9, č. 2 (2012), s. 211-220 ISSN 1214-9705 R&D Projects: GA ČR GA105/09/0089 Institutional support: RVO:68145535 Keywords : weathering * granite, mine * ultrasonic pulse velocity * Schmidt hammer Subject RIV: DH - Mining, incl. Coal Mining Impact factor: 0.530, year: 2011 http://www.irsm.cas.cz/abstracts/AGG/02_12/10_Lednicka_Kalab.pdf
Czech Academy of Sciences Publication Activity Database
Pospíšil, L.; Roštínský, Pavel; Švábenský, O.; Weigl, J.; Witiska, M.
2012-01-01
Roč. 9, č. 3 (2012), s. 315-329 ISSN 1214-9705 Grant - others:GA MŠk(CZ) ED2.1.00/03.0097 Institutional support: RVO:68145535 Keywords : active geodynamics * geomorphological indicator * Waitzendorf and Diendorf faults Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 0.530, year: 2011 http://www.irsm.cas.cz/abstracts/AGG/03_12/7.Pospisil.pdf
Czech Academy of Sciences Publication Activity Database
Gaždová, Renata; Novotný, Oldřich; Málek, Jiří; Valenta, Jan; Brož, Milan; Kolínský, Petr
2011-01-01
Roč. 8, č. 1 (2011), s. 17-27 ISSN 1214-9705 R&D Projects: GA AV ČR IAA300460602 Institutional research plan: CEZ:AV0Z30460519 Keywords : Western Bohemia * earthquake swarm * groundwater level Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 0.530, year: 2011 http://www.irsm.cas.cz/abstracts/AGG/01_11/2_Gazdova.pdf
Ultra-large single crystals by abnormal grain growth.
Kusama, Tomoe; Omori, Toshihiro; Saito, Takashi; Kise, Sumio; Tanaka, Toyonobu; Araki, Yoshikazu; Kainuma, Ryosuke
2017-08-25
Producing a single crystal is expensive because of low mass productivity. Therefore, many metallic materials are being used in polycrystalline form, even though material properties are superior in a single crystal. Here we show that an extraordinarily large Cu-Al-Mn single crystal can be obtained by abnormal grain growth (AGG) induced by simple heat treatment with high mass productivity. In AGG, the sub-boundary energy introduced by cyclic heat treatment (CHT) is dominant in the driving pressure, and the grain boundary migration rate is accelerated by repeating the low-temperature CHT due to the increase of the sub-boundary energy. With such treatment, fabrication of single crystal bars 70 cm in length is achieved. This result ensures that the range of applications of shape memory alloys will spread beyond small-sized devices to large-scale components and may enable new applications of single crystals in other metallic and ceramics materials having similar microstructural features.Growing large single crystals cheaply and reliably for structural applications remains challenging. Here, the authors combine accelerated abnormal grain growth and cyclic heat treatments to grow a superelastic shape memory alloy single crystal to 70 cm.
Butenko, O M; Staniukovich, M K
2001-01-01
Four new species of the nasal mite family Rhinonyssidae collected in different regions of the former USSR are described: Neonyssus (Otocorinyssus) alaudae sp. n. from Alauda arvensis L. (Alaudidae, Passeriformes) from Turkmenistan; Rhinonyssus clangulae sp. n. from Clangula hyemalis (L.) (Anatidae, Anseriformes) from Yakutia; R. marilae sp. n. from Aythya marilae L. (Anatidae, Anseriformes) from the Russian Far East; Locustellonyssus sibiricus sp. n. from Locustella certhiola (Pall.) (Sylviidae, Passeriformes) from Siberia.
"Enhanced" interrogation of detainees: do psychologists and psychiatrists participate?
Halpern, Abraham L; Halpern, John H; Doherty, Sean B
2008-01-01
Abstract After revelations of participation by psychiatrists and psychologists in interrogation of prisoners at Guantánamo Bay and Central Intelligence Agency secret detention centers, the American Psychiatric Association and the American Psychological Association adopted Position Statements absolutely prohibiting their members from participating in torture under any and all circumstances, and, to a limited degree, forbidding involvement in interrogations. Some interrogations utilize very agg...
Czech Academy of Sciences Publication Activity Database
Brož, Milan; Štrunc, Jaroslav
2011-01-01
Roč. 8, č. 3 (2011), s. 345-352 ISSN 1214-9705 R&D Projects: GA ČR GA103/07/1522 Institutional research plan: CEZ:AV0Z30460519 Keywords : analog-to-digital converter * seismic array * weak event Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 0.530, year: 2011 http://www.irsm.cas.cz/abstracts/AGG/03_11/16_Broz.pdf
Czech Academy of Sciences Publication Activity Database
Kaláb, Zdeněk; Lednická, Markéta; Knejzlík, Jaromír; Telesca, L.
2010-01-01
Roč. 7, č. 4 (2010), s. 469-474 ISSN 1214-9705 R&D Projects: GA ČR GA105/09/0089 Institutional research plan: CEZ:AV0Z30860518 Keywords : laser distance meter * Earth tides * Jeroným mine Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 0.452, year: 2010 http://www.irsm.cas.cz/abstracts/AGG/04_10/8_Kalab.pdf
Measurements of P- and S wave velocities in a rock massif and its use in estimating elastic moduli
Czech Academy of Sciences Publication Activity Database
Živor, Roman; Vilhelm, J.; Rudajev, Vladimír; Lokajíček, Tomáš
2011-01-01
Roč. 8, č. 2 (2011), s. 157-167 ISSN 1214-9705 R&D Projects: GA AV ČR IAA300130906 Institutional research plan: CEZ:AV0Z30130516 Keywords : seismic source * seismic waves velocity * elastic constants * geophone * piezo -electric transducer Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 0.530, year: 2011 http://www.irsm.cas.cz/abstracts/AGG/02_11/6_Zivor.pdf
International Nuclear Information System (INIS)
Hajy Alimohammadi, Marjan; Javadian, Soheila; Gharibi, Hussein; Tehrani-Bagha, Ali reza; Alavijeh, Mohammad Rashidi; Kakaei, Karim
2012-01-01
Graphical abstract: Highlights: → Enthalpy-entropy compensation relation was found between and for gemini surfactants. → The intermicellar interaction parameters are influenced with increasing the lengths of the tail and the spacer of gemini surfactants. → Increasing temperature decreases the intermicellar interaction parameters. → The changes in micellar surface charge density, and phase transition between spherical and rod geometries explain the data. - Abstract: The aggregation behavior of the cationic Gemini surfactants C m H 2m+1 N(CH 3 ) 2 (CH 2 ) S (CH 3 ) 2 N C m H 2m+1 ,2Br - with m = 12, 14 and s = 2, 4 were studied by performing surface tension, electrical conductivity, pulsed field gradient nuclear magnetic resonance (PFG-NMR), and cyclic voltammetry (CV) measurements over the temperature range 298 K to 323 K. The critical micelle concentration (CMC), surface excess (Γ max ), mean molecular surface area (A min ), degree of counter ion dissociation (α), and the thermodynamic parameters of micellization were determined from the surface tension and conductance data. An enthalpy-entropy compensation effect was observed and all the plots of enthalpy-entropy compensation exhibit excellent linearity. The micellar self-diffusion coefficients (D m ) and intermicellar interaction parameters (k d ) were obtained from the PFG-NMR and CV measurements. These results are discussed in terms of the intermicellar interactions, the effects of the chain and spacer lengths on the micellar surface charge density, and the phase transition between spherical and rod geometries. The intermicellar interaction parameters were found to decrease slightly with increasing temperature for 14-4-14, which suggests that the micellar surface charge density decreases with increasing temperature. The mean values of the hydrodynamic radius, R h , and the aggregation number, N agg , of the Gemini surfactants'm-4-m micelles were calculated from the micellar self-diffusion coefficient
Directory of Open Access Journals (Sweden)
Maria G. A. Lima
2000-08-01
Full Text Available Realizaram-se levantamentos de plantas daninhas, no Campus da UNESP em Jaboticabal/SP, com o objetivo de identificar espécies de plantas daninhas hospedeiras do tripes Frankliniella schultzei (Trybom. As plantas foram coletadas semanalmente utilizando-se o método de ensacamento. A separação dos tripes foi feita mediante emprego do funil de Berlese. Entre as 43 espécies de plantas daninhas encontradas nas áreas amostradas, 19 são hospedeiras do tripes. Rabanete (Raphanus sativus L., nabiça (R. raphanistrum L. e mostarda (Sinapsis arvensis L. foram as que apresentaram as maiores porcentagens de F. schultzei, 45, 27 e 17% do total de fêmeas coletadas respectivamente.A monitoring of weeds was carried out on the UNESP Campus in Jaboticabal, SP, with the objective of indentifying host weed species of Frankliniella schultzei (Trybom. The plants were collected weekly and transported to the laboratory inside paper bags. The Berlese funnel method was used to separate the insects from the plants. Thrips were found in 19 of the 43 weed species studied: Raphanus sativus L., R. raphanistrum L., and Sinapsis arvensis L. presented the highest percentage of thrips, consisting of 45, 27, and 17% respectively of the total females that were collected.
Inhibitory potential of nine mentha species against pathogenic bacteria strains
International Nuclear Information System (INIS)
Hussain, A.; Ahmad, N.; Rashid, M.; Ikram, A. U.; Shinwari, Z. K.
2015-01-01
Plants produce secondary metabolites, which are used in their growth and defense against pathogenic agents. These plant based metabolites can be used as natural antibiotics against pathogenic bacteria. Synthetic antibiotics caused different side effects and become resistant to bacteria. Therefore the main objective of the present study was to investigate the inhibitory potential of nine Mentha species extracts against pathogenic bacteria. The methanolic leaves extracts of nine Mentha species (Mentha arvensis, Mentha longifolia, Mentha officinalis, Mentha piperita, Mentha citrata, Mentha pulegium, Mentha royleana, Mentha spicata and Mentha suareolens) were compared for antimicrobial activities. These Mentha species showed strong antibacterial activity against four microorganisms tested. Mentha arvensis showed 25 mm and 30 mm zones of inhibition against Staphylococcus aureus, Vibrio cholera and Enterobacter aerogens. Moreover, Mentha longifolia showed 24 mm zone of inhibition against Staphylococcus aureus. Mentha officinalis showed 30 mm zone of inhibition against Staphylococcus aureus. 25 mm inhibitory zone was recorded against Staphylococcus aureus by Mentha piperita. Mentha royleana showed 25 mm zone of inhibition against Vibrio cholera, while Mentha spicata showed 21 mm, 22 mm and 23 mm zones of inhibition against Staphylococcus aureus, Vibrio cholera and Enterobacter aerogens. Moreover most of the Mentha species showed zone of inhibition in the range of 10-20 mm. (author)
Essential oil composition of sixteen elite cultivars of Mentha from western Himalayan region, India
Directory of Open Access Journals (Sweden)
Rajendra C. Padalia
2013-02-01
Full Text Available The hydrodistilled essential oils of 16 cultivars of Mentha, viz. M. arvensis L., M. spicata L. and M. citrata Ehrh., were analysed and compared by gas chromatography and gas chromatography-mass spectrometry. Fifty-seven constituents representing 92.8-99.8% of the total essential oil composition were identified. Monoterpenoids (88.1-98.6% are the major constituents of the essential oils. The major constituents of the oils in 9 cultivars of M. arvensis are menthol (73.7-85.8%, menthone (1.5-11.0%, menthyl acetate (0.5-5.3%, isomenthone (2.1-3.9%, limonene (1.2-3.3% and neomenthol (1.9-2.5%. Carvone (51.3-65.1%, limonene (15.1-25.2%, -pinene (1.3-3.2% and 1,8-cineole (≤0.1-3.6% are the major constituents in 5 cultivars of M. spicata, while in one cultivar (Ganga of M. spicata the major constituents are piperitenone oxide (76.7%, α-terpineol (4.9% and limonene (4.7%. Linalool (59.7%, linalyl acetate (18.4%, nerol (2.0%, trans-p-menth-1-en-2-ol (1.8%, a-terpineol (1.5% and limonene (1.1% are the major constituents of M. citrata.
Akhtar, Md Qussen; Qamar, Nida; Yadav, Pallavi; Kulkarni, Pallavi; Kumar, Ajay; Shasany, Ajit Kumar
2017-06-01
The genes involved in menthol biosynthesis are reported earlier in Mentha × piperita. But the information on these genes is not available in Mentha arvensis. To bridge the gap in knowledge on differential biosynthesis of monoterpenes leading to compositional variation in the essential oil of these species, a comparative transcriptome analysis of the glandular trichome (GT) was carried out. In addition to the mevalonic acid (MVA) and methylerythritol phosphate (MEP) pathway genes, about 210 and 196 different terpene synthases (TPSs) transcripts were identified from annotation in M. arvensis and M. × piperita, respectively, and correlated to several monoterpenes present in the essential oil. Six isoforms of (-)-menthol dehydrogenases (MD), the last enzyme of the menthol biosynthetic pathway, were identified, cloned and characterized from the transcriptome data (three from each species). Varied expression levels and differential enzyme kinetics of these isoforms indicated the nature and composition of the product, as these isoforms generate both (-)-menthol and (+)-neomenthol from (-)-menthone and converts (-)-menthol to (-)-menthone in the reverse reaction, and hence together determine the quantity of (-)-menthol in the essential oil in these two species. Several genes for high value minor monoterpenes could also be identified from the transcriptome data. © 2017 Scandinavian Plant Physiology Society.
Ismail, Amri; Mancini, Emilia; De Martino, Laura; Hamrouni, Lamia; Hanana, Mohsen; Jamoussi, Bassem; Gargouri, Samia; Scognamiglio, Mariarosa; De Feo, Vincenzo
2014-01-01
The chemical composition of the essential oils obtained by hydrodistillation of leaves, stems, and female cones of Cupressus arizonica Greene, grown in Tunisia, was studied by GC-FID and GC/MS analyses. Altogether, 62 compounds were identified, 62 in the leaf oil, 19 in the cone oil, and 24 in the stem oil. The cone and stem oils were mainly composed by monoterpene hydrocarbons (96.6 and 85.2%, resp.). In the leaf oil, the total sesquiterpene fraction constituted 36.1% and that of the monoterpene hydrocarbons 33.8% of the total oil composition. The three oils were evaluated for their in vitro herbicidal activity by determining their influence on the germination and the shoot and root growth of the four weed species Sinapis arvensis L., Lolium rigidum Gaudin, Trifolium campestre Schreb., and Phalaris canariensis L. At the highest doses tested (0.8 and 1.0 mg/ml), the leaf essential oil inhibited either totally or almost completely the seed germination and the shoot and root growth of S. arvensis and T. campestre. The oils were also tested for their antifungal activity; however, their effects on the fungal growth were statistically not significant. Copyright © 2014 Verlag Helvetica Chimica Acta AG, Zürich.
Hypoglycemic Activity Of Polygala arvensis In Normal And Alloxan ...
African Journals Online (AJOL)
Blood glucose was estimated by the glucose oxidase method in both normal and alloxan-induced diabetic rats before and 2h after the administration of drugs. The glycogen content of the liver, skeletal muscle, cardiac muscle and glucose uptake by isolated rat hemi-diaphragm were estimated. It showed significant reduction ...
Edible flowers - antioxidant activity and impact on cell viability
Kuceková, Zdenka; Mlček, Jiří; Humpolíček, Petr; Rop, Otakar
2013-01-01
The phenolic compound composition, antioxidant activity and impact on cell viability of edible flower extracts of Allium schoenoprasum; Bellis perennis; Cichorium intybus; Rumex acetosa; Salvia pratensis; Sambucus nigra; Taraxacum officinale; Tragopogon pratensis; Trifolium repens and Viola arvensis was examined for the first time. Total phenolic content of the flowers of these plants fell between 11.72 and 42.74 mg of tannin equivalents/kg of dry matter. Antioxidant activity ranged from 35.5...
Breeding birds on organic and conventional arable farms
Kragten, Steven
2009-01-01
As a result of agricultural intensification, farmland bird populations have been declining dramatically over the past decades. Organic farming is often mentioned to be a possible solution to stop these declines. In order to see whether farmland birds really benefit from organic farming a study was carried out comparing breeding bird densities, breeding success and bird food abundance between organic and conventional arable farms in Flevoland, the Netherlands. skylark (Alauda arvensis) and lap...
A latex metabolite benefits plant fitness under root herbivore attack
Huber, M.; Epping, J.; Gronover, C.S.; Fricke, J.; Aziz, Z.; Brillatz, T.; Swyers, M.; Köllner, T.G.; Vogel, H.; Hammerbacher, A.; Triebwasser-Freese, D.; Robert, C.A.M.; Verhoeven, K.; Preite, V.; Gershenzon, J.
2016-01-01
Plants produce large amounts of secondary metabolites in their shoots and roots and store them in specialized secretory structures. Although secondary metabolites and their secretory structures are commonly assumed to have a defensive function, evidence that they benefit plant fitness under herbivore attack is scarce, especially below ground. Here, we tested whether latex secondary metabolites produced by the common dandelion (Taraxacum officinale agg.) decrease the performance of its major n...
Multiplex PCR Assay for Identification of Human Diarrheagenic Escherichia coli
Toma, Claudia; Lu, Yan; Higa, Naomi; Nakasone, Noboru; Chinen, Isabel; Baschkier, Ariela; Rivas, Marta; Iwanaga, Masaaki
2003-01-01
A multiplex PCR assay for the identification of human diarrheagenic Escherichia coli was developed. The targets selected for each category were eae for enteropathogenic E. coli, stx for Shiga toxin-producing E. coli, elt and est for enterotoxigenic E. coli, ipaH for enteroinvasive E. coli, and aggR for enteroaggregative E. coli. This assay allowed the categorization of a diarrheagenic E. coli strain in a single reaction tube.
2007-12-01
Impact to flying insect species could be generated by artificial lightning. 2.1.5.2.3 Biotope connecting travel corridors would be impacted by the...well as applying lamps with light that is less attractive to night- active insects (e.g. gaslight, fluorescent tube). Mitigation measures for the...Devi l~bit (Scabious) symphytum officinale agg. Gew6hnlichcr Beinwcll Common Comfrey urtica dioica GroJ3e Brennesscl Stinging Nettle
Veryfying the Possibilities of Using a 3D Laser Scanner in the Mining Underground
Czech Academy of Sciences Publication Activity Database
Kajzar, Vlastimil; Kukutsch, Radovan; Heroldová, Nikola
2015-01-01
Roč. 12, č. 1 (2015), s. 51-58 ISSN 1214-9705 R&D Projects: GA MŠk(CZ) LO1406; GA MŠk ED2.1.00/03.0082 Institutional support: RVO:68145535 Keywords : HDS * laser scanning * convergence measurement Subject RIV: DH - Mining , incl. Coal Mining Impact factor: 0.561, year: 2015 https://www.irsm.cas.cz/materialy/acta_content/2015_doi/Kajzar_AGG_2015_0004.pdf
Results of repeated measurements at the Železné hory – Tišnov fault system surroundings
Czech Academy of Sciences Publication Activity Database
Švábenský, O.; Pospíšil, L.; Weigel, J.; Roštínský, Pavel; Witiska, M.
2014-01-01
Roč. 11, č. 3 (2014), s. 211-223 ISSN 1214-9705 Grant - others:GA MŠk(CZ) 2.1.00/03.0097 Institutional support: RVO:68145535 Keywords : Železné hory – Tišnov tectonic zone * GPS * movement tendencies Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 0.389, year: 2014 http://www.irsm.cas.cz/materialy/acta_content/2014_doi/Svabensky_AGG_2014_0009.pdf
Genetic differentiation among sexually compatible relatives of Brassica napus L.
Directory of Open Access Journals (Sweden)
Pipan Barbara
2013-01-01
Full Text Available Analysis of gene flow between Brassica napus L. and its sexually compatible relatives that could be found in the wild in Slovenia was performed by microsatellite analysis using fifteen selected primer pairs. Genotypes included in the study were obtained from the field survey of sexually compatible relatives of B. napus in natural habitats around Slovenia and from reference collections. Two different wild species of all the presented sexually compatible relatives of B. napus were found in Slovenia, B. rapa and Sinapis arvensis. The reference genotypes included varieties and wild forms from internal collections as marketable seeds or from gene banks. Reference genotypes were represented by the following species and subspecies: B. napus ssp. napobrassica, B. napus ssp. napus, B. nigra, B. oleracea, B. rapa ssp. oleifera, Diplotaxis muralis; D. tenuifolia, Raphanus raphanistrum, R. sativus, R. sativus var. oleiformis, Rapistrum rugosum, S. alba and S. arvensis. Estimation of gene flow described by average number of migrants was 0.72 followed by 0.20 migrants. Due to the observed gene migrations, genetic drift and selection, Hardy-Weinberg equilibrium was not met. The mean number of alleles over all loci was 16.9, the average polymorphic information content was 0.43. We found four highly divergent and polymorphic loci (Na12-C08, Na10-A08, Ni3-G04b and BRMS-050 at statistically significant level (p<0.05 of gene flow detected. Over all gene diversity intra-individual among populations (0.55 was lower than inter-individual among population (0.77. The results of genetic linkages based standard genetic distance and unweighted pair group method with arithmetic mean clustering method, generally divided the genotypes in three divergent groups. Similar results were obtained by principal coordinate analysis where three main groups were constructed according to three factors. A real number of genetic clusters demonstrated a clear separation between populations
Micelle-encapsulated fullerenes in aqueous electrolytes
Energy Technology Data Exchange (ETDEWEB)
Ala-Kleme, T., E-mail: timo.ala-kleme@utu.fi [Department of Chemistry, University of Turku, 20014 Turku (Finland); Maeki, A.; Maeki, R.; Kopperoinen, A.; Heikkinen, M.; Haapakka, K. [Department of Chemistry, University of Turku, 20014 Turku (Finland)
2013-03-15
Different micellar particles Mi(M{sup +}) (Mi=Triton X-100, Triton N-101 R, Triton CF-10, Brij-35, M{sup +}=Na{sup +}, K{sup +}, Cs{sup +}) have been prepared in different aqueous H{sub 3}BO{sub 3}/MOH background electrolytes. It has been observed that these particles can be used to disperse the highly hydrophobic spherical [60]fullerene (1) and ellipsoidal [70]fullerene (2). This dispersion is realised as either micelle-encapsulated monomers Mi(M{sup +})1{sub m} and Mi(M{sup +})2{sub m} or water-soluble micelle-bound aggregates Mi(M{sup +})1{sub agg} and Mi(M{sup +})2{sub agg}, where especially the hydration degree and polyoxyethylene (POE) thickness of the micellar particle seems to play a role of vital importance. Further, the encapsulation microenvironment of 1{sub m} was found to depend strongly on the selected monovalent electrolyte cation, i.e., the encapsulated 1{sub m} is accommodated in the more hydrophobic microenvironment the higher the cationic solvation number is. - Highlights: Black-Right-Pointing-Pointer Different micellar particles is used to disperse [60]fullerene and [70]fullerene. Black-Right-Pointing-Pointer Fullerene monomers or aggregates are dispersed encaging or bounding by micelles. Black-Right-Pointing-Pointer Effective facts are hydration degree and polyoxyethylene thickness of micelle.
Yánez Navarrete, Zoila Elizabeth
2014-01-01
The genus Botrytis (sexual form Botryotinia Whetzel) contains renowned plant pathogenic species with a necrotrophic lifestyle in which kill and feed on its hosts. Recent reports of symptomless endophytic colonization by Botrytis cinerea in cultivated plants of lettuce (Lactuca sativa) and Botrytis spp. in the wild plants dandelion (Taraxacum agg) and spotted knapweed (Centaura stoebe) reveal a different “side” of Botrytis spp. These findings, expose additional strategies of Botrytis species t...
Miguel Angel Quiroga; Martin Persson; Thomas Sterner
2009-01-01
We study whether lax environmental regulations induce comparative advantages, causing the least-regulated countries to specialize in polluting industries. We seek to improve three areas in the empirical literature based on the Heckscher-Ohlin-Vanek’s factor content of trade, more specifically in Tobey’s (1990) approach: the measurement of environmental endowments, the possible endogeneity due to an omitted variable that has not been considered, and the influence of the industrial level of agg...
Characterizing gas permeability and pore properties of Czech granitic rocks
Czech Academy of Sciences Publication Activity Database
Konečný, Pavel; Kožušníková, Alena
2016-01-01
Roč. 13, č. 4 (2016), s. 331-338 ISSN 1214-9705 R&D Projects: GA ČR GA105/09/0089; GA MŠk(CZ) LO1406; GA MŠk ED2.1.00/03.0082 Institutional support: RVO:68145535 Keywords : granitic rocks * permeability * pore properties Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.699, year: 2016 https://www.irsm.cas.cz/materialy/acta_content/2016_doi/Konecny_AGG_2016_0015.pdf
Czech Academy of Sciences Publication Activity Database
Sitek, Libor; Bodnárová, L.; Souček, Kamil; Staš, Lubomír; Gurková, Lucie
2015-01-01
Roč. 12, č. 1 (2015), s. 79-89 ISSN 1214-9705 R&D Projects: GA MŠk(CZ) LO1406; GA ČR GAP104/12/1988; GA MŠk ED2.1.00/03.0082 Institutional support: RVO:68145535 Keywords : concrete * cement paste * aggregate * high temperature Subject RIV: JQ - Machines ; Tools Impact factor: 0.561, year: 2015 https://www.irsm.cas.cz/materialy/acta_content/2015_doi/Sitek_AGG_2015_0009.pdf
Directory of Open Access Journals (Sweden)
Jan Winkler
2008-01-01
Full Text Available The impact of soil tillage on weeds in spring barley was observed on the field trial. The field trial was established in very warm and dry climatic region (experimental field station in Žabčice, Mendel University of Agriculture and Forestry Brno, Czech Republic. In the experiment there was used 7-strip crop rotation and three variants of soil tillage: conventional tillage (CT, minimum tillage (MT, when soil is shallow loosened and no tillage (NT what means direct sowing without any soil tillage. The weed infestation was evaluated by counting method before herbicide application. Analysis of variance (ANOVA and then LSD methods, DCA (Detrended Correspondence Analysis and CCA (Canonical Correspondence Analysis were used for evaluation of results. The obtained results showed, that different soil tillage did not statistically influenced weed infestation in spring barley. The number of weed species depended on the depth of soil tillage, the variant of minimum tillage had lower number of weed species. These species were more common on the variant of conventional tillage: Chenopodium album, Silene noctiflora, Sinapis arvensis, Veronica polita. The variant of minimum tillage was more suitable for these species: Cirsium arvense, Convolvulus arvensis, Amaranthus sp., Galium aparine. On the variant of direct sowing there appeared mainly these species: Sonchus oleraceus, Lactuca serriola, Tripleurospermum inodorum.
Diversity of agrocoenoses in the Lublin region, Poland
Directory of Open Access Journals (Sweden)
Mariola Staniak
2017-11-01
Full Text Available The Lublin region, one of the main agricultural regions in Poland, has very favorable conditions for agricultural production but the development of the agricultural sector has been very slow there. This is due, among other factors, to the extensive farming used on large areas and the fragmentation of fields with numerous fragments of natural ecosystems. In Lublin Province, cereals comprise the highest proportion of the crop structure, especially wheat, but farmers also often cultivate maize, oilseed rape, sugar beet, and legumes for consumption. The biological diversity of agricultural areas is enhanced by growing traditional plant species and varieties. Crop species are accompanied by segetal weeds, sometimes very expansive, sometimes rare and endangered by extinction. In recent years, the following have been the dominant weed species in the region’s crop fields: Galium aparine, Convolvulus arvensis, Papaver rhoeas, Viola arvensis, and Veronica persica. However, there are several locations of occurrence of Muscari comosum (a strictly protected species and the following unique species: Adonis aestivalis, Anthemis tinctoria, Caucalis platycarpos, Galium tricornutum, and Thymelaea passerina. In Lublin Province, there are many organic farms which contribute to the significant diversity of agricultural plant communities. In this review, we also indicate the biocoenotic role of weeds and their importance in the proper maintenance of agroecosystems and ecosystem services.
Threats to rainfed and canal irrigated agro-ecosystems of the Punjab, Pakistan by weed infestation
International Nuclear Information System (INIS)
Hussain, M.; Ahmed, M.S.A.; Hameed, M.; Aqeel, M.
2012-01-01
To record the weed flora infesting the rainfed and canal irrigated arable fields in the Punjab province, three districts viz. Chakwal, Jhelum and Rawalpindi in rainfed agro-ecosystem, while three districts in canal irrigated wheat fields i.e., Sahiwal, Qasoor and Gujrat were surveyed comprehensively to examine weed spectra. Weeds occurring in various localities largely varied with the variation in the mode of irrigation i.e., Barani areas and Canal irrigated area. In Rainfed (Barani) areas Fumeria parviflora and Asphodelus tenuifolius were noted frequently while their representation was very rare or even absent in canal irrigated areas. Carthamus oxayacantha was also observed at some sites there. The only weeds growing infrequently were hardy grasses like Cynodon dactylon and Cyperus rotundus. None of the weed could cross the limits of occasional frequency level. Nevertheless, in canal irrigated areas Convolvulus arvensis, Anagalus arvensis, Chenopodium sp., Melilotus alba, Lepidium sativum, Lathyrus aphaca, Medicago denticulata, Rumex dentatus and Cynodon dactylon were frequently observed. Phalaris minor and Avena fatua formed very dense stands in many areas. Carthamus oxayacantha, Poa annua, Sonchus asper and Vicia sativa were recorded infrequently. The farmers of Sahiwal and Qasoor districts seem well informed about the importance and use of weedicides as a result the spectrum of weeds growing there was quite low and none of them could establish dense stands. (author)
Xu, Xiangru; Zhang, Wenju; Xu, Minggang; Li, Shuangyi; An, Tingting; Pei, Jiubo; Xiao, Jing; Xie, Hongtu; Wang, Jingkuan
2016-12-01
Long-term use of artificial fertiliser has a significant impact on soil organic carbon (SOC). We used physical-chemical fractionation methods to assess the impact of long-term (26years) fertilisation in a maize cropping system developed on Brown Earth in Northeast China. Plot treatments consisted of control (CK); nitrogen (N) fertiliser (N2); low-level organic manure combined with inorganic N and phosphorus (P) fertiliser (M1N1P1); medium-level organic manure combined with inorganic N fertiliser (M2N2); and high-level organic manure combined with inorganic N and P fertiliser (M4N2P1). Our objectives were to (1) determine the contents of and variations in the SOC fractions; (2) explore the relationship between total SOC and its fractions. In treatments involving organic manure (M1N1P1, M2N2, and M4N2P1), total SOC and physically protected microaggregate (μagg) and μagg occluded particulate organic carbon (iPOC) contents increased by 9.9-58.9%, 1.3-34.7%, 29.5-127.9% relative to control, respectively. But there no significant differences (P>0.05) were detected for the chemically, physically-chemically, and physically-biochemically protected fractions among the M1N1P1, M2N2, and M4N2P1 treatments. Regression analysis revealed that there was a linear positive correlation between SOC and the unprotected coarse particulate organic carbon (cPOC), physically protected μagg, and iPOC fractions (Pfractions responded negatively to SOC content. The highest rate of C accumulation among the SOC fractions occurred in the cPOC fraction, which accounted for as much as 32% of C accumulation as total SOC increased, suggesting that cPOC may be the most sensitive fraction to fertiliser application. We found that treatments had no effect on C levels in H-μsilt and NH-μsilt, indicating that the microaggregated silt C-fractions may have reached a steady state in terms of C saturation in the Brown Earth of Northeast China. Copyright © 2016 Elsevier B.V. All rights reserved.
Order Aggressiveness and Order Book Dynamics
Anthony D. Hall; Nikolaus Hautsch
2004-01-01
In this paper, we study the determinants of order aggressiveness and traders' order submission strategy in an open limit order book market. Using order book data from the Australian Stock Exchange, we model traders' aggressiveness in market trading, limit order trading as well as in order cancellations on both sides of the market using a six-dimensional autoregressive intensity model. The information revealed by the open order book plays an important role in explaining the degree of order agg...
Directory of Open Access Journals (Sweden)
J. Valderrama N.
2009-07-01
Full Text Available Se analizan k>s posibles refinamientos de los modelos de pares aplicados a soluciones metálicas liquidas. Como una extensión de los mismos se discute el tratamiento estadístico de Takeuchi y se presenta su aplicación a los sistemas Ag-Ge, Ag-Sn, Cu-ln y Cd-Cu. Cd-Sb, St>- Zn, El comportamiento de mini- estructuras en estos sistemas es también bien presentado y discutido.
Czech Academy of Sciences Publication Activity Database
Schenková, Zdeňka; Schenk, Vladimír
2011-01-01
Roč. 8, č. 3 (2011), s. 195 ISSN 1214-9705. [Czech-Polish Workshop on Recent Geodynamics of the Sudety Mts. and Adjacent Areas. /11./. Třešť, 04.11.2010-06.11.2010] R&D Projects: GA MŠk(CZ) LC506 Institutional research plan: CEZ:AV0Z30460519 Keywords : geodynamics Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.530, year: 2011 http://www.irsm.cas.cz/abstracts/AGG/03_11/1_Preface.pdf
2015-04-15
a need to reduce water consumption whenever possible. Congress issued the initial guidelines for flow control in various plumbing products via the...Base • Florida Solar Energy Center ( Cocoa , FL) • Houston County Solid Waste Disposal Facility (Kathleen, GA) Certification CDEP interns each... PRODUCTS · COMPIOP AGG $ 2,000,000 POUCY ~rg: LOC $ ~"’~"~ ~~~INGlE UMIT s All’f AUTO BODILY INJURY (Por pononj $ ........ ~~,~~ BODILY INJURY (Por
Structure of a stacked anthraquinone–DNA complex
De Luchi, Daniela; Usón, Isabel; Wright, Glenford; Gouyette, Catherine; Subirana, Juan A.
2010-01-01
The crystal structure of the telomeric sequence d(UBrAGG) interacting with an anthraquinone derivative has been solved by MAD. In all previously studied complexes of intercalating drugs, the drug is usually sandwiched between two DNA base pairs. Instead, the present structure looks like a crystal of stacked anthraquinone molecules in which isolated base pairs are intercalated. Unusual base pairs are present in the structure, such as G·G and A·UBr reverse Watson–Crick base pairs. PMID:20823516
Detection of mesocarp oleoyl-thioesterase gene of the South ...
African Journals Online (AJOL)
Administrator
TAT CCA ACT TGG GGT GAT GTT GTT GAG ATT GAA ACA TGG TGC CAA GGG 48. Y P T W G D V V E I E T W C G G 16. GAA GGA AGA ATA GGC ACC AGG CGT GAT TGG ATT ATC AAG GAT TTG GCT 96. E G R I G T R R D W I I K D L A 32. ACT GGT GAA GTT ATT GGT AGA GCC ...
Directory of Open Access Journals (Sweden)
Maria de Fátima Arrigoni-Blank
2011-03-01
Full Text Available A hortelã japonesa (Mentha arvensis é uma espécie aromática, originária do sul da China, o seu óleo essencial é rico em mentol, o qual é empregado nas indústrias farmacêuticas, de alimentos e de cosméticos. Este trabalho teve como objetivo desenvolver um protocolo para a micropropagação e aclimatização de genótipos de hortelã japonesa, além de analisar a composição química dos óleos essenciais de plantas micropropagadas e não micropropagadas. Segmentos nodais são os mais indicados para a micropropagação dos genótipos de M. arvensis. A concentração de 4,4 µM de AIA promoveu um maior número de brotos e folhas por explante do genótipo MA701-02, em relação aos demais genótipos. A utilização de 4,4 µM AIA e 9,3 µM CIN + 8,9 µM BAP + 2,2 µM AIA proporcionou maior acúmulo de massa seca no genótipo MA701-02, e no MA701-04 foi a concentração de 8,9 µM BAP + 5,4 µM ANA. O substrato pó de coco + 1 g L-1 de calcário + 12 g L-1 de Biosafra® (3-12-6 pode ser indicado para a aclimatização de mudas micropropagadas dos genótipos de hortelã japonesa avaliados. A micropropagação não alterou o teor de óleo essencial e foram identificados 17 constituintes químicos, perfazendo um total de 92 a 99%.Japanese mint (Mentha arvensis L. is an aromatic species originated from South China and its essential oil is rich in menthol, which is used in the pharmaceutical, food and cosmetic industries. The aim of this work was to develop a protocol for micropropagation and acclimatization of japanese mint genotypes and analyze the chemical composition of the essential oils from micropropagated and not micropropagated plants. Nodal segments are the most indicated for micropropagation of the M. arvensis genotypes. The concentration of 4.4 µM of IAA promoved higher number of shoots and leaves per explant of the MA701-02 genotype when compared with the others. The use of 4,4 µM of IAA and 9,3 µM of KIN + 8,9 µM of BAP + 2
Directory of Open Access Journals (Sweden)
Tânea Maria Bisognin Garlet
2008-08-01
Full Text Available O objetivo do estudo foi determinar o teor e a acumulação de nutrientes em três espécies de Mentha e testar o desempenho de solução nutritiva calculada para o cultivo de menta, a partir de dados anteriores de produção de matéria seca e de quantidade de nutrientes extraídos por M. arvensis, no sistema hidropônico NFT Técnica do Fluxo Laminar de Nutrientes (NFT. O trabalho foi conduzido em casa de vegetação de 250m² do Departamento de Fitotecnia da UFSM, RS, Brasil, no período de outubro a dezembro de 2004. Empregou-se delineamento experimental inteiramente casualizado, com três tratamentos (órgãos da planta e cinco repetições. Estacas de plantas matrizes foram enraizadas em espuma fenólica por 20 dias em berçário e após foram transferidas para bancadas de produção final. As plantas foram colhidas aos 62 (M. arvensis, 69 (M. x gracilis e 76 (M. x piperita var. citrata dias após o plantio, separadas em partes (raízes, hastes, folhas e secas em estufa a 70°C para determinação de matéria seca e análise de tecidos. Nitrogênio, cálcio e potássio foram os macronutrientes com maior concentração em todas as partes das plantas, já os micronutrientes foram ferro, manganês e zinco. Houve maior acúmulo de macronutrientes nas folhas, seguidas pelas hastes e raízes. Constatou-se que a solução nutritiva elaborada garantiu elevada produção de fitomassa, sem que as plantas apresentassem sintomas visuais de deficiência ou toxicidade de macro e micronutrientes.The intention of this study was to determine the levels and accumulation of nutrients in three Mentha species and to test the performance of the nutrient solution for the growth of mint, obtained from previous data of dry matter production and quantity of nutrients extracted by M. arvensis, in NFT (Nutrient Film Technique hydroponic system. The research was carried out at the Departament of Fitotecny, Universidade Federal de Santa Maria (UFSM, RS, Brazil, from
Aphanes arvensis (Rosaceae) en el extremo nordeste de la Argentina
Gustavo Hildt; Héctor A. Keller
2017-01-01
Se menciona por primera vez para el nordeste argentino a una hierba adventicia en el nuevomundo. La especie es ilustrada mediante fotografías Fil: Hildt, Gustavo. Universidad Nacional de Misiones; Argentina Fil: Keller, Hector Alejandro. Consejo Nacional de Investigaciones Científicas y Técnicas. Centro Científico Tecnológico Nordeste. Instituto de Botánica del Nordeste (i); Argentina
Antibacterial Activity and Mode of Action of Mentha arvensis Ethanol ...
