WorldWideScience

Sample records for artichoke est database

  1. Ontology and diversity of transcript-associated microsatellites mined from a globe artichoke EST database

    Directory of Open Access Journals (Sweden)

    Lanteri Sergio

    2009-09-01

    Full Text Available Abstract Background The globe artichoke (Cynara cardunculus var. scolymus L. is a significant crop in the Mediterranean basin. Despite its commercial importance and its both dietary and pharmaceutical value, knowledge of its genetics and genomics remains scant. Microsatellite markers have become a key tool in genetic and genomic analysis, and we have exploited recently acquired EST (expressed sequence tag sequence data (Composite Genome Project - CGP to develop an extensive set of microsatellite markers. Results A unigene assembly was created from over 36,000 globe artichoke EST sequences, containing 6,621 contigs and 12,434 singletons. Over 12,000 of these unigenes were functionally assigned on the basis of homology with Arabidopsis thaliana reference proteins. A total of 4,219 perfect repeats, located within 3,308 unigenes was identified and the gene ontology (GO analysis highlighted some GO term's enrichments among different classes of microsatellites with respect to their position. Sufficient flanking sequence was available to enable the design of primers to amplify 2,311 of these microsatellites, and a set of 300 was tested against a DNA panel derived from 28 C. cardunculus genotypes. Consistent amplification and polymorphism was obtained from 236 of these assays. Their polymorphic information content (PIC ranged from 0.04 to 0.90 (mean 0.66. Between 176 and 198 of the assays were informative in at least one of the three available mapping populations. Conclusion EST-based microsatellites have provided a large set of de novo genetic markers, which show significant amounts of polymorphism both between and within the three taxa of C. cardunculus. They are thus well suited as assays for phylogenetic analysis, the construction of genetic maps, marker-assisted breeding, transcript mapping and other genomic applications in the species.

  2. CyMSatDB: The Globe Artichoke (Cynara cardunculus var. scolymus) Microsatellite Database

    DEFF Research Database (Denmark)

    Portis, Ezio; Portis, Flavio; Valente, Luisa;

    include 66.700 compound SSRs. CyMSatDB (http://www.artichokegenome.unito.it) is a user-friendly and freely accessible tool, and offers chromosome wise as well as location wise search of primers by implementing Primer3. This web application, based on a LAMP solution stack, organizes microsatellites data in......The first high-quality genome assembly of the globe artichoke (Cynara cardunculus var. scolymus) has been recently produced at the DISAFA (Plant Genetics and Breeding) within the Compositae Genome Project (Scaglione et al. 2014, XXII PAG Conference). The assembly contains 13K scaffolds (N50= 125...... a MySQL database and provides an effective and responsive interface developed in PHP. To cater the customized needs of wet lab, features with a novelty of an automated primer designing tool is added. The feature of user defined primer designing has great advantage in terms of precise selection from...

  3. CyMSatDB: The Globe Artichoke (Cynara cardunculus var. scolymus) Microsatellite Database

    DEFF Research Database (Denmark)

    Portis, Ezio; Portis, Flavio; Valente, Luisa;

    2015-01-01

    include 66.700 compound SSRs. CyMSatDB (http://www.artichokegenome.unito.it) is a user-friendly and freely accessible tool, and offers chromosome wise as well as location wise search of primers by implementing Primer3. This web application, based on a LAMP solution stack, organizes microsatellites data in......The first high-quality genome assembly of the globe artichoke (Cynara cardunculus var. scolymus) has been recently produced at the DISAFA (Plant Genetics and Breeding) within the Compositae Genome Project (Scaglione et al. 2014, XXII PAG Conference). The assembly contains 13K scaffolds (N50= 125...... a MySQL database and provides an effective and responsive interface developed in PHP. To cater the customized needs of wet lab, features with a novelty of an automated primer designing tool is added. The feature of user defined primer designing has great advantage in terms of precise selection from...

  4. An EST database from saffron stigmas

    Directory of Open Access Journals (Sweden)

    Chiusano Maria Luisa

    2007-10-01

    Full Text Available Abstract Background Saffron (Crocus sativus L., Iridaceae flowers have been used as a spice and medicinal plant ever since the Greek-Minoan civilization. The edible part – the stigmas – are commonly considered the most expensive spice in the world and are the site of a peculiar secondary metabolism, responsible for the characteristic color and flavor of saffron. Results We produced 6,603 high quality Expressed Sequence Tags (ESTs from a saffron stigma cDNA library. This collection is accessible and searchable through the Saffron Genes database http://www.saffrongenes.org. The ESTs have been grouped into 1,893 Clusters, each corresponding to a different expressed gene, and annotated. The complete set of raw EST sequences, as well as of their electopherograms, are maintained in the database, allowing users to investigate sequence qualities and EST structural features (vector contamination, repeat regions. The saffron stigma transcriptome contains a series of interesting sequences (putative sex determination genes, lipid and carotenoid metabolism enzymes, transcription factors. Conclusion The Saffron Genes database represents the first reference collection for the genomics of Iridaceae, for the molecular biology of stigma biogenesis, as well as for the metabolic pathways underlying saffron secondary metabolism.

  5. Database Description - ClEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ClEST Database... Description General information of database Database name ClEST Alternative name Cimex lectul...6812 (ext.222-36812) Fax: +81-29-861-6812 E-mail: Database classification Nucleotide Sequence Database...s Organism Taxonomy Name: Cimex lectularius Taxonomy ID: 79782 Database description Exp...ressed sequence tags (EST) database of unique organs and whole bodies of the bedbug, Cimex lectularius Featu

  6. Signaling pathways in a Citrus EST database

    Directory of Open Access Journals (Sweden)

    Angela Mehta

    2007-01-01

    Full Text Available Citrus spp. are economically important crops, which in Brazil are grown mainly in the State of São Paulo. Citrus cultures are attacked by several pathogens, causing severe yield losses. In order to better understand this culture, the Millenium Project (IAC Cordeirópolis was launched in order to sequence Citrus ESTs (expressed sequence tags from different tissues, including leaf, bark, fruit, root and flower. Plants were submitted to biotic and abiotic stresses and investigated under different development stages (adult vs. juvenile. Several cDNA libraries were constructed and the sequences obtained formed the Citrus ESTs database with almost 200,000 sequences. Searches were performed in the Citrus database to investigate the presence of different signaling pathway components. Several of the genes involved in the signaling of sugar, calcium, cytokinin, plant hormones, inositol phosphate, MAPKinase and COP9 were found in the citrus genome and are discussed in this paper. The results obtained may indicate that similar mechanisms described in other plants, such as Arabidopsis, occur in citrus. Further experimental studies must be conducted in order to understand the different signaling pathways present.

  7. Update History of This Database - AcEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us AcEST Update History...iew/acest/ ) is released. Joomla SEF URLs by Artio About This Database Database Description Download License Update History... of This Database Site Policy | Contact Us Update History of This Database - AcEST | LSDB Archive ...

  8. Update History of This Database - ClEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ClEST Update History...Joomla SEF URLs by Artio About This Database Database Description Download License Update History of This Da...tabase Site Policy | Contact Us Update History of This Database - ClEST | LSDB Archive ...

  9. Signaling pathways in a Citrus EST database

    OpenAIRE

    Angela Mehta; Marilia Santos Silva; Simone Guidetti-Gonzalez; Helaine Carrer; Marco Aurélio Takita; Natália F. Martins

    2007-01-01

    Citrus spp. are economically important crops, which in Brazil are grown mainly in the State of São Paulo. Citrus cultures are attacked by several pathogens, causing severe yield losses. In order to better understand this culture, the Millenium Project (IAC Cordeirópolis) was launched in order to sequence Citrus ESTs (expressed sequence tags) from different tissues, including leaf, bark, fruit, root and flower. Plants were submitted to biotic and abiotic stresses and investigated under differe...

  10. An EST database from saffron stigmas

    OpenAIRE

    Chiusano Maria Luisa; Pizzichini Daniele; D'Agostino Nunzio; Giuliano Giovanni

    2007-01-01

    Abstract Background Saffron (Crocus sativus L., Iridaceae) flowers have been used as a spice and medicinal plant ever since the Greek-Minoan civilization. The edible part – the stigmas – are commonly considered the most expensive spice in the world and are the site of a peculiar secondary metabolism, responsible for the characteristic color and flavor of saffron. Results We produced 6,603 high quality Expressed Sequence Tags (ESTs) from a saffron stigma cDNA library. This collection is access...

  11. SPODOBASE : an EST database for the lepidopteran crop pest Spodoptera

    Directory of Open Access Journals (Sweden)

    Sabourault Cécile

    2006-06-01

    Full Text Available Abstract Background The Lepidoptera Spodoptera frugiperda is a pest which causes widespread economic damage on a variety of crop plants. It is also well known through its famous Sf9 cell line which is used for numerous heterologous protein productions. Species of the Spodoptera genus are used as model for pesticide resistance and to study virus host interactions. A genomic approach is now a critical step for further new developments in biology and pathology of these insects, and the results of ESTs sequencing efforts need to be structured into databases providing an integrated set of tools and informations. Description The ESTs from five independent cDNA libraries, prepared from three different S. frugiperda tissues (hemocytes, midgut and fat body and from the Sf9 cell line, are deposited in the database. These tissues were chosen because of their importance in biological processes such as immune response, development and plant/insect interaction. So far, the SPODOBASE contains 29,325 ESTs, which are cleaned and clustered into non-redundant sets (2294 clusters and 6103 singletons. The SPODOBASE is constructed in such a way that other ESTs from S. frugiperda or other species may be added. User can retrieve information using text searches, pre-formatted queries, query assistant or blast searches. Annotation is provided against NCBI, UNIPROT or Bombyx mori ESTs databases, and with GO-Slim vocabulary. Conclusion The SPODOBASE database provides integrated access to expressed sequence tags (EST from the lepidopteran insect Spodoptera frugiperda. It is a publicly available structured database with insect pest sequences which will allow identification of a number of genes and comprehensive cloning of gene families of interest for scientific community. SPODOBASE is available from URL: http://bioweb.ensam.inra.fr/spodobase

  12. WildSilkbase: An EST database of wild silkmoths

    Directory of Open Access Journals (Sweden)

    Nagaraju J

    2008-07-01

    Full Text Available Abstract Background Functional genomics has particular promise in silkworm biology for identifying genes involved in a variety of biological functions that include: synthesis and secretion of silk, sex determination pathways, insect-pathogen interactions, chorionogenesis, molecular clocks. Wild silkmoths have hardly been the subject of detailed scientific investigations, owing largely to non-availability of molecular and genetic data on these species. As a first step, in the present study we generated large scale expressed sequence tags (EST in three economically important species of wild silkmoths. In order to make these resources available for the use of global scientific community, an EST database called 'WildSilkbase' was developed. Description WildSilkbase is a catalogue of ESTs generated from several tissues at different developmental stages of 3 economically important saturniid silkmoths, an Indian golden silkmoth, Antheraea assama, an Indian tropical tasar silkmoth, A. mylitta and eri silkmoth, Samia cynthia ricini. Currently the database is provided with 57,113 ESTs which are clustered and assembled into 4,019 contigs and 10,019 singletons. Data can be browsed and downloaded using a standard web browser. Users can search the database either by BLAST query, keywords or Gene Ontology query. There are options to carry out searches for species, tissue and developmental stage specific ESTs in BLAST page. Other features of the WildSilkbase include cSNP discovery, GO viewer, homologue finder, SSR finder and links to all other related databases. The WildSilkbase is freely available from http://www.cdfd.org.in/wildsilkbase/. Conclusion A total of 14,038 putative unigenes was identified in 3 species of wild silkmoths. These genes provide important resources to gain insight into the functional and evolutionary study of wild silkmoths. We believe that WildSilkbase will be extremely useful for all those researchers working in the areas of

  13. White mold of Jerusalem artichoke

    Science.gov (United States)

    Jerusalem artichoke (Helianthus tuberosus) is a Native American food plant closely related to the common sunflower (Helianthus annuus). Tubers of Jerusalem artichoke are increasingly available in retail grocery outlets. White mold (Sclerotinia stem rot), caused by the fungus, Sclerotinia sclerotioru...

  14. MELOGEN: an EST database for melon functional genomics

    Directory of Open Access Journals (Sweden)

    Puigdomènech Pere

    2007-09-01

    Full Text Available Abstract Background Melon (Cucumis melo L. is one of the most important fleshy fruits for fresh consumption. Despite this, few genomic resources exist for this species. To facilitate the discovery of genes involved in essential traits, such as fruit development, fruit maturation and disease resistance, and to speed up the process of breeding new and better adapted melon varieties, we have produced a large collection of expressed sequence tags (ESTs from eight normalized cDNA libraries from different tissues in different physiological conditions. Results We determined over 30,000 ESTs that were clustered into 16,637 non-redundant sequences or unigenes, comprising 6,023 tentative consensus sequences (contigs and 10,614 unclustered sequences (singletons. Many potential molecular markers were identified in the melon dataset: 1,052 potential simple sequence repeats (SSRs and 356 single nucleotide polymorphisms (SNPs were found. Sixty-nine percent of the melon unigenes showed a significant similarity with proteins in databases. Functional classification of the unigenes was carried out following the Gene Ontology scheme. In total, 9,402 unigenes were mapped to one or more ontology. Remarkably, the distributions of melon and Arabidopsis unigenes followed similar tendencies, suggesting that the melon dataset is representative of the whole melon transcriptome. Bioinformatic analyses primarily focused on potential precursors of melon micro RNAs (miRNAs in the melon dataset, but many other genes potentially controlling disease resistance and fruit quality traits were also identified. Patterns of transcript accumulation were characterised by Real-Time-qPCR for 20 of these genes. Conclusion The collection of ESTs characterised here represents a substantial increase on the genetic information available for melon. A database (MELOGEN which contains all EST sequences, contig images and several tools for analysis and data mining has been created. This set of

  15. Download - ClEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...bout This Database Database Description Download License Update History of This Database Site Policy | Contact Us Download - ClEST | LSDB Archive ...

  16. Download - AcEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...t This Database Database Description Download License Update History of This Database Site Policy | Contact Us Download - AcEST | LSDB Archive ...

  17. GoSh: a goat and sheep ESTs database

    Directory of Open Access Journals (Sweden)

    P. Mariani

    2010-04-01

    Full Text Available The GoSh database (http://www.itb.cnr.it/gosh/ is an online resource including expressedsequence tags (ESTs from Ovis aries and Capra hircus. A total of 58,990 sheep and goat sequences were downloadedfrom GenBank and processed by a semi-automated pipeline, integrating public programs and Perl scripts.Data were collected in a MySQL database, which can be queried via a PHP-based web interface. Sequences wereassembled and a unigene dataset was defined. Three annotation procedures were carried out on all the ESTsequences and all the contig consensus sequences. A procedure was also implemented to infer statistical classificationamong Gene Ontology (GO categories from the ontology occurrences related to the sequences included in thedatabase. A number of programs were used to extract features and give significance to rough sequences. Amongthese, AutoSNP was used to perform putative SNP detection. Further analyses were performed on the GoSh dbdataset, including tandem repeats search and protein patterns identification. The web interface allows users toretrieve significant data and correspondent external links and to download selected sequences and accessory informationin different formats. The resulting web site is a resource of data and links related to goat and sheepexpressed genes.

  18. Putative resistance genes in the CitEST database

    Directory of Open Access Journals (Sweden)

    Simone Guidetti-Gonzalez

    2007-01-01

    Full Text Available Disease resistance in plants is usually associated with the activation of a wide variety of defense responses to prevent pathogen replication and/or movement. The ability of the host plant to recognize the pathogen and to activate defense responses is regulated by direct or indirect interaction between the products of plant resistance (R and pathogen avirulence (Avr genes. Attempted infection of plants by avirulent pathogens elicits a battery of defenses often followed by the collapse of the challenged host cells. Localized host cell death may help to prevent the pathogen from spreading to uninfected tissues, known as hypersensitive response (HR. When either the plant or the pathogen lacks its cognate gene, activation of the plant’s defense responses fails to occur or is delayed and does not prevent pathogen colonization. In the CitEST database, we identified 1,300 reads related to R genes in Citrus which have been reported in other plant species. These reads were translated in silico, and alignments of their amino acid sequences revealed the presence of characteristic domains and motifs that are specific to R gene classes. The description of the reads identified suggests that they function as resistance genes in citrus.

  19. All 5' EST - KOME | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...ST name SEQUENCE 5' EST sequence Joomla SEF URLs by Artio About This Database Database Description Download License Update History

  20. All 3' EST - KOME | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...ST name SEQUENCE 3' EST sequence Joomla SEF URLs by Artio About This Database Database Description Download License Update History

  1. Pepper EST database: comprehensive in silico tool for analyzing the chili pepper (Capsicum annuum transcriptome

    Directory of Open Access Journals (Sweden)

    Kim Woo Taek

    2008-10-01

    Full Text Available Abstract Background There is no dedicated database available for Expressed Sequence Tags (EST of the chili pepper (Capsicum annuum, although the interest in a chili pepper EST database is increasing internationally due to the nutritional, economic, and pharmaceutical value of the plant. Recent advances in high-throughput sequencing of the ESTs of chili pepper cv. Bukang have produced hundreds of thousands of complementary DNA (cDNA sequences. Therefore, a chili pepper EST database was designed and constructed to enable comprehensive analysis of chili pepper gene expression in response to biotic and abiotic stresses. Results We built the Pepper EST database to mine the complexity of chili pepper ESTs. The database was built on 122,582 sequenced ESTs and 116,412 refined ESTs from 21 pepper EST libraries. The ESTs were clustered and assembled into virtual consensus cDNAs and the cDNAs were assigned to metabolic pathway, Gene Ontology (GO, and MIPS Functional Catalogue (FunCat. The Pepper EST database is designed to provide a workbench for (i identifying unigenes in pepper plants, (ii analyzing expression patterns in different developmental tissues and under conditions of stress, and (iii comparing the ESTs with those of other members of the Solanaceae family. The Pepper EST database is freely available at http://genepool.kribb.re.kr/pepper/. Conclusion The Pepper EST database is expected to provide a high-quality resource, which will contribute to gaining a systemic understanding of plant diseases and facilitate genetics-based population studies. The database is also expected to contribute to analysis of gene synteny as part of the chili pepper sequencing project by mapping ESTs to the genome.

  2. EST Table - KAIKOcDNA | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available KAIKOcDNA EST Table Data detail Data name EST Table Description of data contents List of silkworm ESTs (cDNAs) consisting of public...ly available data in addition to sequences registered to public database as of Septem

  3. Fructans of Jerusalem artichokes

    DEFF Research Database (Denmark)

    Rumessen, J J; Bodé, S; Hamberg, O;

    1990-01-01

    Fructans are naturally occurring plant oligosaccharides with sweetening properties. Fructans (FAs) isolated from Jerusalem artichokes (Helianthus tuberosus) were studied with respect to intestinal handling and influence on blood glucose (BG), insulin, and C-peptide responses in eight healthy...... subjects. The responses were compared with those for fructose ingestion. The effect of FAs added to a wheat-starch meal was also studied. Standardized breath-hydrogen excretion indicated that FAs were completely malabsorbed and, after a 20-g dose, traces of FA were detected in 24-h urine collections in one...