African Journals Online (AJOL)
Reactive oxygen species (ROS) generation and protein leakage from the bacterial cells induced by the extract were also evaluated. .... as well as MIC/MBC values of the extract were calculated. The results of the disc diffusion assay .... This work was supported by grants from the. Science and Technology Innovation Fund of.
Euppayo, Thippaporn; Siengdee, Puntita; Buddhachat, Kittisak; Pradit, Waranee; Viriyakhasem, Nawarat; Chomdej, Siriwadee; Ongchai, Siriwan; Harada, Yasuji; Nganvongpanit, Korakot
2015-09-01
Intra-articular injection with non-steroidal anti-inflammatory drugs (NSAIDs) is used to treat inflammatory joint disease, but the side effects of NSAIDs include chondrotoxicity. Hyaluronan has shown positive effects on chondrocytes by reducing apoptosis and increasing proteoglycan synthesis. The purposes of this study were to evaluate the effects of low molecular weight hyaluronan (low MW HA), carprofen 25 mg/ml, carprofen 12.5 mg/ml, and a combination of HA and carprofen on canine osteoarthritis (OA) articular chondrocytes and a cartilage explant model in terms of cell viability, extracellular matrix remaining, and gene expression after exposure. In chondrocyte culture, MTT assay was used to evaluate the chondrotoxicity of IC50 and IC80 of carprofen with HA. In cartilage explant culture, two kinds of extracellular matrix (uronic acid and collagen) remaining in cartilage were used to evaluate cartilage damage for 14 d after treatment. Expression of COL2A1, AGG, and MMP3 was used to evaluate the synthesis and degradation of the matrix for 7 d after treatment. In chondrocyte culture, low MW HA could preserve OA chondrocyte viability but could not reduce the chondrotoxicity level of carprofen (P carprofen caused less destruction of uronic acid and collagen structure when compared with the control (P carprofen resulted in higher COL2A1 and AGG expression levels than carprofen alone.
Role of Hunk and Punc in Breast Cancer and Mammary Development
2001-08-01
develop- (C/T)(C/T)-3’) and PTKIIa (5’-CCCGGGGAATTCCA(A/T)AGG- ment, suggesting that these molecules may be important ACCA (G/C)AC(G/A)TC-3’), have...actin in order to correct for these As an initial control, Northern blots were hybridized dilutional effects. with probes for the genes encoding f3 ...scale increases in milk protein gene expression during late pregnancy and lactation. Expression levels normalized to f3 -actin are shown relative to
Use of AFLP marker system on sugarcane somaclones to study their resistance to rust
María Ileana Oloriz; Luis Rojas; Víctor Gil; Milady Mendoza; Ariel Arencibia; Elva Rosa Carmona; Elio Jiménez
2002-01-01
AFLPs (amplified fragment length polymorphism) was carried out from genomic DNA of five rust resistant sugar cane somaclons and their susceptible donor, Saccharum officinarum var B 4362, using three combinations of primers (EcoRI/aca: MseI/acc; EcoRI/aca: MseI/atg and EcoRI/aca: MseI/agg). Six polymorphic bands were obtained, two of these only appeared in the resistant genotypes, which are probably DNA sequences, related to rust resistance locus. These fragments have been cloned to study thei...
Geodynamic reactions to recent tectonic events observed on selected sites monitored in Slovakia
Czech Academy of Sciences Publication Activity Database
Petro, L.; Košťák, Blahoslav; Stemberk, Josef; Vlčko, J.
2011-01-01
Roč. 8, č. 4 (2011), s. 453-467 ISSN 1214-9705 R&D Projects: GA MŠk OC 625.10; GA ČR GA205/06/1828; GA ČR GA205/09/2024; GA AV ČR IAA300120905 Institutional research plan: CEZ:AV0Z30460519 Keywords : finite pressure pulse * geodynamic monitoring * tectonic process Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 0.530, year: 2011 http://www.irsm.cas.cz/abstracts/AGG/04_11/7_Petro.pdf
On the cost/delay tradeoff of wireless delay tolerant geographic routing
Tasiopoulos, Argyrios; Tsiaras, Christos; Toumpis, Stavros
2012-01-01
In Delay Tolerant Networks (DTNs), there is a fundamental tradeoff between the aggregate transport cost of a packet and the delay in its delivery. We study this tradeoff in the context of geographical routing in wireless DTNs.We ?rst specify the optimal cost/delay tradeoff, i.e., the tradeoff under optimal network operation, using a dynamic network construction termed the Cost/Delay Evolving Graph (C/DEG) and the Optimal Cost/Delay Curve (OC/DC), a function that gives the minimum possible agg...
Sharma, Rekha; Dhillon, Ankita; Kumar, Dinesh
2018-03-26
The present paper reports a facile and selective colorimetric method for the detection of potential environmental and health hazardous metal ions using green synthesized silver nanoparticles (AgNPs). Here the organic functional groups present in the plant extract (Mentha arvensis) are used as reductants and stabilizers in the synthesis of AgNPs. They also provide a suitable binding site to the (Al(III)) analyte in the detection mechanism. The leaf extract of Mentha arvensis was used to synthesize AgNPs at room-temperature and at 80 °C. The AgNPs synthesized at 80 °C exhibit excellent selective colorimetric detection of Al(III). The as-synthesized AgNPs have been characterized, and the synthesis, stabilization of NPs and detection mechanism has also been illustrated by using UV-vis, XPS, FTIR, TEM, EDX, SEM, AAS, and TGA analytical tools and techniques. The selectivity of detection probe was supported by the reaction between probe and metal ions followed first-order kinetics having the highest value of the regression coefficient (R 2 = 0.99) for Al(III) and the analysis of thermodynamic parameters. The prepared sensor showed a lower limit of detection (LOD) of 1 nM (S/N = 3.2) in real water samples. The proposed method can be successfully utilized for the detection of Al(III) from both drinking and real water samples at the nanomolar level.
The choice of bromeliads as a microhabitat by Scinax argyreornatus (Anura, Hylidae).
Pederassi, J; Lima, M S C S; Peixoto, O L; Souza, C A S
2012-05-01
The association of anurans to bromeliads presents different degrees of interaction such as: eventual, obligatory and bromeligen. The frog species Scinax argyreornatus shows a regular association with these plants. The goal of this study is to characterise the degree of association between the frog S. argyreornatus to different species of bromeliads. We identified which species of bromeliad is regularly associated with S. argyreornatus and recognised which factors interfere with this association preference. We analysed the Concentration of Relative Dominance of frogs per bromeliad species. As possible criteria for frog association preference to different bromeliads species we established the analysis of leaves number, length and width, number of leaf axils, stored water in the axils, pH and relative humidity, among other organographic components. Our observations were analyzed by ANOVA followed by the Tukey test. We also evaluated the preference for association by the constancy of Bodenheimer. The correlation matrix indicated that the relative humidity is the factor responsible for the frog-bromeliads association, except for Aechmea sp.. However Aechmea sp. was the species with greater constancy of occupation followed by Quesnelia arvensis and Neoregelia johannis. According to our statistical results, Aechmea sp. and Q. arvensis are not different regarding organographic parameters, but differ from N. johannis. Our observations suggest that the bromeliads organographic structure and the relative humidity are key conditions which influence the preferences of S. argyreornatus to bromeliad species, while the other features showed no correlation.
State of weed infestation and features of sugar beet protection in Belarus
Directory of Open Access Journals (Sweden)
Soroka Sergey Vladimirovich
2006-01-01
Full Text Available The changes of phytosanitary situation recently taking place in sugar beet crops in the Republic of Belarus are shown. It is noticed that in the crop agrocoenosises there is a high infestation level caused by Japanese barnyard millet (Echinochloa crus-galli (L Pal. Beauv, field sowthistle (Sonchus arvensis L, chickweed (Stellaria media (L Vill, quick grass (Agropyron repens (L Pal Beauv, matricary (Matricaria perforate Merat, creeping thistle (Circium arvense (L scop, marsh woundwort (Stachus palustris L wild buckwheat (Polygonum convolvulus L, bristle stem hemp nettle (Galeopsis tetrahit L, common horsetail (Equisetum arvense L, field forget-me-not (Myosotis arvensis (L Hill, shepherd's purse (Capsella bursa-pastoris (L Med etc. Due to non-observance of preventive and separate agrotechnical techniques especially in spring-summer period, such weeds as bedstraw (Galium aparine L, white campion (Melandrium album (Mill Garcke, green amaranthus (Amaranthus retroflexus L started to appear in the crops. To protect sugar beet effectively, two variants of herbicides application are proposed. The first one - a combined, one stipulating soil action herbicides application before planting or before sugar beet seedlings emergence and on seedlings - to carry out two treatment by post-emergence preparations. The second variant, a split post- -emergence herbicide application (two-three times spraying on growing weeds at small application rates. In the next 5-6 years, a combined method will be of a primary importance in the conditions of the Republic.
Herrera, Teófilo; Pérez-Silva, Evangelina; Valenzuela, Víctor H.
2006-01-01
Se citan 8 especies de macromicetos recolectados en el área poniente de la Reserva Ecológica del Pedregal de San Ángel, D.F., México, de las cuales 5 son lignícolas y 3 humícolas, Se desarrollan a la sombra y entre hojarasca de plantas superiores. Entre los agaricales la familia Agaricaceae es la mejor representada. Se citan por primera vez en la micobiota del Pedregal de San Ángel: Gymnopus confluens, Agrocybe pediades, Agaricus arvensis y A. silvaticus, Setchelliogaster rheophyllus y Coprin...
Composição química e valor nutricional de cogumelos silvestres comestíveis do nordeste de Portugal
Barros, Lillian; Baptista, Paula; Correia, Daniela M.; Casal, Susana; Oliveira, M.B.P.P.; Ferreira, Isabel C.F.R.
2007-01-01
Neste trabalho, determinou-se a composição química e o valor nutricional de cinco espécies de cogumelos silvestres comestíveis (Agaricus arvensis, Lactarius deliciosus, Leucopaxillus giganteus, Sarcodon imbricatus, Tricholoma portentosum) vulgarmente consumidos na região de Trás-os-Montes, Nordeste de Portugal. A avaliação da composição química incluíu determinação de humidade, gordura total, proteína total, cinzas, hidratos de carbono e do valor nutricional. O perfil de macron...
Güvenç, İsmail; Kaya, Yusuf
2010-01-01
ÖZET 1 Bu çalışma, Erzurum vejetasyonunda doğal olarak yetişen ve sebze olarak kullanılan yöreselbitkileri belirlemek amacıyla gerçekleştirildi. Yöreden toplanan bitki örneklerinin tamtum teşhis edildi. Sebzeolarak değerlendirilen bu bitkilerin yöresel adları bağa yaprağı (Plantago majör), ısırgan (Urtica dioica), (Sinapis arvensis), kuzu kulağı (Rumex acetocella), çaşır (Prangos uechritzii), çir...
Morfología polínica de Veronica L. (Scrophulariaceae) en el suroeste de España
Fernández González, Inmaculada; Juan Rodríguez, Rocío; Pastor Díaz, Julio Enrique
1997-01-01
Morfología polínica de Veronica L. (Scrophulariaceae) en el suroeste de España. Se estudia la morfología polínica, al microscopio óptico y electónico de barrido, de 13 taxones de Veronica L.: V. scutellata, V. anagallis-aquatica, V. anagalloides, V. thriphyllos, V. praecox, V. arvensis, V. peregrina, V. polita, V. agrestis, V. persica, V. cymbalaria, V. hederifolia subsp. hederifolia y V. hedertfolia subsp. triloba. Los resultados confirman el carácter euripolínico del género. Se est...
Directory of Open Access Journals (Sweden)
Karol Bujak
2012-12-01
Full Text Available In the paper effect of limitation of postharvest measure to single cultivating or disking of soil and mineral fertilization level on number, air-dry matter and botanical composition of weeds in the potato-field is presented. Simplifield postharvest measure was increasing insignificantly and more intensive fertilization was limiting the weed infestation of potato-field. Decteasing of weeds number increasing fertilization was ststistically significant. Dominating species of weeds in the potato-field were Capsella bursa-pastoris, Poa annua, Viola arvensis, Chenopodium album, Elymus repens i Equisetum arvense.
New Records To The Vascular Flora Of Kazakhstan (Central Asia
Directory of Open Access Journals (Sweden)
Ebel Aleksandr L.
2015-12-01
Full Text Available The paper presents distributional data for seven species new for the flora of Kazakhstan: Atriplex gardneri var. aptera (A. Nelson S. L. Welsh. & Crompton, Cardamine hirsuta L., Carduus acanthoides L., Galega orientalis Lam., Silene cserei Baumg., Didymophysa fedtschenkoana Regel and Acinos arvensis (Lam. Dandy. Didymophysa fedtschenkoana is a native element in the Kazakh flora; the other species should be treated as alien, expansively spreading or invasive in this part of Asia. A list of localities of the species in Kazakhstan and their habitat preferences are presented.
Analysis of vertical movements detected by radar interferometry in urban areas
Czech Academy of Sciences Publication Activity Database
Kadlečík, Pavel; Schenk, Vladimír; Seidlová, Zuzana; Schenková, Zdeňka
2010-01-01
Roč. 7, č. 3 (2010), s. 371-380 ISSN 1214-9705. [Czech-Polish Workshop on Recent Geodynamics of the Sudety Mts. and Adjacent Areas /10./. Szklarska Poreba, 05.11.2009-07.11.2009] R&D Projects: GA MŠk(CZ) LC506; GA AV ČR 1QS300460551 Institutional research plan: CEZ:AV0Z30460519 Keywords : InSAR * PSI * subsidence Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 0.452, year: 2010 www.irsm.cas.cz/abstracts/AGG/03_10/15_Kadlecik.pdf
What have the poorest countries to gain from the Doha Development Agenda (DDA)?
James Scott; Rorden Wilkinson
2010-01-01
This paper sets out to examine the likely benefits accruing to developing countries from the Doha Development Agenda (DDA) as it currently stands. In pursuit of this aim, the paper draws from the insights of both the economic and the political economy literatures in pursuit of a more fulsome account of the likely results of the DDA for poor countries. The paper begins with a review of the projected aggregate gains accruing to developing countries from a concluded DDA. It then marries this agg...
Reversible migration of silver on memorized pathways in Ag-Ge40S60 films
Directory of Open Access Journals (Sweden)
J. Orava
2015-07-01
Full Text Available Reversible and reproducible formation and dissolution of silver conductive filaments are studied in Ag-photodoped thin-film Ge40S60 subjected to electric fields. A tip-planar geometry is employed, where a conductive-atomic-force microscopy tip is the tip electrode and a silver patch is the planar electrode. We highlight an inherent “memory” effect in the amorphous chalcogenide solid-state electrolyte, in which particular silver-ion migration pathways are preserved “memorized” during writing and erasing cycles. The “memorized” pathways reflect structural changes in the photodoped chalcogenide film. Structural changes due to silver photodoping, and electrically-induced structural changes arising from silver migration, are elucidated using Raman spectroscopy. Conductive filament formation, dissolution, and electron (reduction efficiency in a lateral device geometry are related to operation of the nano-ionic Programmable Metallization Cell memory and to newly emerging chalcogenide-based lateral geometry MEMS technologies. The methods in this work can also be used for qualitative multi-parameter sampling of metal/amorphous-chalcogenide combinations, characterizing the growth/dissolution rates, retention and endurance of fractal conductive filaments, with the aim of optimizing devices.
International Nuclear Information System (INIS)
Chen, Xin; Chen, Shuangjing; Wang, Jinyu
2016-01-01
Highlights: • The screened M-G structures are very thermodynamically stable, and the stability is even higher than that of the corresponding bulk metal surfaces. • The binding energies of ORR intermediates suggest that they are not linear dependence, which are different form the cases found on some metal-based catalysts. • The Au-, Co-, and Ag-G structures could be used as the ORR catalysts. - Abstract: Graphene doping is a promising direction for developing effective oxygen reduction reaction (ORR) catalysts. In this paper, we computationally investigated the ORR performance of 10 kinds of metal-doped graphene (M-G) catalysts, namely, Al-, Si-, Mn-, Fe-, Co-, Ni-, Pd-, Ag-, Pt-, and Au-G. The results shown that the binding energies of the metal atoms incorporated into the graphene vacancy are higher than their bulk cohesive energies, indicating the formed M-G catalysts are even more stable than the corresponding bulk metal surfaces, and thus avoid the metals dissolution in the reaction environment. We demonstrated that the linear relation among the binding energies of the ORR intermediates that found on metal-based materials does not hold for the M-G catalysts, therefore a single binding energy of intermediate alone is not sufficient to evaluate the ORR activity of an arbitrary catalyst. By analysis of the detailed ORR processes, we predicted that the Au-, Co-, and Ag-G materials can be used as the ORR catalysts.
Directory of Open Access Journals (Sweden)
K. De Rauw
2014-09-01
Full Text Available In 2011, a large outbreak of infections caused by Shiga toxin-producing Escherichia coli (STEC O104:H4 occurred in Germany. This exceptionally virulent strain combined virulence factors of enteroaggregative E. coli (EAggEC and STEC. After the outbreak only a few sporadic cases of infection with this rare serotype were reported, most of which were related to travel to the Middle East or North Africa. Here we describe two cases of enteroaggregative STEC (Agg-STEC O104:H4 infection that occurred in Belgium in 2012 and 2013 respectively. In both cases travel in a Mediterranean country preceded the infection. The first strain was isolated from the stool of a 42-year-old woman presenting bloody diarrhoea, who had travelled to Tunisia the week before. The second case involves a 14-year-old girl who, upon her return from Turkey to Belgium, suffered from an episode of bloody diarrhoea and haemolytic uraemic syndrome. Extended typing of the isolates with pulsed field gel electrophoresis revealed that the strains were closely related, though not exactly the same as the 2011 outbreak strain. This report supports the previously made hypothesis that Agg-STEC has a human reservoir and might be imported by travellers coming from an area where the pathogen is endemic. Furthermore, it emphasizes the concern that these bacteria may cause future outbreaks as evenly virulent O104:H4 isolates seem to be widespread.
Directory of Open Access Journals (Sweden)
Dong Yan
2017-12-01
Full Text Available Abstract This study aimed to determine the association between the polymorphisms and haplotypes in the xeroderma pigmentosum group D (XPD gene and the risk of pancreatic cancer in the Chinese Han population. SNaPshot was used for genotyping six SNP sites of the XPD gene. Comparisons of the correlations between different genotypes in combination with smoking and the susceptibility to pancreatic cancer were performed. Individual pancreatic cancer risk in patients who carry mutant C alleles (AC, CC, and AC+CC at rs13181 increased (p < 0.05. Taking non-smoking individuals who carry the AA genotype as a reference, and non-smoking individuals who carry mutant allele C (AC+CC, the risk of pancreatic cancer increased by 3.343 times in individuals who smoked ≥ 20 cigarettes daily, 3.309 times in individuals who smoked ≥ 14 packs per year, 5.011 times in individuals who smoked ≥ 24 packs per year, and 4.013 times in the individuals who smoked ≥ 37 packs per year (P < 0.05. In addition, haplotype analysis revealed that haplotype AGG, which comprised rs13181, rs3916874 and rs238415, was associated with a 1.401-fold increase in pancreatic cancer risk (p < 0.05. We conclude that the polymorphism of XPD Lys751Gln (rs13181 in combination with smoking contributes to increased risk of pancreatic cancer in the Chinese Han population. Haplotype AGG might be a susceptibility haplotype for pancreatic cancer.
Effect of Wild Mustard (Sinapis arvensis Competition and Nitrogen Levels on
Directory of Open Access Journals (Sweden)
F Soleymani
2012-06-01
Full Text Available To investigate the effect of wild mustard plant density and nitrogen fertilizer on morphological characters, yield and yield components of canola a split-plot experiment based on a randomized complete block design with 3 replications was carried out in Bu-Ali Sina university of Hamedan, in 2009. 4 levels of nitrogen fertilization (100, 150, 200 and 250 kgN h-1 were assigned to main-plots and plant density of wild mustard at 5 levels (0, 4, 8, 16 and 32 plants m-2 to the sub-plots. Results showed that the effects of wild mustard competition on yield and components of canola was significant. 32 plants m-2 of wild mustard reduced grain and biologic yield, number of pod per plant, number of seed per pod and 1000seed weight about 28.7, 30, 40.9, 22.2 and 16 percent respectively. With more nitrogen application, number of pod per plant, number of seed per pod, 1000seed weight and grain yield was increased. By increasing nitrogen from 100 to 250 kg ha-1, grain yield was increased more than 53 percent. Increasing density of wild mustard significantly reduced all above mentioned morphological and qualitative characters, except protein percentage. By increasing nitrogen fertilizer, plant height, number of branches per plant, pod length, oil yield and protein percentage of canola were increased significantly. Overall nevertheless negative effect of weed on canola yield, seems that the application 200 kgN/ha in addition to increasing grain yield and canola oil, had less decline in weed interference.
Aerial Photogrammetry observation of the subsidence depression near Karviná
Czech Academy of Sciences Publication Activity Database
Kajzar, Vlastimil; Doležalová, Hana; Souček, Kamil; Staš, Lubomír
2011-01-01
Roč. 8, č. 3 (2011), s. 309-317 ISSN 1214-9705. [Czech-Polish Workshop on Recent Geodynamics of the Sudety Mts. and Adjacent Areas. /11./. Třešť, 04.11.2010-06.11.2010] Grant - others:GA MŠk(CZ) ED2.1.00/03/0082 Institutional research plan: CEZ:AV0Z30860518 Keywords : subsidence depression * monitoring * aerial photogrammetry * GNSS Subject RIV: DH - Mining, incl. Coal Mining Impact factor: 0.530, year: 2011 http://www.irsm.cas.cz/abstracts/AGG/03_11/12_%20Kajzar.pdf
Czech Academy of Sciences Publication Activity Database
Kajzar, Vlastimil; Doležalová, Hana; Souček, Kamil; Staš, Lubomír
2012-01-01
Roč. 9, č. 3 (2012), s. 401-407 ISSN 1214-9705. [Czech - Polish Workshop on Recent Geodynamics of the Sudeten and Adjacent Areas /12./. Jugowice, 20.10.2012-22.10.2012] R&D Projects: GA MŠk ED2.1.00/03.0082; GA MŠk(CZ) ED1.1.00/02.0070 Institutional support: RVO:68145535 Keywords : GNSS * underground mining * mining subsidence * horizontal displacements Subject RIV: DH - Mining, incl. Coal Mining Impact factor: 0.530, year: 2011 http://www.irsm.cas.cz/abstracts/AGG/03_12/15.Kajzar.pdf
Analysis of surface movements from undermining in time
Czech Academy of Sciences Publication Activity Database
Doležalová, Hana; Kajzar, Vlastimil; Souček, Kamil; Staš, Lubomír
2012-01-01
Roč. 9, č. 3 (2012), s. 389-400 ISSN 1214-9705. [Czech - Polish Workshop on Recent Geodynamics of the Sudeten and Adjacent Areas /12./. Jugowice, 20.10.2012-22.10.2012] R&D Projects: GA MŠk(CZ) ED1.1.00/02.0070; GA MŠk ED2.1.00/03.0082 Institutional support: RVO:68145535 Keywords : GNSS * mining subsidence * horizontal displacements Subject RIV: DH - Mining, incl. Coal Mining Impact factor: 0.530, year: 2011 http://www.irsm.cas.cz/abstracts/AGG/03_12/14.Dolezalova.pdf
in BALB/c mice is caused by mutations in the GJA8 locus
Indian Academy of Sciences (India)
D8mit14 ttt tca cac tca cgt gtg cg gtc tct cct tcc tgg cgc tg. 167. 142. D8mit84 ttt ggt ttg aca att gaa ggg aca acc cac ctc cag tct ca. 162. 148. D8mit94 gtt ggg gct ctg ctc tct c cac ata tgc ata cat ata cat aca cgt. 130. 156. D8mit65 ctc cta gca tct ata tcc cat ca ctc tca tat cca tat gga gga agg. 280. 234. D9mit4 tgc tga gca agc tat gag ga.
Chemical Control of Curled Dock (Rumex crispus L. and Other Weeds in Noncropped Areas
Directory of Open Access Journals (Sweden)
Tsvetanka Dimitrova
2008-01-01
Full Text Available Rumex crispus L. is an invasive species widespread in our country and in particular in the region of North Bulgaria. It is characterized by high biological and ecological plasticity. Owing to its great reproductive potential, the weed has been assigned to the list of economically most important weeds in the country. With the purpose of studying the possibility of chemical weed control in noncropped areas with heavy natural background infestation with R. crispus L. and other dicotyledonous weeds, two field trials were carried out. A ready-to-use herbicide mixture 2,4-D 140.2 g/l-1 + Triclopyr 144 g/l-1, trade product Genoxon 3X (X0050, was tested at two doses of active ingredient, 3552 and 2842 ml/ha-1. It was found that: (1 population density of Rumex crispus L. can be successfully reduced by treatment at the stage of early stem formation; herbicideefficacy with 3552 and 2882 ml/ha-1 doses on the 21st day after treatment was 100% and 90.5%, respectively, at the end of vegetation 94.4 and 85.7%, respectively; (2 herbicidal efficacy was lower when R. crispus L. was treated at the 5 - 6 leaf stage, being 100 – 94.1%and 80 – 76.5% respectively for the indicated doses and time of recording; (3 at the studied doses the herbicide controlled both annual dicotyledonous weeds (Amaranthus spp., Chenopodium album L., Portulaca oleracea L. and perennial dicotyledonous ones (Cirsiumarvense L., Sonchus arvensis L., Convolvulus arvensis L., Carduus acanthoides L., but it was not toxic to monocotyledonous weeds.
Torres, Glenda L.; Cooper, W. Rodney; Horton, David R.; Swisher, Kylie D.; Garczynski, Stephen F.; Munyaneza, Joseph E.; Barcenas, Nina M.
2015-01-01
“Candidatus Liberibacter solanacearum” (Proteobacteria) is an important pathogen of solanaceous crops (Solanales: Solanaceae) in North America and New Zealand, and is the putative causal agent of zebra chip disease of potato. This phloem-limited pathogen is transmitted to potato and other solanaceous plants by the potato psyllid, Bactericera cockerelli (Hemiptera: Triozidae). While some plants in the Convolvulaceae (Solanales) are also known hosts for B. cockerelli, previous efforts to detect Liberibacter in Convolvulaceae have been unsuccessful. Moreover, studies to determine whether Liberibacter can be acquired from these plants by B. cockerelli are lacking. The goal of this study was to determine whether horizontal transmission of Liberibacter occurs among potato psyllids on two species of Convolvulaceae, sweet potato (Ipomoea batatas) and field bindweed (Convolvulus arvensis), which grows abundantly in potato growing regions of the United States. Results indicated that uninfected psyllids acquired Liberibacter from both I. batatas and C. arvensis if infected psyllids were present on plants concurrently with the uninfected psyllids. Uninfected psyllids did not acquire Liberibacter from plants if the infected psyllids were removed from the plants before the uninfected psyllids were allowed access. In contrast with previous reports, PCR did detect the presence of Liberibacter DNA in some plants. However, visible amplicons were faint and did not correspond with acquisition of the pathogen by uninfected psyllids. None of the plants exhibited disease symptoms. Results indicate that horizontal transmission of Liberibacter among potato psyllids can occur on Convolvulaceae, and that the association between Liberibacter and Convolvulaceae merits additional attention. PMID:26555359
Güvenç, İsmail; Kaya, Yusuf
2011-01-01
ÖZET 1 Bu çalışma, Erzurum vejetasyonunda doğal olarak yetişen ve sebze olarak kullanılan yöreselbitkileri belirlemek amacıyla gerçekleştirildi. Yöreden toplanan bitki örneklerinin tamtum teşhis edildi. Sebzeolarak değerlendirilen bu bitkilerin yöresel adları bağa yaprağı (Plantago majör), ısırgan (Urtica dioica), (Sinapis arvensis), kuzu kulağı (Rumex acetocella), çaşır (Prangos uechritzii), çiriş (Asphodelus ramosus), (Rheum ribes), ...
Ecología de la germinación en especies del género Verónica (Scrophulariaceae) del SO de España
Juan, R.; Fernández, I; Pastor, Julio E.
1995-01-01
Ecología de la germinación en especies del género Veronica (Scrophulariaceae) del SO de España. Se ha realizado un estudio de germinación y viabilidad con semillas de 11 especies de Veronica del SO de España. En las pruebas de laboratorio, a 22±2 °(, la respuesta de germinación fue distinta en luz y obscuridad. En luz, V. anagallis-aquatica, V. anagalloides, V. arvensis, V. persica y V.palita alcanzaron porcentajes de germinación altos (superiores al 80%), mientras que en otras como V. cymba...
Spano, Liliana Cruz; da Cunha, Keyla Fonseca; Monfardini, Mariane Vedovatti; de Cássia Bergamaschi Fonseca, Rita; Scaletsky, Isabel Christina Affonso
2017-12-18
Diarrheagenic Escherichia coli (DEC) are important bacterial causes of childhood diarrhea in Brazil, but its impact in adults is unknown. This study aimed at investigating DEC among children and adults living in endemic areas. A total of 327 stools specimens were collected from children (n = 141) and adults (n = 186) with diarrhea attending health centers. Diarrheagenic E. coli (DEC) were identified by their virulence genes (multiplex polymerase chain reaction) and HEp-2 cell adherence patterns. DEC were detected in 56 (40%) children and 74 (39%) adults; enteroaggregative E. coli (EAEC) (23%) was the most prevalent pathotype, followed by diffusely adherent E. coli (DAEC) (13%), and occurred at similar frequencies in both diarrheal groups. Atypical enteropathogenic E. coli (aEPEC) strains were recovered more frequently from children (6%) than from adults (1%). Twenty-six percent of the EAEC were classified as typical EAEC possessing aggR gene, and carried the aap gene. EAEC strains carrying aggR-aap-aatA genes were significantly more frequent among children than adults (p < 0.05). DAEC strains possessing Afa/Dr. genes were detected from children (10%) and adults (6%). EAEC and DAEC strains harboring genes for the EAST1 (astA), Pet, Pic, and Sat toxins were common in both diarrheal groups. The astA and the porcine AE/associated adhesin (paa) genes were found in most of aEPEC strains. High levels of resistance to antimicrobial drugs were found among DAEC and aEPEC isolates. The results show a high proportion of EAEC and DAEC carrying toxin-encoding genes among adults with diarrhea.
Yakupoglu, Tugrul; Gundogan, Recep; Dindaroglu, Turgay; Kara, Zekeriya
2017-10-29
Land-use change through degrading natural vegetation for agricultural production adversely affects many of soil properties particularly organic carbon content of soils. The native shrub land and grassland of Gaziantep-Adiyaman plateau that is an important pistachio growing eco-region have been cleared to convert into pistachio orchard for the last 50 to 60 years. In this study, the effects of conversion of natural vegetation into agricultural uses on soil erodibility have been investigated. Soil samples were collected from surface of agricultural fields and adjacent natural vegetation areas, and samples were analyzed for some soil erodibility indices such as dispersion ratio (DR), erosion ratio (ER), structural stability index (SSI), Henin's instability index (I s ), and aggregate size distribution after wet sieving (AggSD). According to the statistical evaluation, these two areas were found as different from each other in terms of erosion indices except for I s index (P < 0.001 for DR and ER or P < 0.01 for SSI). In addition, native shrub land and converted land to agriculture were found different in terms of AggSD in all aggregate size groups. As a contrary to expectations, correlation tests showed that there were no any interaction between soil organic carbon and measured erodibility indices in two areas. In addition, significant relationships were determined between measured variables and soil textural fractions as statistical. These obtaining findings were attributed to changing of textural component distribution and initial aggregate size distribution results from land-use change in the study area. Study results were explained about hierarchical aggregate formation mechanism.
Digital Repository Service at National Institute of Oceanography (India)
KrishnaKumari, L.; Kaisary, S.; Rodrigues, V.
distributed along the coast of Goa and forms an inexpensive and delicious seafood among recorded as Ag/g dry weight in the whole soft tissue was 3.8, 30.3, 13.5, estuary, Goa. Clams were categorised into two groups, 25–35 mm (small size) and 35–40 mm (big size.... Concentration factor was determined as a ratio of mean metal content (dissolved) in water (Ag/l) and that in the soft tissue (Ag/kg wet weight). All the analyses were carried out in duplicate, and the average values are reported in this paper. 3. Results...
Evaluation of vertical and horizontal movements in the subsidence depression near Karviná
Czech Academy of Sciences Publication Activity Database
Doležalová, Hana; Kajzar, Vlastimil; Souček, Kamil; Staš, Lubomír
2010-01-01
Roč. 7, č. 3 (2010), s. 355-361 ISSN 1214-9705. [Czech-Polish Workshop on recent geodynamics of the Sudety Mts. and adjacent areas /10./. Sklarska Poreba, 05.11.2009-07.11.2009] R&D Projects: GA ČR GA105/07/1586; GA ČR GA105/07/0878 Institutional research plan: CEZ:AV0Z30860518 Keywords : subsidence depression * GPS * horizontal shifts Subject RIV: DH - Mining, incl. Coal Mining Impact factor: 0.452, year: 2010 http://www.irsm.cas.cz/?Lang=CZE&Menu=25,29,0,0;&File=Obsah/AGG/Contents/AGGC7_3%28159%2910.htm
3-Loop massive O(T2F) contributions to the DIS operator matrix element Agg
International Nuclear Information System (INIS)
Ablinger, J.; Schneider, C.; Bluemlein, J.; Freitas, A. de; Hasselhuhn, A.; Round, M.; Manteuffel, A. von
2014-09-01
Contributions to heavy flavour transition matrix elements in the variable flavour number scheme are considered at 3-loop order. In particular a calculation of the diagrams with two equal masses that contribute to the massive operator matrix element A (3) gg,Q is performed. In the Mellin space result one finds finite nested binomial sums. In x-space these sums correspond to iterated integrals over an alphabet containing also square-root valued letters.
Kosovac, Andrea; Johannesen, Jes; Krstić, Oliver; Mitrović, Milana; Cvrković, Tatjana; Toševski, Ivo; Jović, Jelena
2018-01-01
The stolbur phytoplasma vector Hyalesthes obsoletus is generally considered as a polyphagous species associated with numerous wild and cultivated plants. However, recent research in southeastern Europe, the distribution centre of H. obsoletus and the area of most stolbur-inflicted crop diseases, points toward specific host-plant associations of the vector, indicating specific vector-based transmission routes. Here, we study the specificity of populations associated with four host-plants using mitochondrial and nuclear genetic markers, and we evaluate the evolution of host-shifts in H. obsoletus. Host-plant use was confirmed for Convolvulus arvensis, Urtica dioica, Vitex agnus-castus and Crepis foetida. Mitochondrial genetic analysis showed sympatric occurrence of three phylogenetic lineages that were ecologically delineated by host-plant preference, but were morphologically inseparable. Nuclear data supported the existence of three genetic groups (Evanno's ΔK(3) = 803.72) with average genetic membership probabilities > 90%. While populations associated with C. arvensis and U. dioica form a homogenous group, populations affiliated with V. agnus-castus and C. foetida constitute two independent plant-associated lineages. The geographical signal permeating the surveyed populations indicated complex diversification processes associated with host-plant selection and likely derived from post-glacial refugia in the eastern Mediterranean. This study provides evidence for cryptic species diversification within H. obsoletus sensu lato: i) consistent mitochondrial differentiation (1.1-1.5%) among host-associated populations in syntopy and in geographically distant areas, ii) nuclear genetic variance supporting mitochondrial data, and iii) average mitochondrial genetic distances among host-associated meta-populations are comparable to the most closely related, morphologically distinguishable species, i.e., Hyalesthes thracicus (2.1-3.3%).
Directory of Open Access Journals (Sweden)
Andrea Kosovac
Full Text Available The stolbur phytoplasma vector Hyalesthes obsoletus is generally considered as a polyphagous species associated with numerous wild and cultivated plants. However, recent research in southeastern Europe, the distribution centre of H. obsoletus and the area of most stolbur-inflicted crop diseases, points toward specific host-plant associations of the vector, indicating specific vector-based transmission routes. Here, we study the specificity of populations associated with four host-plants using mitochondrial and nuclear genetic markers, and we evaluate the evolution of host-shifts in H. obsoletus. Host-plant use was confirmed for Convolvulus arvensis, Urtica dioica, Vitex agnus-castus and Crepis foetida. Mitochondrial genetic analysis showed sympatric occurrence of three phylogenetic lineages that were ecologically delineated by host-plant preference, but were morphologically inseparable. Nuclear data supported the existence of three genetic groups (Evanno's ΔK(3 = 803.72 with average genetic membership probabilities > 90%. While populations associated with C. arvensis and U. dioica form a homogenous group, populations affiliated with V. agnus-castus and C. foetida constitute two independent plant-associated lineages. The geographical signal permeating the surveyed populations indicated complex diversification processes associated with host-plant selection and likely derived from post-glacial refugia in the eastern Mediterranean. This study provides evidence for cryptic species diversification within H. obsoletus sensu lato: i consistent mitochondrial differentiation (1.1-1.5% among host-associated populations in syntopy and in geographically distant areas, ii nuclear genetic variance supporting mitochondrial data, and iii average mitochondrial genetic distances among host-associated meta-populations are comparable to the most closely related, morphologically distinguishable species, i.e., Hyalesthes thracicus (2.1-3.3%.
Kosovac, Andrea; Johannesen, Jes; Krstić, Oliver; Cvrković, Tatjana; Toševski, Ivo
2018-01-01
The stolbur phytoplasma vector Hyalesthes obsoletus is generally considered as a polyphagous species associated with numerous wild and cultivated plants. However, recent research in southeastern Europe, the distribution centre of H. obsoletus and the area of most stolbur-inflicted crop diseases, points toward specific host-plant associations of the vector, indicating specific vector-based transmission routes. Here, we study the specificity of populations associated with four host-plants using mitochondrial and nuclear genetic markers, and we evaluate the evolution of host-shifts in H. obsoletus. Host-plant use was confirmed for Convolvulus arvensis, Urtica dioica, Vitex agnus-castus and Crepis foetida. Mitochondrial genetic analysis showed sympatric occurrence of three phylogenetic lineages that were ecologically delineated by host-plant preference, but were morphologically inseparable. Nuclear data supported the existence of three genetic groups (Evanno’s ΔK(3) = 803.72) with average genetic membership probabilities > 90%. While populations associated with C. arvensis and U. dioica form a homogenous group, populations affiliated with V. agnus-castus and C. foetida constitute two independent plant-associated lineages. The geographical signal permeating the surveyed populations indicated complex diversification processes associated with host-plant selection and likely derived from post-glacial refugia in the eastern Mediterranean. This study provides evidence for cryptic species diversification within H. obsoletus sensu lato: i) consistent mitochondrial differentiation (1.1–1.5%) among host-associated populations in syntopy and in geographically distant areas, ii) nuclear genetic variance supporting mitochondrial data, and iii) average mitochondrial genetic distances among host-associated meta-populations are comparable to the most closely related, morphologically distinguishable species, i.e., Hyalesthes thracicus (2.1–3.3%). PMID:29738577
Directory of Open Access Journals (Sweden)
Elżbieta Harasim
2013-07-01
Full Text Available A field study was conducted in the period 2004–2007 on grey-brown podzolic soil (sandy. This study analysed the relationship between the use of stem shortening in cereals by means of retardants with the following active substances: chlormequat chloride (Antywylegacz Płynny 675 SL, trinexapac-ethyl (Moddus 250 EC, chlormequat chloride + ethephon (Cecefon 465 SL, and weed infestation. The retardants were applied at the 1st node stage (BBCH 31 – Antywylegacz Płynny 675 SL and the 2nd node stage of winter wheat (BBCH 32 – Moddus 250 EC and Cecefon 465 SL, together with the adjuvant Atpolan 80 EC (75% of SN 200 mineral oil or without the adjuvant. Winter wheat, cv. 'Muza', was grown after vetch grown for seed. The whole experiment was sprayed with the herbicides Apyros 75 WG and Starane 250 EC at the full tillering stage (BBCH 29–30. Plots where no growth regulators were used were the control treatment. Weed density and biomass showed great variation between years. In the winter wheat crop, Veronica persica, Viola arvensis, Veronica arvensis, Capsella bursa-pastoris,and Chenopodium album dominated in the dicotyledonous class, whereas Apera spica-venti, Echinochloa crus-galli,and Elymus repens were predominant among monocotyledonous plants. The level of weed infestation of the winter wheat crop, as measured by the number and air-dry weight of weeds, was significantly differentiated by years and retardants used as well as by interactions of these factors. The adjuvant Atpolan 80 EC did not have a significant effect on the above-mentioned weed infestation parameters. .
Fitness consequences of indirect plant defence in the annual weed, Sinapis arvensis
Gols, R.; Wagenaar, R.; Poelman, E.H.; Kruidhof, H.M.; van Loon, J.J.A.; Harvey, J.A.
2015-01-01
Plant traits that enhance the attraction of the natural enemies of their herbivores have been postulated to function as an 'indirect defence'. An important underlying assumption is that this enhanced attraction results in increased plant fitness due to reduced herbivory. This assumption has been
Fitness consequences of indirect plant defence in the annual weed, Sinapis arvensis
Gols, Rieta; Wagenaar, Roel; Poelman, Erik H.; Kruidhof, H. Marjolein; van Loon, Joop J.A.; Harvey, Jeffrey A.
2015-01-01
* Plant traits that enhance the attraction of the natural enemies of their herbivores have been postulated to function as an ‘indirect defence’. An important underlying assumption is that this enhanced attraction results in increased plant fitness due to reduced herbivory. This assumption has been
Fitness consequences of indirect plant defence in the annual weed, Sinapis arvensis
Gols, R.; Wagenaar, R.; Poelman, E.H.; Kruidhof, M.; Loon, van J.J.A.; Harvey, J.A.
2015-01-01
1. Plant traits that enhance the attraction of the natural enemies of their herbivores have been postulated to function as an ‘indirect defence’. An important underlying assumption is that this enhanced attraction results in increased plant fitness due to reduced herbivory. This assumption has been
Energy Technology Data Exchange (ETDEWEB)
Sigal, R.J.; Doria, A.; Warram, J.H.; Krolewski, A.S. [Joslin Diabetes Center, Boston, MA (United States)
1996-04-01
Because of the role of insulin receptor substrate-1 in insulin action, the insulin receptor substrate-1 gene is a candidate gene for noninsulin-dependent diabetes mellitus (NIDDM). Modest associations between NIDDM and a GGG-AGG single base substitution (corresponding to a glycine-arginine amino acid substitution) in codon 972 of the gene have been found, but none reached statistical significance. To examine further how large a proportion of NIDDM cases could be caused by the mutation, we performed a stratified analysis combining the results from the 6 earlier studies and those from our panel of 192 unrelated NIDDM subjects and 104 healthy controls. In addition, we looked for a possibility that the codon 972 mutation plays a role only in the presence of certain conditions. Genomic DNA samples obtained from NIDDM cases and healthy controls were genotyped using a PCR-restriction fragment length polymorphism protocol modified for genomic DNA. The GGG{r_arrow}AGG substitution was found in 5.7% of the diabetic subjects (11 of 192) and 6.9% of the controls (7 of 104). The difference between groups was not statistically significant, and it was not different from the results of other studies. The Mantel-Haenszel summary odds ratio across all studies was 1.49 (P < 0.05; 95% confidence intervals, 1.01-2.2). This summary odds ratio is consistent with a small proportion of NIDDM cases ({approximately}3%) being caused by the mutation. Exploratory subgroup analyses on our panel suggested a clustering of NIDDM, the codon 972 mutation, and overweight, raising the hypothesis that the mutation may predispose to NIDDM only in the presence of excess body weight. 9 refs., 2 tabs.
Li, Hui; Huang, Linjian; Xie, Qianyang; Cai, Xieyi; Yang, Chi; Wang, Shaoyi; Zhang, Min
2017-01-01
To investigate the effects of gradient mechanical pressure on chondrocyte proliferation, apoptosis, and the expression of markers of chondrogenesis and chondrocyte hypertrophy. Mandibular condylar chondrocytes from 5 rabbits were cultured in vitro, and pressed with static pressures of 50kPa, 100kPa, 150kPa and 200kPa for 3h, respectively. The chondrocytes cultured without pressure (0kPa) were used as control. Cell proliferation, apoptosis, and the expression of aggrecan (AGG), collagen II (COL2), collagen X (COL10), alkaline phosphatase (ALP) were investigated. Ultrastructures of the pressurized chondrocytes under transmission electron microscopy (TEM) were observed. Chondrocyte proliferation increased at 100kPa and decreased at 200kPa. Chondrocyte apoptosis increased with peak pressure at 200kPa in a dose-dependent manner. Chondrocyte necrosis increased at 200kPa. The expression of AGG increased at 200kPa. The expression of COL2 decreased at 50kPa and increased at 150kPa. The expression of COL10 and ALP increased at 150kPa. Ultrastructure of the pressurized chondrocytes under TEM showed: at 100kPa, cells were enlarged with less cellular microvillus and a bigger nucleus; at 200kPa, cells shrank with the sign of apoptosis, and apoptosis cells were found. The mechanical loading of 150kPa is the moderate pressure for chondrocyte: cell proliferation and apoptosis is balanced, necrosis is reduced, and chondrogenesis and chondrocyte hypertrophy are promoted. When the pressure is lower, chondrogenesis and chondrocyte hypertrophy are inhibited. At 200kPa, degeneration of cartilage is implied. Copyright © 2016 Elsevier Ltd. All rights reserved.
Comparison of three tracers for detecting lung epithelial injury in anesthetized sheep
International Nuclear Information System (INIS)
Peterson, B.T.; Dickerson, K.D.; James, H.L.; Miller, E.J.; McLarty, J.W.; Holiday, D.B.
1989-01-01
We compared the ability of three aerosolized tracers to discriminate among control, lung inflation with a positive end expired pressure of 10 cmH 2 O, lung vascular hypertension and edema without lung injury, and lung edema with lung injury due to intravenous oleic acid. The tracers were 99m Tc-diethylenetriaminepentaacetate ( 99m Tc-DTPA, mol wt 492), 99m Tc-human serum albumin ( 99m Tc-ALB, mol wt 69,000), and 99m Tc-aggregated albumin ( 99m Tc-AGG ALB, mol wt 383,000). 99m Tc-DTPA clearance measurements were not able to discriminate lung injury from lung inflation. The 99m Tc-AGG ALB clearance rate was unchanged by lung inflation and increased slightly with lung injury. The 99mTc-ALB clearance rate (0.06 +/- 0.02%/min) was unchanged by lung inflation (0.09 +/- 0.02%/min, P greater than 0.05) or 4 h of hypertension without injury (0.09 +/- 0.04%/min, P greater than 0.05). Deposition of 99m Tc-ALB within 15 min of the administration of the oleic acid increased the clearance rate to 0.19 +/- 0.06%/min, which correlated well with the postmortem lung water volume (r = 0.92, P less than 0.01). This did not occur when there was a 60-min delay in the deposition of 99m Tc-ALB. We conclude that 99m Tc-ALB is the best indicator for studying the effects of lung epithelial injury on protein and fluid transport into and out of the air spaces of the lungs in a minimally invasive manner
Use of AFLP marker system on sugarcane somaclones to study their resistance to rust
Directory of Open Access Journals (Sweden)
María Ileana Oloriz
2002-10-01
Full Text Available AFLPs (amplified fragment length polymorphism was carried out from genomic DNA of five rust resistant sugar cane somaclons and their susceptible donor, Saccharum officinarum var B 4362, using three combinations of primers (EcoRI/aca: MseI/acc; EcoRI/aca: MseI/atg and EcoRI/aca: MseI/agg. Six polymorphic bands were obtained, two of these only appeared in the resistant genotypes, which are probably DNA sequences, related to rust resistance locus. These fragments have been cloned to study their nucleotide sequence and to investigate their roll in resistance mechanism develop by these mutants during Puccinia melanocephala infection. Key words: molecular markers, Puccinia. melanocephala, Saccharum
Mitochondrial genome of the bull shark Carcharhinus leucas (Carcharhiniformes: Carcharhinidae).
Chen, Xiao; Liu, Min; Peng, Zaiqing; Shi, Xiaofang
2015-01-01
The bull shark Carcharhinus leucas is a large elasmobranch species widespread in tropical and warm oceans, rivers and lakes. We first determine the complete mitogenome of C. leucas in this article. It is 16,704 bp in length, consists 37 genes and one control region with the typical gene order in vertebrates. The ND6 gene used the rare AGG as stop codon. The 22 tRNA genes ranged from 67 to 75 bp. The tRNA-Ser2 lacks the dihydrouridine arm and cannot form the typical cloverleaf structure. The control region is 1066 bp in length with high A+T and low G contents.
Herbicide on Weed Composition, Diversity and Density in Silage Corn (cv. Sc 704
Directory of Open Access Journals (Sweden)
M. Zafarian
2012-07-01
Full Text Available In order to study the effect of plant density, planting pattern and herbicide dosage of nicosulfuron, a field experiment was arranged in a factorial split plot treatments based on RCBD with three replications in Chenaran, Khorasan Razavi, in 2010. The experimental treatments consisted of a factorial plant density (100000, 120000 and 140000 plants ha-1 in the planting pattern (single and double row as main plot and herbicide dosage of nicousulforon in four levels (0, 1, 1/5 and 2, l.ha-1 as sub-plot. Samplings were made at in five stages (37days after the emergence of corn and it was repeated once per 20 days. The results indicated reducing the weed density and dry matter of weeds in the first stage after the herbicide treatment. Moreover, it was observed a significant interaction effect between plant density with planting pattern and between planting pattern with herbicides dosages during growth season on reducing weed density and dry matter. Also results indicated that in between of this experiment's treatments, nicosulfuron herbicide reduced weed density at the beginning of growth season and double row planting pattern suppressed weed density during growing season, and resulted in lowest Jacard similarity index (Sj of weed species. Results also indicated that with increasing of plant density and herbicide dosage especially in composition of double row planting pattern, according to Shannon- Wiener index, sensitive population such as common purslane (Portulaca oleracea L., buckhorn plantain (Plantago lanceolata L., prostrate knotweed (Polygonum aviculareL., black nightshade (Solanum nigrum L. and Johnson grass (Sorghum halepens L. was reduced in during growing season. Simpson dominance index, showed that some low populated weeds such as redroot pigweed (Amaranthus retroflexus L., common lambsquarters (Chenopodium album L., field bindweed (Convolvulus arvensis L. and Canada thistle (Circum arvensis L. persisted their growth up to the end of
Energy Technology Data Exchange (ETDEWEB)
Dubey, K. A.; Bhardwaj, Y. K.; Chaudhari, C. V.; Varshney, L. [Radiation Technology Development Division, Bhabha Atomic Research Centre (India)
2014-07-15
Radiation-processed natural polymers and their derivatives, namely starch, alginate, chitosan and carboxymethyl cellulose (CMC) were explored for different agricultural applications such as biodegradable mulch films, super adsorbent polymers (SAPs), and plant growth promoters (PGPs). It was observed that gamma radiation-processed starch can lead to a better processability of starch/synthetic polymer alloys, and can offer tuneable biodegradability (as low as one month) with acceptable physico-mechanical properties. Acrylic acid/CMC-based SAP was prepared using {sup 60}Co gamma radiation, for soil conditioning. The equilibrium degree of swelling (EDS) of the acrylic acid/CMC SAP was found to be 460 g/g. The field trial of the SAP was conducted on sorghum. It was found that, with the use of 20 kg/ha of SAP, the crop yield can be increased by almost 18.5% whereas the increase in plant height was 8.5%. A new super adsorbent polymer with a much higher water uptake capacity was also developed by adding a small fraction of carrageenan to neutralized acrylic acid (AA). This SAP had EDS of 800 g/g, with the addition of only 1% carrageenan. Experiments to check the soil conditioning efficacy of AA/carrageenan SAP are in progress. Oligomers of chitosan and alginates were prepared by gamma irradiation and were tried as plant growth promoters in wheat (Triticum aestivum), mung bean (Vigna radiata), linseed (Linum usitatissimum), mentha (Mentha arvensis), and lemon grass. The results suggest that these oligomers have a significant impact on the grain and oil yield. Large scale field trials on Mentha arvensis in collaboration with an industry are in progress, and efforts are going on to formulate a policy framework for the use of oligosaccharides as plant growth promoters. (author)
Weed occurrence in Finnish coastal regions: a survey of organically cropped spring cereals
Directory of Open Access Journals (Sweden)
P. RIESINGER
2008-12-01
Full Text Available Weed communities of organically cropped spring cereal stands in the southern and the northwestern coastal regions of Finland (= south and northwest, respectively were compared with respect to number of species, frequency of occurrence, density and dry weight. Regional specialization of agricultural production along with differences in climate and soil properties were expected to generate differences in weed communities between south and northwest. Total and average numbers of species were higher in the south than in the northwest (33 vs. 26 and 15.6 vs. 10.0, respectively. Some rare species (e.g. Papaver dubium were found in the south. Fumaria officinalis and Lamium spp. were found only in the south. The densities and dry weights of Lapsana communis, Myosotis arvensis, Polygonum aviculare, Tripleurospermum inodorum and Vicia spp. were higher in the south, while the densities and dry weights of Elymus repens, Persicaria spp. and Spergula arvensis were higher in the northwest. Total density of weeds did not differ between south and northwest (average = 565 vs. 570 shoots m-2, respectively. Total dry weight of weeds was higher in the northwest compared with the south (average = 1594 vs. 697 kg ha-1, respectively, mainly due to the high dry weight of E. repens. The only variable that was dependent on the duration of organic farming was weed density in the south. The abundance of nitrophilous in relation to non-nitrophilous weed species was higher while the abundance of perennial ruderal and grassland weed species was lower compared with previous weed surveys. This can be regarded as the result of increasing cropping intensity on organic farms in Finland. Different weed communities call for the application of specific target-oriented weed management in the respective coastal regions.;
Directory of Open Access Journals (Sweden)
Grazia Disciglio
2017-12-01
Full Text Available This study investigated the qualitative characteristics of several edible wild herbaceous species, including those most consumed in Foggia Province (southern Italy. Analysis of qualitative characteristics was performed for the edible parts of 11 wild species (Beta vulgaris L., Foeniculum vulgare Miller, Centaurea solstitialis L., Cichorium intybus L., Scolymus hispanicus L., Sonchus oleraceus L., Borago officinalis L., Diplotaxis erucoides L., Diplotaxis tenuifolia (L. DC, Sinapis arvensis L., Portulaca oleracea L. and three cultivated species (C. intybus, B. officinalis, D. tenuifolia. The plants were collected from areas in the Foggia countryside, and the edible part of each species was analysed for dry matter, protein, cation and anion contents as well as total phenols and antioxidant activities. Among the cations, calcium was the most differentiated among species, ranging 784 mg kg–1 fresh weight (Fw for B. vulgaris to 5886 mg kg–1 Fw for S. hispanicus. The nitrate contents were also highly variable, from 75 mg kg–1 Fw for C. intybus to 3874 mg kg–1 Fw for D. tenuifolia. Total polyphenols ranged from 1054 mg gallic acid equivalents (GAE mg kg–1 Fw for C. solstitialis to 3664 mg GAE mg kg–1 Fw for S. arvensis. Antioxidant activities ranged from 839 mg Trolox equivalents (TE kg–1 Fw for B. vulgaris to 5658 mg TE kg–1 Fw for C. intybus. Significant differences were also noted between wild and cultivated plants in the qualitative parameters. Total polyphenols and antioxidant activity were higher in wild C. intybus and B. officinalis than in their cultivated counterparts. Multivariate analysis (cluster analysis and linear discriminant analysis allowed integration of the ANOVA data to determine the qualitative characteristics of the wild species that contribute most to group differences. The results of the present study aims to improve current knowledge about edible wild species as vegetable sources in the Mediterranean diet.
Czech Academy of Sciences Publication Activity Database
Šerá, Božena; Novák, František
2011-01-01
Roč. 66, č. 3 (2011), s. 470-476 ISSN 0006-3088 Institutional research plan: CEZ:AV0Z60870520; CEZ:AV0Z60660521 Keywords : Chenopodium album * growth stimulation * humic substance * lignite * seed germination Subject RIV: EH - Ecology, Behaviour Impact factor: 0.557, year: 2011
Mancini, Emilia; De Martino, Laura; Malova, Hanna; De Feo, Vincenzo
2013-01-01
The chemical composition of the essential oil from aerial parts of Calamintha nepeta (L.) Savi, collected in the Campania Region, was obtained by hydrodistillation and analyzed by GC and GC-MS. In all, 42 compounds were identified. The oil was characterized by a prevalence of the sesquiterpenic fraction (80.8%). The main components were 1,10-di-epi-cubenol (18.5%), allo-aromadendrene epoxide (11.4%) and cadalene (5.7%). The essential oil was evaluated for its in vitro potential phytotoxic activity against germination and initial radical growth of Raphanus sativus L., Lepidium sativum L., Sinapis arvensis L., Triticum durum L. and Phalaris canariensis L. seeds. The essential oil showed no antioxidant activity.
The W alloying effect on thermal stability and hardening of nanostructured Cu–W alloyed thin films
Zhao, J. T.; Zhang, J. Y.; Hou, Z. Q.; Wu, K.; Feng, X. B.; Liu, G.; Sun, J.
2018-05-01
In order to achieve desired mechanical properties of alloys by manipulating grain boundaries (GBs) via solute decoration, it is of great significance to understand the underlying mechanisms of microstructural evolution and plastic deformation. In this work, nanocrystalline (NC) Cu–W alloyed films with W concentrations spanning from 0 to 40 at% were prepared by using magnetron sputtering. Thermal stability (within the temperature range of 200 °C–600 °C) and hardness of the films were investigated by using the x-ray diffraction, transmission electron microscope (TEM) and nanoindentation, respectively. The NC pure Cu film exhibited substantial grain growth upon all annealing temperatures. The Cu–W alloyed films, however, displayed distinct microstructural evolution that depended not only on the W concentration but also on the annealing temperature. At a low temperature of 200 °C, all the Cu–W alloyed films were highly stable, with unconspicuous change in grain sizes. At high temperatures of 400 °C and 600 °C, the microstructural evolution was greatly controlled by the W concentrations. The Cu–W films with low W concentration manifested abnormal grain growth (AGG), while the ones with high W concentrations showed phase separation. TEM observations unveiled that the AGG in the Cu–W alloyed thin films was rationalized by GB migration. Nanoindentation results showed that, although the hardness of both the as-deposited and annealed Cu–W alloyed thin films monotonically increased with W concentrations, a transition from annealing hardening to annealing softening was interestingly observed at the critical W addition of ∼25 at%. It was further revealed that an enhanced GB segregation associated with detwinning was responsible for the annealing hardening, while a reduced solid solution hardening for the annealing softening.
The W alloying effect on thermal stability and hardening of nanostructured Cu-W alloyed thin films.
Zhao, J T; Zhang, J Y; Hou, Z Q; Wu, K; Feng, X B; Liu, G; Sun, J
2018-05-11
In order to achieve desired mechanical properties of alloys by manipulating grain boundaries (GBs) via solute decoration, it is of great significance to understand the underlying mechanisms of microstructural evolution and plastic deformation. In this work, nanocrystalline (NC) Cu-W alloyed films with W concentrations spanning from 0 to 40 at% were prepared by using magnetron sputtering. Thermal stability (within the temperature range of 200 °C-600 °C) and hardness of the films were investigated by using the x-ray diffraction, transmission electron microscope (TEM) and nanoindentation, respectively. The NC pure Cu film exhibited substantial grain growth upon all annealing temperatures. The Cu-W alloyed films, however, displayed distinct microstructural evolution that depended not only on the W concentration but also on the annealing temperature. At a low temperature of 200 °C, all the Cu-W alloyed films were highly stable, with unconspicuous change in grain sizes. At high temperatures of 400 °C and 600 °C, the microstructural evolution was greatly controlled by the W concentrations. The Cu-W films with low W concentration manifested abnormal grain growth (AGG), while the ones with high W concentrations showed phase separation. TEM observations unveiled that the AGG in the Cu-W alloyed thin films was rationalized by GB migration. Nanoindentation results showed that, although the hardness of both the as-deposited and annealed Cu-W alloyed thin films monotonically increased with W concentrations, a transition from annealing hardening to annealing softening was interestingly observed at the critical W addition of ∼25 at%. It was further revealed that an enhanced GB segregation associated with detwinning was responsible for the annealing hardening, while a reduced solid solution hardening for the annealing softening.
International Nuclear Information System (INIS)
Rub, Malik Abdul; Khan, Farah; Sheikh, Mohmad Shafi; Azum, Naved; Asiri, Abdullah M.
2016-01-01
Highlights: • Interaction between (IBF + TX-100) mixtures has been investigated. • (IBF + TX-100) mixtures exhibit synergistic behavior. • Urea increases the surface charge of the micelles resulting halt of the micelles formation. • N agg , K sv and dielectric constant of mixed systems have also been evaluated. • 1 H NMR data suggested that IBF and TX-100 interacts through hydrophobic as well as hydrophillic interaction. - Abstract: The desirable surface/bulk properties for specific applications of drug sodium salt of ibuprofen (IBF) and Triton X-100 (TX-100) can be achieved by adjusting mainly the composition of these systems. The interactions of anionic drug IBF with non-ionic surfactant TX-100 micelles have been investigated using tensiometry, fluorometry and 1 H NMR in aqueous as well in 250 mmol⋅kg −1 urea solutions. Different theoretical models like Clint, Rubingh, and Rosen, etc. were utilized to get information about the nature of interaction between these two in bulk and at the interface. These models disclose that the non-ideal behavior with attractive interaction in bulk and at the interface exists. The steady-state fluorescence quenching study was employed to evaluate micelle aggregation numbers (N agg ), which signify the involvement of surfactant was forever higher compared to IBF. Stern–Volmer binding constants (K sv ), micropolarity (I 1 /I 3 ) and dielectric constant (D exp ) of the mixtures are also obtained using fluorescence method. By the addition of urea raise in the surface charge of the micelles was observed followed by halt of the micellization of drug and surfactant as well as their mixture, therefore cmc values increases followed by decrease in aggregation number. The 1 H NMR resonance intensity variations were paralleled by upfield shifts in the resonance frequencies, due to an increased shielding of IBF happening from closeness of the non-ionic TX-100 surfactant.
Germination of Chenopodium Album in Response to Microwave Plasma Treatment
International Nuclear Information System (INIS)
Sera, Bozena; Stranak, Vitezslav; Sery, Michal; Spatenka, Petr; Tichy, Milan
2008-01-01
The seeds of Lamb's Quarters (Chenopodium album agg.) were stimulated by low-pressure discharge. The tested seeds were exposed to plasma discharge for different time durations (from 6 minutes to 48 minutes). Germination tests were performed under specified laboratory conditions during seven days in five identical and completely independent experiments. Significant differences between the control and plasma-treated seeds were observed. The treated seeds showed structural changes on the surface of the seat coat. They germinated faster and their sprout accretion on the first day of seed germination was longer. Germination rate for the untreated seeds was 15% while it increased approximately three times (max 55%) for seeds treated by plasma from 12 minutes to 48 minutes.
VEGETATIVE COMPATIBILITY OF Fusarium oxysporum ISOLATED FROM WEEDS IN EASTERN CROATIA
Directory of Open Access Journals (Sweden)
Jelena Ilić
2013-06-01
Full Text Available Different formae speciales of Fusarium oxysporum are the main causal agent of Fusarium wilts. In 2008 and 2009 we collected F. oxysporum samples from symptomless Abutilon theophrasti, Xanthium strumarium, Chenopodium album, Matricaria perforata, Ambrosia artemisiifolia, Polygonum lapathifolium, Sonchus arvensis, Amaranthus blitoides, Amaranthus retroflexus, Datura stramonium, Sorghum halepense and Hibiscus trionum. Only 16 out of 41 isolates of F. oxysporum yielded nit mutants. The frequency of nit3 mutants was higher (43% than the frequency of nit1 (35% and NitM (22% mutants. Two vegetative compatibility groups (VCGs of F. oxysporum were determined in the complementation tests. These results stress out the problem with isolation of nit mutants and show a high genetic diversity of F. oxysporum isolated from weeds.
Chemical composition and biological activities of essential oils of Pinus patula.
Amri, Ismail; Lamia, Hamrouni; Gargouri, Samia; Hanana, Mohsen; Mahfoudhia, Mariem; Fezzani, Tarek; Ezzeddine, Ferjani; Jamoussi, Bassem
2011-10-01
Essential oils isolated from needles of Pinus patula by hydrodistillation were analyzed by gas chromatography-flame ionization detection (GC-FID) and gas chromatography mass spectrometry (GC-MS). Thirty-eight compounds were identified, representing 98.3% of the total oil. The oil was rich in monoterpene hydrocarbons (62.4%), particularly alpha-pinene (35.2%) and beta-phellandrene (19.5%). The in vitro antifungal assay showed that P. patula oil significantly inhibited the growth of 9 plant pathogenic fungi. The oil, when tested on Sinapis arvensis, Lolium rigidum, Phalaris canariensis and Trifolium campestre, completely inhibited seed germination and seedling growth of all species. Our preliminary results showed that P. patula essential oil could be valorized for the control of weeds and fungal plant diseases.
Stubble field plant communities of the Mazowiecki Landscape Park
Directory of Open Access Journals (Sweden)
Teresa Skrajna
2012-12-01
Full Text Available The characteristics of communities found in unploughed stubble fields of the Mazowiecki Landscape Park and its agricultural buffer zone are presented in the paper. The association Echinochloo-Setarietum divided into a typical variant, the variant with Galinsoga parviflora, and the variant with Bidens tripartite, was the most frequently noted and floristically differentiated association. Patches of Digitarietum ischaemi were also frequently observed in stubble fields on the poorest habitats. Rarely, on fertile soils, small patches of floristically rich communities with Veronica agrestis were recorded. Periodically, excessively wet habitats were seldom occupied by the speciesrichest phytocoenoses of Centunculo-Anthoceretum punctati. Single patches of the community with Setaria pumila, the form with Aphanes arvensis, were observed only in the south-eastern part of the Park.
Allelopatic potential of weeds under the minimalization of soil treatment
Directory of Open Access Journals (Sweden)
Mikhail A. Mazirov
2014-01-01
Full Text Available The content of water-dispersible phenol substances in rhizosphere both of annual and perennial species of weeds (Cirsium arvense, Sonchus arvensis increases under soil treatment minimalization. The higher content of phenol substances of researched weeds is defined in rhizosphere of Common Couch (Agropyrum repens. The absence of intensive anthropogenic treatment of plowing layer which accumulates the significant mass of weed’s roots in the cause of much more higher allelopathic potential of some species’ of weeds. The high level of saturation by weeds in agrophytocoenosis under non-tillage soil treatment is defines the competitiveness between certain sepsis’ of weeds, especially, at the beginning of the vegetation. In this case, increasing the secretion of phenol substances is one of the physiological screenings of such competitiveness.
Flowers visited by honey bee in southern Finland
Directory of Open Access Journals (Sweden)
Markku Käpylä
1979-01-01
Full Text Available A list of nectar and pollen sources of honeybee (Apis mellifera L. in southern Finland based on 44 500 flower records is presented. Only the common wild and cultivated species are included, 139 species altogether. The flowering times are shown with an accuracy of two weeks. The most important food sources during spring (April—May are Salix spp., and Tussilago farfara: during early summer (late May and June Salix spp., Taraxacum officinale, Acer platanoides, Vaccinium vitis-idaea, Barbarea vulgaris, Ribes spp., Malus domestica, Sorbus aucuparia, and Geranium sylvaticum; during mid-summer Trifolium repens, T. hybridum, Rubus idaeus, Tilia cordata, Epilobium angustifolium, and Cirsium arvense; during late summer and early autumn Calluna vulgaris, Arctium tomentosum, Sonchus arvensis and Leontodon autumnalis.
Directory of Open Access Journals (Sweden)
Ailton Reis
2007-06-01
Full Text Available O manjericão (Ocimum basilicum L. é uma hortaliça da família Lamiaceae, utilizada na culinária ou como matéria prima para a indústria de fármacos e óleos essenciais. Amostras de plantas de manjericão apresentando sintomas de murcha, seca de hastes e podridão de colo foram coletadas na área rural de Brazlândia (DF durante a estação chuvosa de 2005. Outras duas amostras foram coletadas em plantas cultivadas em campo aberto e casas de vegetação na região de Ponte Alta (DF. Isolados de um fungo, identificado como Fusarium oxysporum, foram obtidos em todas as amostras. Testes de patogenicidade foram conduzidos com mudas das cultivares O. basilicum 'Dark Opal' e 'Italian Large Leaf', e de acessos das espécies O. americanum L. (manjericão de folha miúda, O. campechianum Mill. (alfavaca, Origanum manjorana L. (manjerona, Origanum vulgare L. (orégano, Mentha arvensis L. (menta, Coleus blumei Benth. (tapete, Leonorus sibiricus L. (rubim e Leonotis nepetaefolia (L. W.T. Aiton (cordão-de-frade. Todos os isolados fúngicos mostraram-se altamente virulentos sobre as duas cultivares de manjericão. Em O. campechianum e O. americanum os isolados causaram apenas suave escurecimento vascular e leve redução de crescimento, sendo avirulentos sobre acessos das espécies O. manjorana, O. vulgare, M. arvensis, C. blumei, L. sibiricus e L. nepetaefolia. Este conjunto de dados indicou que o agente causal da doença é o fungo F. oxysporum f. sp. basilici, constituindo-se no primeiro registro formal deste patógeno no Brasil. Os lotes de sementes utilizados nas áreas de ocorrência da doença foram submetidos a um teste de sanidade visando verificar a presença do patógeno. O fungo F. oxysporum f. sp. basilici foi detectado em quatro dos seis lotes e os isolados obtidos das sementes contaminadas mostraram similar sintomatologia e um idêntico perfil de virulência aos verificados em campo e casa de vegetação, sugerindo que as sementes
Mai, Quanfa; Li, Weidong; Chen, Hao; Ai, Weiming; Chen, Xiao
2016-09-01
The complete mitochondrial genome of the Sicklefin weasel shark Hemigaleus microstoma was first presented in this study. It was 16 701 bp in length with the typical gene arrangement in vertebrates. A total of 25 bp short intergenic spaces and 33 bp overlaps located in 12 and 9 gene junctions, respectively. The overall nucleotide composition was 31.0% A, 26.4% C, 13.5% G and 29.1% T. Two start (ATG and GTG) and three stop (TAG, AGG and TAA/T) codons were found in the protein-coding genes. The size of 22 tRNA genes ranged from 67 to 75 bp. In the phylogenetic tree, H. microstoma (Hemigaleidae) was placed as sister to Galeocerdo cuvier (Carcharhinidae).
Effect of foliar treatments on distribution of 14C-glyphosate in Convolvulus arvensis L
International Nuclear Information System (INIS)
Lauridson, T.C.
1986-01-01
Field bindweed is a perennial weed which produces shoots from buds on its roots. Herbicides, such as glyphosate [N-(phosphonomethyl)glycine] used for control of field bindweed usually do not kill all shoot buds on the roots, thus field bindweed often reinfests areas within 3 to 6 weeks of treatment. This dissertation deals with the development of a technique to change glyphosate distribution in field bindweed roots and could result in less shoot regrowth after glyphosate application. In field studies eight plant growth regulators were applied in September, 3 days before 2.24 kg/ha of 2.4-D[(2,4-dichlorophenoxy) acetic acid] or 1.68 kg/ha of glyphosate. Eight months later, regrowth of shoots was least where glyphosate was applied at 0.028 kg/ha as a pretreatment, followed by a standard rate of 1.68 kg/ha. In subsequent greenhouse studies, typical patterns of shoot growth and 14 C-glyphosate distribution in isolated root sections taken from 15-week-old intact plants were determined. In subsequent growth chamber studies, plants were decapitated to observe the effect of shoot apical dominance on 14 C-glyphosate translocation. After 14 C-glyphosate was applied, intact plants had about twice as much 14 C in distal root sections as in proximal or middle root sections. Decapitated plants had more 14 C in proximal and middle root sections than in distal sections, and about twice as much 14 C was translocated to roots of decapitated plants than intact plants. Eight concentrations of 2,4,-D or glyphosate from 1 to 5000 ppm were applied in logarithmic series to 6-week old plants
Directory of Open Access Journals (Sweden)
Mehdi Afshari
2017-05-01
Full Text Available Tribenuron-methyl is commonly used for post emergence control of broad leaf weeds in wheat fields. In order to survey suspicious resistant weeds in wheat fields to this herbicide thirty-eight fields of Kermanshah province were investigated during 2012- 2013. Seeds of suspected resistance of wild mustard were gathered and tested in a randomized complete blocks design experiment with three replications. First, for early detection of herbicide resistance, the suspected population was screened using discriminating dose of tribenuron-methyl. Determining of the resistance degree was conducted by whole plant bioassay tests using dose-response curves. The resistance mechanisms were assayed by molecular methods, especially using the ALS gene cloning by PJET1.2/blunt Vector. For susceptible populations, the concentration required for complete control was 10.4 g ai ha-1 tribenuron-methyl. Also, in screening tests 50% of populations as resistant populations were identified. According to the Beckie and Tardif, it was found that 57.8% of these population did have a very high degree of resistance, 31.5% with high resistance and 10/5% with low resistance degree. GR50 of the resistant weeds was also increased as compared to sensitive weed, which indicates resistance in this province, Thus to control the resistant populations Z15, this amount increased to 1309 g ai ha-1.The results of DNA sequencing showed that mutation by replacing proline amino acid at position Ala122 causes resistance based on target-site mutation.
Czech Academy of Sciences Publication Activity Database
Doubková, Pavla; Vlasáková, E.; Sudová, Radka
2013-01-01
Roč. 370, 1-2 (2013), s. 149-161 ISSN 0032-079X R&D Projects: GA AV ČR KJB600050812 Institutional support: RVO:67985939 Keywords : arbuscular mycorrhizal fungi * drought * serpentine soil Subject RIV: EF - Botanics Impact factor: 3.235, year: 2013
Directory of Open Access Journals (Sweden)
Bipinchandra K. Salunke
2015-01-01
Full Text Available Silver nanoparticles (AgNPs as a result of their excellent optical and electronic properties are promising catalytic materials for various applications. In this study, we demonstrate a novel approach for enhanced degradation of cellulose using biosynthesized AgNPs in an enzyme catalyzed reaction of cellulose hydrolysis by cellulase. AgNPs were synthesized through reduction of silver nitrate by extracts of five medicinal plants (Mentha arvensis var. piperascens, Buddleja officinalis Maximowicz, Epimedium koreanum Nakai, Artemisia messer-schmidtiana Besser, and Magnolia kobus. An increase of around twofold in reducing sugar formation confirmed the catalytic activity of AgNPs as nanocatalyst. The present study suggests that immobilization of the enzyme onto the surface of the AgNPs can be useful strategy for enhanced degradation of cellulose, which can be utilized for diverse industrial applications.
The Importance of Landscape Structure for the Long-Term Conservation of Species
DEFF Research Database (Denmark)
Nabe-Nielsen, Jacob; Sibly, Richard M; Forchhammer, Mads C.
population recovery was affected by landscape structure for four species in an agricultural landscape: skylark (Alauda arvensis), vole (Microtus agrestis), a ground beetle (Bembidion lampros) and a linyphiid spider (Erigone atra). We characterized population persistence based on equilibrium population sizes...... (K) and the time it took populations to recover from perturbations. We separated the effects of corridors and patch arrangement by comparing results from a real landscape with results from two virtual landscapes: One where linear corridors were removed by homogenizing patch shapes, while leaving...... the spatial arrangement of the patches unaltered, and one where patches were shuffled around, while still leaving the landscape composition unaltered. Patch arrangement and the presence of corridors had a large effect on population dynamics for species whose local success depended on the identity...
Directory of Open Access Journals (Sweden)
Romika Dhiman
2016-01-01
Full Text Available In the present investigation, comparison of antimicrobial activities of different spices, Curcuma longa, Zingiber officinale, and Mentha arvensis, and medicinal herbs, such as Withania somnifera, Rauvolfia serpentina, Emblica officinalis, Terminalia arjuna, and Centella asiatica, was evaluated. Different extraction solvents (acetone, methanol, ethanol, and water were used and extracts were examined against Bacillus cereus, Serratia sp., Rhodotorula mucilaginosa, Aspergillus flavus, and Penicillium citrinum isolated from juices. Extracts from the medicinal herb and spices have significant activity. B. cereus was the most sensitive and R. mucilaginosa was the most resistant among the microorganisms tested. Ethanolic and methanolic extract of C. asiatica displayed maximum diameter of inhibition zone against bacteria and yeast and percentage mycelial inhibition against moulds. This study confirmed the potential of selected extracts of spices as effective natural food preservative in juices.