  4. REDVET está indexada en Academia Journals Database

    OpenAIRE

    Redaccion Veterinaria.org

    2007-01-01

    El slogan de la Academia Journals Database, base de datos y directorio bibliográfico es “La difusión de conocimientos científicos de calidad controlada” por lo que es una satisfacción para REDVET que se nos valore por esta institución como una revista de calidad.

  5. REDVET está indexada en Academia Journals Database

    Directory of Open Access Journals (Sweden)

    Redaccion Veterinaria.org

    2007-12-01

    Full Text Available El slogan de la Academia Journals Database, base de datos y directorio bibliográfico es “La difusión de conocimientos científicos de calidad controlada” por lo que es una satisfacción para REDVET que se nos valore por esta institución como una revista de calidad.

  6. AcEST Contig - AcEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credit s ] BLAST Search Image Search Home About Archive Update History Contact us AcEST AcEST C ... c.jp/togodb/view/archive_acestcontig#en Data acquisit ion method - Data analysis method - Number of data ... entries 4,298 entries Data it em Description Contig ID ID of contig sequence of A ... ris Number of clones The number of EST clones constit uting the contig sequence of Adiantum capillus-vene ... ris Definit ion Definit ion Link to clone list In the TogoDB edi ...

  7. Mining, characterization and validation of EST derived microsatellites from the transcriptome database of Allium sativum L

    OpenAIRE

    Chand, Subodh Kumar; Nanda, Satyabrata; Rout, Ellojita; Joshi, Raj Kumar

    2015-01-01

    Expressed Sequence Tags (ESTs) with comprehensive transcript information are valuable resources for development of molecular markers as they are derived from conserved genic regions. The present study highlights the mining of EST database to deduce the class I hyper variable SSRs in A. sativum. From 21694 garlic EST sequences, 642 non-redundant SSRs were identified with an average frequency of 1 per 14.9 kb of garlic transcriptome. The most abundant SSR motifs were the mononucleotides (32.86%...

  8. SolEST database: a "one-stop shop" approach to the study of Solanaceae transcriptomes

    Directory of Open Access Journals (Sweden)

    Chiusano Maria

    2009-11-01

    Full Text Available Abstract Background Since no genome sequences of solanaceous plants have yet been completed, expressed sequence tag (EST collections represent a reliable tool for broad sampling of Solanaceae transcriptomes, an attractive route for understanding Solanaceae genome functionality and a powerful reference for the structural annotation of emerging Solanaceae genome sequences. Description We describe the SolEST database http://biosrv.cab.unina.it/solestdb which integrates different EST datasets from both cultivated and wild Solanaceae species and from two species of the genus Coffea. Background as well as processed data contained in the database, extensively linked to external related resources, represent an invaluable source of information for these plant families. Two novel features differentiate SolEST from other resources: i the option of accessing and then visualizing Solanaceae EST/TC alignments along the emerging tomato and potato genome sequences; ii the opportunity to compare different Solanaceae assemblies generated by diverse research groups in the attempt to address a common complaint in the SOL community. Conclusion Different databases have been established worldwide for collecting Solanaceae ESTs and are related in concept, content and utility to the one presented herein. However, the SolEST database has several distinguishing features that make it appealing for the research community and facilitates a "one-stop shop" for the study of Solanaceae transcriptomes.

  9. Database Description - AcEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available title: Author name(s): Journal: Pubmed ID: Original website information Database ... funding Research funded by the basic research budget of Tokyo Metropolitan University Reference(s) Article

  10. Details of rice EST mapping results - RGP estmap2001 | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available Description Download License Update History of This Database Site Policy | C...[ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...d clone-specific primer pairs designed from 6713 unique EST sequences (3' end) ...nes *; PCR band size longer than predicted Ann T; 60 ℃ unless otherwise indicated NI; YACs with unknown inse...e (sites) name DDBJ Acc FW DDBJ accession of the EST clone (Forward sequence) DDBJ Acc RV DDBJ accession of the EST clone (Reverse

  11. Cluster - ClEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...including Blastx search results and GO annotations Data file File name: clest_cluster.zip File URL: ftp://ftp.biosciencedbc.jp/archiv...istory of This Database Site Policy | Contact Us Cluster - ClEST | LSDB Archive ...

  12. GarlicESTdb: an online database and mining tool for garlic EST sequences

    Directory of Open Access Journals (Sweden)

    Choi Sang-Haeng

    2009-05-01

    Full Text Available Abstract Background Allium sativum., commonly known as garlic, is a species in the onion genus (Allium, which is a large and diverse one containing over 1,250 species. Its close relatives include chives, onion, leek and shallot. Garlic has been used throughout recorded history for culinary, medicinal use and health benefits. Currently, the interest in garlic is highly increasing due to nutritional and pharmaceutical value including high blood pressure and cholesterol, atherosclerosis and cancer. For all that, there are no comprehensive databases available for Expressed Sequence Tags(EST of garlic for gene discovery and future efforts of genome annotation. That is why we developed a new garlic database and applications to enable comprehensive analysis of garlic gene expression. Description GarlicESTdb is an integrated database and mining tool for large-scale garlic (Allium sativum EST sequencing. A total of 21,595 ESTs collected from an in-house cDNA library were used to construct the database. The analysis pipeline is an automated system written in JAVA and consists of the following components: automatic preprocessing of EST reads, assembly of raw sequences, annotation of the assembled sequences, storage of the analyzed information into MySQL databases, and graphic display of all processed data. A web application was implemented with the latest J2EE (Java 2 Platform Enterprise Edition software technology (JSP/EJB/JavaServlet for browsing and querying the database, for creation of dynamic web pages on the client side, and for mapping annotated enzymes to KEGG pathways, the AJAX framework was also used partially. The online resources, such as putative annotation, single nucleotide polymorphisms (SNP and tandem repeat data sets, can be searched by text, explored on the website, searched using BLAST, and downloaded. To archive more significant BLAST results, a curation system was introduced with which biologists can easily edit best-hit annotation

  13. Data correction on January 10th, 2013 - AcEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available AcEST Data correction on January 10th, 2013 Errors regarding clone IDs and contig length were found on AcEST... Contig data, and they were corrected on January 10th, 2013. The contents of data correction are listed belo... of This Database Site Policy | Contact Us Data correction on January 10th, 2013 - AcEST | LSDB Archive ...

  14. Analysis of newly established EST databases reveals similarities between heart regeneration in newt and fish

    Directory of Open Access Journals (Sweden)

    Weis Patrick

    2010-01-01

    Full Text Available Abstract Background The newt Notophthalmus viridescens possesses the remarkable ability to respond to cardiac damage by formation of new myocardial tissue. Surprisingly little is known about changes in gene activities that occur during the course of regeneration. To begin to decipher the molecular processes, that underlie restoration of functional cardiac tissue, we generated an EST database from regenerating newt hearts and compared the transcriptional profile of selected candidates with genes deregulated during zebrafish heart regeneration. Results A cDNA library of 100,000 cDNA clones was generated from newt hearts 14 days after ventricular injury. Sequencing of 11520 cDNA clones resulted in 2894 assembled contigs. BLAST searches revealed 1695 sequences with potential homology to sequences from the NCBI database. BLAST searches to TrEMBL and Swiss-Prot databases assigned 1116 proteins to Gene Ontology terms. We also identified a relatively large set of 174 ORFs, which are likely to be unique for urodele amphibians. Expression analysis of newt-zebrafish homologues confirmed the deregulation of selected genes during heart regeneration. Sequences, BLAST results and GO annotations were visualized in a relational web based database followed by grouping of identified proteins into clusters of GO Terms. Comparison of data from regenerating zebrafish hearts identified biological processes, which were uniformly overrepresented during cardiac regeneration in newt and zebrafish. Conclusion We concluded that heart regeneration in newts and zebrafish led to the activation of similar sets of genes, which suggests that heart regeneration in both species might follow similar principles. The design of the newly established newt EST database allows identification of molecular pathways important for heart regeneration.

  15. Cloning and Alternative Splicing Analysis of Bombyx mori Transformer-2 Gene using Silkworm EST Database

    Institute of Scientific and Technical Information of China (English)

    Bao-Long NIU; Zhi-Qi MENG; Yue-Zhi TAO; Shun-Lin LU; Hong-Biao WENG; Li-Hua HE; Wei-Feng SHEN

    2005-01-01

    We have identified Bombyx mori transformer-2 gene (Bmtra-2) cDNA by blasting the EST database of B. mori. It was expressed in the whole life of the male and female silkworm and was observed as a band of 1.3 kb by Northern blot analysis. By comparing corresponding ESTs to the Bmtra-2 DNA sequence,it was revealed that there were eight exons and seven introns, and all splice sites of exons/introns conformed to the GT/AG rule. Bmtra-2 pre-mRNA can produce multiple mRNAs encoding six distinct isoforms of BmTRA-2 protein using an alternative splicing pathway during processing. Six types of Bmtra-2 cDNA clones were identified by reverse transcription-polymerase chain reaction. All isoforms of BmTRA-2 protein contain two arginine/serine-rich domains and one RNA recognition motif, showing striking organizational similarity to Drosophila TRA-2 proteins.

  16. Development and Characterization of Microsatellite Markers for the Pacific Abalone (Haliotis discus) via EST Database Mining

    Institute of Scientific and Technical Information of China (English)

    ZHAN Aibin; BAO Zhenmin; WANG Mingling; CHANG Dan; YUAN Jian; WANG Xiaolong; HU Xiaoli; LIANG Chengzhu; HU Jingjie

    2008-01-01

    The EST database of the Pacific abalone (Haliotis discus) was mined for developing mierosatellite markers. A total of 1476 EST sequences were registered in GenBank when data mining was performed. Fifty sequences (approximately 3.4%) were found to contain one or more mierosatellites. Based on the length and GC content of the flanking regions, duster analysis and BLASTN, 13 microsatellite-containing ESTs were selected for PCR primer design. The results showed that 10 out of 13 primer pairs could amplify seorable PCR products and showed polymorphism. The number of alleles ranged from 2 to 13 and the values of Hoand He varied from 0.1222 to 0.8611 and 0.2449 to 0.9311, respectively. No significant linkage disequilibrium (LD) between any pairs of these loci was found, and 6 of 10 loci conformed to the Hardy-Weinberg equilibrium (HWE). These EST-SSRs are therefore potential tools for studies of intraspecies variation and hybrid identification.

  17. Mining, characterization and validation of EST derived microsatellites from the transcriptome database of Allium sativum L.

    Science.gov (United States)

    Chand, Subodh Kumar; Nanda, Satyabrata; Rout, Ellojita; Joshi, Raj Kumar

    2015-01-01

    Expressed Sequence Tags (ESTs) with comprehensive transcript information are valuable resources for development of molecular markers as they are derived from conserved genic regions. The present study highlights the mining of EST database to deduce the class I hyper variable SSRs in A. sativum. From 21694 garlic EST sequences, 642 non-redundant SSRs were identified with an average frequency of 1 per 14.9 kb of garlic transcriptome. The most abundant SSR motifs were the mononucleotides (32.86%) followed by trinucleotides (28.50%) and dinucleotides (13.39%). Among the individual SSRs, (A/T)n accounted for the highest number (137; 21.33%) followed by (G/C)n (74; 11.52%) and (AAG)n (63;9.81%). Primers designed from a robust set of 7 AsESTSSRs resulted in the amplification of 63 polymorphic alleles in 14 accessions of garlic. The resolving power of the markers varied from 4.286 (AsSSR7) to 18.143 (AsSSR13) while the average marker index (MI) was 5.087. These EST-SSRs markers for garlic could be useful for the improvement of garlic linkage map and could be used for evaluating genetic variation and comparative genomics studies in Allium species. PMID:25987765

  18. AcEST(EST sequences of Adiantum capillus-veneris and their annotation) - AcEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available AcEST AcEST(EST sequences of Adiantum capillus-veneris and their annotation) Data detail Data name AcEST(EST... sequences of Adiantum capillus-veneris and their annotation) Description of data contents EST sequence of Adiantum capi...db/view/archive_acest#en Data acquisition method Capillary sequencer Data analysi...atabases) Number of data entries Adiantum capillus-veneris ESTs: 30,540. Data item Description Clone id Clon...e ID of EST sequence of Adiantum capillus-veneris. Library Library name Length Nu

  19. Statistics information of rice EST mapping results - RGP estmap2001 | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us RGP estmap2001 Statistics... information of rice EST mapping results Data detail Data name Statistics informati...of This Database Site Policy | Contact Us Statistics information of rice EST mapping results - RGP estmap2001 | LSDB Archive ...

  20. An elm EST database for identifying leaf beetle egg-induced defense genes

    Directory of Open Access Journals (Sweden)

    Büchel Kerstin

    2012-06-01

    Full Text Available Abstract Background Plants can defend themselves against herbivorous insects prior to the onset of larval feeding by responding to the eggs laid on their leaves. In the European field elm (Ulmus minor, egg laying by the elm leaf beetle ( Xanthogaleruca luteola activates the emission of volatiles that attract specialised egg parasitoids, which in turn kill the eggs. Little is known about the transcriptional changes that insect eggs trigger in plants and how such indirect defense mechanisms are orchestrated in the context of other biological processes. Results Here we present the first large scale study of egg-induced changes in the transcriptional profile of a tree. Five cDNA libraries were generated from leaves of (i untreated control elms, and elms treated with (ii egg laying and feeding by elm leaf beetles, (iii feeding, (iv artificial transfer of egg clutches, and (v methyl jasmonate. A total of 361,196 ESTs expressed sequence tags (ESTs were identified which clustered into 52,823 unique transcripts (Unitrans and were stored in a database with a public web interface. Among the analyzed Unitrans, 73% could be annotated by homology to known genes in the UniProt (Plant database, particularly to those from Vitis, Ricinus, Populus and Arabidopsis. Comparative in silico analysis among the different treatments revealed differences in Gene Ontology term abundances. Defense- and stress-related gene transcripts were present in high abundance in leaves after herbivore egg laying, but transcripts involved in photosynthesis showed decreased abundance. Many pathogen-related genes and genes involved in phytohormone signaling were expressed, indicative of jasmonic acid biosynthesis and activation of jasmonic acid responsive genes. Cross-comparisons between different libraries based on expression profiles allowed the identification of genes with a potential relevance in egg-induced defenses, as well as other biological processes, including signal transduction

  1. Taking Another Look At Globe Artichokes At Virginia Tech

    OpenAIRE

    Bratsch, Tony; Welbaum, G. E. (Gregory E.)

    2009-01-01

    There has been historical interest in growing artichokes on the east coast, and annual production has been evaluated in Connecticut, New York and here in Virginia. This publication reviews the viability of growing artichokes as a profitable annual option.

  2. EST2uni: an open, parallel tool for automated EST analysis and database creation, with a data mining web interface and microarray expression data integration

    Directory of Open Access Journals (Sweden)

    Nuez Fernando

    2008-01-01

    Full Text Available Abstract Background Expressed sequence tag (EST collections are composed of a high number of single-pass, redundant, partial sequences, which need to be processed, clustered, and annotated to remove low-quality and vector regions, eliminate redundancy and sequencing errors, and provide biologically relevant information. In order to provide a suitable way of performing the different steps in the analysis of the ESTs, flexible computation pipelines adapted to the local needs of specific EST projects have to be developed. Furthermore, EST collections must be stored in highly structured relational databases available to researchers through user-friendly interfaces which allow efficient and complex data mining, thus offering maximum capabilities for their full exploitation. Results We have created EST2uni, an integrated, highly-configurable EST analysis pipeline and data mining software package that automates the pre-processing, clustering, annotation, database creation, and data mining of EST collections. The pipeline uses standard EST analysis tools and the software has a modular design to facilitate the addition of new analytical methods and their configuration. Currently implemented analyses include functional and structural annotation, SNP and microsatellite discovery, integration of previously known genetic marker data and gene expression results, and assistance in cDNA microarray design. It can be run in parallel in a PC cluster in order to reduce the time necessary for the analysis. It also creates a web site linked to the database, showing collection statistics, with complex query capabilities and tools for data mining and retrieval. Conclusion The software package presented here provides an efficient and complete bioinformatics tool for the management of EST collections which is very easy to adapt to the local needs of different EST projects. The code is freely available under the GPL license and can be obtained at http://bioinf.comav.upv.es/est

  3. Pepper EST database: comprehensive in silico tool for analyzing the chili pepper (Capsicum annuum) transcriptome

    OpenAIRE

    Kim Woo Taek; Cho Hye-Sun; Lee Bong-Woo; Kim JungEun; Lee Seung-Won; Baek Kwang-Hyun; Kim Hyun-Jin; Choi Doil; Hur Cheol-Goo

    2008-01-01

    Abstract Background There is no dedicated database available for Expressed Sequence Tags (EST) of the chili pepper (Capsicum annuum), although the interest in a chili pepper EST database is increasing internationally due to the nutritional, economic, and pharmaceutical value of the plant. Recent advances in high-throughput sequencing of the ESTs of chili pepper cv. Bukang have produced hundreds of thousands of complementary DNA (cDNA) sequences. Therefore, a chili pepper EST database was desi...

  4. Generation, annotation, analysis and database integration of 16,500 white spruce EST clusters

    Directory of Open Access Journals (Sweden)

    Siddiqui Asim

    2005-10-01

    Full Text Available Abstract Background The sequencing and analysis of ESTs is for now the only practical approach for large-scale gene discovery and annotation in conifers because their very large genomes are unlikely to be sequenced in the near future. Our objective was to produce extensive collections of ESTs and cDNA clones to support manufacture of cDNA microarrays and gene discovery in white spruce (Picea glauca [Moench] Voss. Results We produced 16 cDNA libraries from different tissues and a variety of treatments, and partially sequenced 50,000 cDNA clones. High quality 3' and 5' reads were assembled into 16,578 consensus sequences, 45% of which represented full length inserts. Consensus sequences derived from 5' and 3' reads of the same cDNA clone were linked to define 14,471 transcripts. A large proportion (84% of the spruce sequences matched a pine sequence, but only 68% of the spruce transcripts had homologs in Arabidopsis or rice. Nearly all the sequences that matched the Populus trichocarpa genome (the only sequenced tree genome also matched rice or Arabidopsis genomes. We used several sequence similarity search approaches for assignment of putative functions, including blast searches against general and specialized databases (transcription factors, cell wall related proteins, Gene Ontology term assignation and Hidden Markov Model searches against PFAM protein families and domains. In total, 70% of the spruce transcripts displayed matches to proteins of known or unknown function in the Uniref100 database (blastx e-value Arabidopsis or rice genomes. Detailed analysis of translationally controlled tumour proteins and S-adenosylmethionine synthetase families confirmed a twofold size difference. Sequences and annotations were organized in a dedicated database, SpruceDB. Several search tools were developed to mine the data either based on their occurrence in the cDNA libraries or on functional annotations. Conclusion This report illustrates specific

  5. Exploiting EST databases for the development and characterization of EST-SSR markers in castor bean (Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    Yang Jun-Bo

    2010-12-01

    Full Text Available Abstract Background The castor bean (Ricinus communis L., a monotypic species in the spurge family (Euphorbiaceae, 2n = 20, is an important non-edible oilseed crop widely cultivated in tropical, sub-tropical and temperate countries for its high economic value. Because of the high level of ricinoleic acid (over 85% in its seed oil, the castor bean seed derivatives are often used in aviation oil, lubricants, nylon, dyes, inks, soaps, adhesive and biodiesel. Due to lack of efficient molecular markers, little is known about the population genetic diversity and the genetic relationships among castor bean germplasm. Efficient and robust molecular markers are increasingly needed for breeding and improving varieties in castor bean. The advent of modern genomics has produced large amounts of publicly available DNA sequence data. In particular, expressed sequence tags (ESTs provide valuable resources to develop gene-associated SSR markers. Results In total, 18,928 publicly available non-redundant castor bean EST sequences, representing approximately 17.03 Mb, were evaluated and 7732 SSR sites in 5,122 ESTs were identified by data mining. Castor bean exhibited considerably high frequency of EST-SSRs. We developed and characterized 118 polymorphic EST-SSR markers from 379 primer pairs flanking repeats by screening 24 castor bean samples collected from different countries. A total of 350 alleles were identified from 118 polymorphic SSR loci, ranging from 2-6 per locus (A with an average of 2.97. The EST-SSR markers developed displayed moderate gene diversity (He with an average of 0.41. Genetic relationships among 24 germplasms were investigated using the genotypes of 350 alleles, showing geographic pattern of genotypes across genetic diversity centers of castor bean. Conclusion Castor bean EST sequences exhibited considerably high frequency of SSR sites, and were rich resources for developing EST-SSR markers. These EST-SSR markers would be particularly

  6. About Libraries - AcEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available acquisition method - Data analysis method Adiantum capillus-veneris EST library creation information Number ...neris EST library About Adiantum capillus-veneris EST library creation information References References of creation

  7. Computational EST database analysis identifies a novel member of the neuropoietic cytokine family.

    Science.gov (United States)

    Shi, Y; Wang, W; Yourey, P A; Gohari, S; Zukauskas, D; Zhang, J; Ruben, S; Alderson, R F

    1999-08-19

    A novel member of the neuropoietic cytokine family has been cloned and the protein expressed and characterized. In an effort to identify novel secreted proteins, an algorithm incorporating neural network algorithms was applied to a large EST database. A full-length clone was identified that is 1710 bp in length and has a single open reading frame of 225 amino acids. This new cytokine is most homologous to cardiotrophin-1, having a similarity and an identity of 46 and 29%, respectively, and therefore we have named it cardiotrophin-like cytokine (CLC). Northern hybridization analysis identified a 1.4-kb messenger RNA that is highly expressed in spleen and peripheral leukocytes. Purified recombinant CLC induced the activation of NFkappaB and SRE reporter constructs in the TF-1, U937, and M1 cell lines. Furthermore, the signal transduction pathway for CLC was characterized in the neuroblastoma cell line SK-N-MC and found to involve tyrosine phosphorylation of gp130 and STAT-1. PMID:10448081

  8. The barley EST DNA Replication and Repair Database (bEST-DRRD as a tool for the identification of the genes involved in DNA replication and repair

    Directory of Open Access Journals (Sweden)

    Gruszka Damian

    2012-06-01

    Full Text Available Abstract Background The high level of conservation of genes that regulate DNA replication and repair indicates that they may serve as a source of information on the origin and evolution of the species and makes them a reliable system for the identification of cross-species homologs. Studies that had been conducted to date shed light on the processes of DNA replication and repair in bacteria, yeast and mammals. However, there is still much to be learned about the process of DNA damage repair in plants. Description These studies, which were conducted mainly using bioinformatics tools, enabled the list of genes that participate in various pathways of DNA repair in Arabidopsis thaliana (L. Heynh to be outlined; however, information regarding these mechanisms in crop plants is still very limited. A similar, functional approach is particularly difficult for a species whose complete genomic sequences are still unavailable. One of the solutions is to apply ESTs (Expressed Sequence Tags as the basis for gene identification. For the construction of the barley EST DNA Replication and Repair Database (bEST-DRRD, presented here, the Arabidopsis nucleotide and protein sequences involved in DNA replication and repair were used to browse for and retrieve the deposited sequences, derived from four barley (Hordeum vulgare L. sequence databases, including the “Barley Genome version 0.05” database (encompassing ca. 90% of barley coding sequences and from two databases covering the complete genomes of two monocot models: Oryza sativa L. and Brachypodium distachyon L. in order to identify homologous genes. Sequences of the categorised Arabidopsis queries are used for browsing the repositories, which are located on the ViroBLAST platform. The bEST-DRRD is currently used in our project during the identification and validation of the barley genes involved in DNA repair. Conclusions The presented database provides information about the Arabidopsis genes involved in

  9. License - AcEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available erivative work based on part of whole of the data from this database. 2. When you conduct research by using ...this database, and describe the research results in an article or paper, you alwa

  10. License - ClEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available database. The license for this database is specified in the Creative Commons Attribution-Share Alike 2.1 Jap...oriyama (AIST) licensed under CC Attribution-Share Alike 2.1 Japan . The summary ...of the Creative Commons Attribution-Share Alike 2.1 Japan is found here . With regard to this database, you

  11. RNA-seq analysis and de novo transcriptome assembly of Jerusalem artichoke (Helianthus tuberosus Linne.

    Directory of Open Access Journals (Sweden)

    Won Yong Jung

    Full Text Available Jerusalem artichoke (Helianthus tuberosus L. has long been cultivated as a vegetable and as a source of fructans (inulin for pharmaceutical applications in diabetes and obesity prevention. However, transcriptomic and genomic data for Jerusalem artichoke remain scarce. In this study, Illumina RNA sequencing (RNA-Seq was performed on samples from Jerusalem artichoke leaves, roots, stems and two different tuber tissues (early and late tuber development. Data were used for de novo assembly and characterization of the transcriptome. In total 206,215,632 paired-end reads were generated. These were assembled into 66,322 loci with 272,548 transcripts. Loci were annotated by querying against the NCBI non-redundant, Phytozome and UniProt databases, and 40,215 loci were homologous to existing database sequences. Gene Ontology terms were assigned to 19,848 loci, 15,434 loci were matched to 25 Clusters of Eukaryotic Orthologous Groups classifications, and 11,844 loci were classified into 142 Kyoto Encyclopedia of Genes and Genomes pathways. The assembled loci also contained 10,778 potential simple sequence repeats. The newly assembled transcriptome was used to identify loci with tissue-specific differential expression patterns. In total, 670 loci exhibited tissue-specific expression, and a subset of these were confirmed using RT-PCR and qRT-PCR. Gene expression related to inulin biosynthesis in tuber tissue was also investigated. Exsiting genetic and genomic data for H. tuberosus are scarce. The sequence resources developed in this study will enable the analysis of thousands of transcripts and will thus accelerate marker-assisted breeding studies and studies of inulin biosynthesis in Jerusalem artichoke.

  12. Stress -induced biosynthesis of dicaffeoylquinic acids in globe artichoke

    NARCIS (Netherlands)

    Moglia, A.; Lanteri, S.; Comino, C.; Acquadro, A.; Vos, de C.H.; Beekwilder, M.J.

    2008-01-01

    Leaf extracts from globe artichoke (Cynara cardunculus L. var. scolymus) have been widely used in medicine as hepatoprotectant and choleretic agents. Globe artichoke leaves represent a natural source of phenolic acids with dicaffeoylquinic acids, such as cynarin (1,3-dicaffeoylquinic acid), along wi

  13. POSITIONAL CANDIDATE GENE SELECTION FROM LIVESTOCK EST DATABASES USING GENE ONTOLOGY

    Science.gov (United States)

    The number of expressed sequence tags (ESTs) in GenBank has now surpassed 200,000 for cattle and 100,000 for swine. The Institute of Genome Research (TIGR) has organized these sequences into approximately 60,000 non-redundant consensus sequences for cattle and 40,000 for swine in the TIGR Gene Indi...

  14. SSR mining in oil palm EST database: application in oil palm germplasm diversity studies

    Indian Academy of Sciences (India)

    Ngoot-Chin Ting; Noorhariza Mohd Zaki; Rozana Rosli; Eng-Ti Leslie Low; Maizura Ithnin; Suan-Choo Cheah; Soon-Guan Tan; Rajinder Singh

    2010-08-01

    This study reports on the detection of additional expressed sequence tags (EST) derived simple sequence repeat (SSR) markers for the oil palm. A large collection of 19243 Elaeis guineensis ESTs were assembled to give 10258 unique sequences, of which 629 ESTs were found to contain 722 SSRs with a variety of motifs. Dinucleotide repeats formed the largest group (45.6%) consisting of 66.9% AG/CT, 21.9% AT/AT, 10.9% AC/GT and 0.3% CG/CG motifs. This was followed by trinucleotide repeats, which is the second most abundant repeat types (34.5%) consisting of AAG/CTT (23.3%), AGG/CCT (13.7%), CCG/CGG (11.2%), AAT/ATT (10.8%), AGC/GCT (10.0%), ACT/AGT (8.8%), ACG/CGT (7.6%), ACC/GGT (7.2%), AAC/GTT (3.6%) and AGT/ACT (3.6%) motifs. Primer pairs were designed for 405 unique EST-SSRs and 15 of these were used to genotype 105 E. guineensis and 30 E. oleifera accessions. Fourteen SSRs were polymorphic in at least one germplasm revealing a total of 101 alleles. The high percentage (78.0%) of alleles found to be specific for either E. guineensis or E. oleifera has increased the power for discriminating the two species. The estimates of genetic differentiation detected by EST-SSRs were compared to those reported previously. The transferability across palm taxa to two Cocos nucifera and six exotic palms is also presented. The polymerase chain reaction (PCR) products of three primer-pairs detected in E. guineensis, E. oleifera, C. nucifera and Jessinia bataua were cloned and sequenced. Sequence alignments showed mutations within the SSR site and the flanking regions. Phenetic analysis based on the sequence data revealed that C. nucifera is closer to oil palm compared to J. bataua; consistent with the taxanomic classification.

  15. SSR mining in oil palm EST database: application in oil palm germplasm diversity studies.

    Science.gov (United States)

    Ting, Ngoot-Chin; Zaki, Noorhariza Mohd; Rosli, Rozana; Low, Eng-Ti Leslie; Ithnin, Maizura; Cheah, Suan-Choo; Tan, Soon-Guan; Singh, Rajinder

    2010-08-01

    This study reports on the detection of additional expressed sequence tags (EST) derived simple sequence repeat (SSR) markers for the oil palm. A large collection of 19243 Elaeis guineensis ESTs were assembled to give 10258 unique sequences, of which 629 ESTs were found to contain 722 SSRs with a variety of motifs. Dinucleotide repeats formed the largest group (45.6%) consisting of 66.9% AG/CT, 21.9% AT/AT, 10.9% AC/GT and 0.3% CG/CG motifs. This was followed by trinucleotide repeats, which is the second most abundant repeat types (34.5%) consisting of AAG/CTT (23.3%), AGG/CCT (13.7%), CCG/CGG (11.2%), AAT/ATT (10.8%), AGC/GCT (10.0%), ACT/AGT (8.8%), ACG/CGT (7.6%), ACC/GGT (7.2%), AAC/GTT (3.6%) and AGT/ACT (3.6%) motifs. Primer pairs were designed for 405 unique EST-SSRs and 15 of these were used to genotype 105 E. guineensis and 30 E. oleifera accessions. Fourteen SSRs were polymorphic in at least one germplasm revealing a total of 101 alleles. The high percentage (78.0%) of alleles found to be specific for either E. guineensis or E. oleifera has increased the power for discriminating the two species. The estimates of genetic differentiation detected by EST-SSRs were compared to those reported previously. The transferability across palm taxa to two Cocos nucifera and six exotic palms is also presented. The polymerase chain reaction (PCR) products of three primer-pairs detected in E. guineensis, E. oleifera, C. nucifera and Jessinia bataua were cloned and sequenced. Sequence alignments showed mutations within the SSR site and the flanking regions. Phenetic analysis based on the sequence data revealed that C. nucifera is closer to oil palm compared to J. bataua; consistent with the taxanomic classification. PMID:20861564

  16. Exploiting EST databases for the mining and characterization of short sequence repeat (SSR) markers in Catharanthus roseus L.

    Science.gov (United States)

    Joshi, Raj Kumar; Kar, Basudeba; Nayak, Sanghamitra

    2011-01-01

    Periwinkle (Catharanthus roseus L.) (Family: Apocyanaceae) is a ornamental plants with great medicinal properties. Although it is represented by seven species, little work has been carried out on its genetic characterization due to non-availability of reliable molecular markers. Simple sequence repeats (SSRs) have been widely applied as molecular markers in genetic studies. With the rapid increase in the deposition of nucleotide sequences in the public databases and advent of bioinformatics tools, it has become a cost effective and fast approach to scan for microsatellite repeats and exploit the possibility of converting it into potential genetic markers. Expressed sequence tags (EST's) from Catharanthus roseus were used for the screening of Class I (hyper variable) simple sequence repeats (SSR's). A total of 502 microsatellite repeats were detected from 21730 EST sequences of turmeric after redundancy elimination. The average density of Class I SSRs account to 1 SSR per 10.21 kb of EST. Mononucleotides was the most abundant class of microsatellite motifs. It accounted for 44.02% of the total, followed by the trinucleotide (26.09%) and dinucleotide repeats (14.34%). Among all the repeat motifs, (A/T)n accounted for the highest Proportion (36.25%) followed by (AAG)n. These detected SSRs can be used to design primers that have functional importance and should also facilitate the analysis of genetic diversity, variability, linkage mapping and evolutionary relationships in plants especially medicinal plants. PMID:21383904

  17. Hydrolase activity in Jerusalem artichoke and chicory

    Energy Technology Data Exchange (ETDEWEB)

    Klaushofer, H.; Abraham, B.; Leichtfried, G.

    1988-03-01

    Post-harvest storage of chicory and Jerusalem artichoke and overwintering of Jerusalem artichoke in the soil cause a more or less pronounced shortening of the fructan chain, depending on the variety. The proportion of fructose in the total fructan thus shifts towards glucose. This reduction on the fructose/glucose ratio is undesirable if the intention is to obtain a sweetener of high fructose content. In this work an attempt was made, via the quantity of fructose formed after a 4(3)-hour reaction of a tuber (root) extract with inulin, to assign a characteristic value to the depolymerization tendency of the material in question. However, since the plant extract not only contains enzymes (hydrolase A and B) that shorten the fructan chains but the activity of fructosyltransferase (SST, FFT) and enzymes of microbial origin (inulinase II, invertase) must also be considered, the concept of 'hydrolase activity' used by the authors is essentially an expression of 'total activity'. The activity unit (EU) is defined as the ability to split of 1 ..mu..mol of fructose from (chicory) inulin per minute under experimental conditions. Values of 0.25 to 0.77 EU/g dry solids were found in Jerusalem artichoke. Considerable differences may occur between varieties from the same cultivated area and the same harvest period. With one and the same variety, the activity appears to be subject to marked yearly fluctuations, so that at present, because of hydrolase activity, nothing certain can be said about the depolymerization tendency of a variety.

  18. Databases

    Data.gov (United States)

    National Aeronautics and Space Administration — The databases of computational and experimental data from the first Aeroelastic Prediction Workshop are located here. The databases file names tell their contents...

  19. Databases

    Digital Repository Service at National Institute of Oceanography (India)

    Kunte, P.D.

    Information on bibliographic as well as numeric/textual databases relevant to coastal geomorphology has been included in a tabular form. Databases cover a broad spectrum of related subjects like coastal environment and population aspects, coastline...

  20. Potential Biogas Production from Artichoke Byproducts in Sardinia, Italy

    OpenAIRE

    Fabio Menna; Remo Alessio Malagnino; Matteo Vittuari; Giovanni Molari; Giovanna Seddaiu; Paola A. Deligios; Stefania Solinas; Luigi Ledda

    2016-01-01

    The paper aims at evaluating the potential biogas production, both in terms of CH4 and theoretical energy potential, from globe artichoke agricultural byproducts in Sardinia. Field data about the productivity of byproducts were collected on five artichoke varieties cultivated in Sardinia, to assess the biomethane production of their aboveground non-food parts (excluding the head). Moreover, secondary data from previous studies and surveys at regional scale were collected to evaluate the poten...

  1. Valorization of artichoke wastewaters by integrated membrane process

    OpenAIRE

    Conidi, Carmela; Cassanno, A.; García Castelló, Esperanza María

    2014-01-01

    In this work an integrated membrane system was developed on laboratory scale to fractionate artichoke wastewaters. In particular, a preliminary ultrafiltration (UF) step, based on the use of hollow fibre membranes, was investigated to remove suspended solids from an artichoke extract. The clarified solution was then submitted to a nanofiltration (NF) step. Two different 2.5 × 21 in. spiral-wound membranes (Desal DL and NP030) with different properties were investigated. Both membranes showed ...

  2. Artichoke and Cynar liqueur: two (not quite) entangled proteomes.

    Science.gov (United States)

    Saez, Vicente; Fasoli, Elisa; D'Amato, Alfonsina; Simó-Alfonso, Ernesto; Righetti, Pier Giorgio

    2013-01-01

    Combinatorial peptide ligand libraries (CPLLs) have been adopted to investigate the proteome of artichoke extracts, of a home-made alcoholic infusion and of the Italian Cynar liqueur. The aim of study was not only to perform the deepest investigation so far of the artichoke proteome but also to assess the genuineness of the commercial aperitif via a three-pronged attack. First, different extraction techniques have been used for the characterization of the artichoke's proteome, secondly a home-made infusion has been analyzed and finally the proteome of the commercial drink was checked. The artichoke proteome has been evaluated via prior capture with CPLLs at four different pH (2.2, 4.0, 7.2 and 9.3) values. Via mass spectrometry analysis of the recovered fractions, after elution of the captured populations in 4% boiling SDS, we could identify a total of 876 unique gene products in the artichoke extracts, 18 in the home-made infusion and no proteins at all in the Italian Cynar liqueur, casting severe doubts on the procedure stated by the manufacturer (that should be made by an infusion of artichoke leaves plus thirteen different herbs). This could be the starting point for investigating the genuineness and natural origin of commercial drinks in order to protect consumers from adulterated products. PMID:22968169

  3. Databases

    Directory of Open Access Journals (Sweden)

    Nick Ryan

    2004-01-01

    Full Text Available Databases are deeply embedded in archaeology, underpinning and supporting many aspects of the subject. However, as well as providing a means for storing, retrieving and modifying data, databases themselves must be a result of a detailed analysis and design process. This article looks at this process, and shows how the characteristics of data models affect the process of database design and implementation. The impact of the Internet on the development of databases is examined, and the article concludes with a discussion of a range of issues associated with the recording and management of archaeological data.