Dhiman, Romika; Aggarwal, Neeraj; Aneja, Kamal Rai; Kaur, Manpreet
2016-01-01
In the present investigation, comparison of antimicrobial activities of different spices, Curcuma longa, Zingiber officinale, and Mentha arvensis, and medicinal herbs, such as Withania somnifera, Rauvolfia serpentina, Emblica officinalis, Terminalia arjuna, and Centella asiatica, was evaluated. Different extraction solvents (acetone, methanol, ethanol, and water) were used and extracts were examined against Bacillus cereus, Serratia sp., Rhodotorula mucilaginosa, Aspergillus flavus, and Penicillium citrinum isolated from juices. Extracts from the medicinal herb and spices have significant activity. B. cereus was the most sensitive and R. mucilaginosa was the most resistant among the microorganisms tested. Ethanolic and methanolic extract of C. asiatica displayed maximum diameter of inhibition zone against bacteria and yeast and percentage mycelial inhibition against moulds. This study confirmed the potential of selected extracts of spices as effective natural food preservative in juices. PMID:26880927
Directory of Open Access Journals (Sweden)
Ismail Amri
2017-05-01
Full Text Available The chemical composition of essential oils isolated by hydrodistillation from the needles of Tunisian Pinus nigra L. subsp. laricio was analyzed by GC and GC/MS. 27 compounds were identified, representing 97.9% of total oil, which was found to be rich in oxygenated diterpenes (38.5% particularly manool oxide (38% and sesquiterpene hydrocarbons (41.4% that included germacrene D (16.7%, δ-cadinene (9% and (E-caryophyllene (8.9%. Results of the herbicidal effects of the oil when tested on Phalaris canariensis L., Trifolium campestre Schreb. and Sinapis arvensis L., indicated that the oil completely inhibited germination and seedling growth at a high concentration (5 μL/mL−1, while at low doses the oil acted by decreasing germination and partially inhibiting seedling growth of all tested weeds.
Directory of Open Access Journals (Sweden)
Jelena Ilić
2012-12-01
Full Text Available Pathogenicity of thirty isolates representing 14 Fusarium species isolated from weeds and plant debris in eastern Croatia was investigated in the laboratory. Pathogenicity tests were performed on wheat and maize seedlings. The most pathogenic Fusarium spp. was F. graminearum isolated from Amaranthus retroflexus, Abutilon theophrasti and Chenopodium album. There was a noticeable inter- and intraspecies variability in pathogenicity towards wheat and maize. Isolates of F. solani from Sonchus arvensis and F. verticillioides from C. album were highly pathogenic to wheat seedlings and apathogenic to maize seedlings. Isolates of F. venenatum were very pathogenic to wheat and maize being the first report about pathogenicity of this species. This experiment proves that weeds and plant debris can serve as alternate hosts and source of inoculum of plant pathogens.
Directory of Open Access Journals (Sweden)
Hsueh Yu-Mei
2011-07-01
Full Text Available Abstract Background Arsenic exposure is an important public health issue worldwide. Dose-response relationship between arsenic exposure and risk of urothelial carcinoma (UC is consistently observed. Inorganic arsenic is methylated to form the metabolites monomethylarsonic acid and dimethylarsinic acid while ingested. Variations in capacity of xenobiotic detoxification and arsenic methylation might explain individual variation in susceptibility to arsenic-induced cancers. Methods To estimate individual susceptibility to arsenic-induced UC, 764 DNA specimens from our long-term follow-up cohort in Southwestern Taiwan were used and the genetic polymorphisms in GSTM1, GSTT1, GSTP1 and arsenic methylation enzymes including GSTO1 and GSTO2 were genotyped. Results The GSTT1 null was marginally associated with increased urothelial carcinoma (UC risk (HR, 1.91, 95% CI, 1.00-3.65, while the association was not observed for other GSTs. Among the subjects with cumulative arsenic exposure (CAE ≥ 20 mg/L*year, the GSTT1 null genotype conferred a significantly increased cancer risk (RR, 3.25, 95% CI, 1.20-8.80. The gene-environment interaction between the GSTT1 and high arsenic exposure with respect to cancer risk was statistically significant (multiplicative model, p = 0.0151 and etiologic fraction was as high as 0.86 (95% CI, 0.51-1.22. The genetic effects of GSTO1/GSTO2 were largely confined to high arsenic level (CAE ≥ 20. Diplotype analysis showed that among subjects exposed to high levels of arsenic, the AGG/AGG variant of GSTO1 Ala140Asp, GSTO2 5'UTR (-183A/G, and GSTO2 Asn142Asp was associated with an increased cancer risk (HRs, 4.91, 95% CI, 1.02-23.74 when compared to the all-wildtype reference, respectively. Conclusions The GSTs do not play a critical role in arsenic-induced urothelial carcinogenesis. The genetic effects of GSTT1 and GSTO1 on arsenic-induced urothelial carcinogenesis are largely confined to very high exposure level.
Rodriguez-Calvillo, P.; Leunis, E.; Van De Putte, T.; Jacobs, S.; Zacek, O.; Saikaly, W.
2018-04-01
The industrial production route of Grain Oriented Electrical Steels (GOES) is complex and fine-tuned for each grade. Its metallurgical process requires in all cases the abnormal grain growth (AGG) of the Goss orientation during the final high temperature annealing (HTA). The exact mechanism of AGG is not yet fully understood, but is controlled by the different inhibition systems, namely MnS, AlN and CuxS, their size and distribution, and the initial primary recrystallized grain size. Therefore, among other parameters, the initial heating stage during the HTA is crucial for the proper development of primary and secondary recrystallized microstructures. Cold rolled 0.3 mm Cu-bearing Grain Oriented Electrical Steel has been submitted to interrupted annealing experiments in a lab tubular furnace. Two different annealing cycles were applied:• Constant heating at 30°C/h up to 1000°C. Two step cycle with initial heating at 100°C/h up to 600°C, followed by 18 h soaking at 600°C and then heating at 30°C/h up to 1050°C. The materials are analyzed in terms of their magnetic properties, grain size, texture and precipitates. The characteristic magnetic properties are analyzed for the different extraction temperatures and Cycles. As the annealing was progressing, the coercivity values (Hc 1.7T [A/m]) decreased, showing two abrupt drops, which can be associated to the on-set of primary and secondary recrystallization. The primary recrystallized grain sizes and recrystallized fractions are fitted to a model using a non-isothermal approach. This analysis shows that, although the resulting grain sizes were similar, the kinetics for the two step annealing were faster due to the lower recovery. The on-set of secondary recrystallization was also shifted to higher temperatures in the case of the continuous heating cycle, which might end in different final grain sizes and final magnetic properties. In both samples, nearly all the observed precipitates are Al-Si-Mn nitrides
Directory of Open Access Journals (Sweden)
P. Rodriguez-Calvillo
2018-04-01
Full Text Available The industrial production route of Grain Oriented Electrical Steels (GOES is complex and fine-tuned for each grade. Its metallurgical process requires in all cases the abnormal grain growth (AGG of the Goss orientation during the final high temperature annealing (HTA. The exact mechanism of AGG is not yet fully understood, but is controlled by the different inhibition systems, namely MnS, AlN and CuxS, their size and distribution, and the initial primary recrystallized grain size. Therefore, among other parameters, the initial heating stage during the HTA is crucial for the proper development of primary and secondary recrystallized microstructures. Cold rolled 0.3 mm Cu-bearing Grain Oriented Electrical Steel has been submitted to interrupted annealing experiments in a lab tubular furnace. Two different annealing cycles were applied:• Constant heating at 30°C/h up to 1000°C. Two step cycle with initial heating at 100°C/h up to 600°C, followed by 18 h soaking at 600°C and then heating at 30°C/h up to 1050°C. The materials are analyzed in terms of their magnetic properties, grain size, texture and precipitates. The characteristic magnetic properties are analyzed for the different extraction temperatures and Cycles. As the annealing was progressing, the coercivity values (Hc 1.7T [A/m] decreased, showing two abrupt drops, which can be associated to the on-set of primary and secondary recrystallization. The primary recrystallized grain sizes and recrystallized fractions are fitted to a model using a non-isothermal approach. This analysis shows that, although the resulting grain sizes were similar, the kinetics for the two step annealing were faster due to the lower recovery. The on-set of secondary recrystallization was also shifted to higher temperatures in the case of the continuous heating cycle, which might end in different final grain sizes and final magnetic properties. In both samples, nearly all the observed precipitates are Al
Spigolature toponomastiche carsiche
Directory of Open Access Journals (Sweden)
Mario Doria
1984-12-01
Full Text Available Denominazione di cui si ignora l'"origine", annota Carlo Chersi nella sua accurata guida Itinerari del Carso triestino (giunta postuma alla sua settima edizione, Trieste 1984, a proposito di Coste, nome di un colle abbastanza alto(m. 410 che si eleva alle spalle di Sales (Salež, nella catena cui appar tengono anche il Monte San Leonardo (Sv. Leonard, a. N. 0., e la Vetta Grande (Ostri Vrh aS. E., ed è chiamato oggi local mente Gradec (in quanto sede di castelliere, cfr. A. M. Radmilli ASPP 193-75, p. 126 e già C. Marchesetti Castellieri, Trieste 1903, p. 37 o anche (Monte Dernovesch (Dernovesh, grafie te deschizzanti di uno slov. (dial. Dernovcah (dall'agg. drnovec "provvisto di zolle erbose".
Supply Chain adoption in Small and Medium-Sized Enterprises (SMEs)
DEFF Research Database (Denmark)
Juhl, Mathias Thim; Bernon, Mike
Purpose: The importance of having a competitive supply chain strategy is not to be underestimated (Underwood & Agg 2012; Aronow et al. 2014). Despite the importance of creating strong supply chain capabilities, small and medium-sized enterprises (SMEs) find it difficult to implement supply chain...... and customer needs. Research Approach: An exploratory case study of five small and medium sized manufacturing companies was undertaken using in-depth interviews and business reports. Combined with relevant literature, the case study interviews provide basis for a discussion on the current adoption of supply...... needs and a low interaction in the supply chain, to having an “outside-in” perspective (Day & Moorman 2013) and development of capabilities that support long-term competitive advantage. The case studies revealed two significant factors to support consistency between supply chain capabilities...
Mitochondrial genome and phylogenetic position of the sliteye shark Loxodon macrorhinus.
Wang, Junjie; Chen, Hao; Lin, Lingling; Ai, Weiming; Chen, Xiao
2016-11-01
The sliteye shark Loxodon macrorhinus is the only member of the genus Loxodon in the family Carcharhinidae. In this study, we first present the complete mitochondrial genome of L. macrorhinus and determine its phylogenetic position within Carcharhinidae based on relative mitogenomes. The mitochondrial genome was 16 702 bp in length with the typical gene order in vertebrates. The overall base composition of the H-strand was 31.7% A, 25.8% C, 13.1% G, and 29.4% T. Two start codons (ATG and GTG) and three stop codons (TAG, AGG, and TAA/T) were found in the protein-coding genes. The tRNA genes ranged from 67 bp to 75 bp. Loxodon macrorhinus was placed as sister to the genus Scoliodon in the Bayesian tree.
Forest structure and plant diversity in maritime pine (Pinus pinaster Ait.) stands in central Spain
Energy Technology Data Exchange (ETDEWEB)
Osorio, L. F.; Bravo, F.; Zaldivar, P.; Pando, V.
2009-07-01
The relationship between forest structure and plant diversity in Mediterranean Maritime pine stands (Pinus pinaster Ait.) in the Iberian Range (Spain) was studied. Forty eight stands were sampled. In each, a circular plot (15 m radius) and a transect (25*1 m{sup 2}) were established to estimate stand variables and record presence and abundance of vascular species respectively. Canonical correlation analysis (CCA), simple correlations and multiple stepwise linear regressions were used to explore the relationship between plant diversity and forest structure. Correlation between diversity measurements and stand variables is very weak, but significant correlations were found when evaluating each set of variables separately. Presence and cover of some species (for instance, Veronica arvensis L. or Micropyrum tenellum (L.) Link) is correlated with stand variables; however, determination coefficients found in step-by-step regression are not significant. (Author) 34 refs.
Impact of fungicides on weed growth
Directory of Open Access Journals (Sweden)
Nordmeyer, Henning
2014-02-01
Full Text Available The study has shown that fungicides influence the growth of weeds. The competition against crops will be substantially reduced. Bioassays in a climate chamber variation in temperature as well as different lightning phases and microplot trials under semi field levels were carried out to investigate the influence of fungicides on weed growth. Selected weed species (Alopecurus myosuroides, Viola arvensis, Galium aparine, Stellaria media, Lamium purpureum have been examined with different dose rates of fungicides (Adexar, Bravo 500, Diamant, Crupozin flüssig. Weed species showed a different sensitivity. There were leaf discoloration, contractions and growth inhibition. In some cases using common practise dose rates of fungicides more than 70% growth inhibition could be estimated 14 days after application in comparison to the untreated control. Effects were much stronger in bioassays than in semi field trials.
Souza, Lucéia Fatima; De Barros, Ingrid Bergman Inchausti; Mancini, Emilia; De Martino, Laura; Scandolera, Elia; De Feo, Vincenzo
2014-12-01
The chemical composition of the essential oils of Pereskia aculeata Mill. and P. grandifolia Haw. (Cactaceae), grown in Brazil, was studied by means of GC and GC-MS. In all, 37 compounds were identified, 30 for P. aculeata and 15 for P. grandifolia. Oxygenated diterpenes are the main constituents, both in the oil ofP. grandifolia (55.5%) and in that ofP. aculeata (29.4%). The essential oils were evaluated for their in vitro phytotoxic activity against germination and initial radicle growth of Raphanus sativus L., Sinapis arvensis L., and Phalaris canariensis L. seeds. The essential oil of P. grandifolia, at all doses tested, significantly inhibited the radicle elongation of R. sativus. Moreover, the antimicrobial activity of the essential oils was assayed against ten bacterial strains. The essential oils showed weak inhibitory activity against the Gram-positive pathogens.
Belz, Regina G
2007-09-30
Parthenium hysterophorus L. is an invasive weed that biosynthesizes several phytochemicals. The sesquiterpene lactone parthenin receives most attention regarding allelopathy of the plant or potential herbicidal properties. Since parthenin exhibits dose-dependent phytotoxicity with low dose stimulation, this study investigated the occurrence and temporal features of parthenin hormesis in Sinapis arvensis L. sprayed with parthenin under semi-natural conditions. Dose/response studies showed that the occurrence and the magnitude of hormesis depended on climatic conditions and the parameter measured. Within the tested dose range, stimulatory responses were only observed under less-stressful conditions and were most pronounced for leaf area growth [138 % of control; 13 days after treatment (DAT)]. Temporal assessment of leaf area development showed that doses causing a stimulatory response at the end of the experiment (allelopathy of P. hysterophorus and exploitation of growth stimulatory responses in agriculture.
Wang, Ying-hao; Wei, Wei; Kang, Ding-ming; Ma, Ke-ping
2013-01-01
It has been reported that wild Brassica and related species are widely distributed across Xinjiang, China, and there has been an argument for species identification. Seed coat microsculpturing (SCM) is known to be an excellent character for taxonomic and evolutionary studies. By identifying collections from Xinjiang, China, and combining SCM pattern, flow cytometry, and genome-specific DNA markers as well as sexual compatibility with known species, this study aimed to detect potential relatio...
Design of Ag-Ge-Zn braze/solder alloys: Experimental thermodynamics and surface properties
Directory of Open Access Journals (Sweden)
Delsante S.
2017-01-01
Full Text Available The experimental investigation of the Ag-Ge-Zn phase diagram was performed by using combined microstructural and Differential Scanning Calorimeter (DSC analyses. The samples were subjected to thermal cycles by a heat-flux DSC apparatus with heating and cooling rate of 0.5 or 0.3°C/min. The microstructure of the samples, both after annealing and after DSC analysis, was studied by optical and scanning electron microscopy coupled with EDS (Energy Dispersive Spectroscopy analysis. Considering the slow heating and cooling rate adopted, the isothermal section at room temperature was established. No ternary compounds were observed. On the basis of the experimental investigations the invariant reactions were identified. Combining the thermodynamic data on the Ag-Ge, Ag-Zn and Ge-Zn liquid phases by means of Butler’s model the surface tension of Ag-Ge-Zn alloys was calculated.
DEFF Research Database (Denmark)
Cong, Yi; Banta, Gary Thomas; Selck, Henriette
2011-01-01
There is increasing concern about the toxicities and potential risks, both still poorly understood, of silver nanoparticles for the aquatic environment after their eventual release via wastewater discharges. In this study, the toxicities of sediment associated nano (...)- and ionic (AgNO3)- Ag on the sediment-dwelling polychaete, Nereis diversicolor, were compared after 10 days of sediment exposure, using survival, DNA damage (comet assay) and bioaccumulation as endpoints. The nominal concentrations used in all exposure scenarios were 0, 1, 5, 10, 25, and 50 g Ag/g dry...... weight (dw) sediment. Our results showed that Ag was able to cause DNA damage in Nereis coelomocytes, and that this effect was both concentration- and Ag form-related. There was significantly greater genotoxicity (higher tail moment and tail DNA intensities) at 25 and 50 g/g dw in nano- and micron-Ag...
DEFF Research Database (Denmark)
cong, Yi; Banta, Gary Thomas; Selck, Henriette
(comet assay) and bioaccumulation as endpoints. Prior to the toxicity experiment, the physical-chemical properties of Ag NPs were fully characterized. The nominal concentrations used in all exposure scenarios were 0, 5, 10, 25, 50 and 100 µg Ag/g dry weight (dw) sediment. Lysosomal membrane stability...... of Nereis coelomocytes, which was measured by neutral red retention time (NRRT), decreased in a concentration-dependent manner in all Ag treatments, indicating increased permeability of lysosomal membranes. Comet assay results showed that Ag was able to cause DNA damage in Nereis coelomocytes regardless......In this study, the toxicities of commercial silver nanoparticles (Ag NPs, 20 and 80 nm) were compared with the toxicities of Ag+ ions in the marine sediment-dwelling polychaete, Nereis diversicolor, after 10 d of sediment exposure, using lysosomal membrane stability (neutral red assay), DNA damage...
Directory of Open Access Journals (Sweden)
E. Puricelli
2009-06-01
Full Text Available Los experimentos se condujeron en el campo experimental de la Facultad de Ciencias Agrarias ubicado en Zavalla (Argentina durante 2005 y 2006. El objetivo de este trabajo fue estudiar la eficacia de glifosato aplicado al estado vegetativo y reproductivo de Convolvulus arvensis, Oenothera indecora, Iresine diffusa, Parietaria debilis, Rumex paraguayensis y Trifolium repens. El diseño del experimento fue completamente al azar con un arreglo factorial: año, especies, estado reproductivo y vegetativo y dosis de glifosato 48% (4X, 2X, 1X, 1/2X, 1/4X, 0X siendo X la dosis recomendada 1200 g i.a. ha-1. Se estableció la relación entre la dosis de glifosato y el control de la biomasa de las malezas a través de curvas de dosis respuesta con un modelo log-logístico. Se comparó el grado de tolerancia por medio de la DL50. En ambos estados de las malezas, la mayor DL50 obtenida para I. diffusa indica que de las especies estudiadas ésta es la más tolerante a glifosato. El número de especies tolerantes al glifosato es menor al estado vegetativo que al reproductivo.Experiments were conducted at the University of Rosario Experimental Farm, Zavalla in 2005 and 2006 to study the effect of glyphosate on the control of Convolvulus arvensis, Oenothera indecora, Iresine diffusa, Parietaria debilis, Rumex paraguayensis and Trifolium repens at the vegetative and reproductive stage. The experiments were established in a complete randomized design with the following factorial arrangement of treatments: year, species, vegetative and reproductive growth stages and glyphosate 48% (4X, 2X, 1X, 1/2X, 1/4X, 0X being 1X the recommended dose (1,200 g a.i. ha-1. The relationship between glyphosate dose and weed biomass control was established with a log-logistic model. The degree of tolerance was compared by LD50. In both stages, the higher LD50 was obtained for I. diffusa indicating that this is the species most tolerant to glyphosate among those studied. The number of
Directory of Open Access Journals (Sweden)
Yan Xiaohong
2013-01-01
Full Text Available Abstract Background The fertile and sterile plants were derived from the self-pollinated offspring of the F1 hybrid between the novel restorer line NR1 and the Nsa CMS line in Brassica napus. To elucidate gene expression and regulation caused by the A and C subgenomes of B. napus, as well as the alien chromosome and cytoplasm from Sinapis arvensis during the development of young floral buds, we performed a genome-wide high-throughput transcriptomic sequencing for young floral buds of sterile and fertile plants. Results In this study, equal amounts of total RNAs taken from young floral buds of sterile and fertile plants were sequenced using the Illumina/Solexa platform. After filtered out low quality data, a total of 2,760,574 and 2,714,441 clean tags were remained in the two libraries, from which 242,163 (Ste and 253,507 (Fer distinct tags were obtained. All distinct sequencing tags were annotated using all possible CATG+17-nt sequences of the genome and transcriptome of Brassica rapa and those of Brassica oleracea as the reference sequences, respectively. In total, 3231 genes of B. rapa and 3371 genes of B. oleracea were detected with significant differential expression levels. GO and pathway-based analyses were performed to determine and further to understand the biological functions of those differentially expressed genes (DEGs. In addition, there were 1089 specially expressed unknown tags in Fer, which were neither mapped to B. oleracea nor to B. rapa, and these unique tags were presumed to arise basically from the added alien chromosome of S. arvensis. Fifteen genes were randomly selected and their expression levels were confirmed by quantitative RT-PCR, and fourteen of them showed consistent expression patterns with the digital gene expression (DGE data. Conclusions A number of genes were differentially expressed between the young floral buds of sterile and fertile plants. Some of these genes may be candidates for future research on CMS in
Yan, Xiaohong; Dong, Caihua; Yu, Jingyin; Liu, Wanghui; Jiang, Chenghong; Liu, Jia; Hu, Qiong; Fang, Xiaoping; Wei, Wenhui
2013-01-16
The fertile and sterile plants were derived from the self-pollinated offspring of the F1 hybrid between the novel restorer line NR1 and the Nsa CMS line in Brassica napus. To elucidate gene expression and regulation caused by the A and C subgenomes of B. napus, as well as the alien chromosome and cytoplasm from Sinapis arvensis during the development of young floral buds, we performed a genome-wide high-throughput transcriptomic sequencing for young floral buds of sterile and fertile plants. In this study, equal amounts of total RNAs taken from young floral buds of sterile and fertile plants were sequenced using the Illumina/Solexa platform. After filtered out low quality data, a total of 2,760,574 and 2,714,441 clean tags were remained in the two libraries, from which 242,163 (Ste) and 253,507 (Fer) distinct tags were obtained. All distinct sequencing tags were annotated using all possible CATG+17-nt sequences of the genome and transcriptome of Brassica rapa and those of Brassica oleracea as the reference sequences, respectively. In total, 3231 genes of B. rapa and 3371 genes of B. oleracea were detected with significant differential expression levels. GO and pathway-based analyses were performed to determine and further to understand the biological functions of those differentially expressed genes (DEGs). In addition, there were 1089 specially expressed unknown tags in Fer, which were neither mapped to B. oleracea nor to B. rapa, and these unique tags were presumed to arise basically from the added alien chromosome of S. arvensis. Fifteen genes were randomly selected and their expression levels were confirmed by quantitative RT-PCR, and fourteen of them showed consistent expression patterns with the digital gene expression (DGE) data. A number of genes were differentially expressed between the young floral buds of sterile and fertile plants. Some of these genes may be candidates for future research on CMS in Nsa line, fertility restoration and improved agronomic
Spatial correlation between weed species densities and soil properties
DEFF Research Database (Denmark)
Walter, Mette; Christensen, Svend; Simmelsgaard, Svend Erik
2002-01-01
The spatial cross-correlation between weed species densities and six soil properties within fields was analysed using cross-semivariograms. The survey was carried out in three successive years in two fields. The most consistent relationship between weed species density (numbers m−2) and soil...... properties was negative cross-correlation between the density of Viola arvensis Murray and clay content. This correlation was found in both fields; however, the range of spatial dependence varied between fields. In one of the fields, the density of Lamium purpureum L. was positively cross......-correlated with the phosphorus content in the soil in all years. The density of Veronica spp. and Poa annua L. was negatively cross-correlated with pH in all three years. Other spatial cross-correlations that were found in this study were inconsistent over time or field site. The densities of some of the weed species were...
Abu-Taha, M. I.; Abu-Teir, M. M.; Al-Jamal, A. J.; Eideh, H.
The aim of this work was to establish the feasibility of the combined photoacoustic (PA) and photopyroelectric (PPE) detection of the vapours emitted from essential oils and their corresponding uncrushed leaves or flowers. Gas traces of jasmine (Jessamine (Jasminum)), mint (Mentha arvensis L.) and Damask rose (Rosa damascena Miller) and their essential oils were tested using a combined cell fitted with both a photopyroelectric film (PVDF) and a microphone in conjunction with a pulsed wideband infrared source (PWBS) source. Infrared PA and PPE absorbances were obtained simultaneously at room temperatures with excellent reproducibility and high signal-to-noise ratios. Significant similarities found between the PA and PPE spectra of the trace gas emissions of plant parts, i.e., flowers or leaves and their related essential oils show the good correlation of their emissions and that both effects are initiated by the same absorbing molecules.
Flora in abandoned fields and adjacent crop fields on rendzina soils in the Zamość region
Directory of Open Access Journals (Sweden)
Marta Ziemińska-Smyk
2015-10-01
Full Text Available A floristic inventory of segetal flora was carried out in abandoned fields and adjacent crop fields on rendzina soils in the Zamość region in the year 2010. This study found a total of 130 weed species belonging to 30 botanical families. The following families were represented most frequently: Asteraceae, Fabaceae, Poaceae, Lamiaceae, Scrophulariaceae, and Brassicaceae. In the segetal flora, apophytes are dominant (55% of the total flora, with the highest number of meadow and xerothermic grassland species among them. Archeophytes (38% predominate in the group of anthropophytes. The species characterized by the highest constancy classes and reaching the highest cover indices posed the greatest threat to crops in the study area. The following weeds are most frequently found in fallow fields: Consolida regalis, Cichorium intybus, and Sinapis arvensis, while Papaver rhoeas is the greatest threat to cereal crops grown on rendzina soils.
Effects of gamma Co-60 radiation on the growth and development of peppermint (Mentha arvensis L.)
International Nuclear Information System (INIS)
Tran Thi Le Minh; Nguyen Truong Giang; Bui Thi Hong Gam; Le Quang Luan
2015-01-01
In this study, mints were regenerated from calluses irradiated by γ-rays (Co-60) at doses from 0 to 70 Gy. After 4 times of propagation, the M_1V_4 mints were transferred in a greenhouse for assessments of growth, development and essential oil content. Mint regenerated from calluses irradiated at low doses (0, 3, 4, 6, 8 and 10 Gy) showed no morphological difference compared to the control plants. However, low-dose irradiated mints showed better effect on growth and development, and mints regenerated from 6 Gy-irradiated sample had essential oil content with 1.3 times higher than that of control group. In case of plants irradiated at higher dose (30, 40, 50, 60 and 70 Gy), there were morphological variations such as stem become bigger and color of stem become purple. Especially, samples irradiated at 60 Gy showed better in growth, development and essential oil content (1.34 times higher than the control plants) and these characters were stable in M_1V_4. Among the irradiated mints, purple stem variations had the highest essential oil yield with 1.7 times higher than that of the original plants. (author)
Czech Academy of Sciences Publication Activity Database
Doubková, Pavla; Sudová, Radka
2014-01-01
Roč. 24, č. 3 (2014), s. 209-217 ISSN 0940-6360 R&D Projects: GA AV ČR KJB600050812 Institutional support: RVO:67985939 Keywords : arbuscular mycorrhizal * symbiosis * nickel toxicity * semi-hydroponics Subject RIV: EF - Botanics Impact factor: 3.459, year: 2014
Kobayashi, Nobumichi; Nagashima, Shigeo
2009-01-01
We carried out the first study of Enterococcus faecalis clinical isolates in Cuba by multilocus sequence typing linking the molecular typing data with the presence of virulence determinants and the antibiotic resistance genes. A total of 23 E. faecalis isolates recovered from several clinic sources and geographic areas of Cuba during a period between 2000 and 2005 were typed by multilocus sequence typing. Thirteen sequence types (STs) including five novel STs were identified, and the ST 64 (clonal complex [CC] 8), ST 6 (CC2), ST 21(CC21), and ST 16 (CC58) were found in more than one strain. Sixty-seven percent of STs corresponded to STs reported previously in Spain, Poland, and The Netherlands, and other STs (ST115, ST64, ST6, and ST40) were genetically close to those detected in the United States. Prevalence of both antimicrobial resistance genes [aac(6′)-aph(2″), aph(3′), ant(6), ant(3″)(9), aph(2″)-Id, aph(2″)-Ic, erm(B), erm(A), erm(C), mef(A), tet(M), and tet(L)] and virulence genes (agg, gelE, cylA, esp, ccf, and efaAfs) were examined by polymerase chain reaction. Aminoglycoside resistance genes aac(6′)-Ie-aph(2″)-Ia, aph(3′), ant(6), ant(3″)(9) were more frequently detected in ST6, ST16, ST23, ST64, and ST115. The multidrug resistance was distributed to all STs detected, except for ST117 and singleton ST225. The presence of cyl gene was specifically linked to the ST64 and ST16. Presence of the esp, gel, and agg genes was not specific to any particular ST. This research provided the first insight into the population structure of E. faecalis in Cuba, that is, most Cuban strains were related to European strains, whereas others to U.S. strains. The CC2, CC21, and CC8, three of the biggest CCs in the world, were evidently circulating in Cuba, associated with multidrug resistance and virulence traits. PMID:19857135
DEFF Research Database (Denmark)
cong, Yi; Banta, Gary Thomas; Selck, Henriette
There is increasing concern about the toxicities and potential risks, both still poorly understood, of silver nanoparticles for the aquatic environment after their eventual release. In this study, the toxicities of nano (AgNO3)-Ag on the sediment......-dwelling polychaete, Nereis diversicolor, were compared after 10 d of sediment exposure, using growth, DNA damage (comet assay) and bioaccumulation as endpoints. The nominal concentrations used in all exposure scenarios were 0, 1, 5, 10, 25, 50 µg Ag/g dry weight (dw) sediment. Our results show that Ag is able...... to cause DNA damage in Nereis coelomocytes and that this effect is both concentration- and Ag form-related. There were significantly greater genotoxity (higher tail moment and tail DNA intensities) at 25 and 50 µg/g dw in nano- and micron-Ag treated groups and at 50 µg/g dw in ionic-Ag treated group...
In Vitro Screening for the Tumoricidal Properties of International Medicinal Herbs
Mazzio, Elizabeth A.; Soliman, Karam F. A.
2009-01-01
There is growing use of anticancer complementary and alternative medicines (CAMs) worldwide. The purpose of the current study is to assess a sizeable variety of natural and plant sources of diverse origin, to ascertain prospective research directives for cancer treatment and potential new chemotherapy drug sources. In this study, 374 natural extracts (10 μg/mL-5 mg/mL) were evaluated for dose-dependent tumoricidal effects using immortal neuroblastoma of spontaneous malignant origin. The findings indicate no pattern of tumoricidal effects by diverse plants with similar families/genus under the classes Pinopsida, Equisetopsida, Lycopodiosida, Filicosida, Liliopsida Monocotyledons or Magnoliopsida Dicotyledons. The results indicate that many of the most commonly used CAMs exhibited relatively weak tumoricidal effects including cats claw, astragalus, ginseng, echinacea, mistletoe, milk thistle, slippery elm, cayenne, chamomile, don quai, meadowsweet, motherwort and shepherd's purse. The data demonstrate that the most potent plant extracts were randomly dispersed within the plantae kingdom (LC50 = 31-490 μg/mL) in order of the lowest LC50 Dioscorea villosa (Dioscoreaceae) > Sanguinaria canadensis (Papaveraceae) > Dipsacus asper (Dipsacaceae) > Populus balsamifera (Salicaceae) > Boswellia carteri (Burseraceae) > Cyamopsis psoralioides (Fabaceae) > Rhamnus cathartica (Rhamnaceae) > Larrea tridentate (Zygophyllaceae) > Dichroa febrifuga (Hydrangeaceae) > Batschia canescens (Boraginaceae) > Kochia scoparia (Chenopodiaceae) > Solanum xanthocarpum (Solanaceae) > Opoponax chironium (Umbelliferae) > Caulophyllum thalictroides (Berberidaceae) > Dryopteris crassirhizoma (Dryopteridaceae) > Garcinia cambogia (Clusiaceae) > Vitex agnus-castus (Verbenaceae) > Calamus draco (Arecaceae). These findings show tumoricidal effect by extracts of wild yam root, bloodroot, teasel root, bakuchi seed, dichroa root, kanta kari, garcinia fruit, mace, dragons blood and the biblically referenced
In vitro screening for the tumoricidal properties of international medicinal herbs.
Mazzio, Elizabeth A; Soliman, Karam F A
2009-03-01
There is growing use of anticancer complementary and alternative medicines (CAMs) worldwide. The purpose of the current study is to assess a sizeable variety of natural and plant sources of diverse origin, to ascertain prospective research directives for cancer treatment and potential new chemotherapy drug sources. In this study, 374 natural extracts (10 microg/mL-5 mg/mL) were evaluated for dose-dependent tumoricidal effects using immortal neuroblastoma of spontaneous malignant origin. The findings indicate no pattern of tumoricidal effects by diverse plants with similar families/genus under the classes Pinopsida, Equisetopsida, Lycopodiosida, Filicosida, Liliopsida Monocotyledons or Magnoliopsida Dicotyledons. The results indicate that many of the most commonly used CAMs exhibited relatively weak tumoricidal effects including cats claw, astragalus, ginseng, echinacea, mistletoe, milk thistle, slippery elm, cayenne, chamomile, don quai, meadowsweet, motherwort and shepherd's purse. The data demonstrate that the most potent plant extracts were randomly dispersed within the plantae kingdom (LC(50) = 31-490 microg/mL) in order of the lowest LC(50) Dioscorea villosa (Dioscoreaceae) > Sanguinaria canadensis (Papaveraceae) > Dipsacus asper (Dipsacaceae) > Populus balsamifera (Salicaceae) > Boswellia carteri (Burseraceae) > Cyamopsis psoralioides (Fabaceae) > Rhamnus cathartica (Rhamnaceae) > Larrea tridentate (Zygophyllaceae) > Dichroa febrifuga (Hydrangeaceae) > Batschia canescens (Boraginaceae) > Kochia scoparia (Chenopodiaceae) > Solanum xanthocarpum (Solanaceae) > Opoponax chironium (Umbelliferae) > Caulophyllum thalictroides (Berberidaceae) > Dryopteris crassirhizoma (Dryopteridaceae) > Garcinia cambogia (Clusiaceae) > Vitex agnus-castus (Verbenaceae) > Calamus draco (Arecaceae). These findings show tumoricidal effect by extracts of wild yam root, bloodroot, teasel root, bakuchi seed, dichroa root, kanta kari, garcinia fruit, mace, dragons blood and the biblically
Distribution Map and Community Characteristics of Weeds in Barley Fields of Ardabil Province
Directory of Open Access Journals (Sweden)
B. Soheili
2013-06-01
Full Text Available Surveying weeds of irrigated barley fields is one of the most important practices in weed management. Based on cultivated areas irrigated barley in all counties of Ardabil province during six years (2000-2005, 46 sample barley fields were selected and weed species were counted in each sampling point and population indices were calculated with Thomas method. By using specific furmula the density, frequency and uniformity of each weed species in fields were calculated. In each field longitude, latitude and altitude were recorded by using GPS. These data were used for producing weed maps using GIS. Results showed that Galium tricurnatum, Fumaria vaillantiand Raphanus raphanistrum were dominante broadleaf species in irrigated barley fields of Ardabil province. The dominant grassy weed species in these fields were Avena fatua and Secale cereal. Convolvulus arvensis and Cirsium arvense were the most important troublesome plants prior to harvesting in irrigated barley fields of this province.
Vegetation of the Landfill Supíkovice (Olomouc Region, Czech Republic
Directory of Open Access Journals (Sweden)
Cimalová Šárka
2016-03-01
Full Text Available The paper presents the results of floristic and vegetation analyses of the landfill Supíkovice. Ruderal, segetal and meadow vegetation units were recorded in June 2015. The most interesting findings were threatened weed species growing in decontamination patches on loamy and nutrient-poor soils in the central part of the landfill. Dianthus armeria (C4a and Filago arvensis (C3 are listed in the national Red List of the Czech Republic. Moreover, these taxa were evaluated in the same category of rarity on the regional level. Apart from the above mentioned, Centaurea cyanus (C4a and Papaver dubium (C4a, registered only in the regional Red List of vascular plants of the Moravian-Silesian Region (see methods, were found. Besides threatened species, relatively small populations of invasive taxa as Erigeron annuus, Impatiens parviflora or Reynoutria sp., were also recorded on the landfill Supíkovice.
Antagonistic Bioactivity of Endophytic Actinomycetes Isolated from Medicinal Plants
Directory of Open Access Journals (Sweden)
M. Gangwar
2011-10-01
Full Text Available Endophytic actinomycetes are promising biocontrol agents for use in agriculture and have been isolated from various plant species. In the present study, 40 endophytic actinomycetes were isolated from roots, stems and leaves of three medicinal plants viz. Aloe vera, Mentha arvensis and Ocimum sanctum. The identification revealed that the majority of the isolates were Streptomyces spp. and the rest were identified as Saccharopolyspora spp., Micromonospora spp. and Actinopolyspora spp. The dual tests revealed that nine endophytic actinomycete isolates displayed a wide spectrum activity against nine fungal phytopathogens. Out of 8 isolates, 90% inhibited the growth of at least one or more phytopathogenic fungi and Saccharopolyspora 0-9 (Out of 8 isolates, 90% inhibited the growth of at least one or more phytopathogenic fungi and Saccharopolyspora 0-9 exhibited antagonistic activity against Aspergillus niger, Aspergillus flavus, Alternaria brassicicola, Botrytis cinerea, Penicillium digitatum, Fusarium oxysporum, Penicillium pinophilum, Phytophthora dresclea and Colletotrichum falcatum.
Directory of Open Access Journals (Sweden)
M. R Labbafi
2012-02-01
Full Text Available There are many methods for weed management one of them is putting allelopathic and cover crop in weed management programs. In order to study the effect of sowing time (delayed sowing, synchronic sowing and wheat cultivars (Shiraz, Roshan, Tabasi, Niknejad on allelopathic interaction of wheat and weed species (Secale cereale L., Avena ludoviciana L.: monocotyledon, Convolvulus arvensis L. and Vicia villosa L.: dicotyledon, an experiment was conducted with factorial arrangement in a completely randomized design and 4 replications. According to the results, the inhibitory effect of wheat on monocot weeds (oat and rye was more than in synchronic sowing and the inhibitory effect of wheat on dicot weeds (bindweed and vetch was more than in delayed sowing. Effect of wheat cultivars on rye and oat (except hypocotyls length was inhibitory and that of vetch was stimulatory. Hypocotyls length showed the most sensitivity to released allelochemicals from wheat cultivars, because root has the most contact with allelochemicals in the soil.