  4. Optimization of pectin extraction and antioxidant activities from Jerusalem artichoke

    Science.gov (United States)

    Liu, Shengyi; Shi, Xuejie; Xu, Lanlan; Yi, Yuetao

    2016-03-01

    Jerusalem artichoke is an economic crop widely planted in saline-alkaline soil. The use of Jerusalem artichoke is of great significance. In this study, the response surface method was employed to optimize the effects of processing variables (extraction temperature, pH, extraction time, and liquid-to-solid ratio) on the yield of Jerusalem artichoke pectin. Under the optimal extraction conditions: pH 1.52, 63.62 min, 100°C and a liquid-to-solid ratio of 44.4 mL/g, the maximum pectin yield was predicted to be 18.76%. Experiments were conducted under these optimal conditions and a pectin yield of 18.52±0.90% was obtained, which validated the model prediction. The effects of diff erent drying methods (freeze drying, spray drying and vacuum drying) on the properties of Jerusalem artichoke pectin were evaluated and they were compared with apple pectin. FTIR spectral analysis showed no major structural diff erences in Jerusalem artichoke pectin samples produced by various drying treatments. The antioxidant activities of pectin dried by diff erent methods were investigated using in vitro hydroxyl and DPPH radical scavenging systems. The results revealed that the activities of spray dried pectin (SDP) and apple pectin (AP) were stronger than those of vacuum oven dried pectin (ODP) and vacuum freeze dried pectin (FDP). Therefore compared with the other two drying methods, the spray drying method was the best.

  5. Biodiesel production from yeast Cryptococcus sp. using Jerusalem artichoke.

    Science.gov (United States)

    Sung, Mina; Seo, Yeong Hwan; Han, Shin; Han, Jong-In

    2014-03-01

    Jerusalem artichoke was investigated as a cheap substrate for the heterotrophic production using a lab yeast strain Cryptococcus sp. Using Response Surface Method, 54.0% of fructose yield was achieved at 12% of dried Jerusalem artichoke powder, 0.57% of nitric acid concentration, 117°C of reaction temperature, and 49min of reaction time. At this optimal condition, nitric acid showed the best catalytic activity toward inulin hydrolysis and also the resulting fructose hydrolyte supported the highest microbial growth compared with other acids. In addition, lipid productivity of 1.73g/L/d was achieved, which is higher than a defined medium using pure fructose as a substrate. Lipid quality was also found to be generally satisfactory as a feedstock for fuel, demonstrating Jerusalem artichoke could indeed be a good and cheap option for the purpose of biodiesel production. PMID:24434697

  6. BlastX Result : Swiss-Prot - AcEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search ... Image Search ... Home About Archive Update History Contact us AcEST BlastX ... Description of data contents Results of the blastx search ... of Adiantum capillus-veneris EST (AcEST) sequences ... t/LATEST/blasthits_sp.zip File size: 7.77MB Simple search ... URL http://togodb.biosciencedbc.jp/togodb/view/arc ...

  7. BlastX Result : TrEMBL - AcEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search ... Image Search ... Home About Archive Update History Contact us AcEST BlastX ... Description of data contents Results of the blastx search ... of Adiantum capillus-veneris EST (AcEST) sequences ... t/LATEST/blasthits_tr.zip File size: 7.03MB Simple search ... URL http://togodb.biosciencedbc.jp/togodb/view/arc ...

  8. Potential Biogas Production from Artichoke Byproducts in Sardinia, Italy

    Directory of Open Access Journals (Sweden)

    Fabio De Menna

    2016-02-01

    Full Text Available The paper aims at evaluating the potential biogas production, both in terms of CH4 and theoretical energy potential, from globe artichoke agricultural byproducts in Sardinia. Field data about the productivity of byproducts were collected on five artichoke varieties cultivated in Sardinia, to assess the biomethane production of their aboveground non-food parts (excluding the head. Moreover, secondary data from previous studies and surveys at regional scale were collected to evaluate the potential biogas production of the different districts. Fresh globe artichoke residues yielded, on average, 292.2 Nm3·tDOM−1, with dissimilarities among cultivars. Fresh samples were analyzed in two series: (a wet basis; and (b wet basis with catalytic enzymes application. Enzymes proved to have some beneficial effects in terms of anticipated biomethane availability. At the regional level, ab. 20 × 106 Nm3 CH4 could be produced, corresponding to the 60% of current installed capacity. However, districts potentials show some differences, depending on the specific biomass partitioning and on the productivity of cultivated varieties. Regional assessments should encompass the sensitiveness of results to agro-economic variables and the economic impacts of globe artichoke residue use in the current regional biogas sector.

  9. New Polylactic Acid Composites Reinforced with Artichoke Fibers

    Directory of Open Access Journals (Sweden)

    Luigi Botta

    2015-11-01

    Full Text Available In this work, artichoke fibers were used for the first time to prepare poly(lactic acid (PLA-based biocomposites. In particular, two PLA/artichoke composites with the same fiber loading (10% w/w were prepared by the film-stacking method: the first one (UNID reinforced with unidirectional long artichoke fibers, the second one (RANDOM reinforced by randomly-oriented long artichoke fibers. Both composites were mechanically characterized in tensile mode by quasi-static and dynamic mechanical tests. The morphology of the fracture surfaces was analyzed through scanning electron microscopy (SEM. Moreover, a theoretical model, i.e., Hill’s method, was used to fit the experimental Young’s modulus of the biocomposites. The quasi-static tensile tests revealed that the modulus of UNID composites is significantly higher than that of the neat PLA (i.e., ~40%. Moreover, the tensile strength is slightly higher than that of the neat matrix. The other way around, the stiffness of RANDOM composites is not significantly improved, and the tensile strength decreases in comparison to the neat PLA.

  10. Analysis of expressed sequence tags from Actinidia: applications of a cross species EST database for gene discovery in the areas of flavor, health, color and ripening

    Directory of Open Access Journals (Sweden)

    Richardson Annette C

    2008-07-01

    Full Text Available Abstract Background Kiwifruit (Actinidia spp. are a relatively new, but economically important crop grown in many different parts of the world. Commercial success is driven by the development of new cultivars with novel consumer traits including flavor, appearance, healthful components and convenience. To increase our understanding of the genetic diversity and gene-based control of these key traits in Actinidia, we have produced a collection of 132,577 expressed sequence tags (ESTs. Results The ESTs were derived mainly from four Actinidia species (A. chinensis, A. deliciosa, A. arguta and A. eriantha and fell into 41,858 non redundant clusters (18,070 tentative consensus sequences and 23,788 EST singletons. Analysis of flavor and fragrance-related gene families (acyltransferases and carboxylesterases and pathways (terpenoid biosynthesis is presented in comparison with a chemical analysis of the compounds present in Actinidia including esters, acids, alcohols and terpenes. ESTs are identified for most genes in color pathways controlling chlorophyll degradation and carotenoid biosynthesis. In the health area, data are presented on the ESTs involved in ascorbic acid and quinic acid biosynthesis showing not only that genes for many of the steps in these pathways are represented in the database, but that genes encoding some critical steps are absent. In the convenience area, genes related to different stages of fruit softening are identified. Conclusion This large EST resource will allow researchers to undertake the tremendous challenge of understanding the molecular basis of genetic diversity in the Actinidia genus as well as provide an EST resource for comparative fruit genomics. The various bioinformatics analyses we have undertaken demonstrates the extent of coverage of ESTs for genes encoding different biochemical pathways in Actinidia.

  11. Dynamics of flowering of artichoke globe (Cynara scolymus L.) plants in depending on cultivation method

    OpenAIRE

    Andrzej Sałata

    2012-01-01

    The study was carried out in the years 2001-2002 in the Felin Research Center in Lublin. The differences in growth dynamics and morphology of flowering shoots were investigated with regards to a method of cultivation of artichoke. In the year 2001 flowering shoots and flowers occurred the earliest in the year 2001 on artichoke plants cultivated from crowns. In the year 2002 plants cultivated from crowns and transplants produced flowering shoots in the same time. Artichoke plants cultivated fr...

  12. Generation of a predicted protein database from EST data and application to iTRAQ analyses in grape (Vitis vinifera cv. Cabernet Sauvignon berries at ripening initiation

    Directory of Open Access Journals (Sweden)

    Smith Derek

    2009-01-01

    Full Text Available Abstract Background iTRAQ is a proteomics technique that uses isobaric tags for relative and absolute quantitation of tryptic peptides. In proteomics experiments, the detection and high confidence annotation of proteins and the significance of corresponding expression differences can depend on the quality and the species specificity of the tryptic peptide map database used for analysis of the data. For species for which finished genome sequence data are not available, identification of proteins relies on similarity to proteins from other species using comprehensive peptide map databases such as the MSDB. Results We were interested in characterizing ripening initiation ('veraison' in grape berries at the protein level in order to better define the molecular control of this important process for grape growers and wine makers. We developed a bioinformatic pipeline for processing EST data in order to produce a predicted tryptic peptide database specifically targeted to the wine grape cultivar, Vitis vinifera cv. Cabernet Sauvignon, and lacking truncated N- and C-terminal fragments. By searching iTRAQ MS/MS data generated from berry exocarp and mesocarp samples at ripening initiation, we determined that implementation of the custom database afforded a large improvement in high confidence peptide annotation in comparison to the MSDB. We used iTRAQ MS/MS in conjunction with custom peptide db searches to quantitatively characterize several important pathway components for berry ripening previously described at the transcriptional level and confirmed expression patterns for these at the protein level. Conclusion We determined that a predicted peptide database for MS/MS applications can be derived from EST data using advanced clustering and trimming approaches and successfully implemented for quantitative proteome profiling. Quantitative shotgun proteome profiling holds great promise for characterizing biological processes such as fruit ripening

  13. Analysis of EST database for two subspecies of largemouth bass%大口黑鲈两个亚种EST数据库分析

    Institute of Scientific and Technical Information of China (English)

    景燕娟; 白俊杰; 李胜杰; 于凌云; 蔡磊

    2012-01-01

    应用新一代高通量测序技术Roche 454对大口黑鲈(Micropterus salmoides)北方亚种和佛罗里达亚种进行转录组测序并建立ESTs数据库,结果得到北方亚种ESTs序列468 671条,佛罗里达亚种ESTs序列332 322条,两亚种ESTs序列的平均长度分别为306.5bp和304.4bp。将得到的高质量序列进行拼接,大口黑鲈北方亚种和佛罗里达亚种共得到contig序列总数分别为42 056条和35 743条,平均长度分别为612.6bp和588.2bp。将大口黑鲈北方亚种和佛罗里达亚种的数据库合并,通过与蛋白数据库比对后,共78 938条EST序列被注释,根据Gene Ontology(GO)信息,对序列按照分子功能、细胞组成、生物学过程进行分类。通过对大口黑鲈合并的EST库信息进行大通量SSR和SNP位点的发掘,发现了含SSRs和SNPs的序列分别为25 469和8 547条。从EST数据库中随机选取75条contigs进行北方亚种和佛罗里达亚种的序列比较,结果表明两个亚种EST序列同源性为99.2%。%In this study,Roche 454 high-throughput technology was used to conduct transcriptome sequencing and establish ESTs database of the largemouth bass northern subspecies and Florida subspecies.The results showed that a total of 468 671 and 332 322 ESTs were generated from northern subspecies and Florida subspecies.The average length was 306.5 bp and 304.4 bp,respectively.Assembly of the largemouth bass northern subspecies and Florida subspecies' high quality ESTs resulted in 42 056 and 35 743 contigs.The average length was 612.6 bp and 588.2 bp,respectively.EST database of largemouth bass northern subspecies and Florida subspecies was merged and then compared with known protein databases.78 938 EST sequences in total were annotated.By exploring the merged largemouth bass EST library,over 25 469 and 8 547 putative SSRs and SNPs were identified.Comparison of the northern subspecies and Florida subspecies sequence was made by randomly selecting 75 contigs from

  14. The Possible Efficacy of Artichoke in Fluconazole Related Hepatotoxicity

    Directory of Open Access Journals (Sweden)

    Hüseyin Kurt

    2014-01-01

    Full Text Available Although fluconazole related hepatotoxicity (FRH is rare, mortal acute hepatic necrosis and jaundice were reported in immunocompromised states such as acquired immunodeficiency syndrome (AIDS and bone marrow transplant (BMT. We present a case of a patient with multiple sclerosis who developed hepatotoxicity with the use of a single 150 mg fluconazole tablet for fungal vaginitis, 10 days after methylprednisolone pulse treatment. Our patient’s alanine aminotransferase (ALT and aspartate aminotransferase (AST levels were decreased, 1200 U/L and 800 U/L, respectively, and bilirubin levels were consistent at 37 mg/dL. Artichoke which has anticholestatic and antioxidant properties was used by our patient. She consumed a 30 mg artichoke leaf extract tea 3 times a day. The bilirubin levels significantly declined at the end of the first week and all liver function tests were normalized within 2 months.

  15. Exploiting EST databases for the mining and characterization of short sequence repeat (SSR) markers in Catharanthus roseus L.

    OpenAIRE

    Joshi, Raj Kumar; Kar, Basudeba; Nayak, Sanghamitra

    2011-01-01

    Periwinkle (Catharanthus roseus L.) (Family: Apocyanaceae) is a ornamental plants with great medicinal properties. Although it is represented by seven species, little work has been carried out on its genetic characterization due to non-availability of reliable molecular markers. Simple sequence repeats (SSRs) have been widely applied as molecular markers in genetic studies. With the rapid increase in the deposition of nucleotide sequences in the public databases and advent of bioinformatics t...

  16. Accumulation of cynaropicrin in globe artichoke and localization ofenzymes involved in its biosynthesis

    NARCIS (Netherlands)

    Eljounaidi, K.; Comino, C.; Moglia, A.; Cankar, K.; Genre, A.; Hehn, A.; Bourgaud, F.; Beekwilder, J.; Lanteri, S.

    2015-01-01

    Globe artichoke (Cynara cardunculus var. scolymus) belongs to the Asteraceae family, in which one ofthe most biologically significant class of secondary metabolites are sesquiterpene lactones (STLs). Inglobe artichoke the principal STL is the cynaropicrin, which contributes to approximately 80% of i

  17. Influence of planting date and temperature on inulin content in Jerusalem Artichoke (Helianthus tuberosus L.)

    Science.gov (United States)

    Lower temperatures during the dry season in tropical regions might affect inulin content and inulin yield of Jerusalem artichoke. The objective of this study was to determine the effect of planting dates during low temperature on inulin yield and content of Jerusalem artichoke. Two pot experiments...

  18. Isolation of a polyphenol oxidase (PPO) cDNA from artichoke and expression analysis in wounded artichoke heads.

    Science.gov (United States)

    Quarta, Angela; Mita, Giovanni; Durante, Miriana; Arlorio, Marco; De Paolis, Angelo

    2013-07-01

    The polyphenol oxidase (PPO) enzyme, which can catalyze the oxidation of phenolics to quinones, has been reported to be involved in undesirable browning in many plant foods. This phenomenon is particularly severe in artichoke heads wounded during the manufacturing process. A full-length cDNA encoding for a putative polyphenol oxidase (designated as CsPPO) along with a 1432 bp sequence upstream of the starting ATG codon was characterized for the first time from [Cynara cardunculus var. scolymus (L.) Fiori]. The 1764 bp CsPPO sequence encodes a putative protein of 587 amino acids with a calculated molecular mass of 65,327 Da and an isoelectric point of 5.50. Analysis of the promoter region revealed the presence of cis-acting elements, some of which are putatively involved in the response to light and wounds. Expression analysis of the gene in wounded capitula indicated that CsPPO was significantly induced after 48 h, even though the browning process had started earlier. This suggests that the early browning event observed in artichoke heads was not directly related to de novo mRNA synthesis. Finally, we provide the complete gene sequence encoding for polyphenol oxidase and the upstream regulative region in artichoke. PMID:23628925

  19. Annotation of novel neuropeptide precursors in the migratory locust based on transcript screening of a public EST database and mass spectrometry

    Directory of Open Access Journals (Sweden)

    De Loof Arnold

    2006-08-01

    Full Text Available Abstract Background For holometabolous insects there has been an explosion of proteomic and peptidomic information thanks to large genome sequencing projects. Heterometabolous insects, although comprising many important species, have been far less studied. The migratory locust Locusta migratoria, a heterometabolous insect, is one of the most infamous agricultural pests. They undergo a well-known and profound phase transition from the relatively harmless solitary form to a ferocious gregarious form. The underlying regulatory mechanisms of this phase transition are not fully understood, but it is undoubtedly that neuropeptides are involved. However, neuropeptide research in locusts is hampered by the absence of genomic information. Results Recently, EST (Expressed Sequence Tag databases from Locusta migratoria were constructed. Using bioinformatical tools, we searched these EST databases specifically for neuropeptide precursors. Based on known locust neuropeptide sequences, we confirmed the sequence of several previously identified neuropeptide precursors (i.e. pacifastin-related peptides, which consolidated our method. In addition, we found two novel neuroparsin precursors and annotated the hitherto unknown tachykinin precursor. Besides one of the known tachykinin peptides, this EST contained an additional tachykinin-like sequence. Using neuropeptide precursors from Drosophila melanogaster as a query, we succeeded in annotating the Locusta neuropeptide F, allatostatin-C and ecdysis-triggering hormone precursor, which until now had not been identified in locusts or in any other heterometabolous insect. For the tachykinin precursor, the ecdysis-triggering hormone precursor and the allatostatin-C precursor, translation of the predicted neuropeptides in neural tissues was confirmed with mass spectrometric techniques. Conclusion In this study we describe the annotation of 6 novel neuropeptide precursors and the neuropeptides they encode from the

  20. Influence of sugars on the dry-weight increase of gamma irradiated Jerusalem artichoke tuber's tissue

    International Nuclear Information System (INIS)

    Jerusalem artichoke tuber's explants after a γ irradiation of 6000 rads couldn't proliferate in a growth medium containing glucose and indolyl acetic acid; their dry weight is increased by an accumulation of sugars

  1. Sensory quality and appropriateness of raw and boiled Jerusalem artichoke tubers (Helianthus tuberosus L.)

    DEFF Research Database (Denmark)

    Bach, Vibe; Kidmose, Ulla; Thybo, Anette;

    2013-01-01

    BACKGROUND: The aim of the present study was to investigate the sensory attributes, dry matter and sugar content of five varieties of Jerusalem artichoke tubers and their relation to the appropriateness of the tubers for raw and boiled preparation. RESULTS: Sensory evaluation of raw and boiled...... Jerusalem artichoke tubers was performed by a trained sensory panel and a semi-trained consumer panel of 49 participants, who also evaluated the appropriateness of the tubers for raw and boiled preparation. The appropriateness of raw Jerusalem artichoke tubers was related to Jerusalem artichoke flavour......, green nut flavour, sweetness and colour intensity, whereas the appropriateness of boiled tubers was related to celeriac aroma, sweet aroma, sweetness and colour intensity. In both preparations the variety Dwarf stood out from the others by being the least appropriate tuber. CONCLUSION: A few sensory...

  2. Effects of Prickly Pear Dried Leaves, Artichoke Leaves, Turmeric and Garlic Extracts, and Their Combinations on Preventing Dyslipidemia in Rats

    OpenAIRE

    Qinna, Nidal A.; Basma S. Kamona; Alhussainy, Tawfiq M.; Hashem Taha; Badwan, Adnan A.; Matalka, Khalid Z.

    2012-01-01

    The successful use of herbal combinations in managing diseases or conditions over a single herb has lead us to evaluate the anti-dyslipidemic properties of the combination of the artichoke leaves extract, turmeric extract, prickly pear dried leaves (PPL) and garlic extract versus each one alone in two different hyperlipidemic animal models. A two-week treatment of each of the natural extracts, combination 1 (artichoke, turmeric and PPL) or combination 2 (artichoke, turmeric, PPL and garlic) p...

  3. The prospects of Jerusalem artichoke in functional food ingredients and bioenergy production

    OpenAIRE

    Linxi Yang; Quan Sophia He; Kenneth Corscadden; Udenigwe, Chibuike C.

    2015-01-01

    Jerusalem artichoke, a native plant to North America has recently been recognized as a promising biomass for bioeconomy development, with a number of advantages over conventional crops such as low input cultivation, high crop yield, wide adaptation to climatic and soil conditions and strong resistance to pests and plant diseases. A variety of bioproducts can be derived from Jerusalem artichoke, including inulin, fructose, natural fungicides, antioxidant and bioethanol. This paper provides an ...

  4. A Shortcut to the Production of High Ethanol Concentration from Jerusalem Artichoke Tubers

    OpenAIRE

    Ge, Xiang-Yang; Zhang, Wei-Guo

    2005-01-01

    Aspergillus niger SL-09, a newly isolated exoinulinase-hyperproducing strain, and Saccharomyces cerevisiae Z-06, with high ethanol tolerance, were used in a fed-batch process for simultaneous saccharification and fermentation of Jerusalem artichoke tuber mash and flour. S. cerevisiae Z-06 utilized 98 % of the total sugar and produced 19.6 % of ethanol in 48 h. In this process the conversion efficiency of the fermentation of Jerusalem artichoke and the production of ethanol were 90 % of the th...

  5. In vitro antioxidant activities of edible artichoke (Cynara scolymus L.) and effect on biomarkers of antioxidants in rats

    DEFF Research Database (Denmark)

    Jimenez-Escrig, A.; Dragsted, Lars Ove; Daneshvar, Bahram;

    2003-01-01

    Artichoke (Cynara scolymus L.), an edible vegetable from the Mediterranean area, is a good source of natural antioxidants such as vitamin C, hydroxycinnamic acids, and flavones. The antioxidant activity of aqueous-organic extracts of artichoke were determined using three methods: (a) free radical 2......,2-diphenyl-1-picrylhydrazyl (DPPH.) scavenging, (b) ferric-reducing antioxidant power (FRAP), and...

  6. Kombucha fermentation on raw extracts of different cultivars of Jerusalem artichoke

    Directory of Open Access Journals (Sweden)

    Lončar Eva S.

    2007-01-01

    Full Text Available Kombucha is a symbiosis between yeasts and acetic bacteria. It usually grows on sweetened black tea, but cultivation is possible on many other substrates. Jerusalem artichoke tubers extract is one of them. Tubers are suitable for the dietetic nutrition because of the low monosaccharide content and presence of some polyfructan ingredients which act as prebiotic. Five different cultivars of Jerusalem artichoke were used for the preparation of substrates for kombucha fermentation. The aim of this paper was the investigation of the influence of different Jerusalem artichoke cultivars on metabolic activity of kombucha. Composition of carbohydrates was followed using thin-layer chromatography and pH, reducing sugars content and yield of biomass were measured. Most of the samples with Jerusalem artichoke tubers extract contained fructose, probably small amount of glucose, fructo-oligosaccharides with different degree of polymerization and, inulin. Considering TLC chromatograms, Jerusalem artichoke cultivar did not affect significantly the composition of oligosaccharides in the fermentative liquid, as only minor differences were observed.

  7. Characterization and differential expression analysis of artichoke phenylalanine ammonia-lyase-coding sequences.

    Science.gov (United States)

    De Paolis, Angelo; Pignone, Domenico; Morgese, Anita; Sonnante, Gabriella

    2008-01-01

    Sequences encoding phenylalanine ammonia-lyase were isolated from artichoke, by using a sequence homology strategy, by screening a genomic library and by 3'-rapid amplification of cDNA end (RACE) technology. These analyses and Southern blots suggested that, in artichoke, phenylalanine ammonia-lyase (PAL) is encoded by a small gene family. The sequences isolated from genomic DNA possess two exons and one intron at the conserved position as in most plant pal characterized to date. The 3'-RACE analysis also indicated that each member of the artichoke pal gene family was present as a pool of transcripts, different in the length of 3'-untranslated region. The deduced amino acid sequences were highly similar to those of PAL from lettuce and sunflower. One of the artichoke pal genes was completely sequenced, and its 5' upstream region contained TATA, CAAT box and cis regulatory elements identified in other phenylpropanoid pathway genes as playing a role in UV and elicitor induction. The expression of three of the identified artichoke pal sequences was evaluated in different plant parts, in developmental stages and after wounding, using gene-specific primers/probe combinations in real-time polymerase chain reaction assays. The three putative genes were differentially expressed in the plant parts analysed and were developmentally regulated. Moreover, after leaf mechanical injury, all of them were differentially regulated. The possible involvement of the single pal genes in different physiological processes is discussed. PMID:18251868

  8. Construction and application of an electronic spatiotemporal expression profile and gene ontology analysis platform based on the EST database of the silkworm, Bombyx mori.

    Science.gov (United States)

    Gan, Li-Ping; Zhang, Wen-Yu; Niu, Yan-Shan; Xu, Li; Xi, Jian; Ji, Ming-Ming; Xu, Shi-Qing

    2010-01-01

    An Expressed Sequence Tag (EST) is a short sub-sequence of a transcribed cDNA sequence. ESTs represent gene expression and give good clues for gene expression analysis. Based on EST data obtained from NCBI, an EST analysis package was developed (apEST). This tool was programmed for electronic expression, protein annotation and Gene Ontology (GO) category analysis in Bombyx mori (L.) (Lepidoptera: Bombycidae). A total of 245,761 ESTs (as of 01 July 2009) were searched and downloaded in FASTA format, from which information for tissue type, development stage, sex and strain were extracted, classified and summed by running apEST. Then, corresponding distribution profiles were formed after redundant parts had been removed. Gene expression profiles for one tissue of different developmental stages and from one development stage of the different tissues were attained. A housekeeping gene and tissue-and-stage-specific genes were selected by running apEST, contrasting with two other online analysis approaches, microarray-based gene expression profile on SilkDB (BmMDB) and EST profile on NCBI. A spatio-temporal expression profile of catalase run by apEST was then presented as a three-dimensional graph for the intuitive visualization of patterns. A total of 37 query genes confirmed from microarray data and RT-PCR experiments were selected as queries to test apEST. The results had great conformity among three approaches. Nevertheless, there were minor differences between apEST and BmMDB because of the unique items investigated. Therefore, complementary analysis was proposed. Application of apEST also led to the acquisition of corresponding protein annotations for EST datasets and eventually for their functions. The results were presented according to statistical information on protein annotation and Gene Ontology (GO) category. These all verified the reliability of apEST and the operability of this platform. The apEST can also be applied in other species by modifying some

  9. Study on exploitation of Jerusalem artichoke bulbs in relation to chemical composition

    Directory of Open Access Journals (Sweden)

    Sorina Ropciuc

    2014-11-01

    Full Text Available Abstract Jerusalem artichoke (Helianthus tuberosus L. known in USA also as sunchoke, is a perennial plant, well-adapted to humid and cold climats, nonpretencious to soil and with good yield increase. The bulbs are the eatable part that grows in the ground that have certain similitudes with the potato. The value of Jerusalem artichoke as a technical and medical vegetable is based on the chemical composition of the plant. The bulbs of the Jerusalem artichoke harvested in autumn have been sensorially and chemically analyzed along the deposition during the cold season. Measurements were made on the light brown variety with a slightly elongated shape. The low mass loss during depostion, the high content of reducing sugar (4.7- 6.12% and total carbohydrates (94.27-96.18% enable their successful use in the functional food and for the production of alcohol.

  10. Cadmium Accumulation and Translocation in Two Jerusalem Artichoke (Helianthus tuberosus L.) Cultivars

    Institute of Scientific and Technical Information of China (English)

    CHEN Liang; LONG Xiao-Hua; ZHANG Zhen-Hua; ZHENG Xiao-Tao; Z. RENGEL; LIU Zhao-Pu

    2011-01-01

    Jerusalem artichoke (Helianthus tuberosus L.) not just can be used for bioethanol production but may be potentially used in phytoremediation for the removal of heavy metal pollutants.Two Jerusalem artichoke cultivars,N2 and N5,were subjected to six cadmium (Cd) concentrations (0,5,25,50,100 and 200 mg L-1) to investigate Cd tolerance and accumulation.After 21 days of growth,the effects of Cd on growth,chlorophyll content,net photosynthetic rate,intercellular CO2 concentration and malondialdehyde content were evaluated.Most growth parameters were reduced under Cd stress.The two Jerusalem artichoke cultivars had relatively high Cd tolerance and accumulation capacity (> 100 mg kg-1),with N5 being more tolerant and having higher Cd accumulation than N2.Roots accumulated more Cd than stems and leaves.The bioconcentration factors (far higher than 1) and translocation factors (lower than 1) decreased with an increase in Cd applied.The results suggested that Jerusalem artichoke could be grown at relatively high Cd loads,and N5 could be an excellent candidate for phytoremediation of Cd-contaminated soils.

  11. Growth and yield performance of Jerusalem artichoke clones in a semiarid region of China

    NARCIS (Netherlands)

    Liu, Z.X.; Spiertz, J.H.J.; Sha, J.; Xue, S.; Xie, G.H.

    2012-01-01

    This study investigated biomass yield and growth characteristics of 26 Jerusalem artichoke (Helianthus tuberosus L.) clones and assessed it as a bioenergy crop for a semiarid region of the Loess Plateau in China. Genotype, year, and genotype ´ year interaction contributed to differences in crop deve

  12. CHANGE OF INULIN IN THE TUBERS OF JERUSALEM ARTICHOKE AT STORAGE

    Directory of Open Access Journals (Sweden)

    Nazarenko M. N.

    2013-12-01

    Full Text Available This article examines the change of the mass fraction of inulin in Jerusalem artichoke tubers during storage under different conditions. The influence of temperature, storage time and variety features on the content of inulin have been shown. The terms and conditions of storage of raw materials before processing have been set.

  13. Design and Simulation of Two Robotic Systems for Automatic Artichoke Harvesting

    Directory of Open Access Journals (Sweden)

    Domenico Longo

    2013-12-01

    Full Text Available The target of this research project was a feasibility study for the development of a robot for automatic or semi-automatic artichoke harvesting. During this project, different solutions for the mechanical parts of the machine, its control system and the harvesting tools were investigated. Moreover, in cooperation with the department DISPA of University of Catania, different field structures with different kinds of artichoke cultivars were studied and tested. The results of this research could improve artichoke production for preserves industries. As a first step, an investigation on existing machines has been done. From this research, it has been shown that very few machines exist for this purpose. Based also on previous experiences, some proposals for different robotic systems have been done, while the mobile platform itself was developed within another research project. At the current stage, several different configurations of machines and harvesting end-effectors have been designed and simulated using a 3D CAD environment interfaced with Matlab®. Moreover, as support for one of the proposed machines, an artificial vision algorithm has been developed in order to locate the artichokes on the plant, with respect to the robot, using images taken with a standard webcam.

  14. El potencial del topinambur en la salud y la nutrición The potential of Jerusalem Artichokes in health and nutrition

    Directory of Open Access Journals (Sweden)

    D Scollo

    2011-12-01

    Full Text Available Introducción: El topinambur es un tubérculo con alto contenido en inulina. La inulina es un carbohidrato soluble no digerible que está presente en muchos vegetales, frutas y cereales siendo usada ampliamente como ingrediente en alimentos funcionales. Objetivo: Obtener tubérculos de topinambur, fijar distintos parámetros de extracción de inulina y preparar diversos alimentos, reemplazando parte de las harinas tradicionales por harina de topinambur. Se propuso, además, evaluar la preferencia de los consumidores sobre los mismos. Material y métodos: Se sembraron y cosecharon tubérculos de topinambur partiendo de 4 parcelas con diferentes condiciones de riego y fertilización. Los mismos se conservaron a variadas temperaturas. Se determinó el contenido de inulina por HPLC y se realizó la extracción de la misma de los tubérculos. A partir de los tubérculos cosechados en la parcela 3 se elaboraron harinas que fueron utilizadas para reemplazar parcialmente a la harina de trigo en la preparación de diferentes productos alimenticios. Sobre los mismos se realizó una evaluación de preferencia. Resultados: El rinde de la cosecha fue mayor en la parcela 3 (tierra fértil y riego según necesidades, 91 ton/Ha. El método de conservación más adecuado fue el frío, sin embargo no se utilizaron estos tubérculos para la extracción de inulina. Los productos alimenticios obtenidos fueron considerados adecuados por los jueces intervinientes. Conclusiones: la elaboración de productos alimenticios a partir de harina de topinambur podría ser una alternativa de alimento funcional por su contenido de inulina.Introduction: The Jerusalem artichoke Is a tuber high in inulin. Inulin is a soluble non-digestible carbohydrate that is present in many vegetables, fruits and cereals and is widely used as an ingredient in functional foods. Objective: To get Jerusalem artichoke tubers, set various parameters for extraction of inulin and prepare various foods

  15. EST sequences and their annotation (amino acid sequence and results of homology search) - Dicty_cDB | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available lone covering full-length ORF provided by the National BioResource Project ( http://www.nbrp.jp/ ). The...ein Coding Gene in dictyBase ( http://dictybase.org/ ). The link to dictyBase is provided in the...Dicty_cDB EST sequences and their annotation (amino acid sequence and results of homology search) Data detai...l Data name EST sequences and their annotation (amino acid sequence and results of homology search) Descript...ion of data contents Sequences of cDNA clones of Dictyostelium discoideum and the

  16. Variation of Phenolic Content in Globe Artichoke in Relation to Biological, Technical and Environmental Factors

    Directory of Open Access Journals (Sweden)

    Giovanni Mauromicale

    2011-02-01

    Full Text Available In Italy, globe artichoke production is prevailingly concentrated in the South and islands, where it provides an important contribution to the agricultural economy. In recent years, there has been a renewed interest in this crop as a promising source of polyphenols, a heterogeneous class of secondary metabolites characterized by various healthy properties well-documented in literature. The phenolic fraction, present in the different artichoke plant parts, varies widely in relation to biotic and abiotic factors. Therefore, the present study aimed at evaluating the variation of phenolic content in globe artichoke in relation to biological, technical and environmental factors. Two field-experiments were carried out in Sicily (South Italy in two representative cultivation areas, in order to examine the effects of genotype, head fraction, season conditions, planting density and arrangement on the globe artichoke phenolic concentration. Both the total polyphenols and the individual phenolic compounds detected were notably genotype- dependent. Particularly, the high level of caffeoylquinic acids (chlorogenic acid, among others and apigenin 7- O-glucuronide, reported respectively by “Violetto di Sicilia” and “Romanesco clone C3”, could be used to encourage globe artichoke fresh consumption. Total polyphenols content also resulted more abundant in specific accumulation sites within the inflorescence, such as the floral stem and receptacle, and for most of genotypes it decreased during the second year in response to the different meteorological conditions. Additionally, total polyphenols content significantly and linearly increased as plant density increased from 1.0 to 1.8 plant m-2 and it significantly increased by 13% passing from single to twin rows plant arrangement.

  17. Synbiotic functional drink from Jerusalem artichoke juice fermented by probiotic Lactobacillus plantarum PCS26.

    Science.gov (United States)

    Dimitrovski, Darko; Velickova, Elena; Dimitrovska, Maja; Langerholc, Tomaz; Winkelhausen, Eleonora

    2016-01-01

    A probiotic strain Lactobacillus plantarum PCS26 was used to ferment Jerusalem artichoke juice. Growth kinetics of the bacterial strain was followed during juice fermentation both in flask and in laboratory fermentor. Jerusalem artichoke showed to be an excellent source of nutrients for L. plantarum PCS26 growth. The culture grew very well reaching more than 10(10) cfu/ml in just 12 h. The pH changed from the initial 6.5 to 4.6 at the end of fermentation. The culture hydrolyzed fructooligosaccharides present in the Jerusalem artichoke juice, yielding fructose which was presumably consumed along with the malic acid as energy and carbon source. Lactic acid was the main metabolite produced in concentration of 4.6 g/L. Acetic and succinic acid were also identified. Sensory evaluation of the fermented Jerusalem artichoke juice and its mixtures with blueberry juice showed that the 50/50 % v/v mixture would be very well accepted by the consumers. Above 80 % of the panelists would buy this drink, and over 60 % were willing to pay more for it. Culture survivability in the fermented juices during storage at 4-7 °C was assayed by the Weibullian model. The product shelf-life was extended from 19.70 ± 0.50 days of pure Jerusalem artichoke juice to 35.7 ± 6.4 days of the mixture containing 30 % blueberry juice. PMID:26787997

  18. Genetic relatedness of artichoke (Cynara scolymus L.) hybrids using random amplified polymorphic DNA (RAPD) fingerprinting.