Interrelations between segetal and ruderal flora in the Olsztyn Lake District
Directory of Open Access Journals (Sweden)
Tadeusz Korniak
2013-12-01
Full Text Available The paper presents differences and similarities between segetal and ruderal flora in the Olsztyn Lake District. The investigation was conducted in rural areas and in areas of small towns. 415 taxa of vascular plants were noted altogether in the flora examined. The segetal flora includes 259 species, and the ruderal flora - 334 ones. A comparison between species of those two florae (table l, figure l, 81 species appear in segetal habitats, and 156 in ruderal habitats. Common species, for those two comparsing florae (segetal and ruderal were 178. The following plants were classified as frequent or common in ruderal habitats of the Olsztyn Lake District, having (under certain conditions a significant influence on the weed infestation of cultivated fields: Amaranthus retroflexus, Artemisia vulgaris, Atriplex patula, Chamomilla suaveolens, Cirsium arvense, Conyza canadensis, Descurainia sophia, Galinsoga ciliata, Galinsoga parviflora, Geranium pusillum, Lapsana communis, Melandrium album, Poa annua, Polygonum aviculare, Rumex crispus, Sisymbrium officinale, Sonchus arvensis, Sonchus asper, Sonchus oleraceus, Tussil farfara.
Energy Technology Data Exchange (ETDEWEB)
Vepsaelaeinen, Ville [Finnish Museum of Natural History, P.O. Box 17, University of Helsinki, FI-00014 Helsinki (Finland)
2010-07-15
Here, I present the first comparison of the abundance of farmland birds in energy grass fields and in cereal-dominated conventionally cultivated fields (CCFs). I demonstrate that in boreal farmland, skylark (Alauda arvensis) densities were significantly lower in reed canary grass (RCG) (Phalaris arundinacea) fields than in CCFs. I found that during the early breeding season RCG fields and CCFs are equally good habitats, but over the ensuing couple of weeks RCG rapidly grows too tall and dense for field-nesting species. Consequently, RCG is an inferior habitat for skylark for laying replacement clutches (after failure of first nesting) or for a second clutch after one successful nesting. The results imply that if RCG cultivation is to be expanded, the establishment of large monocultures should be avoided in farmland landscapes; otherwise the novel habitat may affect detrimentally the seriously depleted skylark population, and probably also other field-nesting bird species with similar breeding habitats. (author)
Directory of Open Access Journals (Sweden)
Sri Karindah
2015-09-01
Full Text Available Anaxipha longipennis Serville (Orthoptera: Gryllidae is one of the generalist predator in rice habitat that has a potential as a biological control agents of rice leaf folder eggs and small insects such as rice hoppers. Females insert their eggs in plant tissue. The female’s oviposition site is important for the subsequent distribution of the cricket. Oviposition preference on 17 weeds species from rice habitat were tested in a free choice experiment in the laboratory. There was strong evidence to conclude that the cricket preferred certain plant for laying eggs. In free choice experiment nine species of weeds were preferred by A. longipennis for laying their eggs instead of rice. The preferred species were ranked as follows: rice, Monochoria vaginalis, Cyperus rotundus, C. iria, Echinochloa colonum, E. crusgalli, Eleusine indica, Fimbristylis miliacea, Imperata cylindrica, and Limnocharis flava. Whereas Ageratum conyzoides, Alternanthera sessilis, Commelina diffusa, Leersia hexandra, Leptochloa chinensis, Ludwigia adscendens, Panicum repens, and Sonchus arvensis were not preferred in free-choice test.
Directory of Open Access Journals (Sweden)
Anisoara STRATU
2015-12-01
Full Text Available The current paper presents the results of a study on the effects of aqueous extracts from five weed species (Amaranthus retroflexus, Cirsium arvense, Convolvulus arvensis, Echinochloa crus-galii, Setaria verticillata on germination and initial growth in Raphanus sativus L. The following indicators have been analyzed: indices of germination (the germination percentage; the speed of germination; the speed of accumulated germination and the coefficient of germination rate, the length of the root and hypocotyls, the pH of aqueous extracts, the UV-Vis absorption spectra of aqueous extracts. The results of the investigations showed the following aspects: the aqueous extracts reduced the values of calculated germination indices and root growth in the first ontogenetic stages of the test species; the pH of the extracts was slightly acid to neutral. Qualitative spectrophotometric analysis indicated the possible presence of phenolic and organic compounds in the extracts. C. arvense, S. verticillata and E. crus-galii presented the most pronounced effect on germination and growth processes.
Directory of Open Access Journals (Sweden)
Anisoara STRATU
2015-12-01
Full Text Available The current paper presents the results of a study on the effects of aqueous extracts from five weed species (Amaranthus retroflexus, Cirsium arvense, Convolvulus arvensis, Echinochloa crus-galii, Setaria verticillata on germination and initial growth in Raphanus sativus L. The following indicators have been analyzed: indices of germination (the germination percentage; the speed of germination; the speed of accumulated germination and the coefficient of germination rate, the length of the root and hypocotyls, the pH of aqueous extracts, the UV-Vis absorption spectra of aqueous extracts. The results of the investigations showed the following aspects: the aqueous extracts reduced the values of calculated germination indices and root growth in the first ontogenetic stages of the test species; the pH of the extracts was slightly acid to neutral. Qualitative spectrophotometric analysis indicated the possible presence of phenolic and organic compounds in the extracts. C. arvense, S. verticillata and E. crus-galii presented the most pronounced effect on germination and growth processes.
Directory of Open Access Journals (Sweden)
Ismail Amri
2012-12-01
Full Text Available The chemical composition of the essential oils of Melaleuca armillaris Sm., Melaleuca styphelioides Sm. and Melaleuca acuminata F. Muell., collected in Tunisia, was studied by means of GC and GC-MS analysis. In all, 46 compounds were identified, 38 for M. armillaris, 20 for M. acuminata and eight for M. styphelioides, respectively. The presence of a sesquiterpenic fraction (52.2% characterized the oil from M. armillaris; M. sthypheliodes oil was rich in methyl eugenol, a phenolic compound (91.1%, while M. acuminata oil is mainly constituted by oxygenated monoterpenoids (95.6%. The essential oils were evaluated for their in vitro potentially phytotoxic activity against germination and initial radicle growth of Raphanus sativus L., Lepidium sativum L., Sinapis arvensis L., Triticum durum L. and Phalaris canariensis L. seeds. The radicle elongation of five seeds was inhibited at the highest doses tested, while germination of all seeds was not affected. Moreover, the essential oils showed low antimicrobial activity against eight selected microorganisms.
Amri, Ismail; Mancini, Emilia; De Martino, Laura; Marandino, Aurelio; Lamia, Hamrouni; Mohsen, Hanana; Bassem, Jamoussi; Scognamiglio, Mariarosa; Reverchon, Ernesto; De Feo, Vincenzo
2012-12-05
The chemical composition of the essential oils of Melaleuca armillaris Sm., Melaleuca styphelioides Sm. and Melaleuca acuminata F. Muell., collected in Tunisia, was studied by means of GC and GC-MS analysis. In all, 46 compounds were identified, 38 for M. armillaris, 20 for M. acuminata and eight for M. styphelioides, respectively. The presence of a sesquiterpenic fraction (52.2%) characterized the oil from M. armillaris; M. sthypheliodes oil was rich in methyl eugenol, a phenolic compound (91.1%), while M. acuminata oil is mainly constituted by oxygenated monoterpenoids (95.6%). The essential oils were evaluated for their in vitro potentially phytotoxic activity against germination and initial radicle growth of Raphanus sativus L., Lepidium sativum L., Sinapis arvensis L., Triticum durum L. and Phalaris canariensis L. seeds. The radicle elongation of five seeds was inhibited at the highest doses tested, while germination of all seeds was not affected. Moreover, the essential oils showed low antimicrobial activity against eight selected microorganisms.
Fundamentals of algebraic graph transformation
Ehrig, Hartmut; Prange, Ulrike; Taentzer, Gabriele
2006-01-01
Graphs are widely used to represent structural information in the form of objects and connections between them. Graph transformation is the rule-based manipulation of graphs, an increasingly important concept in computer science and related fields. This is the first textbook treatment of the algebraic approach to graph transformation, based on algebraic structures and category theory. Part I is an introduction to the classical case of graph and typed graph transformation. In Part II basic and advanced results are first shown for an abstract form of replacement systems, so-called adhesive high-level replacement systems based on category theory, and are then instantiated to several forms of graph and Petri net transformation systems. Part III develops typed attributed graph transformation, a technique of key relevance in the modeling of visual languages and in model transformation. Part IV contains a practical case study on model transformation and a presentation of the AGG (attributed graph grammar) tool envir...
Millimeter and Submillimeter Wave Spectroscopy of Higher Energy Conformers of 1,2-PROPANEDIOL
Zakharenko, Olena; Bossa, Jean-Baptiste; Lewen, Frank; Schlemmer, Stephan; Müller, Holger S. P.
2017-06-01
We have performed a study of the millimeter/submillimeter wave spectrum of four higher energy conformers of 1,2-propanediol (continuation of the previous study on the three lowest energy conformers. The present analysis of rotational transitions carried out in the frequency range 38 - 400 GHz represents a significant extension of previous microwave work. The new data were combined with previously-measured microwave transitions and fitted using a Watson's S-reduced Hamiltonian. The final fits were within experimental accuracy, and included spectroscopic parameters up to sixth order of angular momentum, for the ground states of the four higher energy conformers following previously studied ones: g'Ga, gG'g', aGg' and g'Gg. The present analysis provides reliable frequency predictions for astrophysical detection of 1,2-propanediol by radio telescope arrays at millimeter wavelengths. J.-B. Bossa, M.H. Ordu, H.S.P. Müller, F. Lewen, S. Schlemmer, A&A 570 (2014) A12)
Directory of Open Access Journals (Sweden)
Edgar Bacarji
Full Text Available Abstract The main objective of this work is to present the technical viability of Self Compacting Concretes (SCC containing by-products from crushed coarse aggregate production. For this purpose, a vast characterization of these by-products was made; six mixtures of SCC were produced using two different aggregates: granite and mica schist. The binder/dry aggregate (b/agg ratio by mass was 1:3. The following properties were analyzed: compressive strength, direct tensile strength, flexural tensile strength and splitting tensile strength. Granite presented the best mechanical performance. The replacement of natural sand by granite sand generated concretes with the same level of compressive strength and caused an increase in tensile strength values. The incorporation of silica fume into concrete with granite produced an increase of 17% in compressive strength. So, the use of these by-product materials can provide a technically feasible solution that is also consistent with the aims of sustainable development and preservation of the environment.
Performance analysis and improvement of WPAN MAC for home networks.
Mehta, Saurabh; Kwak, Kyung Sup
2010-01-01
The wireless personal area network (WPAN) is an emerging wireless technology for future short range indoor and outdoor communication applications. The IEEE 802.15.3 medium access control (MAC) is proposed to coordinate the access to the wireless medium among the competing devices, especially for short range and high data rate applications in home networks. In this paper we use analytical modeling to study the performance analysis of WPAN (IEEE 802.15.3) MAC in terms of throughput, efficient bandwidth utilization, and delay with various ACK policies under error channel condition. This allows us to introduce a K-Dly-ACK-AGG policy, payload size adjustment mechanism, and Improved Backoff algorithm to improve the performance of the WPAN MAC. Performance evaluation results demonstrate the impact of our improvements on network capacity. Moreover, these results can be very useful to WPAN application designers and protocol architects to easily and correctly implement WPAN for home networking.
Performance Analysis and Improvement of WPAN MAC for Home Networks
Directory of Open Access Journals (Sweden)
Saurabh Mehta
2010-03-01
Full Text Available The wireless personal area network (WPAN is an emerging wireless technology for future short range indoor and outdoor communication applications. The IEEE 802.15.3 medium access control (MAC is proposed to coordinate the access to the wireless medium among the competing devices, especially for short range and high data rate applications in home networks. In this paper we use analytical modeling to study the performance analysis of WPAN (IEEE 802.15.3 MAC in terms of throughput, efficient bandwidth utilization, and delay with various ACK policies under error channel condition. This allows us to introduce a K-Dly-ACK-AGG policy, payload size adjustment mechanism, and Improved Backoff algorithm to improve the performance of the WPAN MAC. Performance evaluation results demonstrate the impact of our improvements on network capacity. Moreover, these results can be very useful to WPAN application designers and protocol architects to easily and correctly implement WPAN for home networking.
Directory of Open Access Journals (Sweden)
Supamattaya, K.
2005-02-01
Full Text Available Fluorescence in situ hybridization technique is very useful for the evaluation of microbial communities in various environments. It is possible to apply this technique to study the intestinal microflora in white shrimp (Penaeus vannamei. Different fixatives and storage temperature were tested in this technique. It was found that fixation with 10% buffered formalin for 12 hours and changed to 70% ethanol shown positive results when compared to the fixation with Davidson's fixative or RF fixative. The best signaling was obtainedfrom the samples which were stored in -20ºC. By using the DNA probe targeted to the Eubacteria domain (EUB338 probe, 5′-GCT GCC TCC CGT AGG AGT-3′ labeled with fluorescein as a hybridizing probe, it was found that most intestinal microflora were aggregated with the intestinal contents, or dispersed in the lumen. There was not evidence of the attachment of the microflora with the intestinal epithelium in this study.
Chen, Xiao; Liu, Min; Xiao, Jiamei; Yang, Weidi; Peng, Zaiqing
2016-01-01
The complete mitochondrial genome of Carcharhinus macloti was determined in this study. It is 16,701 bp in length and contains 37 genes with the typical gene order and transcriptional orientation in vertebrates. A total of 29 bp overlaps and 29 bp short intergenic spaces located in 22 gene junctions. The overall base composition is 31.6% A, 26.2% C, 13.0% G and 29.2% T. Two start codons (ATG and GTG) and three stop codons (AGG, TAG and TAA/T) were found in 13 protein-coding genes. The length of 22 tRNA genes ranged from 66 bp (tRNA-Ser2) to 75 bp (tRNA-Leu1). The tRNA-Ser2 (GCU) lacks the dihydrouridine arm by a simple loop and can not be folded into the typical cloverleaf structure. The control region is 1066 bp in length with high A+T content (68.2%).
Lead and cadmium in mushrooms from the vicinity of two large emission sources in Slovenia
International Nuclear Information System (INIS)
Petkovšek, Samar Al Sayegh; Pokorny, Boštjan
2013-01-01
Cd and Pb contents were determined in 699 samples of fruiting bodies of 55 mushrooms species, collected in the period 2000–2007 in the vicinity of the largest Slovenian thermal power plant (the Šalek Valley) and near an abandoned lead smelter (the Upper Meža Valley). The present study is the first regarding lead and cadmium in mushrooms from those exposed areas. Therefore, there was a significant lack of prior data. Among 55 studied mushroom species 36 species are edible and important from an ecotoxicological perspective. However, the remaining non-edible species are important for bioindication and allowed us to compare our results with other studies carried out in other polluted areas in Europe. The highest contents of Cd were found in Agaricus arvensis Schff.: Fr. (117 mg/kg dw) and Agaricus silvicola L.: Fr. (67.9 mg/kg dw), while the highest contents of Pb were found in Macrolepiota procera (Scop.) Singer (53.8 mg/kg dw) and Lycoperdon perlatum Pers. (50 mg/kg dw), respectively. Considering the high contents of both metals in fruiting bodies of edible fungi, together with FAO/WHO directives on tolerable levels of weekly intake of Pb/Cd by humans, it is evident that consumption of some mushroom species originating from both study areas may pose a significant human health risk. A. arvensis Schff.: Fr., A. silvicola L.: Fr. and Cortinarius caperatus (Pers.) Fr. originating from the Šalek Valley, and Armillaria mellea Vahl. P. Kumm., Boletus edulis Bull., L. perlatum Pers., Leccinum versipelle (Fr. and Hök) Snell, and M. procera (Scop.) Singer originating from the Upper Meža Valley should not be consumed at all. Our findings are consistent with some other studies, which emphasized that mushrooms from heavily polluted areas, such as in the vicinity of smelters, accumulate extremely high amounts of metals, and should therefore be omitted from human consumption. - Highlights: ► The Pb contents were higher in saprophytic fungi in comparison with mycorrhizal
Directory of Open Access Journals (Sweden)
Marta K. Kostrzewska
2014-04-01
Full Text Available This study, lasting from 1999 to 2006, was conducted at the Research Station in Tomaszkowo, which belongs to the University of Warmia and Mazury in Olsztyn. The experiment was set up on brown rusty soil classified as good rye complex 5 in the Polish soil valuation system. The analysis comprised weeds in fields sown with pea cultivated in two four-field crop rotation systems with a different first crop: A. potato – spring barley – pea – spring barley; B. mixture of spring barley with pea – spring barley – pea – spring barley. Every year, at the 2–3 true leaf stage of pea, the species composition and density of individual weed species were determined; in addition, before harvesting the main crop, the dry matter of weeds was weighed. The results were used to analyze the constancy of weed taxa, species diversity, and the evenness and dominance indices, to determine the relationships between all biological indicators analyzed and weather conditions, and to calculate the indices of similarity, in terms of species composition, density and biomass of weeds, between the crop rotations compared. The species richness, density and biomass of weeds in fields with field pea were not differentiated by the choice of the initial crop in a given rotation system. In the spring, the total number of identified taxa was 28 and it increased to 36 before the harvest of pea plants. Chenopodium album and Echinochloa crus-galli were the most numerous. Chenopodium album, Echinochloa crus-galli, Sonchus arvensis, Fallopia convolvulus and Viola arvensis were constant in all treatments, regardless of what the first crop in rotation was or when the observations were made. The species diversity and the evenness and species dominance indices varied significantly between years and dates of observations. Species diversity calculated on the basis of the density of weed species was higher in the rotation with a mixture of cereals and legumes, while that calculated on
Czech Academy of Sciences Publication Activity Database
Doubková, Pavla; Suda, Jan; Sudová, Radka
2011-01-01
Roč. 345, 1-2 (2011), s. 325-338 ISSN 0032-079X R&D Projects: GA AV ČR KJB600050812 Institutional research plan: CEZ:AV0Z60050516 Keywords : arbuscular mycorrhiza * serpentine soils * edaphic stress Subject RIV: EF - Botanics Impact factor: 2.733, year: 2011
Witkowska-Banaszczak, Ewa; Długaszewska, Jolanta
2017-11-01
This study was undertaken to evaluate the antioxidant activity of methanol and water extracts from Succisa pratensis Moench (Dipsacaceae) leaves and flowers as well as the chemical composition of the essential oils found in them and the antimicrobial activity of the oils and extracts thereof. The essential oils from S. pratensis leaves and flowers were analysed by the GC-MS. The total phenolic content was determined with Folin-Ciocalteu, that of flavonoids with aluminium chloride and that of phenolic acids with Arnov's reagent. The antioxidant activity was investigated by the DPPH radical scavenging assay. Antimicrobial activity was studied in vitro against G-positive and G-negative bacteria, and fungi using disc diffusion and broth microdilution methods. Eighty-six components of the leaf essential oil and 50 of the flower essential oil were identified. The main components of the leaf essential oil were 2-hexyl-1-octanol (5.76%) and heptacosane (5.53%), whereas hexadecanoic acid (16.10%), 8-octadecen-1-ol acetate (9.86%), methyl linolenate (8.58%), pentacosane (6.63%) and heptacosane (5.50%) were found in the flower essential oil. The essential oils exerted high antimicrobial activity (range: 0.11 to >3.44mg/ml) against the following bacteria: Pseudomonas aeruginosa, Staphylococcus aureus and fungi: Trichophyton mentagrophytes, Candida albicans, whereas the methanol and water extracts showed moderate or weak activity. The strongest antioxidant activity was shown by methanol extracts from S. pratensis leaves, IC 50 = 0.09 mg/ml. There was a positive correlation between the total phenolic content and the antimicrobial activity, while for the antioxidant effect, it was not observed. The results suggest great antibacterial activity of the oils and high antioxidant activity of the methanol extract and may justify the application in treating infections. © 2017 Royal Pharmaceutical Society.
Directory of Open Access Journals (Sweden)
Ester Wickert
2007-12-01
Full Text Available O objetivo deste trabalho foi caracterizar a diversidade genética existente em três genótipos de umezeiro (Clone 05, cv. Rigitano e Clone 15 e identificar marcadores moleculares fAFLP (fluorescent Amplified Fragment Lenght Polymorphism passíveis de serem utilizados na discriminação dos três genótipos de umezeiro selecionados como porta-enxertos para pessegueiro. Foram utilizadas 24 diferentes combinações de primers seletivos fAFLP que geraram 648 marcas, das quais 272 foram diferenciadoras dos três genótipos entre si. As marcas diferenciadoras permitiram o agrupamento dos clones de umezeiro de acordo com sua similaridade através do Método da Distância e algorítmo Neighbour Joining. As mesmas marcas foram utilizadas para calcular a distância genética entre os clones. Com o uso de marcadores fAFLP foi possível discriminar os três genótipos de umezeiro entre si, destacando-se as combinações Fam ACT/CAT, Joe AGG/CTT e Ned AGC/CAA, que permitiram a diferenciação individual de cada um dos clones. A maior distância genética foi encontrada entre a cv. Rigitano e o Clone 15. Os marcadores fAFLP revelaram maior proximidade genética entre o Clone 05 e a cv. Rigitano.The objective of this work was the identification of fAFLP markers to be used in molecular characterization of three mume genotypes selected as rootstocks for peach tree. Twenty-four different fAFLP primer combinations were used and allowed the recognition of 648 markers, comprising 272 markers which were able to discriminate the three clones one from the other. These markers were used to calculate the groupment of the clones according to their similarities with the distance method and neighbour joining algorithm. The same markers were also used to calculate the genetic distance among the clones. The fAFLP markers were efficient to identify the clones, mainly by the combinations of selective primers Fam ACT/CAT, Joe AGG/CTT and Ned AGC/CAA. fAFLP markers allowed the
The conserved Phe GH5 of importance for hemoglobin intersubunit contact is mutated in gadoid fish
2014-01-01
Background Functionality of the tetrameric hemoglobin molecule seems to be determined by a few amino acids located in key positions. Oxygen binding encompasses structural changes at the interfaces between the α1β2 and α2β1 dimers, but also subunit interactions are important for the oxygen binding affinity and stability. The latter packing contacts include the conserved Arg B12 interacting with Phe GH5, which is replaced by Leu and Tyr in the αA and αD chains, respectively, of birds and reptiles. Results Searching all known hemoglobins from a variety of gnathostome species (jawed vertebrates) revealed the almost invariant Arg B12 coded by the AGG triplet positioned at an exon-intron boundary. Rare substitutions of Arg B12 in the gnathostome β globins were found in pig, tree shrew and scaled reptiles. Phe GH5 is also highly conserved in the β globins, except for the Leu replacement in the β1 globin of five marine gadoid species, gilthead seabream and the Comoran coelacanth, while Cys and Ile were found in burbot and yellow croaker, respectively. Atlantic cod β1 globin showed a Leu/Met polymorphism at position GH5 dominated by the Met variant in northwest-Atlantic populations that was rarely found in northeast-Atlantic cod. Site-specific analyses identified six consensus codons under positive selection, including 122β(GH5), indicating that the amino acid changes identified at this position may offer an adaptive advantage. In fact, computational mutation analysis showed that the replacement of Phe GH5 with Leu or Cys decreased the number of van der Waals contacts essentially in the deoxy form that probably causes a slight increase in the oxygen binding affinity. Conclusions The almost invariant Arg B12 and the AGG codon seem to be important for the packing contacts and pre-mRNA processing, respectively, but the rare mutations identified might be beneficial. The Leu122β1(GH5)Met and Met55β1(D6)Val polymorphisms in Atlantic cod hemoglobin modify the
Studying Geographical Distribution Map of Weeds of Irrigated Wheat Fields of Ardabil Province
Directory of Open Access Journals (Sweden)
B Soheili
2013-12-01
Full Text Available In order to identify the density and abundance of weeds in irrigated wheat fields of Ardabil Province, 76 samples of irrigated wheat fields based on cultivation area from all counties of Ardabil province for six years (2001-2006 were selected. The genus and species of weeds from each sampling fields and their population indices density, frequency and uniformity of each species were calculated by using Thomas method. Geographic coordinates of field (Latitude, Altitude and Elevation were the main coverage and were determined by using GPS. These data were used for producing weed maps using GIS in irrigated wheat fields of Ardabil province. Results showed that bedstraw (Galium tricurnatum, Fumitory(Fumaria vaillantiand wildradish (Raphanus raphanistrum were dominant broad leaf weed species and wild oats (Avena fatua, rye (Secale cereal and mouse foxtail(Alopecurus myosuroides dominant grassy weeds species in irrigated wheat fields of Ardabil province. Bindweed (Convolvulus arvensis, Canada thistle(Cirsium arvenseand Acroptilon repens were the most important disturbing plants prior to harvesting in irrigated wheat fields of Ardabil province.
Directory of Open Access Journals (Sweden)
C. Craemer
1996-07-01
Full Text Available Eriophyid-myte kom waarskynlik op die meeste hoër plante voor en is oor die algemeen baie gasheerspesifiek. Sommiges is skadelik genoeg om oorweeg te word vir biologiese beheerprogramme teen ongewenste plante. Algemene belangstelling in die gebruik van eriophyids vir onkruidbeheer het onlangs ontstaan en vyf spesies is reeds, meestal suksesvol, gebruik vir onkruidbeheer in ander lande. Eriophyid-myte is nog nie as onkruidbeheeragente in Suid-Afrika benut nie. Sewentien spesies wat simptome veroorsaak wat moontlik nuttig kan wees vir die beheer van 12 plantspesies, wat as onkruide in Suid-Afrika beskou word, word gelys en bespreek. Die onkruide is: Acacia saligna (Port Jackson, Acroptilon repens (Russiese dissel, Cardaria draba (peperbos cardaria, Chromolaena odorata (paraffienbos. Convolvulus arvensis (akkerwinde, Cuscuta epithymum (dodder, Hypericum perforatum (St. Janskruid, Lantana camara (lantana, Melia azedarach (sering, Opuntia inermis (doringturksvy, Solanum elaeagnifolium (satansbos, S. mauritianum (luisboom en Spartium junceum (Spaanse besem. Sommige van hierdie eriophyid-spesies kan moontlik suksesvol as onkruidbeheeragente in Suid-Afrika gebruik word en derhalwe is verdere navorsing in hierdie verband geregverdig.
Ernst, Dieter; Rosenbrock-Krestel, Hilkea; Kirchhof, Gudrun; Bieber, Evi; Giunaschwili, Nathela; Müller, Rüdiger; Fischbeck, Gerhard; Wagner, Tobias; Sandermann, Heinrich; Hartmann, Anton
2008-01-01
A field study was conducted during 1994 to 1998 on the Experimental Farm Roggenstein, near Fürstenfeldbruck, Bavaria, Germany to determine the effect of transgenic glufosinate-resistant rape in combination with the herbicide Basta [glufosinate-ammonium, phosphinothricin, ammonium (2RS)-2-amino-4-(methylphosphinato) butyric acid] application on soil microorganisms and the behaviour of the synthetic transgenic DNA in response to normal agricultural practice. No influence of Basta on microbial biomass could be detected. The phospholipid fatty acid analysis of soil extracts showed no difference between Basta application and mechanical weed control, whereas conventional herbicide application revealed a different pattern. Basta application resulted in a changed population of weeds with a selective effect for Viola arvensis. During senescence, transgenic rape DNA was degraded similar to endogenous control DNA. After ploughing the chopped plant material in the soil, transgenic as well as endogenous control DNA sequences could be detected for up to 4 weeks for rape and up to 7 months for maize, whereas PCR analysis of composted transgenic maize revealed the presence of the transgene over a period of 22 months.
Directory of Open Access Journals (Sweden)
KatarÃÂna Kráľová
2007-12-01
Full Text Available The condensation of substituted pyrazine-2-carboxylic acid chlorides with ring-substituted anilines yielded five substituted pyrazine-2-carboxylic acid amides. Thesynthesis, and analytical, lipophilicity and biological data of the newly synthesizedcompounds are presented in this paper. The photosynthesis inhibition, antialgal activityand the effect of a series of pyrazine derivatives as abiotic elicitors on the accumulation offlavonoids in a callus culture of Ononis arvensis (L. were investigated. The most activeinhibitor of the oxygen evolution rate in spinach chloroplasts was 6-chloro-pyrazine-2-carboxylic acid (3-iodo-4-methylphenyl-amide (2, IC50 = 51.0 μmol·L-1. The highestreduction of chlorophyll content in Chlorella vulgaris was found for 5-tert-butyl-N-(4-chloro-3-methylphenyl-pyrazine-2-carboxamide (3, IC50 = 44.0 μmol·L-1. The maximalflavonoid production (about 900% was reached after a twelve-hour elicitation processwith 6-chloropyrazine-2-carboxylic acid (3-iodo-4-methylphenyl-amide (2.
Runnie, I; Salleh, M N; Mohamed, S; Head, R J; Abeywardena, M Y
2004-06-01
In this study, the vasodilatory actions of nine edible tropical plant extracts were investigated. Ipomoea batatas (sweet potato leaf), Piper betle (betel leaf), Anacardium occidentale (cashew leaf), Gynandropsis gynandra (maman leaf), Carica papaya (papaya leaf), and Mentha arvensis (mint leaf) extracts exhibited more than 50% relaxing effect on aortic ring preparations, while Piper betle and Cymbopogon citratus (lemongrass stalk) showed comparable vasorelaxation on isolated perfused mesenteric artery preparation. The vascular effect on the aortic ring preparations were mainly endothelium-dependent, and mediated by nitric oxide (NO) as supported by the inhibition of action in the presence of N(omega)-nitro-L-arginine (NOLA), an nitric oxide synthase (NOS) inhibitor, or by the removal of endothelium. In contrast, vasodilatory actions in resistance vessels (perfused mesenteric vascular beds) appear to involve several biochemical mediators, including NO, prostanoids, and endothelium-dependent hyperpolarizing factors (EDHFs). Total phenolic contents and antioxidant capacities varied among different extracts and found to be independent of vascular relaxation effects. This study demonstrates that many edible plants common in Asian diets to possess potential health benefits, affording protection at the vascular endothelium level.
Radiosensitivity on the components of essential oil in the genus Mentha
International Nuclear Information System (INIS)
Ono, Seiroku
1992-01-01
The effects of seed irradiation using X-rays (20KR) on the components of the essential oil in the adult plant were investigated using Mentha arvensis L. var. piperascens Malinvaud (2n=96). 1. X-ray irradiation produced almost no effect on the dry matter weight and content of essential oil at any stage of growth. 2. Using X-ray irradiation, the level of free menthol was increased, and ester menthol and menthone were decreased. This seemed to suggest that menthol was synthesized by the reduction of the menthone. 3. The content of free menthol was found to increase linearly toward leaves of the upper level, while the content of menthone was found to gradually decrease and, finally, to disappear in leaves at fifth level of leaves. 4. No difference was found in the ratios of contents of inorganic component between the first and second harvest seasons. There was also no difference in the content of total nitrogen at any location of leaves, except when an increased concentration of nitrogen at the seventh level of leaves was found. (author)
Radioactivity levels in mushrooms collected in the area of Karlsruhe during 1987 and 1988
International Nuclear Information System (INIS)
Rueckert, G.; Diehl, J.F.; Heilgeist, M.
1990-01-01
Radioactive contamination of wild-growing mushrooms collected in the Northern Black Forest and neighbouring Rhine Valley area has been monitored since the Chernobyl reactor accident. Cs-134, Cs-137, Ag-110m and the natural nuclide K-40 were determined by gamma-spectrometry. Pooled data from all species and all locations showed a decrease in the radio-caesium levels from 1986 to 1988, both in mean values and maximum values. Samples of the same species collected at the same location exhibited large differences, although mixed samples rather than individual mushrooms were measured. Accumulation of caesium was observed particularly in Laccaria amethystina, Xerocomus badius, Xerocomus chrysenteron, Cantharellus tubaeformis, Laccaria laccata, and Russula ochroleuca, with maximum values of 3600 (1986), 2000 (1987), and 1200 (1988) Bq/kg of radio-caesium. A large number of species, among them Calocybe gambosa and Coprinus comatus, showed very small accumulations or no caesium. An accumulation of silver was found in Macrolepiota rhacodes and Agaricus arvensis, which contained a maximum of 11 Bq/kg Ag-110m. (orig.) [de
CONTROLE DE PLANTAS DANINHAS E SELETIVIDADE DE HERBICIDAS EM ALHO
Directory of Open Access Journals (Sweden)
Danton Camacho Garcia
1994-12-01
Full Text Available Foi conduzido um experimento de campo no município de Rio Grande, RS, na safra agrícola 1987/88, com objetivo de avaliar a eficiência de herbicidas no controle de plantas daninhas na cultura do alho, cultivar Quitéria. O delineamento experimental utilizado foi blocos ao acaso, com quatro repetições e os tratamentos constituídos pela aplicação de herbicidas em pré e pós-emergência, das plantas daninhas. Destas, as espécies predominantes na área experimental foram: Digitaria sanguinalis (L. Scop., Eleusine indica (L Gaertne Spergula arvensis L. Os resultados observados indicaram que os tratamentos mais eficientes no controle das plantas daninhas foram: Linuron (PRÉ + Fluazifop-P-butil (PÓS, Linuron (PRÉ + Sethoxydim (PÓS e Oxifluorfen (PRÉ + Alloxydim-sodium (PÓS, que proporcionaram os maiores rendimentos de bulbos curados e toaletados. Houve efeito fitotóxico significativo de Bentazon, aplicado em pós-emergência, reduzindo significativamente o rendimento de bulbos.
Kulkarni, Sharavari S; Dosdall, Lloyd M; Spence, John R; Willenborg, Christian J
2017-01-01
Olfactory ability is an element of fitness in many animals, guiding choices among alternatives such as mating partners or food. Ground beetles (Coleoptera; Carabidae), exhibit preferences for prey, and some species are well-known weed seed predators. We used olfactometer-based bioassays to determine if olfactory stimuli are associated with detection of Brassica napus L., Sinapis arvensis L., and Thlaspi arvense L. seeds by ground beetles characteristic of agroecosystems, and whether behavioural responses to seed odors depended on seed physiological state (imbibed or unimbibed). Imbibed B.napus seeds were preferred over other weed species by two of the three carabid species tested. Only A. littoralis responded significantly to unimbibed seeds of B. napus. Sensitivity to olfactory cues appeared to be highly specific as all carabid species discriminated between the olfactory cues of imbibed brassicaceous weed seeds, but did not discriminate between weed seeds that were unimbibed. Overall, our data suggest that depending on seed physiological state, odours can play an important role in the ability of carabids to find and recognize seeds of particular weed species.
Energy Technology Data Exchange (ETDEWEB)
Akbar, K F; Maqbool, S; Ashraf, I; Ahmad, S S; Ansari, Y.M., E-mail: kezmh@yahoo.com
2011-10-15
The roadside verges of M-3 were surveyed to investigate their floristic composition and the levels of heavy metals in their soils. For this purpose, the floristic data from 102 quadrats, each 1 x 2 m in size were collected and their associated soils were analyzed for total lead, cadmium, copper, manganese, iron and zinc. These quadrats were distributed on three zones (border, verge, and fence) within the M-3 verges. Fifty eight plant species were recorded. By considering their frequency and abundance values, Cynodon dactylon, Anagallis arvensis, Imperata cylindrica, Trifolium alexandrianum and Sonchus oleracea were the most frequent and abundant species of M-3. The mean concentrations of total Cu, Cd, Zn, Mn, Pb and Fe, 1.8 mu gg/sup 1-/, 43.4 mu gg/sup 1-/ , 336.1 mu gg/sup 1-/, 43.2 mu gg/sup 1-/ and 683.1 mu gg/sup 1-/ respectively. By in the roadside soils of M-3 were 14.0 mu gg/sup 1-/ comparing these values with their standard toxic levels, these soils can be considered as non-contaminated. (author)
International Nuclear Information System (INIS)
Akbar, K.F.; Maqbool, S.; Ashraf, I.; Ahmad, S.S.; Ansari, Y.M.
2011-01-01
The roadside verges of M-3 were surveyed to investigate their floristic composition and the levels of heavy metals in their soils. For this purpose, the floristic data from 102 quadrats, each 1 x 2 m in size were collected and their associated soils were analyzed for total lead, cadmium, copper, manganese, iron and zinc. These quadrats were distributed on three zones (border, verge, and fence) within the M-3 verges. Fifty eight plant species were recorded. By considering their frequency and abundance values, Cynodon dactylon, Anagallis arvensis, Imperata cylindrica, Trifolium alexandrianum and Sonchus oleracea were the most frequent and abundant species of M-3. The mean concentrations of total Cu, Cd, Zn, Mn, Pb and Fe, 1.8 mu gg/sup 1-/, 43.4 mu gg/sup 1-/ , 336.1 mu gg/sup 1-/, 43.2 mu gg/sup 1-/ and 683.1 mu gg/sup 1-/ respectively. By in the roadside soils of M-3 were 14.0 mu gg/sup 1-/ comparing these values with their standard toxic levels, these soils can be considered as non-contaminated. (author)
Mancini, Emilia; Camele, Ippolito; Elshafie, Hazem S; De Martino, Laura; Pellegrino, Carlo; Grulova, Daniela; De Feo, Vincenzo
2014-04-01
The chemical composition of the essential oils of Origanum vulgare ssp. hirtum, growing wild in three different localities in the Southern Apennines, was studied by GC-FID and GC/MS analyses. In total, 103 compounds were identified. The oils were mainly composed of phenolic compounds and all oils belonged to the chemotype carvacrol/thymol. The three essential oils were evaluated for their in vitro phytotoxic activity by determining their influence on the germination and initial radicle elongation of Sinapis arvensis L., Phalaris canariensis L., Lepidium sativum L., and Raphanus sativus L. The seed germination and radicle growth were affected in various degrees. Moreover, the antifungal activity of the three essential oils was assayed against three species causing pre- and postharvest fruit decay (Monilinia laxa, M. fructigena, and M. fructicola). At 1000 ppm, the three oils completely inhibited fungal growth. The hemolytic activity of the oils was assayed and showed no effect on the cell membranes of bovine erythrocytes. Copyright © 2014 Verlag Helvetica Chimica Acta AG, Zürich.
Ethnobotanical survey of the medicinal flora used by the Caribs of Guatemala.
Girón, L M; Freire, V; Alonzo, A; Cáceres, A
1991-09-01
An ethnobotanical survey was conducted among the Carib population of Guatemala in 1988-1989. In general terms, the sample surveyed possessed a relatively good standard of living. Results indicated that health services were utilized by the population, and that domestic medicine, mainly plants (96.9%) was used by 15% of the population. One hundred and nineteen plants used for medicinal purposes were collected, of which 102 (85.7%) could be identified; a list of these together with the information provided for each plant is presented. The most frequently reported plants used as medicine are: Acalypha arvensis, Cassia alata, Cymbopogon citratus, Melampodium divaricatum. Momordica charantia, Neurolaena lobata, Ocimum basilicum, Petiveria alliacea and Solanum nigrescens. Most of these plants are found in the region, but some are brought from the Highlands or outside of the country, such as Malva parviflora, Matricaria chamomilla, Peumus boldus, Pimpinella anisum, Rosmarinus officinalis and Tagetes lucida. This survey demonstrated that the Carib population of Guatemala has survived in a transcultural environment of African and native Amerindian beliefs.
Northward invading non-native vascular plant species in and adjacent to Wood Buffalo National Park
Energy Technology Data Exchange (ETDEWEB)
Wein, R.W.; Wein, G.; Bahret, S.; Cody, W.J. (Alberta University, Edmonton, AB (Canada). Canadian Circumpolar Institute)
A survey of the non-native vascular plant species in Wood Buffalo National Park, Canada's largest forested National Park, documented their presence and abundance in key locations. Most of the fifty-four species (nine new records) were found in disturbed sites including roadsides, settlements, farms, areas of altered hydrological regimes, recent bums, and intensive bison grazing. Species that have increased most in geographic area and abundance in recent years include [ital Agropyron repens], [ital Bromus inermis], [ital Chenopodium album], [ital Melilotus spp.], [ital Trifolium spp.], [ital Plantago major], [ital Achillea millefolium], [ital Crepis tectorum] and [ital Sonchus arvensis]. An additional 20 species, now common in the Peace River and Fort Vermilion areas, have the potential to invade the Park if plant communities are subjected to additional stress as northern climates are modified by the greenhouse effect and as other human-caused activities disturb the vegetation. It is recommended that permanent plots be located in key locations and monitored for species invasion and changing abundances as input to management plans.
Directory of Open Access Journals (Sweden)
Cícero Deschamps
2008-06-01
Full Text Available O gênero Mentha compreende diversas espécies de interesse econômico por causa da produção de óleos essenciais. Recentemente, foram introduzidos no Brasil novos materiais genéticos para avaliação da adaptação em relação ao potencial de rendimento e composição do óleo essencial. No presente trabalho, foram comparadas essas características em cultivares das espécies Mentha x piperita L. (cv. Grapefruit Mint e cv. Persian Mint Field, M. suaveolens Ehrh. (cv. Hillarys Sweet Lemon Mint, M. spicata L. (cv. Mentol Mint, M. aquatica L. (cv. Common Mint e M. arvensis L. (cv. Banana Mint, durante o verão e inverno em Curitiba (PR. O rendimento médio das cultivares no verão foi aproximadamente o dobro do rendimento observado no inverno. Duas cultivares de Mentha x piperita L. (cv. Persina Mint Field e cv. Grapefruit Mint apresentaram maior rendimento de óleo essencial no verão e inverno, sendo que as demais não diferiram entre si. A análise da composição do óleo essencial indicou grande variação nessas cultivares, sendo observada a presença de linalol, como constituinte majoritário na cv. Grapefruit Mint e a-felandren-8-ol e cis-ocimeno na cv. Persian Mint Field.The genus Mentha includes many species of economic interest due the essential oil production. Recently new genetic materials were introduced in Brazil to evaluate the adaptation related to essential oil yield and composition. In the present work, these characteristics were compared in six cultivars of the species Mentha x piperita L. (cv. Grapefruit Mint e cv. Persian Mint Field, M. suaveolens Ehrh (cv. Hillarys Sweet Lemon Mint, M. spicata L. (cv. Mentol Mint, M. aquatica L. (cv. Common Mint and M. arvensis L. (cv. Banana Mint during summer and winter in Curitiba (PR. The average of essential oil yield obtained from samples collected during the summer was approximately two fold the observed during the winter. Two cultivars of Mentha piperita (cv. Persian Mint Field
Impact of different soil cultivation on weed species in winter rape (oilseed
Directory of Open Access Journals (Sweden)
Jan Winkler
2005-01-01
Full Text Available A community of weeds and crops is affected by a number of factors, including, among other things, also tillage. In the years 2000–2002, the composition of weed species in rape stands was evaluated on the fields with the total area of 551 hectares (1 hectar equals to some 2.47 acres. The evaluation was carried out with the application of methodology developed by Kühn (1982. On the fields located in the cadastral area of Olomouc – Holice, which had been cultivated in a traditional manner, 115 relevés were recorded. On the fields in the cadastral area of Bohuňovice, which had been cultivated with the application of reduced tillage, 97 relevés were recorded and evaluated. All of the above fields were subjected to the application of chemical agents reducing the occurrence of weeds. The data thus received were processed by means of multidimensional analysis of ecological data with the application of a RDA method (Redundancy Analysis. In the course of three years, 75 weed species were found on the fields under conventional tillage, on the average, 8.2 species per a relevé, while 66 weed species were found during the same period of time on the fields cultivated by means of reduced tillage, on the average, 8.6 species per a relevé. The application of RDA analysis enabled us to sort out the selected species of weeds (i.e. those the frequency of occurrence of which exceeded 15 % into three groups. The conditions provided by the conventional tillage appeared to be more satisfactory for the weed species included in the first group (Arctium tomentosum, Elytrigia repens, Helianthus tuberosus, Chenopodium album, Lolium perenne and Papaver rhoeas. The species included in the second group, i.e. Alsinula media, Apera spica-venti, Atriplex patula, Bromus sterilis, Capsella bursa-pastoris, Equisetum arvense, Fallopia convolvulus, Myosotis arvensis and Thlaspi arvense., responded to reduced tillage by the increase in cover or by increased frequency of
Directory of Open Access Journals (Sweden)
James N. Macpherson
2016-11-01
Full Text Available The identification of a trinucleotide (CGG expansion as the chief mechanism of mutation in Fragile X syndrome in 1991 heralded a new chapter in molecular diagnostic genetics and generated a new perspective on mutational mechanisms in human genetic disease, which rapidly became a central paradigm (“dynamic mutation” as more and more of the common hereditary neurodevelopmental disorders were ascribed to this novel class of mutation. The progressive expansion of a CGG repeat in the FMR1 gene from “premutation” to “full mutation” provided an explanation for the “Sherman paradox,” just as similar expansion mechanisms in other genes explained the phenomenon of “anticipation” in their pathogenesis. Later, FMR1 premutations were unexpectedly found associated with two other distinct phenotypes: primary ovarian insufficiency and tremor-ataxia syndrome. This review will provide a historical perspective on procedures for testing and reporting of Fragile X syndrome and associated disorders, and the population genetics of FMR1 expansions, including estimates of prevalence and the influence of AGG interspersions on the rate and probability of expansion.
Lansberg, Jean-Philippe
2016-12-27
We propose a simple and model-independent procedure to account for the impact of the nuclear modification of the gluon density as encoded in nuclear collinear PDF sets on two-to-two partonic hard processes in proton-nucleus collisions. This applies to a good approximation to quarkonium, D and B meson production, generically referred to H. Our procedure consists in parametrising the square of the parton scattering amplitude, A_{gg -> H X} and constraining it from the proton-proton data. Doing so, we have been able to compute the corresponding nuclear modification factors for J/psi, Upsilon and D^0 as a function of y and P_T at sqrt(s_NN)=5 and 8 TeV in the kinematics of the various LHC experiments in a model independent way. It is of course justified since the most important ingredient in such evaluations is the probability of each kinematical configuration. Our computations for D mesons can also be extended to B meson production. To further illustrate the potentiality of the tool, we provide --for the first t...
Work-related motives and self-esteem in American women.
Bedeian, A G; Touliatos, J
1978-05-01
Acknowledging the need for additional research on work-related motives and self-esteem in American women, this study investigated the hypothesis that women with a favorable self-esteem would score high in n Ach, in Pow, and n Auto, whereas women with a less favorable self-esteem would score high in n Aff, n Agg, and n Def. Eighty-five female college students completed Gough and Heilbrun's Adjective Check List and Form B of the Coopersmith Self-Esteem Inventory. Data were analyzed by means of chi square tests in conjunction with the coefficient of association asymmetric lambda. The results indicated that, as predicted, women with a favorable self-esteem scored high in n Ach (p less than .001) and n Pow (p less than .001), while contrary to expectation, they also scored high in n Aff (p less than .05). All other relationships were found to be nonreliable. These findings were interpreted as stressing the importance of the relationship between self-esteem and work-related motives in women.
The complete mitochondrial genome of the spinner shark Carcharhinus brevipinna.
Chen, Xiao; Xiang, Dan; Peng, Xin; Ai, Weiming; Chen, Hao
2016-05-01
The mitochondrial genome of the spinner shark (Carcharhinus brevipinna) was determined in this study. It was 16,706 bp in length with the typical genomic organization and gene order as most vertebrates. Whole nucleotide base composition was 31.3% A, 25.3% C, 13.2% G and 30.1% T. Among the protein-coding genes, there are three overlapping reading-frames on the same strand, while one of it on the opposite strand. Two start codons (ATG and GTG) and three stop codons (AGG, TAG and TAA/T) were used in 13 protein-coding genes. The 22 tRNA ranged from 67 (tRNA-Cys and tRNA-Ser2) to 75 bp (tRNA-Leu1) in length. Only the tRNA-Ser2 could not fold into the typical clover-leaf structure, which lost the dihydrouridine (DHU) arm and replaced by a simple loop. The control region was 1064 bp in length and showed a higher AT content (66.8%) than the average value of whole mitogenome (61.4%).
PCR detection of a Maell polymorphism in the human major breakpoint cluster region (BCR)
Energy Technology Data Exchange (ETDEWEB)
McClure, J.S.; Litz, C.E. (Medical School, Minneapolis, MN (United States))
1991-09-25
Nested primer pairs flanking the second intron of the breakpoint cluster region were constructed from the published cDNA sequence. The outer primer pair 5{prime}BCR Exon 2 (5{prime}-GTT TCA GAA GCT TCT CCC TG-3{prime}) and 3{prime}BCR Exon 3 (5{prime}-ACT CTG CTT AAA TCC AGT GG-3{prime}), amplified a fragment of genomic DNA approximately 810 bp in length. The inner primer pair, 3{prime}BCR Exon 2(5{prime}-CGC TGA CCA TCA ATA AGG AA-3{prime}) and 5{prime}BCR Exon 3 (5{prime}-AGA AAC CCA TAG AGC CCC GG-3{prime}), amplified a fragment approximately 730 bp in length. Double stranded DNA amplified with the outer primer pair was subjected to asymmetric PCR using the inner primer pair. Sequencing reactions were performed using the Sequenase dideoxy sequencing kit with S{sup 35}-dATP. Sequences in homozygotes revealed either an A or a G 85 bp 5{prime} of the BCR BamHI site. Heterozygotes demonstrated both bands at the corresponding position.
Directory of Open Access Journals (Sweden)
karim moosavi
2009-06-01
Full Text Available In order to evaluate wild mustard competitive effect on winter wheat, an additive series experiment was conducted in 2000-2001 at Agricultural Research Station of Mashhad University.The experiment had 3 factor: wheat seed rate (175 , 215 and 255 kg/ha, nitrogen rate (150 and 225 kg/ha, and a range of wild mustard densities. Hyperbolic functions was used to describe yield-weed density relationship. Increasing wild mustard density had a negative , asymptotic – type effect on wheat biomass and grain yield. By increasing wheat seed rate , in optimum nitrogen rate , maximum wheat biomas loss has reduced about 51 %. Maximum yield loss has increased from 42.1 % to 50.4 %, as nitrogen rate incrased from optimum to upper optimum rate of wheat. By increasing of wheat seed rate from 175 to 255 kg/ha, maximum tiller number reduction due to high densities of wild mustard, has decreased by 54 %. Reduction of fertile tiller number was mostly occurred at presence of high nitrogen level, thus, reduction of fertile tiller number compared to control in N1 was 18% , while in N2 has increased to 30%. Wild mustard competition has reduced wheat seed number per ear 30% in compare to weed free control. Results show that wheat 1000 seed weight was more affected by nitrogen rate than plant densities. Apparently, in competition with wheat, wild mustard was better able to utilize the added nitrogen and thus gained a competitive adventage over the wheat.
E. Héctor; Martha L. Barrón; Lianette Godoy; B. Díaz; María M. Hernández; A. Torres
2005-01-01
El género Mentha constituye una importante fuente de materia prima para varias industrias como la perfumería, cosmética, licorería y farmacéutica. En el estado de Chihuahua, México, se han introducido en los últimos años varias especies de este género con propósitos comerciales, y se ha empleado con relativo éxito la propagación in vitro en la multiplicación masiva de una de ellas. La ocurrencia de contaminaciones endógenas ha sido un problema para el establecimiento in vitro de esta y otras ...
Directory of Open Access Journals (Sweden)
Nilo, M.C.S.,
2017-07-01
Full Text Available Essential oils and infusions from commercial peppermint sachets (CPS, and non-commercial genuine peppermint (NCP and cornmint (NCC samples were analyzed by GC/MS and LC/MS. Minimum inhibitory concentration (MIC of mint oils against Fusarium moniliforme, Aspergillus niger and Aspergillus fumigates was determined. Antioxidant potential was monitored by total phenolic content (TPC, 2,2-diphenyl-1-picrylhydrazyl (DPPH radical and soybean oil oxidation tests. CPS and NCC oils had lower menthofuran content than NCP. Mint oils did not show a uniform standard of antifungal activity and they had the modest reducing ability. CPS and NCC infusions showed higher IC50 and lower TPC than NCP ones. In the soybean oxidation test, mint oils presented prooxidant behavior. CPS infusions showed antioxidant potential significantly (P<0.05, Tukey lower than that from NCC and NCP infusions. NCP infusions were more efficient in delaying propagation reaction than NCC ones. This may be attributed to higher amount of rosmarinic acid and hesperidin in NCP.
Directory of Open Access Journals (Sweden)
Dalva Paulus
2008-03-01
Full Text Available A menta (Mentha arvensis L. é uma planta aromática e que produz um óleo essencial rico em mentol. Para o cultivo hidropônico de hortaliças folhosas e de frutos existe um grande número de soluções nutritivas recomendadas pela pesquisa; no entanto, existem poucas informações sobre soluções nutritivas para menta. O objetivo deste trabalho foi avaliar uma solução nutritiva para o cultivo de menta em hidroponia. Conduziram-se dois experimentos de outubro a dezembro de 2004 em Santa Maria, RS. Para o experimento a campo, as mudas foram obtidas por estacas e produzidas em substrato organo-mineral (plantmax®, posteriormente transplantadas para canteiros de 5,00 m de comprimento e 1,00 de largura, no espaçamento 0,60 x 0,30 m. No sistema hidropônico "NFT", as mudas foram propagadas por estaquia em espuma fenólica, onde permaceram 18 dias no berçário, quando foram transferidas para as bancadas de produção final. O delineamento experimental foi blocos ao acaso em esquema fatorial 2x2 com os fatores: concentração da solução nutritiva e espaçamentos. Determinou-se a fitomassa seca, o teor de óleo essencial e o mentol. Os melhores resultados de teor de óleo essencial (0,60 ml 100 g-1 de folhas frescas, mentol (82,4% e fitomassa seca (45 g planta-1 foram obtidos com 100% da concentração da solução nutritiva no transplante e reposição de 50% quando a condutividade elétrica reduziu 50% do valor inicial e no espaçamento de 0,50 m x 0,25 m nos canais de cultivo. Constatou-se que o teor e rendimento de óleo essencial e fitomassa seca no cultivo hidropônico com a solução nutritiva proposta foram superiores aos encontrados em cultivo a campo de 27 g planta-1de fitomassa seca, 0,53 Ml 100 g-1 de folhas frescas de óleo essencial e 64,43% de mentol. A solução nutritiva com concentração de 100% no transplante e reposição de 50% dos nutrientes quando a condutividade elétrica reduzir 50% do valor inicial e o espaçamento 0
Occurence, spread and possibilities of invasive weeds control in sugar beet
Directory of Open Access Journals (Sweden)
Konstantinović Branko I.
2006-01-01
Full Text Available Floristically rich and diverse weed comunity of sugar beet is in our country represented by 150 weed species. They are not all equaly significant in weediness of this crop. Only a limited number of them participate in weed comunity composition. These are: Abuthilon theophrasti Medic., Ambrosia artemisiifolia L., Amaranthus retroflexus L., Chenopodium album L., Cirsium arvense (L Scop., Convolvulus arvensis L., Cynodon dactylon (L Pers. Digitaria sanguinalis (L Scop., Hibiscus trionum L., Rubus caesius L. Echinochloa crus-gall L., Polygonum aviculare L., P. lapathifolium L., P. persicaria L., Setaria glauca (L P. B., S. viridis (L P. B., Solanum nigrum L. and Sorghum halepense (L Pers. In shooting period up to 4-8 weeks upon emergence, sugar beet is under the haviest harmfull inluence of weeds, especially invasive ones such as: Abuthilon theophrasti Medic. Ambrosia artemisiifolia L., Cirsium arvense (L Scop., Iva xanthifolia L. Sorghum halepense (L Pers. and Xanthium strumarium L. Sugar beet growing requires intensive cultural practices, i.e. basic and additional tillage and cultivation. Due to the widening of weed problems, frequent herbicide use in several applications is needed in the longer time period.
Trace metal uptake by garden herbs and vegetables.
Shariatpanahi, M; Anderson, A C; Mather, F
1986-12-01
In many regions of Iran, crops are irrigated with municipal and industrial wastewater that contain a variety of metals. The purpose of this study was to simulate the level of metals that may be presented to plants over a growing season in a controlled laboratory setting. Cadmium, lead, arsenic, chromium, mercury, nickel, copper, zinc, and selenium were applied to plants at the high rate of 200 g metal/ha/wk. The following plants were examined for metal accumulation and effects on yield: garden cress (Lipidium sativum), leek (Allium porrum L.), basil (Ocimum basilicum L.), mint (Mentha arvensis L.), onion (Allium capa L.), radish (Raphanus sativus L.), and tarragon (Artemisia draculus L.). All plants showed significant uptake of all metals when compared to control (p=0.05), and growth was significantly reduced (p=0.05). Cadmium and chromium levels of 85±7.4 and 47.6±8.9 μg/g); selenium levels were highest in tarragon (16.5±5.8 μg/g). Zinc levels were similar (p=0.05) in all species tested, as were mercury and lead. The remaining metals (nickel and copper) showed significant differences in uptake, depending on plant species.
Directory of Open Access Journals (Sweden)
Z Anafjeh
2012-02-01
Full Text Available ABSTRACT In order to study the effect of various densities of wild mustard (Sinapis arvensis L. on growth indices of Canola (Brassica napus L. in climate of Molathani, Ahvaz, an experiment was conducted in the experimental field of Ramin Agricultural and Natural Resources University, in 2006-2007. The split-plot set of treatments was arranged within randomized complete block design with four replications. Treatments included of wild mustard at five levels (0, 7, 14, 21 and 35 plants m2 and Canola at three densities (60, 80 and 100 plants m2. The results showed that the increase in mustard density rates lead to decreasing total dry matter, leaf area index, crop growth rate, relative growth rate and mean pod dry matter in three canola densities (60, 80 and 100 plants m2. Somewhat the lowest growth indices was obtained in 35 plants mustard (that is the highest mustard density. In addition damage rate of mustard decreased canola seed yield for 7, 14, 21 and 35 plants mustard up to 61, 71, 76 and 91%, respectively. Keywords: Plant density, Competition, Yield loss threshold, Growth indices, Canola, Mustard
Amri, Ismail; De Martino, Laura; Marandino, Aurelio; Lamia, Hamrouni; Mohsen, Hanana; Scandolera, Elia; De Feo, Vincenzo; Mancini, Emilia
2013-03-01
Aromatic plants can interfere in the Mediterranean ecosystem, mainly by the introduction in the environment of volatile compounds. For this reason, we studied the chemical composition and the possible phytotoxic and antimicrobial activities of the essential oil extracted from leaves of Tunisian Artemisia herba-alba Asso. The chemical composition of the essential oil, obtained by hydrodistillation, was analyzed by GC and GC-MS. In all, 24 compounds were identified. The main components were camphor (39.1%), chrysanthenone (15.0%) and cis-thujone (7.8%). The essential oil was evaluated for its in vitro phytotoxic activity against germination and initial radical growth of Raphanus sativus L., Lepidium sativum L., Sinapis arvensis L., Triticum durum L. and Phalaris canariensis L. seeds. The radicle elongation of the five seeds was affected to different extents by the oil, while germination was not affected. The oil, when tested against eight selected bacterial strains, showed low antimicrobial activity. The chemical composition of the oil of A. herba-alba can help in the chemosystematics of this complex genus. However, the recorded biological activities seem to be neither ecologically nor medicinally significant.
Rigat, Montse; Bonet, Maria Àngels; Garcia, Sònia; Garnatje, Teresa; Vallès, Joan
2009-01-01
The present study reports a part of the findings of an ethnobotanical research project conducted in the Catalan region of the high river Ter valley (Iberian Peninsula), concerning the use of wild vascular plants as food and the medicinal uses of both wild and cultivated food plants. We have detected 100 species which are or have been consumed in this region, 83 of which are treated here (the remaining are the cultivated food plants without additional medicinal uses). Some of them, such as Achillea ptarmica subsp. pyrenaica, Convolvulus arvensis, Leontodon hispidus, Molopospermum peloponnesiacum and Taraxacum dissectum, have not been previously reported, or have only very rarely been cited or indicated as plant foods in very restricted geographical areas. Several of these edible wild plants have a therapeutic use attributed to them by local people, making them a kind of functional food. They are usually eaten raw, dressed in salads or cooked; the elaboration of products from these species such as liquors or marmalades is a common practice in the region. The consumption of these resources is still fairly alive in popular practice, as is the existence of homegardens, where many of these plants are cultivated for private consumption.
Late Miocene (Pannonian) Vegetation from the Northern Part of Central Paratethys
Kováčová, M.; Doláková, N.
2009-04-01
. Accumulations of the Chenopodiaceae in the interfluve areas probably indicate local saline swampy environments during sea level fall. The increasing amounts of herbs indicate the existence of wet prairie areas (Thalictrum, Rumex, Valeriana, Dipsacaceae, Lamiaceae, Galium) or steppes (Artemisia - up to 17%, Asteraceae, Campanula, Fabaceae, Daucaceae, Caryophyllaceae, Plantago). This is the contribution to the projects ESF -EC-009-07, APVT 51-011305, APVV-0280-07 (Slovakia) and MSM0021622427 (Czech republic).
A single sequence context cannot satisfy all non-AUG initiator codons in yeast†
Directory of Open Access Journals (Sweden)
Wang Tzu-Ling
2010-07-01
Full Text Available Abstract Background Previous studies in Saccharomyces cerevisiae showed that ALA1 (encoding alanyl-tRNA synthetase and GRS1 (encoding glycyl-tRNA synthetase respectively use ACG and TTG as their alternative translation initiator codons. To explore if any other non-ATG triplets can act as initiator codons in yeast, ALA1 was used as a reporter for screening. Results We show herein that except for AAG and AGG, all triplets that differ from ATG by a single nucleotide were able to serve as initiator codons in ALA1. Among these initiator codons, TTG, CTG, ACG, and ATT had ~50% initiating activities relative to that of ATG, while GTG, ATA, and ATC had ~20% initiating activities relative to that of ATG. Unexpectedly, these non-AUG initiator codons exhibited different preferences toward various sequence contexts. In particular, GTG was one of the most efficient non-ATG initiator codons, while ATA was essentially inactive in the context of GRS1. Conclusion This finding indicates that a sequence context that is favorable for a given non-ATG initiator codon might not be as favorable for another.
The role of Ag buffer layer in Fe islands growth on Ge (111) surfaces
Energy Technology Data Exchange (ETDEWEB)
Fu, Tsu-Yi, E-mail: phtifu@phy.ntnu.edu.tw; Wu, Jia-Yuan; Jhou, Ming-Kuan; Hsu, Hung-Chan [Department of Physics, National Taiwan Normal University, 88, Sec. 4, Ting-Chou Rd, Taipei 116, Taiwan (China)
2015-05-07
Sub-monolayer iron atoms were deposited at room temperature on Ge (111)-c(2 × 8) substrates with and without Ag buffer layers. The behavior of Fe islands growth was investigated by using scanning tunneling microscope (STM) after different annealing temperatures. STM images show that iron atoms will cause defects and holes on substrates at room temperature. As the annealing temperature rises, iron atoms pull out germanium to form various kinds of alloyed islands. However, the silver layer can protect the Ag/Ge(111)-(√3×√3) reconstruction from forming defects. The phase diagram shows that ring, dot, and triangular defects were only found on Ge (111)-c(2 × 8) substrates. The kinds of islands found in Fe/Ge system are similar to Fe/Ag/Ge system. It indicates that Ge atoms were pulled out to form islands at high annealing temperatures whether there was a Ag layer or not. But a few differences in big pyramidal or strip islands show that the silver layer affects the development of islands by changing the surface symmetry and diffusion coefficient. The structure characters of various islands are also discussed.
A taxonomic revision of the genus Ceiba Mill. (Bombacaceae
Directory of Open Access Journals (Sweden)
Gibbs, Peter
2003-12-01
Full Text Available In this taxonomic revision of Ceiba Mill, (in which we include Chorisia Kunth we recognize 17 species, seven of which we group in the C. insignis. species aggregate. One new species is described, C. lupuna P.E. Gibbs & Semir from Peru, which is referred to the C. insignis agg., and one new subspecies, C. aesculifolia subsp. parvifolia (Rose P.E. Gibbs & Semir is recognized. Distribution maps are provided for 16 species (that for C. pentandra is restricted to the New World, and six species are illustrated.En esta revisión taxonómica de Ceiba, que incluye el género Chorisia, se reconocen 17 especies, siete de las cuales se agrupan en el complejo C. insignis. Se describe una nueva especie, C. lupuna P.E. Gibbs & Semir, del Perú, que pertenece al complejo de C. insignis, asf como una nueva subespecie, C. aesculifolia subsp. parvifolia (Rose P.E. Gibbs & Semir. Se incluyen mapas de distribuci6n de 16 especies (aunque en el caso de C. pentandra solo se representa su distribución americana y se dibujan detalles diagnósticos de seis especies.
Directory of Open Access Journals (Sweden)
Bostanabad S
2008-01-01
Full Text Available The aim of this study was to investigate the frequency, location and type of katG mutations in Mycobacterium tuberculosis strains isolated from patients in Belarus. Forty two isoniazid-resistant isolates were identified from sputum of 163 patients with active pulmonary tuberculosis. Drug susceptibility testing was determined by using CDC standard conventional proportional method and BACTEC system. Standard PCR method for detection of isoniazid resistance associated mutations was performed by katG gene amplification and DNA sequencing. Most mutations were found in katG gene codons 315, 316 and 309. Four types of mutations were identified in codon 315: AGC→ACC ( n = 36 85%, AGC→AGG ( n = 1 2.3%, AGC→AAC ( n = 2 4.7%, AGC→GGC ( n = 1 2.3%. One type of mutation was found in codon 316: GGC→AGC ( n = 1841.4%, four types of mutations were detected in codon 309: GGT→GGT ( n = 716.1%, GGT→GCT ( n = 49.2%, GGT→GTC ( n = 36.9%, GGT→GGG ( n = 12.7%. The highest frequency of mutations sharing between primary and secondary infections was found in codon 315.
Energy Technology Data Exchange (ETDEWEB)
Ashida, Jun; Ohgo, Kosuke; Komatsu, Kohei; Kubota, Ayumi; Asakura, Tetsuo [Tokyo University of Agriculture and Technology, Department of Biotechnology (Japan)], E-mail: asakura@cc.tuat.ac.jp
2003-02-15
Spiders synthesize several kinds of silk fibers. In the primary structure of spider silk, one of the major ampullate (dragline, frame) silks, spidroin 1, and flagelliform silk (core fibers of adhesive spiral), there are common repeated X-Gly-Gly (X = Ala, Leu, Pro, Tyr, Glu, and Arg) sequences, which are considered to be related to the elastic character of these fibers. In this paper, two dimensional spin diffusion solid-state NMR under off magic angle spinning (OMAS), {sup 13}C chemical shift contour plots, and Rotational Echo DOuble Resonance (REDOR) were applied to determine the torsion angles of one Ala and two kinds of Gly residues in the Ala-Gly-Gly sequence of {sup 13}C=O isotope-labeled (Ala-Gly-Gly){sub 10}. The torsion angles were determined to be ({phi}, {psi}) = (-90 deg., 150 deg.) within an experimental error of {+-}10 deg. for each residue. This conformation is characterized as 3{sub 1} helix which is in agreement with the structure proposed from the X-ray powder diffraction pattern of poly(Ala-Gly-Gly). The 3{sub 1} helix of (Ala-Gly-Gly){sub 10} does not change by formic acid treatment although (Ala-Gly){sub 15} easily changes from the silk I conformation (the structure of Bombyx mori silk fibroin before spinning in the solid state) to silk II conformation (the structure of the silk fiber after spinning) by such treatment. Thus, the 3{sub 1} helix conformation of (Ala-Gly-Gly){sub 10} is considered very stable. Furthermore, the torsion angles of the 16th Leu residue of (Leu-Gly-Gly){sub 10} were also determined as ({phi}, {psi}) = (-90 deg., 150 deg.) and this peptide is also considered to take 3{sub 1} helix conformation.
Directory of Open Access Journals (Sweden)
Sajjad Mohebali
2016-07-01
Full Text Available Objective: To investigate the effect of wild black mustard seed meal on thyroid hormones (thyroxine and thyroid-stimulating hormone in Japanese quails and also study the ability of FeSO4 to alleviate the possible negative effect of mustard meal on thyroid hormones in these birds for the first time. Methods: The experimental procedure was undertaken on 28 quails which were randomly assigned to a control and 6 test groups with 4 quails in each group for 28 days, during which the control group received basic diet with no mustard meal whereas the test groups (No. 2, 3 and 4 received mustard meal (5%, 10% and 15%, respectively and test groups (No. 5, 6 and 7 received FeSO4 (1%-treated mustard meal (5%, 10% and 15%, respectively on the basic of basic diet. Results: The group fed on 15% non-treated mustard seed meal had the least thyroxine level and its level backed to normal in group fed on 15% FeSO4-treated mustard seed meal although this group had the highest alanine transaminase and aspartate transaminase levels. Conclusions: We concluded that up to 10% FeSO4 mustard seed meal could be incorporated in the quail diet successfully with the least damage to thyroids and livers, but further investigations on these birds are still needed to confirm this hypothesis.
Hıyarda (Cucumis sativus L. yabancı ot çıkış zamanın tahminine yönelik araştırmalar
Directory of Open Access Journals (Sweden)
Nihat Tursun
2015-01-01
Full Text Available İstatistiki modellerin geliştirilmesi için hıyar bitkisinde on bir önemli yabancı otun çıkış zamanın belirlenmesinde modellemeler yapılmıştır. Hıyar deneme arazisinde bulunan önemli yabancı otlar çıkış zamanlarına göre gruplara ayrılmıştır. Bu yabancı otlardan; Amaranthus retroflexus, Chenopodium album, Heliotropium europaeum, Polygonum aviculare ve Solanum nigrum erken, Convolvulus arvensis, Cyperus rotundus, Cynodon dactylon, Portulaca oleracea ve Sorghum halepense bütün vejetasyon boyunca ve Tribulus terrestris ise geç çimlenen yabancı ot türü olarak belirlenmiştir. Farklı doğrusal olmayan büyüme eğrileri (Chapman-Richard, Weibull, logistic, Gompertz ve cubic spline farklı yabancı ot türleri ve yıllar için çıkış yüzdeleri verileri esas alınarak uyarlanmıştır. Cubic splin model birçok yabancı ot türü için en iyi model olarak saptanmıştır.
van Veelen, H Pieter J; Salles, Joana Falcão; Tieleman, B Irene
2018-05-01
The microbiome is essential for development, health and homeostasis throughout an animal's life. Yet, the origins and transmission processes governing animal microbiomes remain elusive for non-human vertebrates, oviparous vertebrates in particular. Eggs may function as transgenerational carriers of the maternal microbiome, warranting characterisation of egg microbiome assembly. Here, we investigated maternal and environmental contributions to avian eggshell microbiota in wild passerine birds: woodlark Lullula arborea and skylark Alauda arvensis. Using 16S rRNA gene sequencing, we demonstrated in both lark species, at the population and within-nest levels, that bacterial communities of freshly laid eggs were distinct from the female cloacal microbiome. Instead, soil-borne bacteria appeared to thrive on freshly laid eggs, and eggshell microbiota composition strongly resembled maternal skin, body feather and nest material communities, sources in direct contact with laid eggs. Finally, phylogenetic structure analysis and microbial source tracking underscored species sorting from directly contacting sources rather than in vivo-transferred symbionts. The female-egg-nest system allowed an integrative assessment of avian egg microbiome assembly, revealing mixed modes of symbiont acquisition not previously documented for vertebrate eggs. Our findings illuminated egg microbiome origins, which suggested a limited potential of eggshells for transgenerational transmission, encouraging further investigation of eggshell microbiome functions in vertebrates.
Directory of Open Access Journals (Sweden)
Rosario Paolo Mauro
2015-06-01
Full Text Available Cover crops can offer significant advantages in the agronomic management of citrus orchards in Mediterranean environments. Therefore, a three-year research was conducted in eastern Sicily aimed at studying the effects of four cover crop sequences (Sinapis arvensis-Trigonella foenum-graecum-T. foenum-graecum; Medicago scutellata-Avena sativa-Lolium perenne; Vicia faba minor-A. sativa-A. sativa; A. sativa-V. faba. minor-L. perenne on weeds, major soil chemical properties and nutritional status of an organically grown orange orchard. The results highlighted that, among the studied cover crop sequences, Vicia faba-Avena-Avena was the most beneficial for weeds control within the orchard (92%, of cover crop cover, and 586 and 89 g DW m–2 of cover crop aboveground biomass and weeds aboveground biomass, respectively. Overall, the chemical fertility of the soil was positively influenced. In particular, it was observed an increase of the content of total nitrogen and available phosphorus in the soil by both Sinapis-Trigonella-Trigonella (0.75 g kg–1 and 59.0 mg kg–1, respectively and Vicia faba-Avena-Avena (0.70 g kg–1 and 56.0 mg kg–1, respectively cover crop sequences. Medicago-Avena-Lolium sequence seemed to be the most useful to ensure a better nutritional status of the orange orchard.
Vegetation pattern and heavy metal accumulation at a mine tailing at Gyöngyösoroszi, hungary.
Tamás, János; Kovács, Alza
2005-01-01
Vegetation at an abandoned heavy metal bearing mine tailing may have multifunctional roles such as modification of water balance, erosion control and landscape rehabilitation. Research on the vegetation of mine tailings can provide useful information on tolerance, accumulation and translocation properties of species potentially applicable at moderately contaminated sites. Analyses of the relationship between heavy metal content (Pb, Zn and Cu) and vegetation in a mine tailing were carried out. These analyses included: (1) spatial analysis of relationship among heavy metal distribution, pH and vegetation patterns, and (2) analysis of heavy metal accumulation and translocation in some plant species. Presence of vegetation was found to be significantly dependent on pH value, which confirms that phytotoxicity is a function of element concentration in solution, which is primarily controlled by pH value in mine tailings. Among the most abundant plant species, dewberry (Rubus caesius), vipersbugloss (Echium vulgare), scarlet pimpernel (Anagallis arvensis) and narrowleaf plantain (Plantago lanceolata) accumulate significant amounts of Pb, Cu and Zn, while in the case of annual bluegrass (Poa annua) only Pb can be measured in elevated contents. Considering the translocation features, scarlet pimpernel, narrowleaf plantain, and dewberry accumulate heavy metals primarily in their roots, while heavy metal concentration in vipersbugloss and annual bluegrass is higher in the shoots.
Sharifi-Rad, M; Iriti, M; Sharifi-Rad, M; Gibbons, S; Sharifi-Rad, J
2016-08-29
In this study, we evaluated the effects of the extracts of the leaves of species from the Rubiaceae (Galium aparine L. and Asperula arvensis L.), Fabaceae (Lathyrus aphaca L. and Vicia narbonensis L.) and Poaceae (Digitaria sanguinalis (L.) Scop. and Hordeum murinum L.) plant families on a wide and extensive panel of isolated methicillin-resistant Staphylococcus aureus strains (MRSA). The effects of the methanolic leaf extracts of Rubiaceae, Fabaceae and Poaceae plants on MRSA were evaluated by the disc diffusion assay and the broth dilution method. Among a total of 177 S. aureus isolates, 92 (51.97%) were found to be methicillin-resistant in an antibiogram and this was confirmed by the presence of the mecA gene in polymerase chain reaction method. All MRSA isolates were sensitive to all extracts. There were dose-dependent inhibitions on tested microorganisms for all plant extracts which showed maximum inhibition zones at a concentration of 300 mg/L. L. aphaca, G. aparine and H. murinum exhibited the highest antibacterial activity on the MRSA strains compared to the positive control (P Fabaceae), G. aparine (Rubiaceae), and H. murinum (Poaceae) proved to have high antibacterial activity on MRSA isolates, thus representing promising antimicrobial agents in clinical settings.
Directory of Open Access Journals (Sweden)
Mohd Nauman Saleem
2016-01-01
Full Text Available The Transdermal Drug Delivery System (TDDS is one of the novel routes for systemic delivery of drugs through intact skin. A transdermal patch (TP is a medicated patch that is placed on skin for delivery of medication through skin into the blood stream. The aim of present study was to formulate and evaluate a Unani transdermal patch that could be used for antiemetic therapy. The incorporation of Unani ingredients, namely, Khardal (Brassica nigra, Zanjabeel (Zingiber officinale, Podina (Mentha arvensis, and Sirka (Vinegar were envisaged. The TP was prepared by solvent evaporation technique and was evaluated for organoleptic characteristics and other physicochemical properties, such as thickness, weight uniformity, folding endurance, moisture content, drug content, and tolerability and acceptability of patch. The in vitro permeation study of the patch was carried out through Franz diffusion cell using egg shell membrane as barrier membrane. Phosphate buffer pH 7.4 was used as dissolution medium and the temperature was maintained at 37 ± 1°C. The in vitro permeation study of the prepared TP indicated a time dependent increase in drug release throughout the study. The percentage of cumulative drug release was found to be 77.38% in 24 hours. The study shows a new approach to work in Unani pharmaceutics.
Kraemer, Thorsten; Hunsche, Mauricio; Noga, Georg
2009-08-01
Typical active ingredient (AI) residue patterns are formed during droplet drying on plant surfaces owing to the interaction of spray solution characteristics and leaf micromorphology. Currently, comparatively little is known about the influence of AI deposit patterns within a spray droplet residue area on the penetration and biological efficacy of glyphosate. A scanning electron microscope with energy dispersive X-ray microanalysis has been used to characterise residue patterns and to quantify the area ultimately covered by glyphosate within the droplet spread area. The easy-to-wet weed species Stellaria media L. and Viola arvensis L., as well as the difficult-to-wet Chenopodium album L. and Setaria viridis L., differing in their surface micromorphology, have been used. Rapeseed oil ethoxylates (RSO 5 or RSO 60) were added to glyphosate solutions to provide different droplet spread areas. Addition of RSO 5 enhanced droplet spread area more than RSO 60, and both caused distinct glyphosate residue patterns. The biological efficacy of treatment solutions showed no significant correlation with the area ultimately covered by glyphosate. The results have implications on herbicide uptake models. This study shows that droplet spread area does not correspond to the area ultimately covered by glyphosate, and that the latter does not affect glyphosate phytotoxicity.