    Science.gov (United States)

    Sharaf-Eldin, M A; Al-Tamimi, A; Alam, P; Elkholy, S F; Jordan, J R

    2015-01-01

    The artichoke (Cynara scolymus L.) is an important food and medicinal crop that is cultivated in Mediterranean countries. Morphological characteristics, such as head shape and diameter, leaf shape, and bract shape, are mainly affected by environmental conditions. A molecular marker approach was used to analyze the degree of polymorphism between artichoke hybrid lines. The degree of genetic difference among three artichoke hybrids was evaluated using random amplified polymorphic DNA-PCR (RAPD-PCR). In this study, the DNA fingerprints of three artichoke lines (A13-010, A11-018, and A12-179) were generated, and a total of 10 decamer primers were applied for RAPD-PCR analyses. Polymorphism  (16.66 to 62.50%) was identified using eight arbitrary decamers and total genomic DNA extracted from the hybrids. Of the 59 loci detected, there were 25 polymorphic and 34 monomorphic loci. Jaccard's similarity index (JSI) ranged between 1.0 and 0.84. Based on the unweighted pair group method with arithmetic mean (UPGMA) similarity matrix and dendrogram, the results indicated that two hybrids (A13-010 and A11-018) were closely related to each other, and the A12-179 line showed more divergence. When identifying correct accessions, consideration of the genetic variation and genetic relationships among the genotypes are required. The RAPD-PCR fingerprinting of artichoke lines clearly showed that it is possible to analyze the RAPD patterns for correlation between genetic means and differences or resemblance between close accessions (A13-010 and A11- 018) at the genomic level. PMID:26782491

  19. New method for determining sensory shelf life using fuzzy logic: canned marinated artichoke hearts (Cynara scolymus L.) case

    OpenAIRE

    Víctor Vásquez-Villalobos; Julia Vásquez Angulo; Eduardo Méndez Reyna

    2015-01-01

    The sensory preference (sp) and shelf life of sensory acceptability (SLSA) of canned artichoke hearts were modeled using fuzzy logic (FL) and accelerated testing. The artichoke hearts were marinated in oil of sacha inchi (Plukenetia volubilis), soybean (Glycine max) and olive (Olea europea); and evaluated using a Ranking test with a semi-trained panel, to identify the best preference both for flavor (f) and limpidity (l). We evaluated a global sp through intersection (AND) and union (OR) fuzz...

  20. In vitro antioxidant activities of edible artichoke (Cynara scolymus L.) and effect on biomarkers of antioxidants in rats.

    Science.gov (United States)

    Jiménez-Escrig, Antonio; Dragsted, Lars Ove; Daneshvar, Bahram; Pulido, Raquel; Saura-Calixto, Fulgencio

    2003-08-27

    Artichoke (Cynara scolymus L.), an edible vegetable from the Mediterranean area, is a good source of natural antioxidants such as vitamin C, hydroxycinnamic acids, and flavones. The antioxidant activity of aqueous-organic extracts of artichoke were determined using three methods: (a) free radical 2,2-diphenyl-1-picrylhydrazyl (DPPH(*)) scavenging, (b) ferric-reducing antioxidant power (FRAP), and (c) inhibition of copper(II)-catalyzed in vitro human low-density lipoprotein (LDL) oxidation. In addition, the present study was performed to investigate the ability of the edible portion of artichoke to alter in vivo antioxidative defense in male rats using selected biomarkers of antioxidant status. One gram (dry matter) had a DPPH(*) activity and a FRAP value in vitro equivalent to those of 29.2 and 62.6 mg of vitamin C and to those of 77.9 and 159 mg of vitamin E, respectively. Artichoke extracts showed good efficiency in the inhibition in vitro of LDL oxidation. Neither ferric-reducing ability nor 2,2'-azinobis(3-ethylbenzothiazolin-6-sulfonate) radical scavenging activity was modified in the plasma of the artichoke group with respect to the control group. Among different antioxidant enzymes measured (superoxide dismutase, gluthatione peroxidase, gluthatione reductase, and catalase) in erythrocytes, only gluthatione peroxidase activity was elevated in the artichoke group compared to the control group. 2-Aminoadipic semialdehyde, a protein oxidation biomarker, was decreased in plasma proteins and hemoglobin in the artichoke-fed group versus the control group. In conclusion, the in vitro protective activity of artichoke was confirmed in a rat model. PMID:12926911

  1. Transgenic potato (Solanum tuberosum) tubers synthesize the full spectrum of inulin molecules naturally occurring in globe artichoke (Cynara scolymus) roots

    OpenAIRE

    Hellwege, Elke M.; Czapla, Sylvia; Jahnke, Anuschka; Willmitzer, Lothar; HEYER, ARND G

    2000-01-01

    The ability to synthesize high molecular weight inulin was transferred to potato plants via constitutive expression of the 1-SST (sucrose:sucrose 1-fructosyltransferase) and the 1-FFT (fructan: fructan 1-fructosyltransferase) genes of globe artichoke (Cynara scolymus). The fructan pattern of tubers from transgenic potato plants represents the full spectrum of inulin molecules present in artichoke roots as shown by high-performance anion exchange chromatography, as well as size exclusion chrom...

  2. Effect of water regime and salinity on artichoke yield

    Directory of Open Access Journals (Sweden)

    Francesca Boari

    2012-03-01

    Full Text Available This work focuses on the effects of different salinity and water inputs on the yield of artichoke Violetto di Provenza. Two years of experimental works had been carried out in a site in Southern Italy characterized by semi-arid climate and deep loam soil. Three salinity levels of irrigation water (S0, S1 and S2 with electrical conductivity (ECw of 0.5, 5 and 10 dS m-1, respectively, were combined with three water regimes (W1, W2 and W3 corresponding in that order to 20 40 and 60% of available water depletion. The overall results of the salinity tolerance are in agreement with those from the literature. However, an higher tolerance to salinity was demonstrated when crop was watered more frequently (at 20% of available water depletion and a lower one when crop watering was performed less frequently (at 60% of available water depletion. The increase of salinity level reduced marketable yield (from 12.9 to 8.8 Mg ha-1, total heads (from 125,100 to 94,700 n ha-1 and heads mean weight (from 99.9 to 94.6 g, while increased heads dry matter (from 161.8 to 193.6 g kg-1 f.w. and reduced edible parte percentage of heads (from 35.2 to 33.2 %. Watering regimes, as average of the salinity levels, affected total heads marketable yield (115,350 n ha-1 and 11.4 Mg ha-1 for W1 and W2, 105,900 n ha-1 and 10 Mg ha-1 for W3. In addition, different watering regimes affected the secondary heads yield for which it was reduced by 3% of mean weight. The effect of different watering regimes changed with various salinity levels. In condition of moderate salinity (S1, maximum water depletion fraction to preserve heads number and weight yield was 40 and 20% of total soil available water, respectively. However, with high salinity (S2, maximum water depletion fraction to keep unchanged heads number and weight yield was 20% for both. The level of soil salinity at beginning of the crop cycle favoured the incidence of head atrophy in the main heads produced in the second year.

  3. More than multiple introductions: Multiple taxa contribute to the genesis of the invasive California's wild artichoke thistle

    Institute of Scientific and Technical Information of China (English)

    Janet LEAK-GARCIA; Jodie S.HOLT; Seung-Chul KIM; Lisa MU; José A.MEJ(I)AS; Norman C.ELLSTRAND

    2013-01-01

    The history of some invasive species is so complex that their origins can be difficult to determine.One example of such invasive species is the California invasive known as "wild artichoke thistle" (Cynara cardunculus var.sylvestris),found in natural and disturbed ecosystems.Wild artichoke thistle is a Mediterranean native and the progenitor of two domesticated horticultural taxa,artichoke and cardoon.Different hypotheses regarding the origins of California plants have included introductions by 19th century Italian immigrants and the de-domestication (evolutionary reversion to wild-type morphology) of feral (escaped,free-living) cultivars.Using microsatellite markers,we compared the genetic constitutions of 12 artichoke thistle populations in California with possible progenitor populations:17 Spanish and Italian wild populations and eight different artichoke and cardoon cultivars.Each California population was compared with its putative progenitors using STRUCTURE analysis.Our results suggest that California's artichoke thistle populations are polyphyletic.Surprisingly,two-thirds of California's populations closely matched populations from the Iberian Peninsula.Three populations matched domesticated artichoke.One population appears to have wild and cultivar hybrid ancestry.Alleles specific to Italian populations were found at low frequencies in some California plants,suggesting that Italian wild plants may have been in California,but have left a trivial genetic legacy.Given that the de-domesticated plants in this study appear to be as invasive as the wild taxon,we conclude with a discussion of the role that ferality and de-domestication may have in plant invasions.

  4. Soft Robotic Manipulation of Onions and Artichokes in the Food Industry

    OpenAIRE

    R Morales; F. J. Badesa; Garcia-Aracil, N.; Sabater, J. M.; Zollo, L.

    2014-01-01

    This paper presents the development of a robotic solution for a problem of fast manipulation and handling of onions or artichokes in the food industry. The complete solution consists of a parallel robotic manipulatior, a specially designed end-effector based on a customized vacuum suction cup, and a computer vision software developed for pick and place operations. First, the selection and design process of the proposed robotic solution to fit with the initial requeriments is presented, includ...

  5. Torrefaction of Yacon and Jerusalem Artichoke Stems as a Contribution to the Alternative Production of Inulin

    Czech Academy of Sciences Publication Activity Database

    Veselý, Václav; Sobek, Jiří; Hanika, Jiří; Punčochář, Miroslav

    Hoboken: John Wiley & Sons, 2013 - (Marquis, F.), s. 103-110 ISBN 978-0-470-94309-0. [Pacific Rim International Congress on Advanced Materials and Processing (PRICM-8) /8./. Waikoloa, Hawaii (US), 04.09.2013-09.09.2013] R&D Projects: GA TA ČR TE01020080; GA TA ČR TA02020369; GA TA ČR TA03020880 Institutional support: RVO:67985858 Keywords : torrefaction * yakon * jerusalem artichoke Subject RIV: CI - Industrial Chemistry, Chemical Engineering

  6. Quality of Jerusalem Artichoke (Helianthus tuberosus L.) Tubers in Relation to Storage Conditions

    OpenAIRE

    Honorata DANILČENKO; Elvyra JARIENE; Paulina ALEKNAVICIENE

    2008-01-01

    The influence of storage conditions on quality parameters of Jerusalem artichoke cv. 'Swojecki' was investigated. Tubers were kept in a cold chamber at the temperature of 20C and RH 90-95% for a period of four months. Three methods of storage were applied: in polypropylene (PP) net bags, in the sand or the peat. During storage period there were systematically determined, using standard methods: weight loss, dry matter, soluble solids, total and reducing sugars content and sucrose content. Res...

  7. Yield component analysis and diversity in Jerusalem artichoke (Helianthus tuberosus L.)

    OpenAIRE

    Sikora V.; Berenji J.; Latković D.

    2010-01-01

    The objective of this study was to analyze the variability and mutual dependence of the tuber weight per plant, tuber number per plant, average tuber weight and total sugars content in the tubers of 20 Jerusalem artichoke genotypes included in a varietal trial conducted in the period 1994-2008. The variability of tuber weight per plant, tuber number per plant and average tuber weight was significantly affected by environmental conditions, while the total su...

  8. Reasoned opinion on the modification of the existing MRLs for pyraclostrobin in cucumbers and Jerusalem artichokes

    Directory of Open Access Journals (Sweden)

    European Food Safety Authority

    2013-02-01

    Full Text Available In accordance with Article 6 of Regulation (EC No 396/2005, Belgium, hereafter referred to as the evaluating Member State (EMS, compiled an application to modify the existing MRLs for the active substance pyraclostrobin in cucumbers and Jerusalem artichokes. In order to accommodate for the intended uses of pyraclostrobin, Belgium proposed to raise the existing MRL for cucumbers to 0.5 mg/kg; for Jerusalem artichokes the EMS proposed to raise the existing MRL, which is set at the limit of quantification (0.02 mg/kg, to 0.1 mg/kg. Belgium drafted an evaluation report in accordance with Article 8 of Regulation (EC No 396/2005, which was submitted to the European Commission and forwarded to EFSA. According to EFSA the submitted data fully support the MRL proposals of 0.5 mg/kg on cucumbers. The MRL proposal of 0.09 mg/kg on Jerusalem artichokes is derived by extrapolation from overdosed trials on carrots, given that this crop is classified as very minor. Alternatively, EFSA derived a tentative MRL of 0.06 mg/kg by applying the proportionality approach. Adequate enforcement analytical methods are available to control the residues of pyraclostrobin in the commodities under consideration. Based on the risk assessment results, EFSA concludes that the proposed uses of pyraclostrobin on cucumbers and Jerusalem artichokes in Belgium will not result in a consumer exposure exceeding the toxicological reference values and therefore are unlikely to pose a consumer health risk.

  9. Studies on Fermentation of Jerusalem artichoke Juice by Beneficial Lactic Acid Bacteria and the Flavor Compounds of Fermented Jerusalem artichoke Juice%乳酸菌发酵菊芋汁及其风味的研究

    Institute of Scientific and Technical Information of China (English)

    李信; 董英; 程新; 刘崇万

    2012-01-01

    对不同品种和产地的菊芋主要成分进行了测定,并利用乳酸菌对菊芋汁进行发酵,研究了不同乳酸菌在菊芋汁中的生长规律、低温存活性及发酵菊芋汁中主要风味物质。结果表明,4种乳酸菌在菊芋汁中均生长良好,最高活菌数可达到10^9CFU/mL;菊芋汁经乳酸菌发酵后具有良好风味,其风味的差异与发酵菌种有关;发酵菊芋汁中乳酸菌在4℃低温贮藏过程中具有较好的低温存活性,4周后活菌数保持在10^9CFU/mL。菊芋汁适用于开发成新的功能性乳酸菌饮料。%Jerusalem artichoke possesses abundant inulin, high content of potassium and low content of sodium. The main nutritional compositions of Jerusalem artichoke from diverse varieties and regions were analyzed. The main purpose of this study was to investigate the growth of four lactic acid bacteria (Lactobacillus plantarum, Lactobacillus casei, Lactobacillus acidophilus, Lactobacillus brevis) on Jerusalem artichoke juice and the production of flavor com- pounds in these bacteria. Growth rule, low-temperature survivability of lactic acid bacteria in Jerusalem artichoke and the major flavor compounds of fermented Jerusalem artichoke juice were considered in this study. In this research it was found that four lactic cultures grew well on the Jerusalem artichoke juice, and the viable cell counts of lactic acid bacteria reached 10^9CFU/mL. Jerusalem artichoke juice that was fermented by beneficial lactic acid bacteria had a good flavor, the main flavor compounds were diverse due to the different species of lactic acid bacteria. Although the lactic cultures of fermented Jerusalem artichoke juice gradually lost their viability during cold storage, the viable cell counts of these lactic acid bacteria still remained at 10^8CFU/mL after 4 weeks of refrigeration at 4℃. The results of this study showed that Jerusalem artichoke juice was a potential substrate to be used for healthy

  10. Development of Novel, Exon-Primed Intron-Crossing (EPIC Markers from EST Databases and Evaluation of their Phylogenetic Utility in Commiphora (Burseraceae

    Directory of Open Access Journals (Sweden)

    Morgan R. Gostel

    2014-03-01

    Full Text Available Premise of the study: Novel nuclear exon-primed intron-crossing (EPIC markers were developed to increase phylogenetic resolution among recently diverged lineages in the frankincense and myrrh family, Burseraceae, using Citrus, Arabidopsis, and Oryza genome resources. Methods and Results: Primer pairs for 48 nuclear introns were developed using the genome resource IntrEST and were screened using species of Commiphora and other Burseraceae taxa. Four putative intron regions (RPT6A, BXL2, mtATP Synthase D, and Rab6 sequenced successfully for multiple taxa and recovered phylogenies consistent with those of existing studies. In some cases, these regions yielded informative sequence variation on par with that of the nuclear ribosomal DNA internal transcribed spacer. Conclusions: The combination of freely available genome resources and our design criteria have uncovered four single-copy nuclear intron regions that are useful for phylogenetic reconstruction of Burseraceae taxa. Because our EPIC primers also amplify Arabidopsis, we recommend their trial in other rosid and eudicot lineages.

  11. Protective Effect of γ-Irradiated Dried Powder of Artichoke Leaves against CCl4 Oxidative Stress Induced in Rat Liver

    International Nuclear Information System (INIS)

    Liver injuries are one of the most degenerative worldwide diseases and can lead to different complications. Artichoke (Cynara scolymus L.) is full of natural antioxidants and has hepato protective effect against liver toxicity. Gamma irradiation has been widely used as a first choice sterilization method of raw medicinal plants to be used in the phytotherapic industry worldwide .This study was designed to investigate the effect of dietary supplementation with γ- irradiated artichoke against carbon tetrachloride (CCl4)-induced oxidative stress and hepatotoxicity. The results of high performance liquid chromatography (HPLC) analysis of artichoke leaves indicated that the value of some of the main phenolic constituents was elevated under the effect of γ-irradiation (10 KGy). CCl4 administration resulted in significant increase in the activity of serum alkaline phosphatase, gamma glutamyl transferase and transaminase in addition to an increase in the level of total bilirubine, malondialdehyde (MDA), glucose and the concentration of some lipid contents. Furthermore, CCl4 administration reduced glutathione content, superoxides dismutase (SOD) and catalase (CAT) activity as well as a remarkable decrease in the level of insulin and high density lipoprotein-cholesterol was observed. In CCl4-treated rats dietary supplemented with either raw or γ-irradiated artichoke, a significant amelioration was observed on the adverse effects of the above mentioned parameters induced by CCl4 administration. The present findings concluded that artichoke may be useful, as dietary supplement and possess phenolic compounds, for the prevention of oxidative stress-induced hepatotoxicity

  12. Carbon sequestration and Jerusalem artichoke biomass under nitrogen applications in coastal saline zone in the northern region of Jiangsu, China.

    Science.gov (United States)

    Niu, Li; Manxia, Chen; Xiumei, Gao; Xiaohua, Long; Hongbo, Shao; Zhaopu, Liu; Zed, Rengel

    2016-10-15

    Agriculture is an important source of greenhouse gases, but can also be a significant sink. Nitrogen fertilization is effective in increasing agricultural production and carbon storage. We explored the effects of different rates of nitrogen fertilization on biomass, carbon density, and carbon sequestration in fields under the cultivation of Jerusalem artichoke as well as in soil in a coastal saline zone for two years. Five nitrogen fertilization rates were tested (in guream(-2)): 4 (N1), 8 (N2), 12 (N3), 16 (N4), and 0 (control, CK). The biomass of different organs of Jerusalem artichoke during the growth cycle was significantly higher in N2 than the other treatments. Under different nitrogen treatments, carbon density in organs of Jerusalem artichoke ranged from 336 to 419gCkg(-1). Carbon sequestration in Jerusalem artichoke was higher in treatments with nitrogen fertilization compared to the CK treatment. The highest carbon sequestration was found in the N2 treatment. Soil carbon content was higher in the 0-10cm than 10-20cm layer, with nitrogen fertilization increasing carbon content in both soil layers. The highest soil carbon sequestration was measured in the N2 treatment. Carbon sequestration in both soil and Jerusalem artichoke residue was increased by nitrogen fertilization depending on the rates in the coastal saline zone studied. PMID:27317133

  13. Thermotolerant Kluyveromyces marxianus and Saccharomyces cerevisiae strains representing potentials for bioethanol production from Jerusalem artichoke by consolidated bioprocessing

    Energy Technology Data Exchange (ETDEWEB)

    Hu, Nan [Agricultural Univ., Qingdao, SD (China). College of Animal Science and Technology; Chinese Academy of Sciences, Qingdao, SD (China). Key Lab. of Biofuels; Yuan, Bo; Wang, Shi-An; Li, Fu-Li [Chinese Academy of Sciences, Qingdao, SD (China). Key Lab. of Biofuels; Sun, Juan [Agricultural Univ., Qingdao, SD (China). College of Animal Science and Technology

    2012-09-15

    Thermotolerant inulin-utilizing yeast strains are desirable for ethanol production from Jerusalem artichoke tubers by consolidated bioprocessing (CBP). To obtain such strains, 21 naturally occurring yeast strains isolated by using an enrichment method and 65 previously isolated Saccharomyces cerevisiae strains were investigated in inulin utilization, extracellular inulinase activity, and ethanol fermentation from inulin and Jerusalem artichoke tuber flour at 40 C. The strains Kluyveromyces marxianus PT-1 (CGMCC AS2.4515) and S. cerevisiae JZ1C (CGMCC AS2.3878) presented the highest extracellular inulinase activity and ethanol yield in this study. The highest ethanol concentration in Jerusalem artichoke tuber flour fermentation (200 g L{sup -1}) at 40 C achieved by K. marxianus PT-1 and S. cerevisiae JZ1C was 73.6 and 65.2 g L{sup -1}, which corresponded to the theoretical ethanol yield of 90.0 and 79.7 %, respectively. In the range of 30 to 40 C, temperature did not have a significant effect on ethanol production for both strains. This study displayed the distinctive superiority of K. marxianus PT-1 and S. cerevisiae JZ1C in the thermotolerance and utilization of inulin-type oligosaccharides reserved in Jerusalem artichoke tubers. It is proposed that both K. marxianus and S. cerevisiae have considerable potential in ethanol production from Jerusalem artichoke tubers by a high temperature CBP. (orig.)