Assessing vocal performance in complex birdsong: a novel approach.
Geberzahn, Nicole; Aubin, Thierry
2014-08-06
Vocal performance refers to the ability to produce vocal signals close to physical limits. Such motor skills can be used by conspecifics to assess a signaller's competitive potential. For example it is difficult for birds to produce repeated syllables both rapidly and with a broad frequency bandwidth. Deviation from an upper-bound regression of frequency bandwidth on trill rate has been widely used to assess vocal performance. This approach is, however, only applicable to simple trilled songs, and even then may be affected by differences in syllable complexity. Using skylarks (Alauda arvensis) as a birdsong model with a very complex song structure, we detected another performance trade-off: minimum gap duration between syllables was longer when the frequency ratio between the end of one syllable and the start of the next syllable (inter-syllable frequency shift) was large. This allowed us to apply a novel measure of vocal performance ¿ vocal gap deviation: the deviation from a lower-bound regression of gap duration on inter-syllable frequency shift. We show that skylarks increase vocal performance in an aggressive context suggesting that this trait might serve as a signal for competitive potential. We suggest using vocal gap deviation in future studies to assess vocal performance in songbird species with complex structure.
Weed vegetation ecology of arable land in Salalah, Southern Oman.
El-Sheikh, Mohamed A
2013-07-01
This paper applies multivariate statistical methods to a data set of weed relevés from arable fields in two different habitat types of coastal and mountainous escarpments in Southern Oman. The objectives were to test the effect of environmental gradients, crop plants and time on weed species composition, to rank the importance of these particular factors, and to describe the patterns of species composition and diversity associated with these factors. Through the application of TWINSPAN, DCA and CCA programs on data relating to 102 species recorded in 28 plots and farms distributed in the study area, six plant communities were identified: I- Dichanthium micranthum, II- Cynodon dactylon-D. micranthum, III- Convolvulus arvensis, IV- C. dactylon-Sonchus oleraceus, V- Amaranthus viridis and VI- Suaeda aegyptiaca-Achyranthes aspera. The ordination process (CCA) provided a sequence of plant communities and species diversity that correlated with some anthropogenic factors, physiographic variables and crop types. Therefore, length of time since farm construction, disturbance levels and altitude are the most important factors related to the occurrence of the species. The perennial species correlated with the more degraded mountain areas of new farm stands, whereas most of the annuals correlated with old lowland and less disturbed farms.
Ben Ghnaya, Asma; Hamrouni, Lamia; Amri, Ismail; Ahoues, Haifa; Hanana, Mohsen; Romane, Abderrahmane
2016-09-01
Allelopathic materials inside a tree can produce positive or negative change in the survival, growth, reproduction and behaviour of other organisms if they escape into the environment. To assess these effects, this work was carried out to evaluate the allelopathic impact of Eucalyptus erythrocorys L. on seed germination and seedling growth of two weeds: Sinapis arvensis L. and Phalaris canariensis L.; on one cultivated crop: Triticum durum L. Aqueous; and on ethanolic leaf extracts of E. erythrocorys L. The study was effected using four concentrations (10, 20, 25 and 30 μL/mL) while distilled water was used as a control. The results showed that the E. erythrocorys L. crude extracts had an inhibitory effect on seed germination and seedling growth of both studied weeds and wheat. The inhibition rate was increased by the increase in extract concentration. Only ethanolic extracts of E. erythrocorys L. induced a significant inhibition of seed germination of durum wheat. The effect of E. erythrocorys L. crude extracts was more severe on weeds than on durum wheat. These results indicate that the seedling growth, especially radicle elongation, was the more sensitive indicator to evaluate the effects of extracts than was the seed germination.
Plant occurrence on burning coal waste – a case study from the Katowice-Wełnowiec dump, Poland
Directory of Open Access Journals (Sweden)
Ciesielczuk Justyna
2015-06-01
Full Text Available Coal-waste dumps superimposed on former rubbish dump frequently undergo selfheating and selfignition of organic matter dispersed in the waste. The special conditions for plant growth generated as a result have been investigated since 2008 on the municipal dump reclaimed with coal wastes in Katowice-Wełnowiec, Poland. The plants observed most frequently where heating has occurred are Sisymbrium loeselii, Artemisia vulgaris, Sonchus arvensis, Chenopodium album, Achillea millefolium, Cirsium arvense, Amaranthus retroflexus, Atriplex nitens and Solanum nigrum. Some new, rare species such as Portulaca oleracea, first noticed in 2011, may be added. Most of encroaching species are annual, alien archeophytes and neophytes. Native species are mainly perennials. The majority of these species show a tendency to form specimens of huge size (gigantism. The abundance of emitted CO2 and nitrogen compounds is the likely cause of this. Additionally, the plants growing there are not attacked by insects. The heating of the ground liquidates the natural seed bank. After cooling, these places are seeded by species providing seeds at that very moment (pioneer species. Heated places on the dumps allow plant growth even in the middle of winter. As the seasonal vegetation cycle is disturbed, plants may be found seeding, blooming and fruiting at the same time.
The main weed species and their control in oilseed crops in Finland
Directory of Open Access Journals (Sweden)
J. SALONEN
2008-12-01
Full Text Available A survey of weeds in spring-sown oilseed crops (Brassica rapa ssp. oleifera and Brassica napus ssp. oleifera was conducted in southern and central Finland during 20072009, representing the first such extensive investigation in the country. The occurrence of the most abundant weed species in oilseeds was surveyed in 429 fields. In the fields with moderate or high weed infestation, 16 harmful weed species were recorded by visual observation according to their biomass production. About 40 weed species were recorded, the most predominant being Chenopodium album, Galeopsis spp., Galium spurium, Sonchus arvensis and Tripleurospermum inodorum. Elymus repens was the only major grass weed. Chemical weed control of broad-leaved weeds had been practised in 53% of the fields, resulting in relatively good control. In addition, both selective graminicides and glyphosate were used to control E. repens. Mechanical weed control was not practised in any field. The crop yield level was about 300 kg ha-1 higher in the fields with low weed infestation compared with in the highly infested fields. New promising options to replace the banned herbicide trifluralin are available. Thus, the most harmful weeds, such as C. album, which interferes with the production of high-quality oil for human consumption, can still be effectively controlled.;
Yabani Hardal (Sinapsis arvensis L. Tohumu ve Yağlarının Bazı Bileşim Özellikleri
Directory of Open Access Journals (Sweden)
Musa Özcan
2015-02-01
Full Text Available Tohum örneğinde bin tane ağırlığı ve irilik, su, ham kül, protein, yağ ve selüloz uçucu yağ miktarları belirlenmiştir. Tohum yağında nispi yoğunluk, kırılma indisi, serbest yağ asitleri, peroksit sayısı, iyot sayısı, sabunlaşma sayısı ve sabunlaşmayan madde tayin edilmiştir. Gaz kromatografisi yöntemiyle %0.25 uçucu yağda %95.40 allil izotiyosiyanat, %22.52 sabit yağda başlıca; %29.62 oleik, %24.18 linoleik, %20.65 erüsik ve %16.52 linolenik asitler saptanmıştır.
Praus, Libor; Hegemann, Arne; Tieleman, B. Irene; Weidinger, Karel
2014-01-01
Predation is a major cause of breeding failure in bird species with open nests. Although many studies have investigated nest predation rates, direct identification of nest predators is sporadic, especially in (semi-)natural habitats. We quantified nest success and identified nest predators in a
Czech Academy of Sciences Publication Activity Database
Hanzl, Martin; Kolář, Filip; Nováková, D.; Suda, Jan
2014-01-01
Roč. 111, č. 6 (2014), s. 935-945 ISSN 0002-9122 R&D Projects: GA ČR GB14-36079G Institutional support: RVO:67985939 Keywords : contact zone * ecological segregation * flow cytometry Subject RIV: EF - Botanics Impact factor: 2.603, year: 2014
Czech Academy of Sciences Publication Activity Database
Doubková, Pavla; Kohout, Petr; Sudová, Radka
2013-01-01
Roč. 23, č. 7 (2013), s. 561-572 ISSN 0940-6360 R&D Projects: GA AV ČR KJB600050812 Institutional support: RVO:67985939 Keywords : arbuscular mycorrhizal symbiosis * serpentine soils * nutrient availability Subject RIV: EF - Botanics Impact factor: 2.985, year: 2013
Directory of Open Access Journals (Sweden)
Jorge H Chagas
2011-09-01
Full Text Available Objetivou-se avaliar os efeitos da adubação orgânica no plantio e em cobertura na produção de biomassa seca da parte aérea e no teor e rendimento de óleo essencial da hortelã-japonesa (Mentha arvensis L.. O experimento constou de duas etapas (colheitas. O delineamento utilizado foi em blocos ao acaso, com três repetições. Na primeira etapa, foram avaliadas cinco diferentes doses de esterco bovino aplicadas às parcelas no plantio (0; 2,5; 5,0; 7,5 e 10,0 kg m-2 e após 120 dias de cultivo foi realizada a primeira colheita. Na segunda etapa, após a primeira colheita, as parcelas foram subdivididas em quatro subparcelas, às quais foram aplicadas quatro doses de esterco bovino em cobertura (0; 2,5; 5,0 e 7,5 kg m-2, obedecendo um arranjo de parcelas subdivididas. A segunda colheita foi realizada 120 dias após a primeira. O material vegetal foi seco em estufa a 37ºC e o óleo essencial foi extraído em aparelho de Clevenger. A biomassa seca da parte aérea (g, o teor percentual (p/p e o rendimento de óleo essencial foram determinados. Os níveis de esterco bovino aplicados tanto no plantio como em cobertura, afetaram de forma linear positiva a produção de biomassa seca da parte aérea e o rendimento de óleo essencial. O teor de óleo essencial não foi afetado pelos diferentes níveis de adubação orgânica.This study aimed to evaluate the effects of organic fertilization at planting and dressing on the aboveground part dry biomass and on the content and yield of essential oil of mint (Mentha arvensis. The experiment consisted of two stages (harvests. A randomized complete block design was used, with three replications. At the first stage, five different cattle manure dosages (0, 2.5, 5.0, 7.5 and 10.0 kg m-2 applied to the plots at planting, were evaluated and the first harvest was carried out 120 days later. At the second stage after the first harvest, the plots were subdivided in four split-plot and four cattle manure dosages
Directory of Open Access Journals (Sweden)
Gholamreza Pouladfar
2017-08-01
Full Text Available Objective: To perform a laboratory investigation to identify and characterize the causative pathogens of a diarrheal outbreak in the south of Iran in July 2015. Methods: Laboratory investigation was done through standard cultures and molecular methods for causative agent and possible source identification. Antibiotic resistant patterns, extended-spectrum β-lactamase (ESBL production ability and plasmid profiling were used to characterize the isolated pathogens. Results: Out of 16 stool samples received in the lab, 14 were positive for enteroaggregative E. coli (EAEC, enteroinvasive E. coli (EIEC and non-O157 enterohaemorrhagic E. coli (EHEC. Of 5 EIEC isolates, 3 were similar in terms of plasmid patterns and ESBL production ability and virulence genes (ipaH+ and virF+. The EAEC isolates were positive for at least one of two virulence genes, agg and aap. Out of 7 EAEC isolates, 2 had the same patterns of plasmid profiles, antibiotic resistance and virulence gene (aap+. Of the 7 EAEC isolates, four had ESBL production ability. The two non-O157 EHEC isolates were positive for stx2 virulent gene and were also susceptible to all tested antibiotics. Conclusions: Laboratory investigation showed that the outbreak was caused by mixed diarrheagenic E. coli pathogroups, possibly due to waste contamination of drinking water.
Elal Mus, Tulay; Cetinkaya, Figen; Cibik, Recep; Soyutemiz, Gul Ece; Simsek, Husniye; Coplu, Nilay
2017-12-01
In this study, the presence of genes responsible for the pathogenicity and antibiotic resistance profile of enterococci isolated from various foodstuffs of animal origin was investigated. The percentage prevalence of enterococci was 54.1% (203/375) and the average count was found to be 3.81 log cfu/ml-g. Species-specific primers revealed Enterococcus faecalis as the predominant species carrying one or more virulence-associated traits of efa, gelE, ace, esp and agg genetic markers. Only one E. faecium isolate (from milk) was positive for the esp gene. Regarding antibiotic resistance, the highest frequency of resistance was observed for tetracycline (21.7%), followed by quinupristin/dalfopristin (13.3%), ciprofloxacin (2.0%), penicillin (2.0%), linezolid (1.0%), ampicillin (1.0%), streptomycin (1.0%), and gentamicin (0.5%). Enterococcus faecalis showed a higher prevalence of antibiotic resistance than other enterococci. The percentage of multidrug resistance among the isolates was 3.4%. Twenty-nine E. faecalis isolates (26.6%) carrying one of the virulence-associated traits were at the same time resistant to at least one antibiotic. Our results show that foods of animal origin, including ready-to-eat products, may be reservoirs of antibiotic-resistant and potentially virulent enterococci.
Degradation forecast for PEMFC cathode-catalysts under cyclic loads
Moein-Jahromi, M.; Kermani, M. J.; Movahed, S.
2017-08-01
Degradation of Fuel Cell (FC) components under cyclic loads is one of the biggest bottlenecks in FC commercialization. In this paper, a novel experimental based algorithm is presented to predict the Catalyst Layer (CL) performance loss during cyclic load. The algorithm consists of two models namely Models 1 and 2. The Model 1 calculates the Electro-Chemical Surface Area (ECSA) and agglomerate size (e.g. agglomerate radius, rt,agg) for the catalyst layer under cyclic load. The Model 2 is the already-existing model from our earlier studies that computes catalyst performance with fixed structural parameters. Combinations of these two Models predict the CL performance under an arbitrary cyclic load. A set of parametric/sensitivity studies is performed to investigate the effects of operating parameters on the percentage of Voltage Degradation Rate (VDR%) with rank 1 for the most influential one. Amongst the considered parameters (such as: temperature, relative humidity, pressure, minimum and maximum voltage of the cyclic load), the results show that temperature and pressure have the most and the least influences on the VDR%, respectively. So that, increase of temperature from 60 °C to 80 °C leads to over 20% VDR intensification, the VDR will also reduce 1.41% by increasing pressure from 2 atm to 4 atm.
International Nuclear Information System (INIS)
Yonezawa, T.
2015-01-01
In order to clarify the effect of SFE on SCC resistance of austenitic stainless steels and to develop the alternative material of Type 316LN stainless steel for BWR application, the effect of chemical composition and heat treatment on SFE value and SCCGR in oxygenated high temperature water were studied. The correlation factors between SFE values for 54 heats of materials and their chemical compositions for nickel, molybdenum, chromium, manganese, nitrogen, silicon and carbon were obtained. From these correlation factors, original formulae for SFE values calculation of austenitic stainless steels in the SHTWC, SHTFC and AGG conditions were established. The maximum crack length, average crack length and cracked area of the IGSCC for 33 heats were evaluated as IGSCC resistance in oxygenated high temperature water. The IGSCC resistance of strain hardened nonsensitized austenitic stainless steels in oxygenated high temperature water increases with increasing of nickel contents and SFE values. From this study, it is suggested that the SFE value is a key parameter for the IGSCC resistance of non-sensitized strain hardened austenitic stainless steels. As an alternative material of Type 316LN stainless steel, increased SFE value material, which is high nickel, high chromium, low silicon and low nitrogen material, is recommendable. (author)
Pathogenic Escherichia coli and food handlers in luxury hotels in Nairobi, Kenya.
Onyango, Abel O; Kenya, Eucharia U; Mbithi, John J N; Ng'ayo, Musa O
2009-11-01
The epidemiology and virulence properties of pathogenic Escherichia coli among food handlers in tourist destination hotels in Kenya are largely uncharacterized. This cross-sectional study among consenting 885 food handlers working in nine luxurious tourist hotels in Nairobi, Kenya determined the epidemiology, virulence properties, antibiotics susceptibility profiles and conjugation abilities of pathogenic Escherichia coli. Pathogenic Escherichia coli was detected among 39 (4.4%) subjects, including 1.8% enteroaggregative Escherichia coli (EAEC) harboring aggR genes, 1.2% enterotoxigenic Escherichia coli (ETEC) expressing both LT and STp toxins, 1.1% enteropathogenic Escherichia coli (EPEC) and 0.2% Shiga-like Escherichia coli (EHEC) both harboring eaeA and stx2 genes respectively. All the pathotypes had increased surface hydrophobicity. Using multivariate analyses, food handlers with loose stools were more likely to be infected with pathogenic Escherichia coli. Majority 53.8% of the pathotypes were resistant to tetracycline with 40.2% being multi-drug resistant. About 85.7% pathotypes trans-conjugated with Escherichia coli K12 F(-) NA(r) LA. The carriage of multi-drug resistant, toxin expressing pathogenic Escherichia coli by this population is of public health concern because exposure to low doses can result in infection. Screening food handlers and implementing public awareness programs is recommended as an intervention to control transmission of enteric pathogens.
FUNCIONALIDADE DOS GRUPOS DE PESQUISA DE ADMINISTRAÇÃO/GESTÃO/ GERÊNCIA DE ENFERMAGEM
Directory of Open Access Journals (Sweden)
Alacoque Lorenzini Erdmann
2010-01-01
Full Text Available El objetivo de ese estudio es entender los modos de organización y funcionamiento de los Grupos de Investigación (GI de Administración/Gestión/Gerencia (AGG de Enfermería, con catastro en el Consejo Nacional de Investigación Científica y Tecnológica – (CNPq. Se utilizó la referencia metodológica de la Teoría Fundamentada en los Datos, realizándose 12 entrevistas con líderes de grupos de investigación, distribuidos en 2 grupos de muestra. El funcionamiento del grupo es visto como el modo estructural de las actividades de los grupos de investigación, las contribuciones teórico-metodológicas más usadas, las vivencias en el ambiente de la investigación, las relaciones intergrupales, las actitudes del líder del G I, las dificultades enfrentadas, así como las estrategias de supervivencia que garantizan la longevidad y productividad del GI. El funcionamiento de los grupos de investigación es el reflejo del calificar, legitimar, aumentar y congregar potencias para la productividad en líneas de investigación y liderazgo de los investigadores en esa área.
Bouchal, Johannes Martin; Güner, Tuncay H.; Denk, Thomas
2015-04-01
The subject of this study is the palynology (biostratigraphic and taxonomic) and the plant remains of the lignite strip mines of Eskihisar, Salihpasalar, and Tinaz (Muğla province, western Turkey). In the Yatağan basin two Miocene to Pliocene formations are present, the Eskihisar Formation (early to middle Miocene) and the Yatağan Formation (late Miocene to early Pliocene). Both formations represent river and lake deposits consisting mainly of conglomerate, sandstone, claystone, limestone, tuffite, and intercalated lignite; the thickest, actively mined lignite seams occur in the Sekköy member of the Eskihisar Formation. Previous palynological studies of the palynoflora of the Yatağan basin mainly focussed on its biostratigraphic and palaeoclimatic significance, using conventional morphological nomenclature and light microscopy (LM). In this study the "single grain method" is applied. Using this method, the same individual pollen grains are investigated by using both LM and scanning electron microscopy (SEM). The resulting high-resolution pictographs enable a much higher taxonomic resolution. The studied palynoflora is very rich and taxonomically diverse. Cryptogams are represented by more than ten spore morphotypes of at least three families (Osmundaceae, Pteridaceae, Polypodiaceae). Gymnosperm pollen is dominated by Cupressaceae, Gnetales (Ephedra), and Pinaceae (Cathaya, Keteleeria, Pinus). Angiosperm pollen can be assigned to 57 different genera belonging to Poaceae, Typhaceae, Altingiaceae, Amaranthaceae (Chenopodieae), Anacardiaceae, Apiaceae (three types), Asteraceae (Asteroideae, Cichoriodeae), Betulaceae (Alnus, Betula, Carpinus, Ostrya) Buxaceae, Campanulaceae, Caprifoliaceae (Lonicera), Caryophyllaceae, Dipsacaceae, Eucommiaceae, Euphorbiaceae, Fabaceae, Fagaceae (Fagus, Quercus, Trigonobalanopsis) Geraniaceae, Juglandaceae, Linaceae, Malvaceae (Tilia), Myricaceae, Oleaceae (four different types), Plumbaginaceae, Polygonaceae (Rumex), Rosaceae
DEFF Research Database (Denmark)
Topping, Christopher John; Odderskær, Peter; Kahlert, Johnny Abildgaard
2013-01-01
of distribution and density, reproductive performance and seasonal changes in territory numbers. Data to support this was collected over a 13-year period and comprised detailed field observations of breeding birds and intensive surveys. The model was able to recreate the real world data patterns accurately......; it was also able to simultaneously fit a number of other secondary system properties which were not formally a part of the testing procedure. The correspondence of model output to real world data and sensitivity analysis are presented and discussed, and the model’s description is provided in ODdox format (a...... formal description inter-linked to the program code). Detailed and stringent tests for model performance were carried out, and standardised model description and open access to the source code were provided to open development of the skylark model to others. Over and above documenting the utility...
Georgiev, Boyko B; Vasileva, Gergana P; Bray, Rodney A; Gibson, David I
2004-01-01
The syntypes of Biuterina passerina Fuhrmann, 1908 from Alauda arvensis and Galerida cristata (Passeriformes, Alaudidae) from an unknown locality are redescribed. B. fuhrmanni Schmelz, 1941 is redescribed on the basis of its syntypes from Emberiza aureola from China; its type-material contains, in addition to a scolex and pre-gravid and gravid fragments of Biuterina, fragments of mature proglottides from a dilepidid cestode, which were erroneously used in the original description. Specimens, which correspond morphologically to B. clerci Spasskii, 1946, from Miliaria calandra, E. citrinella and E. cirlus from Bulgaria and from E. citrinella from the Czech Republic, are studied. The synonymy of B. clerci with B. passerina is rejected; however, it is recognised as a synonym of B. fuhrmanni. Available data suggest that B. passerina is a specific parasite of birds of the family Alaudidae, while B. fuhrmanni is specific to the Emberizidae. B. collurionis Matevosyan, 1950 is considered a species inquirenda, pending confirmation of apparent differences from B. passerina and B. fuhrmanni based on further material. Biuterina cordifera Murai & Sulgostowska, 1983 is redescribed on the basis of specimens, previously identified by Rysavý (1965) as B. triangula (Krabbe, 1869), from Acrocephalus scirpaceus (Muscicapidae, Sylviinae) in the Czech Republic (new geographical record) and from Erithacus megarhynchos (Muscicapidae, Turdinae) in Bulgaria (new host and geographical records).
Linarin Inhibits the Acetylcholinesterase Activity In-vitro and Ex-vivo
Feng, Xinchi; Wang, Xin; Liu, Youping; Di, Xin
2015-01-01
Linarin is a flavone glycoside in the plants Flos chrysanthemi indici, Buddleja officinalis, Cirsium setosum, Mentha arvensis and Buddleja davidii, and has been reported to possess analgesic, antipyretic, anti-inflammatory and neuroprotective activities. In this paper, linarin was investigated for its AChE inhibitory potential both in-vitro and ex-vivo. Ellman’s colorimetric method was used for the determination of AChE inhibitory activity in mouse brain. In-vitro assays revealed that linarin inhibited AChE activity with an IC50 of 3.801 ± 1.149 μM. Ex-vivo study showed that the AChE activity was significantly reduced in both the cortex and hippocampus of mice treated intraperitoneally with various doses of linarin (35, 70 and 140 mg/Kg). The inhibition effects produced by high dose of linarin were the same as that obtained after huperzine A treatment (0.5 mg/Kg). Molecular docking study revealed that both 4’-methoxyl group and 7-O-sugar moiety of linarin played important roles in ligand-receptor binding and thus they are mainly responsible for AChE inhibitory activity. In view of its potent AChE inhibitory activity, linarin may be a promising therapeutic agent for the treatment of some diseases associated with AChE, such as glaucoma, myasthenia gravis, gastric motility and Alzheimer’s disease. PMID:26330885
Influence of fluorides upon vegetation. Preliminary tests in gardon uses
Energy Technology Data Exchange (ETDEWEB)
Gautier, A; Clausmann, P
1919-01-01
Pulverized birchwood charcoal extracted with hot acids and washed in boiling water gave a soil medium containing 1.87 mg F per kg. The soil was composed of purified charcoal, 1000 g; Al/sub 2/O/sub 3/ as a jelly, 120 g; CaCO/sub 3/, 730 g (F = 0.002), humus, 27.3 g; very fertile garden soil, 66.0 (F = 0.007); CaHPO/sub 4/, 24 g; KNO/sub 3/, 34 g; (NH/sub 4/)/sub 2/ SO/sub 4/, 30 g; NaCl, 3.0 g; MgCO/sub 3/, 68 g; MnCl/sub 2/, 0.80 g, ZnCO/sub 3/, 0.07; SiO/sub 2/ as jelly, 17.0; FeSO/sub 4/, 180.0; NaAsO/sub 4/, 1.4 g. This entire mixture contained 11 mg F per kg. Plants were grown in three four-liter pots, A, B, C. The pots contained the above mixture, one with charcoal, another with KF. Pot C contained good garden soil for control. The effects of F were estimated by measuring the height of the plant and when the seed was produced, the weight of the seed. Fluorine exerted a favorable influence upon Gressin alenois, cabbage; Spergula arvensis, Escholtzia California, spinach, yellow day-lilly, viperine, Oignon communis and hemp. An unfavorable influence was observed with dwarf peas and sweet peas.
Studies on the improvement of the components of essential oil of genus Mentha by radiation
International Nuclear Information System (INIS)
Ono, Seiroku
1980-01-01
M. arvensis L. var. piperascens M sub(AL). (2 n = 96, R sup(a)Rsup(a)SS JJ AA, main component menthol) as the material the elucidation of biosynthetic mechanisms of essential oil was attempted. As the result it has been demonstrated that the biosynthesis is completed between 84 - 86 days after placing individual cells in the culture medium, especially on 85 days. Such an elucidation serves as the criteria of the biosynthetic pathway elucidation and it is the first accomplishment in the world. Next, the irradiation with γ-rays of 55R/min, total dose 19.5 KR gives a marked effect, and by this method a new plant (rose mint) having aroma similar to rose oil has been established, and this new plant has been designated as ''rose mint.'' This new improved plant can yield about 1 Kg of essential oil from 30 Kg of plant, and in comparing to 1 Kg of essential oil obtained from about 10 6 rose flowers by the conventional method, the yield is enormously greater and its wide application can be expected in the future. This newly developed breeding method can be also applied to other plants where the extraction of the plant compositions is desired, and at present this method is applied to the Perilla by which a new plant having sweet taste has been successfully established. (author)
Directory of Open Access Journals (Sweden)
Lutfy Ditya Cahyanti
2015-12-01
Full Text Available Uncontrolled weed growth in the early stages of crop establishment, can decrease final crop yield. Phytochemical compounds from bamboo’s (Dendrocalamus sasper leaves known as flavonoids, phenolic and coumarin that inhibit the growth and development of weeds. The objective of this study was to utilizing bamboo’s leaves litter as bioherbicide for sustainable agricultural system. Weedy area used for observation of the effectiveness solution of bamboo’s leaves litter as bioherbicide is 1 m², first area for solution of bamboo’s leaves litter 10%, the second area for solution of bamboo’s leaves litter 5% and third plot only distilled water as a control treatment. Weeds SDR observations was done before spraying and 7 days after spraying bamboo’s leaves litter. The selected plot is a plot with diverse species of weeds. Observations SDR weeds to determine the level of effectiveness of a solution of bamboo’s leaf litter, was conducted used quadrant plots Weed species that dominated on our plot are Mikania micrantha, Eleusine indica, Cyperus rotundus, Cynodon stolon, Cynodon dactylon, Axonopus compressus dan Sanchus arvensis. Solution of bamboo’s leaves litter as bioherbicide are only capable controlled bermuda grass (Cynodon dactylon, both at a dose of 5 % and 10 %. For other species, solution of bamboo’s leaves litter did not work at
Panthaleus major /Duges/ of cereals in Bulgaria
Directory of Open Access Journals (Sweden)
V. Maneva
2016-12-01
Full Text Available Abstract. Until recently, Penthaleus major (Dugès has not been recognized as an economically significant pest for the cereal crops. After climatic changes, its population began to grow and inflict damages around the world. The aim of this study was to investigate its distribution in Bulgaria and establish whether it presents a danger to the cereal crops. In the autumn of 2015 and the spring of 2016, a monitoring survey was conducted to establish Penthaleus major (Dugès with the cereal crops in Bulgaria. Over 60 sowed fields were investigated from all around the country. Samples were taken to identify the pest. It was established that Penthaleus major (Dugès inflicted harm to the wheat in north-eastern (12-14 mites per stem and south-eastern Bulgaria (6-8 mites per stem. Its density was under the threshold of economic harm. There was not found infestation of barley, rye, oat and triticale. On the field boundaries bordering the areas attacked by the mite were reported the following weeds: Capsella bursa pastoris (L. Medic, Descurania sophia (L. Welb. et Berth, Senecio spp., Sisymbrium orientale Torn., Taraxsacum officinale Weber, Anthemis spp., Bromus arvensis L., Eragrostis pilosa (L. P.B. Lolium temulentum L., which can be habitat for Penthaleus major (Dugès.
Directory of Open Access Journals (Sweden)
S. Elahi
2016-04-01
Full Text Available To study weed species diversity and community structure in pistachio (Pistacia vera L. orchards in 33 orchards of 12 villages an investigation was conducted in Bardaskan County, Khorasan Razavi Province, Iran during 2008-2009. Weed population sampling was conducted in a w shape method using 1m² quadrate. The results showed that the weeds of pistachio orchards were belonging to 15 families and 44 species. dicotyledons (31 species were more than monocotyledons (13 species. Such as in this community, weed species of C3, C4, annual and perennial were 26, 18, 28 and 13, respectively. The majority of weed species were belonging to the plant families of chenopodiceae (9 species and poaceae (12 species amongst dicotyledons and monocotyledons, respectively. the most important species of monocotyledon annual weeds were including Echinochloa crus-gali, Digitaria sanguinlis, Setaria viridis and perennial weeds were including Cyperus routundus, Cynodon dactylon and convolvulus arvensis. Weed species were grouped in seven clusters for density average, frequency and uniformity (similarity 75 percent whereas in eight clusters for relative density average, relative frequency and relative uniformity (similarity 75 percent. Amplitude changes of Shannon-winter diversity index were between 2.3 and 0.16 and of Simpson dominant index were between 0.97 and 0.17. The difference among indices of biodiversity and dominant clusters were relative to scale and type of management practices.
Fire and drought experiments in northern wetlands: A climate change analogue
Energy Technology Data Exchange (ETDEWEB)
Hogenbirk, J.C.; Wen, R.W. (Alberta Univ., Edmonton, AB (Canada))
1991-09-01
Drought and fire, which may increase in frequency and severity because of global warming, were simulated in mid-boreal wetlands by transplanting soil block upslope to a lower water table and by prescribed burns. In the 2 years after treatments were applied to seasonally flooded vegetation zones in the Peace-Athabasca Delta, Alberta, the drought treatment did not significantly change stem density and height of the dominant hygrophytes Calamagrostics canadensis and Carex atherodes. Dicotyledonous species' density and richness increased 3- to 36-fold on soil blocks moved upslope to the driest vegetation zone relative to unmoved soil blocks. The percent cover of native dicotyledonous species was unaffected but that of xerophytic Eurasian species, Sonchus arvensis and Cirsium arvense, increased 5- to 13-fold after dought treatment. Fire, particularly the deepest burn, reduced graminoid density and height up to 90%. Dicotyledon density, but not richness, was generally higher after fire. Plant cover was unaffected by fire but Eurasian species' cover was still 3- to 15-fold greater than that of native species. Seasonally flooded vegetation zones will likely be shifted from flood-driven dynamics with cool and moist environmental conditions towards drought- and fire-driven dynamics with warmer and drier conditions. It is hypothesized that, under these climate change conditions, Eurasian species might dominate early successional communities in mid-boreal wetlands. 37 refs., 1 fig., 4 tabs.
Directory of Open Access Journals (Sweden)
Ahmad Soni
2014-05-01
Full Text Available Kidney stones are one of the urologic diseases that have plagued mankind for centuries. The main constituents of stones in the kidney are calcium oxalate monohydrate (COM crystals. Nowadays, there are varieties of drugs and treatments that can be made to minimize the grievances due to kidney stone disease. The treatment can be done either by using chemicals or traditional medicine. Calcusol™ is one of the popular herbal products that have been used by Indonesian people in curing the kidney stone disease. The main constituent that was contained in Calcusol™ is an extract of the tempuyung leaves (Sonchus arvensis L., which is expected could cure the kidney stone disease. This study used primary cultured renal epithelial cells of mice to determine the optimal dose of Calcusol™ and the optimal dose of COM. The primary Kidney epithelial cell were treated with Calcusol™ and COM at various doses. The analysis of the cell death either by necrosis or apoptosis pathways was analyzed by flow cytometric analysis. The results that were obtained is the percentage of cell death that is then analyzed by using a complete randomized design (CRD One Way Anova. Based on the results that were obtained, it is known that the optimal dose of Calcusol™ in vitro were ranging from 75 ppm to 100 ppm, whereas the optimal dose of COM suggested for 500 ppm.
Directory of Open Access Journals (Sweden)
Eduardo Requesens
1999-08-01
Full Text Available No Distrito Azul, zona central da província de Buenos Aires (Argentina, encontram-se ambientes de planície na parte norte e ambientes serranos na parte sul. Esta última, constituí-se numa área predominantemente agrícola, onde a cultura de trigo, principal atividade agrícola, se alterna com culturas de verão como milho, girassol e soja. Com o objetivo de caracterizar globalmente o banco de sementes da área agrícola, foram analisados o conteúdo de sementes, a composição de espécies, a distribuição e variabilidade espacial das espécies que o compõem. A informação básica foi obtida aplicando-se a técnica da emergência em amostras de solo correspondentes a 20 locais alinhados numa faixa de 14 km. A densidade de sementes nos locais de amostragem variou entre 1.173 e 44.000 sem/m2. Na totalidade, foram detectadas 33 espécies. Digitaria sanguinalis foi claramente a espécie dominante, aportando com quase 43 % do banco, seguida de Polygonum aviculare com um aporte de 15 %. As duas espécies, juntamente com Anagallis arvensis e Setaria viridis completam70 % do banco de sementes. A composição específica completa-se com um grupo de 29 espécies, os quais contribuem, cada um delas, com menos de 5%. A distribuição espacial das espécies ao longo da faixa estudada mostrou um grau de agregação variável, sendo encontrada uma correlação positiva significativa entre o tamanho do banco e a relação variância/média. Demonstrou-se, assim, que as espécies mais abundantes em média, apresentaram grande variabilidade espacial. Nelas, foram observados diferentes padrões de distribuição espacial.Azul, in the center of the Province of Buenos Aires (Argentina, includes flat environments in the north and hill environments in the south. Last constitutes a predominantly agricultural area where the wheat crop, principal activity, alternates with summer crops as corn, sunflower and soybean. The objetive of the present paper is to
Directory of Open Access Journals (Sweden)
P.R. Carnelossi
2009-01-01
Full Text Available Os subprodutos de plantas medicinais têm sido estudados como uma alternativa para o controle de doenças de plantas visando amenizar e/ou reduzir o uso abusivo de agrotóxicos, principalmente em condições pós-colheita. Assim, este trabalho teve como objetivo avaliar, in vitro e in vivo, o controle de Colletotrichum gloeosporioides, agente causal da antracnose do mamão em pós-colheita, por óleos essenciais (OEs de Cymbopogon citratus, Eucalyptus citriodora, Mentha arvensis e Artemisia dracunculus. Para inibição do crescimento micelial in vitro, os OEs foram incorporados ao BDA (Batata-dextrose-ágar tendo-se observado a inibição total ou parcial do crescimento micelial e da esporulação deste fitopatógeno, dependendo do óleo essencial utilizado. No ensaio in vivo utilizaram-se os OEs de C. citratus (1% e E. citriodora (1%. A inoculação com o fitopatógeno foi concomitante e 24 h após os tratamentos alternativos, que foram: óleos essenciais de C. citratus e de E. citriodora (1% e biomassa cítrica (150 mL 100 L-1 (Ecolife®. Os parâmetros avaliados foram severidade da doença, redução da massa, diâmetro, comprimento final dos frutos, pH e a concentração de sólidos solúveis totais (ºBrix. Pode-se observar que, no controle da doença, os frutos tratados e imediatamente inoculados com o fitopatógenos apresentaram maior AACPD (Área Abaixo da Curva do Progresso da Doença. Porém, frutos tratados e inoculados 24 h após os tratamentos apresentaram maior controle da doença, confirmando o potencial dos óleos essenciais testados no presente trabalho.The products from medicinal plants have been studied as an alternative in the control of plant diseases in order to mitigate and / or reduce pesticide abuse mainly in postharvest. Thus, the present study aimed to evaluate, in vitro and in vivo, the control of Colletotrichum gloeosporioides, the causative agent of papaya anthracnose, in postharvest using essential oils (EOs of
Directory of Open Access Journals (Sweden)
Marta Simone M Freitas
2006-03-01
Full Text Available Foram avaliados os efeitos de fungos micorrízicos arbusculares (FMA no crescimento e composição mineral de Mentha arvensis L., cultivada com diferentes doses de fósforo. O experimento foi realizado em casa de vegetação e o delineamento estatístico utilizado foi de blocos ao acaso, num fatorial 5x4, sendo cinco tratamentos microbiológicos (controle, Glomus clarum, Glomus etunicatum, Gigaspora margarita e Acaulospora scrobiculata e quatro doses de P (0; 50; 100 e 200 mg kg-1, com quatro repetições. As plantas foram colhidas na fase de floração, aos 65 dias após o plantio. Verificou-se que, na ausência de P, os fungos Glomus clarum e Gigaspora margarita apresentaram maiores percentagens de colonização micorrízica nas raízes e proporcionaram aumentos de 330 e 334% na matéria seca foliar, de 143 e 123% no conteúdo de N, de 224 e 124% no conteúdo de P e de 139 e 142% no conteúdo de K, respectivamente. Os FMA não influenciaram os conteúdos de Ca, Mg, S, Fe e Zn na matéria seca foliar. As doses de P entre 122 e 165 mg kg-1 de solo proporcionaram as maiores produções de matéria seca. Nessas doses, o conteúdo de Mn foi menor quando as plantas foram inoculadas com Glomus clarum, Gigaspora margarita e Glomus etunicatum. A dependência micorrízica da menta variou de acordo com a espécie de fungo e a dose de P utilizada, sendo maior com os fungos Glomus clarum e Gigaspora margarita, na ausência de P.The effects of arbuscular mycorrhizal fungi (AMF were evaluated on the growth and mineral composition of Mentha arvensis L., grown under different phosphorus levels. The experiment was carried out in a greenhouse, in a factorial scheme 5x4, with five microbiological treatments (control without AMF, Glomus clarum, Glomus etunicatum, Gigaspora margarita and Acaulospora scrobiculata and four P levels (0; 50; 100 and 200 mg kg-1. A randomized block design was used, with four replications. The plants were harvested at flowering, 65 days
Guion, Chase E; Ochoa, Theresa J; Walker, Christopher M; Barletta, Francesca; Cleary, Thomas G
2008-05-01
Diarrheagenic Escherichia coli strains are important causes of diarrhea in children from the developing world and are now being recognized as emerging enteropathogens in the developed world. Current methods of detection are too expensive and labor-intensive for routine detection of these organisms to be practical. We developed a real-time fluorescence-based multiplex PCR for the detection of all six of the currently recognized classes of diarrheagenic E. coli. The primers were designed to specifically amplify eight different virulence genes in the same reaction: aggR for enteroaggregative E. coli, stIa/stIb and lt for enterotoxigenic E. coli, eaeA for enteropathogenic E. coli and Shiga toxin-producing E. coli (STEC), stx(1) and stx(2) for STEC, ipaH for enteroinvasive E. coli, and daaD for diffusely adherent E. coli (DAEC). Eighty-nine of ninety diarrheagenic E. coli and 36/36 nonpathogenic E. coli strains were correctly identified using this approach (specificity, 1.00; sensitivity, 0.99). The single false negative was a DAEC strain. The total time between preparation of DNA from E. coli colonies on agar plates and completion of PCR and melting-curve analysis was less than 90 min. The cost of materials was low. Melting-point analysis of real-time multiplex PCR is a rapid, sensitive, specific, and inexpensive method for detection of diarrheagenic E. coli.