  14. Enzymatic browning and after-cooking darkening of Jerusalem artichoke tubers (Helianthus tuberosus L.)

    DEFF Research Database (Denmark)

    Bach, Vibe; Bennedbæk-Jensen, Sidsel; Clausen, Morten Rahr;

    2013-01-01

    enzymatic browning, but Rema and Draga had higher scores than Mari in after-cooking darkening. Jerusalem artichoke tubers had higher contents of total phenolics, phenolic acids and citric acid in the autumn and low contents in the spring, while it was the opposite for malic acid. None of the chemical......Jerusalem artichoke tubers (Helianthus tuberosus L.) undergo enzymatic browning when peeled or cut, and turn grey after boiling, due to after-cooking darkening reactions between iron and phenolic acids. In an attempt to reveal the components responsible for these discolouration reactions, sensory...... evaluation and instrumental colour measurements were related to contents of total phenolics, phenolic acids, organic acids and iron in three varieties of raw and boiled Jerusalem artichoke tubers harvested in the autumn and the spring. No differences were found between varieties in sensory evaluated...

  15. EST2Prot: Mapping EST sequences to proteins

    Directory of Open Access Journals (Sweden)

    Lin David M

    2006-03-01

    Full Text Available Abstract Background EST libraries are used in various biological studies, from microarray experiments to proteomic and genetic screens. These libraries usually contain many uncharacterized ESTs that are typically ignored since they cannot be mapped to known genes. Consequently, new discoveries are possibly overlooked. Results We describe a system (EST2Prot that uses multiple elements to map EST sequences to their corresponding protein products. EST2Prot uses UniGene clusters, substring analysis, information about protein coding regions in existing DNA sequences and protein database searches to detect protein products related to a query EST sequence. Gene Ontology terms, Swiss-Prot keywords, and protein similarity data are used to map the ESTs to functional descriptors. Conclusion EST2Prot extends and significantly enriches the popular UniGene mapping by utilizing multiple relations between known biological entities. It produces a mapping between ESTs and proteins in real-time through a simple web-interface. The system is part of the Biozon database and is accessible at http://biozon.org/tools/est/.

  16. [Effects of hot-NaOH pretreatment on Jerusalem artichoke stalk composition and subsequent enzymatic hydrolysis].

    Science.gov (United States)

    Wang, Qing; Qiu, Jingwen; Li, Yang; Shen, Fei

    2015-10-01

    In order to explore the possibility of Jerusalem artichoke stalk for bioenergy conversion, we analyzed the main composition of whole stalk, pitch, and core of the stalk. Meanwhile, these parts were pretreated with different NaOH concentrations at 121 degrees C. Afterwards, enzymatic hydrolysis was performed to evaluate the pretreatment efficiency. Jerusalem artichoke stalk was characterized by relatively high lignin content (32.0%) compared with traditional crop stalks. The total carbohydrate content was close to that of crop stalks, but with higher cellulose content (40.5%) and lower hemicellulose (19.6%) than those of traditional crop stalks. After pretreatment, the lignin content in the whole stalk, pitch, and core decreased by 13.1%-13.4%, 8.3%-13.5%, and 19.9%-27.2%, respectively, compared with the unpretreated substrates. The hemicellulose content in the whole stalk, pitch, and core decreased 87.8%-96.9%, 87.6%-95.0%, and 74.0%-90.2%, respectively. Correspondingly, the cellulose content in the pretreated whole stalk, pitch, and core increased by 56.5%-60.2%, 52.2%-55.4%, and 62.7%-73.2%, respectively. Moreover, increase of NaOH concentration for pretreatment could improve the enzymatic hydrolysis of the whole stalk and pitch by 2.3-2.6 folds and 10.3-18.5 folds, respectively. The hydrolysis of pretreated stalk core decreased significantly as 2.0 mol/L NaOH was employed, although the increased NaOH concentration can also improve its hydrolysis performance. Based on these results, hot-NaOH can be regarded as an option for Jerusalem artichoke stalk pretreatment. Increasing NaOH concentration was beneficial to hemicellulose and lignin removal, and consequently improved sugar conversion. However, the potential decrease of sugar conversion of the pretreated core by higher NaOH concentration suggested further optimization on the pretreatment conditions should be performed. PMID:26964335

  17. Establishment of fungal entomopathogens Beauveria bassiana and Bionectria ochroleuca (Ascomycota: Hypocreales) as endophytes on artichoke Cynara scolymus.

    Science.gov (United States)

    Guesmi-Jouini, J; Garrido-Jurado, I; López-Díaz, C; Ben Halima-Kamel, M; Quesada-Moraga, E

    2014-06-01

    Entomopathogenic fungi (EPF) are commonly found in diverse habitats and are known to cause mycoses in many different taxa of arthropods. Various unexpected roles have been recently reported for fungal entomopathogens, including their presence as fungal endophytes, plant disease antagonists, rhizosphere colonizers and plant growth promoting fungi. In Tunisia, a wide range of indigenous EPF isolates from different species, such as Beauveria bassiana and Bionectria ochroleuca, were found to occur in the soil, and to be pathogenic against the artichoke aphid Capitophorus elaeagni (Hemiptera: Aphididae). Since endophytic fungi are recently regarded as plant-defending mutualists and their presence in internal plant tissue has been discussed as an adaptive protection against insects, we were interested on elucidating the possible endophytic behavior of B. bassiana and B. ochroleuca on artichoke, Cynara scolymus, after foliar spraying tehcnique. The leaf spray inoculation method was effective in introducing the inoculated fungi into the plant tissues and showed, then, an endophytic activity on artichoke even 10 days later. According S-N-K test, there was significant differences between the two fungal treatments, B. ochroleuca (84% a) and B. bassiana (78% a), and controls (0% b). Likewise, the inoculated entomopathogenic fungi were also isolated from new leaves even though with significant differences respectively between controls (0% c), B. bassiana (56% b) and B. ochroleuca (78% a). These results reveals significant new data on the interaction of inoculated fungi with artichoke plant as ecological roles that can be exploited for the protection of plants. PMID:24681358

  18. Economically Viable Components from Jerusalem Artichoke (Helianthus tuberosus L. in a Biorefinery Concept

    Directory of Open Access Journals (Sweden)

    Eva Johansson

    2015-04-01

    Full Text Available Biorefinery applications are receiving growing interest due to climatic and waste disposal issues and lack of petroleum resources. Jerusalem artichoke (Helianthus tuberosus L. is suitable for biorefinery applications due to high biomass production and limited cultivation requirements. This paper focuses on the potential of Jerusalem artichoke as a biorefinery crop and the most viable products in such a case. The carbohydrates in the tubers were found to have potential for production of platform chemicals, e.g., succinic acid. However, economic analysis showed that production of platform chemicals as a single product was too expensive to be competitive with petrochemically produced sugars. Therefore, production of several products from the same crop is a must. Additional products are protein based ones from tubers and leaves and biogas from residues, although both are of low value and amount. High bioactive activity was found in the young leaves of the crop, and the sesquiterpene lactones are of specific interest, as other compounds from this group have shown inhibitory effects on several human diseases. Thus, future focus should be on understanding the usefulness of small molecules, to develop methods for their extraction and purification and to further develop sustainable and viable methods for the production of platform chemicals.

  19. Screening of Jerusalem artichoke varieties for bio-ethanol production in Portugal

    Energy Technology Data Exchange (ETDEWEB)

    Passarinho, P.C.; Oliveira, A.C.; Rosa, M.F. [INETI, Departamento de Energias Renovaveis, Estrada do Paco do Lumiar, Ed. G, 1649-038, Lisboa (Portugal)

    2008-07-01

    The aim of this work was the evaluation of the potential of 9 Jerusalem artichoke varieties for the sustainable production of bio-ethanol in Portugal. The tubers, which are the part of the plant with higher sugar content, were harvested at different stages of development (29 to 55 weeks), and crashed for juice extraction. The two phases obtained were characterized in terms of total sugars, protein, ash and dry matter. The ethanol productivity of the different J. artichoke varieties was then evaluated fermenting juice or mixtures of juice and pulp aqueous extract with a strain of Kluyveromyces marxianus, a yeast able to hydrolyze and ferment inulin polymers. The chamical characteristic more dependable on the harvest period was the amount of total sugars in the tubers. Juices, obtained until 48 weeks development, contained 173 - 235 g/L of total sugars while juices from the last harvest presented markedly lower sugar contents, indicating crop degradation or sugar migration to the soil. Regarding the fermentative process, ethanol yields ranged from 0.3 to 0.5 g/g. The main conclusion of this work indicates C13 variety as the best. Although bearing a lower sugar concentration in tubers, the substantially higher agricultural productivities (kg/m2) after 8 months growing allowed to estimate productions higher than 10 000 L/ha.

  20. Protective Role of Ca Against NaCl Toxicity in Jerusalem Artichoke by Up-Regulation of Antioxidant Enzymes

    Institute of Scientific and Technical Information of China (English)

    XUE Yan-Feng; LIU Ling; LIU Zhao-Pu; S. K.MEHTA; ZHAO Geng-Mao

    2008-01-01

    The ameliorative effect of external Ca2+ on Jerusalem artichoke (Helianthus tuberosus L.) under salt stress was studied through biochemical and physiological analyses of Jerusalem artichoke seedlings treated with or without 10 mol L-1 CaCl2, 150 mmol L-1 NaCl, and/or 5 mmol L-1 ethylene-bis(oxyethylenenitrilo)-tetraacetic acid (EGTA) for five days. Exposure to NaCl (150 mmol L-1) decreased growth, leaf chlorophyll content, and photosynthetic rate of Jerusalem artichoke seedlings. NaCl treatment showed 59% and 37% higher lipid peroxidation and electrolyte leakage, respectively, than the control. The activities of superoxide dismutase (SOD), peroxidase (POD), and catalase (CAT) were decreased by NaCl, indicating an impeded antioxidant defense mechanism of Jerusalem artichoke grown under salt stress. Addition of 10 mmol L-1 CaCl2 to the salt solutions significantly decreased the damaging effect of NaCl on growth and chlorophyll content and simultaneously restored the rate of photosynthesis almost to the level of the control. Ca2+ addition decreased the leaf malondialdehyde (MDA) content and electrolyte leakage from NaCl-treated seedlings by 47% and 24%, respectively, and significantly improved the activities of SOD, POD, and CAT in NaCl-treated plants. Addition of ECTA, a specific chelator of Ca2+, decreased the growth, chlorophyll content, and photosynthesis, and increased level of MDA and electrolyte leakage from NaCl-treated plants and from the control plants. ECTA addition to the growth medium also repressed the activities of SOD, POD, and CAT in NaCl-treated and control seedlings. External Ca2+ might protect Jerusalem artichoke against NaCl stress by up-regulating the activities of antioxidant enzymes and thereby decreasing the oxidative stress.

  1. Economically Viable Components from Jerusalem Artichoke (Helianthus tuberosus L.) in a Biorefinery Concept

    DEFF Research Database (Denmark)

    Johansson, Eva; Prade, Thomas; Angelidaki, Irini;

    2015-01-01

    Biorefinery applications are receiving growing interest due to climatic and waste disposal issues and lack of petroleum resources. Jerusalem artichoke (Helianthus tuberosus L.) is suitable for biorefinery applications due to high biomass production and limited cultivation requirements. This paper...... as a single product was too expensive to be competitive with petrochemically produced sugars. Therefore, production of several products from the same crop is a must. Additional products are protein based ones from tubers and leaves and biogas from residues, although both are of low value and amount. High...... bioactive activity was found in the young leaves of the crop, and the sesquiterpene lactones are of specific interest, as other compounds from this group have shown inhibitory effects on several human diseases. Thus, future focus should be on understanding the usefulness of small molecules, to develop...

  2. Artichoke and milk thistle pills and syrups as sources of phenolic compounds with antimicrobial activity.

    Science.gov (United States)

    Pereira, Carla; Barros, Lillian; José Alves, Maria; Santos-Buelga, Celestino; Ferreira, Isabel C F R

    2016-07-13

    Dietary supplements based on hepatoprotective plants have been increasingly used in the prevention of liver injuries. In the present work, the aim was to study the phenolic profile and possibly relate it to the in vitro antimicrobial activity of two different formulations (pills and syrups) of artichoke and milk thistle, the antioxidant and anti-hepatocellular carcinoma activities of which were previously reported by our research group. The phenolic profiles were obtained by HPLC-DAD-ESI/MS, and the antimicrobial activity evaluation was performed with the clinical isolates of multiresistant bacteria (Escherichia coli, extended spectrum β-lactamases (ESBL) producing Escherichia coli, Proteus mirabilis, methicillin-resistant Staphylococcus aureus (MRSA) and Pseudomonas aeruginosa). Artichoke syrup revealed the presence of vanillic acid and luteolin-7-O-glucoside while the pills possessed higher concentrations of 4-O-caffeoylquinic, 5-O-caffeoylquinic and 1,3-O-dicaffeoylquinic acids, this latest being able to inhibit the growth of MRSA. Regarding milk thistle formulations, the syrup presented isorhamnetin-O-deoxyhexoside-O-dihexoside, isorhamnetin-O-deoxyhexoside-O-hexoside and isorhamnetin-3-O-rutinoside as the major phenolic constituents whereas the pills were richer in taxifolin, silymarin derivatives and hydroxylated silibinin; the syrup revealed antimicrobial activity against all the studied bacteria with the exception of Proteus mirabilis whereas the pills revealed activity against ESBL producing Escherichia coli. Overall, all of the studied formulations revealed to be a good source of phenolic compounds, among which milk thistle syrup presented the highest variety and concentration of flavonoids, which is possibly related to its strongest antimicrobial activity. PMID:27273551

  3. Syneresis, rheological characteristic and sensory consistency of the artichoke sauce (Cynara scolymus L.

    Directory of Open Access Journals (Sweden)

    Francisco Mora Barandiarán

    2013-09-01

    Full Text Available The effect of the concentration of three hydrocolloids: CMC, guar gum and xanthan gum on the syneresis, rheological features and sensory consistency of the artichoke sauce (Cynara scolymus L. Imperial Star variety was studied. The syneresis was determined by the water loss by centrifugation, the rheological features of the artichoke sauce was determined using a Brookfield RVDV – III model rheometer and finally, the sensory consistency was determined by measuring the degree of satisfaction with hedonic scale of nine points. A simplex lattice design blends with centroid expanded under the response surface methodology was applied to establish the effect of the concentration of hydrocolloid on syneresis, rheological features and sensory consistency. In all treatments, the apparent viscosity decreased with shear rate demonstrating a “non Newtonian” behavior of “general plastic” type with an “n” value less than 1 and an initial shear stress. The flow behavior index “n” was in the range of 0.0856 and 0.3131 (n < 1 and the consistency index “k” in the range of 84.55 y 167.80 Pa.sn , the initial shear stress was in the range of 9,10 y 13,51 Pa and consistency sensory presented score of “like” to “like slightly”. Finally, the hydrocolloid mixture was optimized over the area of feasible formulation. With the optimal mixture, corresponding to 0.28% CMC, 0.13% guar gum and 0.59% xanthan gum is expected to obtain a 0.089% of syneresis and a rating of 6 in terms of sensory consistency.

  4. Genetic mapping and identification of QTL for earliness in the globe artichoke/cultivated cardoon complex

    Directory of Open Access Journals (Sweden)

    Portis Ezio

    2012-05-01

    Full Text Available Abstract Background The Asteraceae species Cynara cardunculus (2n = 2x = 34 includes the two fully cross-compatible domesticated taxa globe artichoke (var. scolymus L. and cultivated cardoon (var. altilis DC. As both are out-pollinators and suffer from marked inbreeding depression, linkage analysis has focussed on the use of a two way pseudo-test cross approach. Results A set of 172 microsatellite (SSR loci derived from expressed sequence tag DNA sequence were integrated into the reference C. cardunculus genetic maps, based on segregation among the F1 progeny of a cross between a globe artichoke and a cultivated cardoon. The resulting maps each detected 17 major linkage groups, corresponding to the species’ haploid chromosome number. A consensus map based on 66 co-dominant shared loci (64 SSRs and two SNPs assembled 694 loci, with a mean inter-marker spacing of 2.5 cM. When the maps were used to elucidate the pattern of inheritance of head production earliness, a key commercial trait, seven regions were shown to harbour relevant quantitative trait loci (QTL. Together, these QTL accounted for up to 74% of the overall phenotypic variance. Conclusion The newly developed consensus as well as the parental genetic maps can accelerate the process of tagging and eventually isolating the genes underlying earliness in both the domesticated C. cardunculus forms. The largest single effect mapped to the same linkage group in each parental maps, and explained about one half of the phenotypic variance, thus representing a good candidate for marker assisted selection.