Optical Property Characterization of Novel Graphene-X (X=Ag, Au and Cu Nanoparticle Hybrids
Directory of Open Access Journals (Sweden)
Sumit Ranjan Sahu
2013-01-01
Full Text Available The present investigation reports new results on optical properties of graphene-metal nanocomposites. These composites were prepared by a solution-based chemical approach. Graphene has been prepared by thermal reduction of graphene oxide (GO at 90°C by hydrazine hydrate in an ammoniacal medium. This ammoniacal solution acts as a solvent as well as a basic medium where agglomeration of graphene can be prevented. This graphene solution has further been used for functionalization with Ag, Au, and Cu nanoparticles (NPs. The samples were characterized by X-ray diffraction (XRD, Raman spectroscopy, UV-Vis spectroscopy, scanning electron microscopy (SEM, and transmission electron microscopy (TEM to reveal the nature and type of interaction of metal nanoparticles with graphene. The results indicate distinct shift of graphene bands both in Raman and UV-Vis spectroscopies due to the presence of the metal nanoparticles. Raman spectroscopic analysis indicates blue shift of D and G bands in Raman spectra of graphene due to the presence of metal nanoparticles except for the G band of Cu-G, which undergoes red shift, reflecting the charge transfer interaction between graphene sheets and metal nanoparticles. UV-Vis spectroscopic analysis also indicates blue shift of graphene absorption peak in the hybrids. The plasmon peak position undergoes blue shift in Ag-G, whereas red shift is observed in Au-G and Cu-G.
Nucleotide sequence of a human tRNA gene heterocluster
International Nuclear Information System (INIS)
Chang, Y.N.; Pirtle, I.L.; Pirtle, R.M.
1986-01-01
Leucine tRNA from bovine liver was used as a hybridization probe to screen a human gene library harbored in Charon-4A of bacteriophage lambda. The human DNA inserts from plaque-pure clones were characterized by restriction endonuclease mapping and Southern hybridization techniques, using both [3'- 32 P]-labeled bovine liver leucine tRNA and total tRNA as hybridization probes. An 8-kb Hind III fragment of one of these γ-clones was subcloned into the Hind III site of pBR322. Subsequent fine restriction mapping and DNA sequence analysis of this plasmid DNA indicated the presence of four tRNA genes within the 8-kb DNA fragment. A leucine tRNA gene with an anticodon of AAG and a proline tRNA gene with an anticodon of AGG are in a 1.6-kb subfragment. A threonine tRNA gene with an anticodon of UGU and an as yet unidentified tRNA gene are located in a 1.1-kb subfragment. These two different subfragments are separated by 2.8 kb. The coding regions of the three sequenced genes contain characteristic internal split promoter sequences and do not have intervening sequences. The 3'-flanking region of these three genes have typical RNA polymerase III termination sites of at least four consecutive T residues
Directory of Open Access Journals (Sweden)
Junjun Shi
2012-01-01
Full Text Available The clinical application of viral vectors for gene therapy is limited for biosafety consideration. In this study, to promote articular cartilage repair, poly (lactic-co glycolic acid (PLGA nanopolymers were used as non-viral vectors to transfect rabbit mesenchymal stem cells (MSCs with the pDC316-BMP4-EGFP plasmid. The cytotoxicity and transfection efficiency in vitro were acceptable measuring by CCK-8 and flow cytometry. After transfection, Chondrogenic markers (mRNA of Col2a1, Sox9, Bmp4, and Agg of experimental cells (MSCs being transfected with BMP-4 plasmid by PLGA nanopolymers were increased more than those of control cells (MSCs being transfected with naked BMP-4 plasmid alone. In vivo study, twelve rabbits (24 knees with large full thickness articular cartilage defects were randomly divided into the experimental group (MSCs being transfected with BMP-4 plasmid by PLGA nanopolymers and the control group (MSCs being transfected with naked BMP-4 plasmid. The experimental group showed better regeneration than the control group 6 and 12 weeks postoperatively. Hyaline-like cartilage formed at week 12 in the experimental group, indicating the local delivery of BMP-4 plasmid to MSCs by PLGA nanopolymers improved articular cartilage repair significantly. PLGA nanopolymers could be a promising and effective non-viral vector for gene therapy in cartilage repair.
Wang, Lili; Zhang, Shaobo; Zheng, Dongming; Fujihara, Sami; Wakabayashi, Akiyo; Okahata, Kazuyuki; Suzuki, Masakazu; Saeki, Atsunori; Nakamura, Hiromi; Hara-Kudo, Yukiko; Kage-Nakadai, Eriko; Nishikawa, Yoshikazu
2017-07-24
The source and routes of diarrheagenic Escherichia coli (DEC) remain poorly understood. To investigate the involvement of domestic animals in the dissemination of DEC, the prevalence of DEC in foods and fecal specimens from cattle, pigs, chickens, healthy carriers, and patients in Osaka and Hyogo, Japan was investigated using a multiplex real-time Polymerase Chain Reaction assay. The most abundant virulence genes were astA and eae, which had a prevalence 46.8% and 27.4%, respectively. Additionally, stx1 (26.6%) and stx2 (45.9%) were prevalent in cattle feces, while est (8.5%) and elt (7.6%) were prevalent in pig feces. afaB was the second-most prevalent gene in patients and healthy carriers, and it had detection rates of 5.1% and 8.1%, respectively. In contrast, afaB was not detected in animal feces or foods, except for three porcine fecal samples. The aggR gene was more prevalent in humans than in foods or animal feces. Both Shiga toxin-producing E. coli and atypical enteropathogenic E. coli carried by cattle may be sources for diarrheal diseases in humans. Pigs may be a source for human enterotoxigenic E. coli infections, whereas humans are expected to be the reservoir for diffusely adhering E. coli, enteroaggregative E. coli, and enteroinvasive E. coli.
Xing, Yun-Peng; Liu, Chun; Zhou, Xiao-Hong; Shi, Han-Chang
2015-01-01
This work was the first to report that the kanamycin-binding DNA aptamer (5'-TGG GGG TTG AGG CTA AGC CGA-3') can form stable parallel G-quadruplex DNA (G4-DNA) structures by themselves and that this phenomenon can be verified by nondenaturing polyacrylamide gel electrophoresis and circular dichroism spectroscopy. Based on these findings, we developed a novel label-free strategy for kanamycin detection based on the G4-DNA aptamer-based fluorescent intercalator displacement assay with thiazole orange (TO) as the fluorescence probe. In the proposed strategy, TO became strongly fluorescent upon binding to kanamycin-binding G4-DNA. However, the addition of kanamycin caused the displacement of TO from the G4-DNA-TO conjugate, thereby resulting in decreased fluorescent signal, which was inversely related to the kanamycin concentration. The detection limit of the proposed assay decreased to 59 nM with a linear working range of 0.1 μM to 20 μM for kanamycin. The cross-reactivity against six other antibiotics was negligible compared with the response to kanamycin. A satisfactory recovery of kanamycin in milk samples ranged from 80.1% to 98.0%, confirming the potential of this bioassay in the measurement of kanamycin in various applications. Our results also served as a good reference for developing similar fluorescent G4-DNA-based bioassays in the future.
Directory of Open Access Journals (Sweden)
Sucik Maylinda
2015-04-01
Full Text Available Research with aim to estimate genetic polymorphism at ACACA (Acetyl-coenzyme A carboxylase locus in Ettawa Crossbred goat wan its relationship with production traits was done at goat population in Batu, Lawang and Ampel Gading. 46 female goats were taken it’s blood sample to isolate the DNA and continue with PCR (Polymerase Chain Reaction and RFLP (Restricted Fragment Length Polymorphism. PCR was used to amplify ACACA gene fragment in intron 3’ about 200 bp with primer F : 5’ – AGT GTA GAA GGG ACA GCC CAG C – 3’ and R : 5’ – GTG GAA TGA CAC ATG GAG AGG G – 3’; RFLP was used to test mutation of that fragment in particular place (point using restriction enzyme RSA1. Variables were alelles and genotypes composition in population, milk and fat content, and birth weight of kid. Result showed that (a genetic polymorphism at locus ACACA in three location was high that is 44,22 %, with allele frequency of G (p = 33 % and allele T (q = 67 %; (b no relationship between the high polymorphism with productive performance of goat in fat and protein content, and birth weight of kid. It was concluded that in goat population there was a high polymorphism at ACACA gene, and that polymorphism was not related to production.
Monteiro, E R; Strioto, D K; Meirelles, A C S; Mangolin, C A; Machado, M F P S
2015-12-15
Amplified fragment length polymorphism (AFLP) analysis was used to evaluate DNA polymorphism in Pilosocereus gounellei with the aim of differentiating samples grown in different Brazilian semiarid regions. Seven primer pairs were used to amplify 703 AFLP markers, of which 700 (99.21%) markers were polymorphic. The percentage of polymorphic markers ranged from 95.3% for the primer combination E-AAG/M-CTT to 100% for E-ACC/M-CAT, E-ACC/M-CAA, E-AGC/M-CAG, E-ACT/M-CTA, and E-AGG/M-CTG. The largest number of informative markers (126) was detected using the primer combination E-AAC/M-CTA. Polymorphism of the amplified DNA fragments ranged from 72.55% (in sample from Piauí State) to 82.79% (in samples from Rio Grande Norte State), with an average of 75.39%. Despite the high genetic diversity of AFLP markers in xiquexique, analysis using the STRUCTURE software identified relatively homogeneous clusters of xiquexique from the same location, indicating a differentiation at the molecular level, among the plant samples from different regions of the Caatinga biome. The AFLP methodology identified genetically homogeneous and contrasting plants, as well as plants from different regions with common DNA markers. Seeds from such plants can be used for further propagation of plants for establishment of biodiversity conservation units and restoration of degraded areas of the Caatinga biome.
Yang, Bin; Zhang, Junlong; Liu, Xinle; Huang, Zhuochun; Su, Zhenzhen; Liao, Yun; Wang, Lanlan
2018-01-23
IgA nephropathy (IgAN) is the most common chronic glomerular disease worldwide. Genetic factors are thought to be crucial in the pathogenesis of IgAN. However, few data are available on the relationship between human leucocyte antigen (HLA) and signal transducer and activator of transcription 4 (STAT4) polymorphisms and IgAN susceptibility in the Chinese population. Therefore, we examined HLA-DP/DQ and STAT4 polymorphisms (rs3077, rs9277535, rs7453920 and rs7574865) in a total of 630 subjects including 140 IgAN and 490 healthy controls in Chinese. There were significant associations between IgAN patients and healthy controls in the allele frequency of rs3077, rs9277535 and rs7574865. In addition, the genotypes of rs3077, rs9277535 and rs7574865 were also significantly associated with IgAN under recessive models. Moreover, the haplotypes block AAG, AGG, GAG and GGA in the HLA gene significantly correlated with the risk of IgAN. This is the first study demonstrating the significant associations of SNP rs3077, rs9277535 and rs7574865 and the haplotypes in the HLA gene with the risk of IgAN in a Southwest Chinese population. This research provides a new insight into the significant relationship between HLA-DP and STAT4 polymorphisms and the susceptibility to IgAN.
Yalcinkaya, E E; Puglia, D; Fortunati, E; Bertoglio, F; Bruni, G; Visai, L; Kenny, J M
2017-02-10
In the present paper, we reported how cellulose nanocrystals (CNC) from microcrystalline cellulose have the capacity to assist in the synthesis of metallic nanoparticles chains. A cationic surfactant, cetyltrimethylammonium bromide (CTAB), was used as modifier for CNC surface. Silver nanoparticles were synthesized on CNC, and nanoparticle density and size were optimized by varying concentrations of nitrate and reducing agents, and the reduction time. The experimental conditions were optimized for the synthesis and the resulting Ag grafted CNC (Ag-g-CNC) were characterized by means of TGA, SEM, FTIR and XRD, and then introduced in PLA matrix. PLA nanocomposite containing silver grafted cellulose nanocrystals (PLA/0.5Ag-g-1CNC) was characterized by optical and thermal analyses and the obtained data were compared with results from PLA nanocomposites containing 1% wt. of CNC (PLA/1CNC), 0.5% wt. of silver nanoparticles (PLA/0.5Ag) and hybrid system containing CNC and silver in the same amount (PLA/1CNC/0.5Ag). The results demonstrated that grafting of silver nanoparticles on CNC positively affected the thermal degradation process and cold crystallization processes of PLA matrix. Finally, the antibacterial activity of the different systems was studied at various incubation times and temperatures, showing the best performance for PLA/1CNC/0.5Ag based nanocomposite. Copyright © 2016 Elsevier Ltd. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Sharma, Rashmi; Tiwari, Ajay [Department of Zoology, Govt. College, Ajmer (India)
2012-07-01
A major feature of all higher eukaryotes is the defined life span of the organism. Radioprotections are substances that protect the cells against Radiation induced damage. Over the past decade interest in evaluating oriental medicinal herbs and edible phytoproducts for use in Cancer preventing strategies is encouraging and emerging as an acceptable approach for controlling the Cancer incidence in many developing countries as well as developed countries. Several experimental evidence has indicated that intake of fruit and vegetables and a number of other dietary items are associated with decreased Cancer incidence. These potential agents either abolish or delay the development of Cancer by interfering with one or more steps in the process of carcinogenesis, such as preventing the activation of carcinogen by increasing detoxification or by blocking the interaction of ultimate carcinogen with cellular macromolecules or suppressing the clonal expansion of neoplastic cells. The potential of using medicinal herbs as Cancer chemo preventive neutraceuticals and functional food is promising. Radioprotective potential of extracts of certain dietary botanicals including Mentha arvensi (field mint), Syzyzium cumini (Jamun), Zingiber officinale (Ginger), Aegle marmelos (Bael), Emblica officianalis (Amla), Aloe vera (Gwar patha), Moringa oleifera (Moringa, Horse Radish Tree), Grewia asiatica (Phalsa), Rosemarinus officinalis (Rosemary), Trigonella foenum-graecum, Ocirnurn sanctum, Phylanthus niruri, Vetiveria zizanioides (vetivergrass), Delbergia sisso oil (Sesame oil) was evaluated. All botanicals tested had shown a very low toxicity. Administration of these botanicals increased the survival of whole body irradiated mice and reduced the symptoms of radiation sickness. (author)
Mercury in mushrooms and soil from the Wieluńska Upland in south-central Poland.
Falandysz, Jerzy; Bielawski, Leszek; Kawano, Masabide; Brzostowski, Andrzej; Chudzyński, Krzysztof
2002-09-01
Concentrations of mercury were determined in the fruiting bodies of 15 species of higher mushrooms and underlying soil substrate collected from Wieluńska Upland in northern part of Sandomierska Valley in south-central Poland in 1995. A total of 197 samples of caps, 197 stalks, 30 whole fruiting bodies and 227 soil (0-10 cm layer) were analyzed. Mean mercury concentrations in soil substrate corresponding to 15 mushroom species were between 28 +/- 17 and 85 +/- 62 ng/g dry matter (total range between 3.0-190 ng/g). The average cap to stalk concentration quotients of Hg were around 2 (range between 1.1 +/- 1.1 and 2.8 +/- 1.4). However, this quotient in Larch bolete (Suillus grevillei) was 4.4 +/- 6.3. Concentrations of Hg varied depending on the mushroom species. Parasol Mushroom (Macrolepiota procera) and Horse mushroom (Agaricus arvensis) contained the greatest mean mercury concentrations both in caps (between 4500 +/- 1700 and 4400 +/- 2400 ng/g dry matter) and stalks (between 2800 +/- 1300 and 3000 +/- 2000 ng/g dry matter). Both the Parasol Mushroom and Horse mushroom were characterised also by a greater potential to bioconcentrate mercury from soils as evidenced by great bioconcentration factors (BCFs), which were between 170 +/- 160 and 130 +/- 120 for caps, and 110 +/- 97 and 89 +/- 92 for stalks. Mercury concentrations in caps and stalks of False death cap (Amanita citrina) increased (p Suillus luteus).
Directory of Open Access Journals (Sweden)
Afsaneh Moradian
2016-06-01
Full Text Available The soil nitrogen content with impact on weed seed dormancy breaking can change their seedling emergence pattern. A trial was carried out in 2014 to predict seedling emergence of Xanthium strumarium, Chenopodium album, Echinocloa cruss-galli, Amaranthus retroflexus andConvolvulus arvensis, and to evaluate the impact of soil nitrogen content (Control with 0.07% nitrogen, adding 50 and 100 kg N.ha-1 on seedling emergence pattern in Moldavian balm. The experimental design was randomized complete block design. Weed seedlings were counted and removed on a weekly basis throughout the season. The data were converted to percent of cumulative emergence and percentage of cumulative emergence values was compared with thermal time using Gompertz modified functions. The all species showed different emergence patterns and thermal time required for the onset of emergence. The results also showed that the emergence patterns of Chenopodium and Convolvulus not affected by nitrogen treatments. However, soil nitrogen content significantly changed emergence patterns of A. retroflexus, E. cruss-galli and X. strumarium. According to our model, A. retroflexus, E. cruss-galli and X. strumarium emergence, respectively, started at 237, 96 and 63 TT with 50 kg additional nitrogen.ha-1, while the respective value in control were 340, 117 and 135, respectively. Due to influence of soil nitrogen on emergence pattern of A. retroflexus, E. cruss-galli and X. strumarium, soil nitrogen content should be considered as an important parameter in the modeling of these weed seedling emergence.
Zehtindjiev, Pavel; Križanauskienė, Asta; Bensch, Staffan; Palinauskas, Vaidas; Asghar, Muhammad; Dimitrov, Dimitar; Scebba, Sergio; Valkiūnas, Gediminas
2012-06-01
Plasmodium polymorphum n. sp. (Haemosporida, Plasmodiidae) was found in the skylark, Alauda arvensis (Passeriformes: Alaudidae), during autumnal migration in southern Italy. This organism is illustrated and described based on the morphology of its blood stages. The most distinctive feature of this malaria parasite is the clear preference of its blood stages (trophozoites, meronts, and gametocytes) for immature red blood cells, including erythroblasts. Based on preference of erythrocytic meronts for immature red blood cells, P. polymorphum is most similar to species of the subgenus Huffia . This parasite can be readily distinguished from all other bird malaria parasites, including Plasmodium ( Huffia ) spp., due to preferential development and maturation of its gametocytes in immature red blood cells, a unique character for avian Plasmodium spp. In addition, the margins of nuclei in blood stages of P. polymorphum are markedly smooth and distinct; this is also a distinct diagnostic feature of this parasite. Plasmodium polymorphum has been recorded only in the skylark; it is probably a rare parasite, whose host range and geographical distribution remain unclear. Microscopic examination detected a light infection of Plasmodium relictum (lineage GRW11, parasitemia of 50-fold higher than that of P. relictum and several different primers were tested, we suggest that the failure to amplify P. polymorphum is a more complex problem than why co-infections are commonly overlooked in PCR-based studies. We suggest possible explanations of these results and call for additional research on evolution of mitochondrial genome of hemosporidian parasites.
Studies on the Effect of Type and Solarization Period on Germination Percentage of Four Weed Species
Directory of Open Access Journals (Sweden)
J. Rostam
2011-01-01
Full Text Available Abstract In order to study the effects of soil solarization on weed control, an experiment with factorial arrangement in a randomized complete block design with four replications was conducted in a fallow farm in Daregaz in 2008. Factors included solarization duration (0, 2, 4 and 6 weeks and soil moisture content (dry and moist. Soil seed bank was sampled (in two depth, 0-10 and 10-20 cm prior to the experiment and immediately after applying treatments, and germination percentage of weed species were determined. Results of this study showed that seed germination percentage in 10 cm soil depth was influenced by soil moisture and solarization and their interactions, while in 20 cm soil depth only solarization period affected the weed seed germination. Germination percentage in moist soil was less than that in dry soil. Seed germination percentage declined more by increasing solarization duration, so that the greatest decline was obtained after 6 weeks solarization. Solarization decreased germination percentage in moist soil more than that in dry soil. Overall, the results of this experiment indicated that solarization of moist soil for 6 weeks was the most effective treatment in controlling common lambsquatres (Chenopodium album, common purslane (Portulaca oleracea, redroot pigweed (Amaranthus retroflexus, and wild mustard (Sinapis arvensis, while solarization of dry soil for 2 weeks was the least effective treatment for weed control. Keywords: Solarization, Soil moisture, Seed bank
Weeds in spring cereal fields in Finland - a third survey
Directory of Open Access Journals (Sweden)
J. SALONEN
2008-12-01
Full Text Available A survey of weeds in spring cereal fields was conducted in 16 regions of southern and central Finland in 1997-1999. Data were collected from conventional and organic farms, both of which applied their normal cropping practices. A total of 690 fields were investigated by counting and weighing the weed species from ten sample quadrats 0.1 m2 in size in late July - early August. Altogether 160 weed species were found, of which 134 were broad-leaved and 26 grass species. The total number of weed species ranged from 41 to 84 between regions. In organically farmed fields, the average species number was 24 and in conventionally farmed fields 16. The most frequent weed species were Viola arvensis 84%, Stellaria media 76% and Galeopsis spp. 70%. Only 18 species exceeded the frequency level of 33%. The average density of weeds was 136 m-2 (median= 91 in sprayed conventional fields, 420 m-2 (374 in unsprayed conventional fields and 469 m-2 (395 in organic fields. The average air-dry above-ground biomass of weeds was 163 kg ha-1 (median=63, 605 kg ha-1 (413 and 678 kg ha-1 (567, respectively. Weed biomass accounted for 3% of the total biomass of the crop stand in sprayed conventional fields and for 17% in organic fields. Elymus repens, the most frequent grass species, produced the highest proportion of weed biomass.
Species-Specific Effects of Ant Inhabitants on Bromeliad Nutrition.
Directory of Open Access Journals (Sweden)
Ana Z Gonçalves
Full Text Available Predator activities may lead to the accumulation of nutrients in specific areas of terrestrial habitats where they dispose of prey carcasses. In their feeding sites, predators may increase nutrient availability in the soil and favor plant nutrition and growth. However, the translocation of nutrients from one habitat to another may depend on predator identity and diet, as well as on the amount of prey intake. Here we used isotopic (15N and physiological methods in greenhouse experiments to evaluate the effects of the identity of predatory ants (i.e., the consumption of prey and nest sites on the nutrition and growth of the bromeliad Quesnelia arvensis. We showed that predatory ants with protein-based nutrition (i.e., Odontomachus hastatus, Gnamptogenys moelleri improved the performance of their host bromeliads (i.e., increased foliar N, production of soluble proteins and growth. On the other hand, the contribution of Camponotus crassus for the nutritional status of bromeliads did not differ from bromeliads without ants, possibly because this ant does not have arthropod prey as a preferred food source. Our results show, for the first time, that predatory ants can translocate nutrients from one habitat to another within forests, accumulating nutrients in their feeding sites that become available to bromeliads. Additionally, we highlight that ant contribution to plant nutrition may depend on predator identity and its dietary requirements. Nest debris may be especially important for epiphytic and terrestrial bromeliads in nutrient-poor environments.
International Nuclear Information System (INIS)
Sharma, Rashmi; Tiwari, Ajay
2012-01-01
A major feature of all higher eukaryotes is the defined life span of the organism. Radioprotections are substances that protect the cells against Radiation induced damage. Over the past decade interest in evaluating oriental medicinal herbs and edible phytoproducts for use in Cancer preventing strategies is encouraging and emerging as an acceptable approach for controlling the Cancer incidence in many developing countries as well as developed countries. Several experimental evidence has indicated that intake of fruit and vegetables and a number of other dietary items are associated with decreased Cancer incidence. These potential agents either abolish or delay the development of Cancer by interfering with one or more steps in the process of carcinogenesis, such as preventing the activation of carcinogen by increasing detoxification or by blocking the interaction of ultimate carcinogen with cellular macromolecules or suppressing the clonal expansion of neoplastic cells. The potential of using medicinal herbs as Cancer chemo preventive neutraceuticals and functional food is promising. Radioprotective potential of extracts of certain dietary botanicals including Mentha arvensi (field mint), Syzyzium cumini (Jamun), Zingiber officinale (Ginger), Aegle marmelos (Bael), Emblica officianalis (Amla), Aloe vera (Gwar patha), Moringa oleifera (Moringa, Horse Radish Tree), Grewia asiatica (Phalsa), Rosemarinus officinalis (Rosemary), Trigonella foenum-graecum, Ocirnurn sanctum, Phylanthus niruri, Vetiveria zizanioides (vetivergrass), Delbergia sisso oil (Sesame oil) was evaluated. All botanicals tested had shown a very low toxicity. Administration of these botanicals increased the survival of whole body irradiated mice and reduced the symptoms of radiation sickness. (author)
Directory of Open Access Journals (Sweden)
Moulay Abdeljalil Ait Baamrane
Full Text Available Food habits of the Moroccan dorcas gazelle, Gazella dorcas massaesyla, previously investigated in the 1980s using microhistological fecal analysis, in the M'Sabih Talaa Reserve, west central Morocco, were re-evaluated over three seasons (spring, summer and autumn 2009 using the trnL approach to determine the diet composition and its seasonal variation from fecal samples. Taxonomic identification was carried out using the identification originating from the database built from EMBL and the list of plant species within the reserve. The total taxonomic richness in the reserve was 130 instead of 171 species in the 1980s. The diet composition revealed to be much more diversified (71 plant taxa belonging to 57 genus and 29 families than it was 22 years ago (29 identified taxa. Thirty-four taxa were newly identified in the diet while 13 reported in 1986-87 were not found. Moroccan dorcas gazelle showed a high preference to Acacia gummifera, Anagallis arvensis, Glebionis coronaria, Cladanthus arabicus, Diplotaxis tenuisiliqua, Erodium salzmannii, Limonium thouini, Lotus arenarius and Zizyphus lotus. Seasonal variations occurred in both number (40-41 taxa in spring-summer and 49 taxa in autumn vs. respectively 23-22 and 26 in 1986-1987 and taxonomic type of eaten plant taxa. This dietary diversification could be attributed either to the difference in methods of analysis, trnL approach having a higher taxonomic resolution, or a potential change in nutritional quality of plants over time.
Directory of Open Access Journals (Sweden)
Mohsen Hanana
2017-05-01
Full Text Available The chemical composition of the essential oils (EOs of four Lamiaceae (Thymus capitatus Hoff. et Link. , Rosmarinus officinalis L., Origanum vulgare L. and Mentha pulegium L. growing wild in Tunisia was analyzed by gas chromatography (GC and gas chromatography-mass spectrometry (GC-MS. Obtained results showed significant variations among the different species. The major constituents identified for each species were respectively carvacrol (69% and δ-terpinene (17% for T. capitatus, 1,8-cineole (41% and α-pinene (24% for R. officinalis, menthol (39% and 1.8-cineole (17% for M. pulegium , thymol (30%, p-cymene (30% and δ-terpinene (27% for O. vulgare . EO herbicidal effects were evaluated against three invasive weed species in most cultivated crops: Sinapis arvensis L., Phalaris paradoxa L. and Lolium rigidum Gaud. The study of herbicidal activity was carried out on seed germination and seedling vigor and growth. All tested EOs significantly inhibited the germination and growth of weeds in a dose dependent manner and their herbicidal activity could be attributed mainly to their high content in oxygenated monoterpenes. The antifungal ability of EOs was assessed by using disc agar diffusion against ten plant pathogenic fungi affecting crops and stored foods. The EOs displayed strong inhibitory effect on all tested fungi. Our results on EOs chemical composition and biological activities showed properties that could be valorized in managing biocontrol of weeds and plant fungi.
Radioactivity in wild-growing mushrooms of the Calabria region, south of Italy
Caridi, F.; Belmusto, G.
2017-01-01
Wild-growing mushrooms are a complementary foodstuff, widely consumed as a delicacy, in Italy. They are considered excellent bioindicators of environmental pollution and the accumulation of radionuclides can pose a radiological hazard. 137Cs and 40K activity concentrations were measured through HPGe gamma-spectrometry in different mushroom species (Agaricus arvensis, Leccinum quercinum, Boletus aereus, Lactarius deliciosus, Boletus edulis, Macrolepiota konradii, Cantharellus lutescens) collected from four different sampling sites in the Calabria region, south of Italy. Experimental values were found to be in the range from (0.3 ± 0.1) Bq/kg f.m. (fresh mass) to (73.1 ± 4.6) Bq/kg f.m. for 137Cs and from (46.9 ± 10.7) Bq/kg f.m. to (161.3 ± 12.9) Bq/kg f.m. for 40K, respectively. All values were much lower than the specific activity limit set by the international legislation at 600 Bq/kg f.m. for 137Cs and at 1,258 Bq/kg f.m. for 40K, respectively. Experimental activity concentrations allowed us to determine the effective dose due to the ingestion of mushrooms by adult members of the population. It was found in the range from 0.25 to 1.35 μSv/y, much lower than the recommended level for the public (1 mSv/y). Data obtained in this article provide useful information on the environmental risk and can be further used for a radiological mapping of the studied area.
Competition increases sensitivity of wheat (Triticum aestivum) to biotic plant-soil feedback.
Hol, W H Gera; de Boer, Wietse; ten Hooven, Freddy; van der Putten, Wim H
2013-01-01
Plant-soil feedback (PSF) and plant competition play an important role in structuring vegetation composition, but their interaction remains unclear. Recent studies suggest that competing plants could dilute pathogenic effects, whereas the standing view is that competition may increase the sensitivity of the focal plant to PSF. In agro-ecosystems each of these two options would yield contrasting outcomes: reduced versus enhanced effects of weeds on crop biomass production. To test the effect of competition on sensitivity to PSF, we grew Triticum aestivum (Common wheat) with and without competition from a weed community composed of Vicia villosa, Chenopodium album and Myosotis arvensis. Plants were grown in sterilized soil, with or without living field inoculum from 4 farms in the UK. In the conditioning phase, field inocula had both positive and negative effects on T. aestivum shoot biomass, depending on farm. In the feedback phase the differences between shoot biomass in T. aestivum monoculture on non-inoculated and inoculated soils had mostly disappeared. However, T. aestivum plants growing in mixtures in the feedback phase were larger on non-inoculated soil than on inoculated soil. Hence, T. aestivum was more sensitive to competition when the field soil biota was present. This was supported by the statistically significant negative correlation between shoot biomass of weeds and T. aestivum, which was absent on sterilized soil. In conclusion, competition in cereal crop-weed systems appears to increase cereal crop sensitivity to soil biota.
The phytocoenoses of anthropogenically transformed areas with a great importance for Apoidea
Directory of Open Access Journals (Sweden)
Małgorzata Wrzesień
2012-12-01
Full Text Available The paper indicates the phytocenoses most rich in bee taxons and occurring in habitats located along railway lines crossing Lublin Upland. To date, in the study area 124 basic phytocoenoses have been discovered, described and classifi ed into 12 different synecological groups. Among 52 phytocoenoses, the participation of bee flora was considerable. Most voluble phytocoenoses represent ruderal and segetal associations (Artemisietea vulgaris, Stellarietea mediae classes - 87 species, meadow and pasture associations (Mollinio-Arrhenatheretea - 56 species, psammophilous and xerothermic grasslands (Festuco- Brometea, Koelerio glauce-Corynophoretea canescensis - 38 species, thermophilous forest edge communities and thickets (Trifolio-Geranietea and Rhamno-Prunetea - 33 species. Significantly fewer melliferous and polleniferous taxons were noticed in mesophilous deciduous forests or thermophilous oak forests - 29 species. Most simple in structure and species richness are associations with Rumex acetosa, Reseda lutea, Linaria vulgaris, Papaver rhoeas, Cirsium arvense, Oenothera biennis, Viola arvensis and Potentilletum anserine or Sisymbrietum altissimi. The communities form patches (15-20 m2 with 80-100% cover of the diagnostic taxon and are of low or medium stability. The most persistent and floristically stable are Tanaceto Artemisietum, Rudbeckio- Solidaginetum, Echio-Melilotetum, Sambucetum nigrae, Rubo fruticosi-Prunetum spinosae and communities with Rosa rugosa, Rubus caesius, Geranium robertianum, Pastinaca sativa, Trifolium medium or Euphorbia cyparissias. The maintenance of the mosaic of phytocoenoses in anthropogenically transformed habitats, including those along railway lines, is of decisive importance for the protection of floristic diversity and adaptation processes of Apoidea.
Directory of Open Access Journals (Sweden)
Marta K. Kostrzewska
2012-10-01
Full Text Available A field study was carried out in the period 2000-2006 at the Experimental Station in Tomaszkowo belonging to the University of Warmia and Mazury in Olsztyn. Its aim was to compare weed infestation of a mixture of spring barley and field pea grown in a four crop rotation with different crop selection and sequence. Each year during tillering of spring barley and before the harvest of the mixture, weed species composition and density were evaluated, while additionally weed biomass was also estimated before the harvest. These results were used to determine species constancy, Simpson’s dominance index, the Shannon-Wiener diversity and evenness indices as well as the community similarity index based on floristic richness, numbers and biomass of particular weed species. The cropping frequency and the position of the mixture in the crop rotation did not differentiate the species composition and total biomass of weed communities in the cereal-legume mixture crops. The crop rotation in which the mixture constituted 50% and was grown after itself had a reducing effect on weed numbers. Growing field pea in the 4-year crop rotation promoted weed infestation of the mixture and the dominance of weed communities. Capsella bursa-pastoris, Chenopodium album, Echinochloa crus-galli, Elymus repens, Polygonum convolvulus, and Sonchus arvensis were constant components of the agrophytocenoses. The weed communities were more similar in terms of their floristic composition than in terms of weed density and air-dry weight of weeds.
Directory of Open Access Journals (Sweden)
Julián Mauricio Ágredo Hoyos
2012-06-01
Full Text Available Pseudocercospora griseola, the etiologic agent of angular leaf spot of common bean (Phaseolus vulgaris, is an important disease in all bean-producing regions worldwide and may cause extremely high yield losses. The control of this disease is made more difficult by the pathogen's genetic variability and the inefficiency of fungicides. In this study, of 26 essential oils tested at different concentrations, 25 demonstrated efficiency in affecting the germination of strains 63-31 and 63-63 of the pathogen, reaching inhibition levels of between 80% and 100%. Cymbopogon citratus and Cymbopogon martinii inhibited conidia germination at all concentrations; Eugenia caryophyllata, Cinnamomum sp., Thymus vulgaris, Matricaria recutita, Cordia verbenacea, Origanum vulgare, Cymbopogon nardus, at 0.1 and 0.5%; and Zingiber officinale, Mentha arvensis, Chamaecyparis pisifera, Lavandula officinalis, Ocimum basilicum, Pimpinella anisum, Ocimum selloi, Baccharis dracunculifolia, Laurus nobilis, Citrus sinensis, Melaleuca alternifolia and Eucalyptus globulus, at 0.5%. The main constituents identified were cinnamaldehyde in Cinnamomum sp.; eugenol in E. caryophyllata; trans-β-farnesene in M. recutita; pulegone in C. verbenacea; thymol in T. vulgaris; geranial and neral in C. citratus, and geraniol in C. martini. Through transmission electron microscopy (TEM, it was verified that C. citratus, C. martini and E. caryophyllata presented direct fungitoxic action on P. griseola, causing severe damage to the cellular ultrastructure of the conidia, invalidating germination. These results indicated that essential oils are a promising alternative strategy for the control of angular leaf spot in bean, representing less risk to human health and the environment.Pseudocercospora griseola, agente etiológico da mancha angular do feijoeiro comum (Phaseolus vulgaris, é uma doença importante nas regiões produtoras de feijão em todo o mundo e pode causar perdas de produtividade
Araújo, Heverton M; Rodrigues, Fabíola F G; Costa, Wégila D; Nonato, Carla de F A; Rodrigues, Fábio F G; Boligon, Aline A; Athayde, Margareth L; Costa, José G M
2015-01-01
Psidium guajava (Myrtaceae), a common plant in Cariri region, Ceara, Brazil, as well as in various parts of the world, contains high concentrations of bioactive compounds and in many communities its parts are used for therapeutic purposes. Studies describe antioxidant, antimicrobial and anti-diarrheal actions from extracts obtained from leaves, but information about the activities of the fruits and comparison of these at different maturity stages (immature, partially mature and mature) are scarce. This study aims to evaluate the antioxidant properties by quantifying the levels of phenolic and flavonoid compounds, carotenoids and vitamin C of P. guajava fruits at different stages of maturation. The content of phenolic compounds for the immature fruit, partially mature and mature were: 22.41; 34.61 and 32.92 mg of AG/g fraction. The flavonoid content for immature fruits, intermediate and mature were: 2.83; 5.10 and 5.65 mg RUT/g fraction, respectively. Following the same standards of maturation stages, the ascorbic acid content was determined with values of 0.48; 0.38 and 0.21 mg AA/g fraction, respectively. HPLC analysis identified and quantified the presence of gallic acid, catechin, chlorogenic acid, caffeic acid, epicatechin, rutin, quercitrin, isoquercitrin, quercetin, kaempferol, glycosylated campeferol, tocopherol, β-carotene and lycopene. The antioxidant activity carried out by DPPH method showed the mature fruits bearing the best results, whereas chelation of Fe2+ ions showed higher percentage for the immature fruit. The results obtained by lipidic peroxidation were not satisfactory.