  5. Jerusalem artichoke as a platform for inulin, ethanol and feed production in Canada

    Energy Technology Data Exchange (ETDEWEB)

    Anyia, A.O.; Mostafa, H.; Melnichuk, R.; Slaski, J.J. [Alberta Research Council, Vegreville, AB (Canada). Bioresource Technologies Unit

    2009-07-01

    The Alberta Research Council (ARC) is developing an extraction and fermentation process for making ethanol from Jerusalem artichoke (JA). In particular, ARC has collaborated with Olds College in developing an extraction process and an engineering process for the commercial production of inulin, ethanol, polymers and animal feed from JA tubers. Fresh JA tubers contain about 20 per cent of water soluble carbohydrates, which occur primarily in the form of inulin. Several health promoting benefits are associated with intake of inulin. High volumes of dry residual aerial biomass following tuber harvest contain 40 to 50 per cent water soluble carbohydrates that are fermentable to ethanol. Some studies have shown that under optimal climatic conditions, JA can yield more ethanol per ha than sugarcane. ARC has the exclusive North American rights to several high yielding JA cultivars. Jerusalem artichoke is not a designated food crop and has a high biomass yield for soluble sugars. This perennial crop forms tubers, has a deep root system that can be adapted to marginal lands. ARC's research involves a seed to final product technology development approach that includes new variety development, agronomy and processing. ARC applied a hot water extraction technique along with a low liquid to JA stalk ratio to achieve more than 40 per cent total water soluble carbohydrates per gram of biomass that are fermentable to ethanol without the need for weak acid or enzymatic hydrolysis. A 400 hectare plantation of JA in Alberta could produce about 1,500 tonnes of inulin and 1.5 million liters of ethanol per year in a pilot scale bio-refining plant. An economic and market analysis showed that capital investments in an inulin production plant in Alberta will be a profitable venture. ARC has estimated a 5 year Internal Rate of Return (IRR) to range from 10 to 30 per cent and payback period of 4 to 5 years depending on plant location and value of by-products. tabs., figs.

  6. Jerusalem artichoke (Helianthus tuberosus L. productivity in different Italian growing areas: a modelling approach

    Directory of Open Access Journals (Sweden)

    Mario Baldini

    2011-06-01

    Full Text Available Jerusalem artichoke is considered one of the more interesting crops for inulin production. It has been used to date for the production of low calorie sweetening syrups, dietetic food enriched with fibre, medicines and cosmetics, while more recently, interesting prospects have been opening up for energy uses. The main aspects influencing its adaptability to different pedo-climatic conditions and cropping systems were analysed by implementing CSS (Cropping System Simulator, a simulation model describing crop biomass production for this specific crop. Growth analysis experimental data of plant dry matter accumulation, obtained over two years of trials (1999-2000 in different Italian growing areas (Udine, Bologna, Bari under irrigated and rain-fed conditions, were used for the parameterisation and calibration of the model. The biomass accumulation observed and simulated under rain-fed and irrigated conditions in the different growing areas is reported for the different plant organs, with good correspondence shown between simulated and measured values as reported by the statistical indices for the model calibration, particularly for biomass of tubers and leaves. The model studied, despite a simplified description of some processes, proves to represent the maximum biomass yield of Jerusalem artichoke satisfactorily, with an adequate response to the main environmental factors causing yield and biomass production variation among the years and locations. However, further model improvements are necessary in order to better represent the relationship between phenology and translocation of the assimilates between stalk and tuber during the development phases of the plant, suggesting shorter survey intervals over this growing phase.

  7. Cellulosic bioethanol production from Jerusalem artichoke (Helianthus tuberosus L.) using hydrogen peroxide-acetic acid (HPAC) pretreatment.

    Science.gov (United States)

    Song, Younho; Wi, Seung Gon; Kim, Ho Myeong; Bae, Hyeun-Jong

    2016-08-01

    Jerusalem artichoke (JA) is recognized as a suitable candidate biomass crop for bioethanol production because it has a rapid growth rate and high biomass productivity. In this study, hydrogen peroxide-acetic acid (HPAC) pretreatment was used to enhance the enzymatic hydrolysis and to effectively remove the lignin of JA. With optimized enzyme doses, synergy was observed from the combination of three different enzymes (RUT-C30, pectinase, and xylanase) which provided a conversion rate was approximately 30% higher than the rate with from treatment with RUT-C30 alone. Fermentation of the JA hydrolyzates by Saccharomyces cerevisiae produced a fermentation yield of approximately 84%. Therefore, Jerusalem artichoke has potential as a bioenergy crop for bioethanol production. PMID:27115748

  8. The Extracellular Matrix Protein Artichoke Is Required for Integrity of Ciliated Mechanosensory and Chemosensory Organs in Drosophila Embryos

    OpenAIRE

    Andrés, Marta; Turiégano, Enrique; Göpfert, Martin C.; Canal, Inmaculada; Torroja, Laura

    2014-01-01

    Sensory cilia are often encapsulated by an extracellular matrix (ECM). In Caenorhabditis elegans, Drosophila melanogaster, and vertebrates, this ECM is thought to be directly involved in ciliary mechanosensing by coupling external forces to the ciliary membrane. Drosophila mechano- and chemosensory cilia are both associated with an ECM, indicating that the ECM may have additional roles that go beyond mechanosensory cilium function. Here, we identify Artichoke (ATK), an evolutionarily conse...

  9. The content of protein and of amino acids in Jerusalem artichoke tubers (Helianthus tuberosus L. of red variety Rote Zonenkugel

    Directory of Open Access Journals (Sweden)

    Ewa Cieślik

    2011-12-01

    Full Text Available   Introduction. Jerusalem artichoke (Helianthus tuberosus L. is grown primarily for its edible tubers, which were first cultivated by native Americans before the arrival of the Europeans. Unlike most tubers, but in common with other members of the Asteraceae, the tubers store fructans instead of starch. Fructans are non-digestible carbohydrates considered functional food ingredients because they affect body processes in ways that result in better health and in many diseases prevention. However, the Jerusalem artichoke deserves attention not only because of the content of fructans, recent studies also indicate a high protein content, including essential amino acids. Material and methods. The aim of the work was to establish the content of protein and amino acids in Jerusalem artichoke tubers (Helianthus tuberosus L. of red variety – Rote Zonenkugel. The content of protein was estimated by Dumas method. The amino acids composition was analysed with ion-change chromatography with postcolumn derivatisation and detection of ninhydryn reaction with automatic amino acids analyser. Results. The assessed liophylisate was characterised by high protein content (6.36% in comparison to chicory (which is the main industrial source of fructans and to commonly consumed potatoes. There was shown a few times higher content of essential amino acids (also of methionine in comparison to chicory and potato. The examined essential amino acids were present in very advantagenous proportions. Conclusions. In Jerusalem artichoke tubers of Rote Zonenkugel variety of the high content of protein was established in comparison to other plant sources. The high content was found of amino acids with special stress on essential amino acids (esp. sulphur ones.  

  10. Cloning and functional characterization of two abiotic stress-responsive Jerusalem artichoke (Helianthus tuberosus) fructan 1-exohydrolases (1-FEHs).

    Science.gov (United States)

    Xu, Huanhuan; Liang, Mingxiang; Xu, Li; Li, Hui; Zhang, Xi; Kang, Jian; Zhao, Qingxin; Zhao, Haiyan

    2015-01-01

    Two fructan hydrolases were previously reported to exist in Jerusalem artichoke (Helianthus tuberosus) and one native fructan-β-fructosidase (1-FEH) was purified to homogeneity by SDS-PAGE, but no corresponding cDNA was cloned. Here, we cloned two full-length 1-FEH cDNA sequences from Jerusalem artichoke, named Ht1-FEH I and Ht1-FEH II, which showed high levels of identity with chicory 1-FEH I and 1-FEH II. Functional characterization of the corresponding recombinant proteins in Pichia pastoris X-33 demonstrated that both Ht1-FEHs had high levels of hydrolase activity towards β(2,1)-linked fructans, but low or no activity towards β(2,6)-linked levan and sucrose. Like other plant FEHs, the activities of the recombinant Ht1-FEHs were greatly inhibited by sucrose. Real-time quantitative PCR analysis showed that Ht1-FEH I transcripts accumulated to high levels in the developing leaves and stems of artichoke, whereas the expression levels of Ht1-FEH II increased in tubers during tuber sprouting, which implies that the two Ht1-FEHs play different roles. The levels of both Ht1-FEH I and II transcript were significantly increased in the stems of NaCl-treated plants. NaCl treatment also induced transcription of both Ht1-FEHs in the tubers, while PEG treatments slightly inhibited the expression of Ht1-FEH II in tubers. Analysis of sugar-metabolizing enzyme activities and carbohydrate concentration via HPLC showed that the enzyme activities of 1-FEHs were increased but the fructose content was decreased under NaCl and PEG treatments. Given that FEH hydrolyzes fructan to yield Fru, we discuss possible explanations for the inconsistency between 1-FEH activity and fructan dynamics in artichokes subjected to abiotic stress. PMID:25522837

  11. Analysis of Essential Oil in Jerusalem Artichoke (Helianthus tuberosus L.) Leaves and Tubers by Gas Chromatography-Mass Spectrometry

    Science.gov (United States)

    Helmi, Zead; Al Azzam, Khaldun Mohammad; Tsymbalista, Yuliya; Ghazleh, Refat Abo; Shaibah, Hassan; Aboul-Enein, Hassan

    2014-01-01

    Purpose: To investigate, for the first time, the chemical composition of essential oil of the tubers and leaves of Jerusalem artichoke (Helianthus tuberosus L.), a species of sunflower native to eastern North America, growing in Ukraine. Methods: A hydrodistillation apparatus was used for the extraction of volatile components and then it was analysed by gas chromatography equipped with a split-splitless injector (split ratio, 1:50) and flame ionization detector (FID). The oil was analyzed under linear temperature programming applied at 4°C/min from 50°C - 340°C. Temperatures of the injector and FID detector were maintained at 280°C and 300°C, respectively. The chemical analysis of the oil was carried out using gas chromatography coupled to mass spectrometry (GC-MS), to determine the chemical composition of the volatile fraction. Results: The essential oils content ranged from 0.00019 to 0.03486 and 0.00011 to 0.00205 (g/100g), in leaves and tubers, respectively. The qualitative and quantitative analysis led to the identification of 17 components in both species samples. The major component found in leaves and tubers was (-)-β-bisabolene with 70.7% and 63.1%, respectively. Conclusion: Essential oil profile of Jerusalem artichoke species showed significant differences between leaves and tubers species. Additionally, the leaves of Jerusalem artichoke are a promising source of natural β-bisabolene. PMID:25671184

  12. Soil Properties and Yield of Jerusalem Artichoke (Helianthus tuberosus L.) with Seawater Irrigation in North China Plain

    Institute of Scientific and Technical Information of China (English)

    ZHAO Geng-Mao; LIU Zhao-Pu; CHEN Ming-Da; GUO Shi-Wei

    2008-01-01

    Irrigation with various dilutions of seawater can act as an alternate water resource and thus plays an important role in saving freshwater resources as well as promoting agriculture in the coastal semi-arid areas of the North China Plain.Jerusalem artichoke (Helianthus tuberosus L.) grown in a field experiment was irrigated with seawater diluted with freshwater from 2001 to 2003 to determine the feasibility of seawater irrigation in the Laizhou area.For treatments of CK (non-irrigation) along with seawater concentrations of 25%,50%,and 75%,total dissolved solid (TDS) in the non-irrigated soil significantly increased (P ≤0.05) in both 2002 and 2003 and was 1.3 times higher in 2003 than in 2001.In the 25%and 50% seawater concentration treatments,TDS in 2001 was significantly greater (P ≤ 0.05) than CK;however,TDS in these two treatments decreased by 34.9% and 40.1%,respectively,in 2003 compared with 2001.The sodium adsorption ratio (SAR) remained below 10 mmol1/2 L-1/2,indicating that alkalization was low with seawater irrigation.In 2001 and 2002,compared to CK and the irrigation treatment with 75% seawater,irrigation with 25% and 50% seawater increased the yields of Jerusalem artichoke,This meant that Jerusalem artichoke could be safely grown in salt-affected land of Laizhou area with 25% and 50% seawater irrigation.

  13. Conte nt of nutritive components, dietary fi bre and energy value of artichoke depending on the variety

    Directory of Open Access Journals (Sweden)

    Iwona Mentel

    2012-06-01

    Full Text Available Background. The artichoke (Cynara scolymus L. is a perennial plant belonging to Asteraceae family. It is less popular vegetable in Poland but very valuable from nutritive and medicinal points of view plant. Material and methods. The experiments were conducted in 2008 and 2009 on fi ve artichoke varieties: ‘Deutscher Hybrid’, ‘Emerald F1’, Green Globe’, ‘Gros Camus de Bretague’ and ‘Kerlouan’, grew in Poland, France and Austria. The experimental material was assessed for: dry mass, protein, ash, vitamin C and dietary fi ber contents and some mineral components (calcium, magnesium, phosphorus, potassium, sodium, iron, zinc levels. Also the energy value and total carbohydrates content were calculated in the vegetable. Results. Among assessed varieties, the highest contents of such components as: dry mass (total solids, carbohydrates, ash, vitamin C, sodium, potassium, magnesium, iron were found in ‘Gros Camus de Bretague’. The hearts of that artichoke had also higher energy value than others. Whereas the lowest ash, phosphorus, sodium, potassium and magnesium were noticed in ‘Kerlouan’ variety. But the highest values of dietary fi ber was observed in that variety. Conclusions. Basing on performed assessments the differences in nutritive components and dietary fi ber, between analysed vegetable varieties were found.

  14. Extractions of High Quality RNA from the Seeds of Jerusalem Artichoke and Other Plant Species with High Levels of Starch and Lipid

    Directory of Open Access Journals (Sweden)

    Tanupat Mornkham

    2013-04-01

    Full Text Available Jerusalem artichoke (Helianthus tuberosus L. is an important tuber crop. However, Jerusalem artichoke seeds contain high levels of starch and lipid, making the extraction of high-quality RNA extremely difficult and the gene expression analysis challenging. This study was aimed to improve existing methods for extracting total RNA from Jerusalem artichoke dry seeds and to assess the applicability of the improved method in other plant species. Five RNA extraction methods were evaluated on Jerusalem artichoke seeds and two were modified. One modified method with the significant improvement was applied to assay seeds of diverse Jerusalem artichoke accessions, sunflower, rice, maize, peanut and marigold. The effectiveness of the improved method to extract total RNA from seeds was assessed using qPCR analysis of four selected genes. The improved method of Ma and Yang (2011 yielded a maximum RNA solubility and removed most interfering substances. The improved protocol generated 29 to 41 µg RNA/30 mg fresh weight. An A260/A280 ratio of 1.79 to 2.22 showed their RNA purity. Extracted RNA was effective for downstream applications such as first-stranded cDNA synthesis, cDNA cloning and qPCR. The improved method was also effective to extract total RNA from seeds of sunflower, rice, maize and peanut that are rich in polyphenols, lipids and polysaccharides.

  15. Chicory and Jerusalem artichoke productivity in different areas of Italy, in relation to water availability and time of harvest

    Directory of Open Access Journals (Sweden)

    Giuseppe De Mastro

    2006-06-01

    Full Text Available Inulin is an important polysaccharide synthesised by different crops, which, in the EU has been included in the system of sugar quotas since 1994. Currently, one of the major problems of the agro-industry is the need to extend the length of the sugar crop harvest season. It was therefore decided, also in relation to the increased demand for inulin, to study the two main inulin producing crops in Italy (chicory and Jerusalem artichoke, to verify yield and quality potential and stability in relation to some important agronomic factors such as irrigation and time of harvest. The work was conducted in 1999 and 2000 in four areas of Italy (Udine, Rovigo, Bologna and Bari. The effects evaluated were time of harvest (3 for chicory and 2 for Jerusalem artichoke and irrigation system (evapotranspiration replacement and dry regime, with irrigation applied only when strictly necessary on the production of storage organs, sugars and inulin in the two crops. The highest chicory root yield was in Bologna, with an average production of 65.6 t ha-1 (fresh weight, compared to Rovigo (54.4 t ha-1, Bari (46.5 t ha-1 and Udine (38.7 t ha-1. For final tuber yield in Jerusalem artichoke, Bari was the most productive environment with an average of 80 t ha-1, followed by Bologna (61 t ha-1 and Udine (55.5 t ha-1. However, when this crop is whole-plant harvested (stalks and tubers at pre-flowering, Bologna, with high stalk yields (58.7 t ha-1 appeared to be the most suitable environment. This type of harvesting was also shown to be more productive in terms of sugar and inulin yield. The total sugar content in the different organs analysed (roots, stalk and tubers was always higher in Udine compared to Bologna, for both crops. Lastly, the length of the inulin chain (average degree of polymerisation [DP] diminishes with the delaying of the harvest in both crops. The Bologna area had the highest potential in terms of chicory root production, while for the tubers yield of

  16. Preparation of Inulin Powder from Jerusalem Artichoke (Helianthus tuberosus L.) Tuber.

    Science.gov (United States)

    Srinameb, Bang-orn; Nuchadomrong, Suporn; Jogloy, Sanun; Patanothai, Aran; Srijaranai, Supalax

    2015-06-01

    The complete procedure for the production of inulin powder from Jerusalem artichoke tubers (JAT) was investigated. The procedure consists of isolation of inulin from JAT, elimination of color from the inulin extract and solidification. Washed tubers were first sliced, dried in a 60 °C oven for 10 h and then milled and sieved into a powder. Inulin was isolated from the JAT powder by hot water extraction using an accelerated solvent extractor (ASE). The effects of temperature and time for the extraction were investigated. The highest extraction efficiency was obtained at the extraction temperature of 80 °C for 20 min. The color of the extract was eliminated using ion exchange process with diethylaminoethyl cellulose as the sorbent. The inulin powder was subsequently obtained by freeze drying. Inulin content and inulin profiles were monitored to evaluate the efficiencies of the complete procedure. The inulin content was indirectly determined by spectrophotometry from free and total fructose measurements using potassium iodide. The inulin profile was monitored using high performance anion exchange chromatography equipped with integrated pulse amperometric detection (HPAEC-PAD). The proposed method provided the inulin production yield of 92.5%. The present procedure is fast, simple and effective for production of inulin powder from JAT. In addition, infrared spectra and some physico-chemical properties of the obtained inulin powder were determined and compared with the standard inulin. PMID:25804251

  17. Salting-out Extraction of 2,3-Butanediol from Jerusalem artichoke-based Fermentation Broth

    Institute of Scientific and Technical Information of China (English)

    DAI Jianying; ZHANG Yuanli; XIU Zhilong

    2011-01-01

    The removal of solid impurities and separation of target products from a fermentation broth is becoming more tedious with the utilization of lignocelluloses as source of substrate.2,3-Butanediol,an important chemical used widely is also a main product of sugar-based fermentation carried out by Klebsiella pneumoniae.In this study,we investigated the use of salting-out extraction(SOE) that employed a K2HPO4/ethanol system consisting of 21% ethanol and 17% K2HPO4(mass fraction) to separate 2,3-butanediol from the viscous Jerusalem artichoke-based fermentation broth.After SOE,about 98% of solid matters was removed,and the viscosity decreased from 72.5 mPa s in the original fermentation broth to 4.4 mPa s in the top phase.The partition coefficient and yield of 2,3-butanediol reached 13.4 and 99%,respectively,and 89% of soluble proteins was removed from the broth.The results showed that SOE is an efficient way for isolating 2,3-BD from a highly viscous fermentation broth by removing much of the solid matters within the broth.

  18. Effect of temperature on acid hydrolysis of Jerusalem artichoke as raw material for ethanol production

    Directory of Open Access Journals (Sweden)

    Razmovski Radojka N.

    2013-01-01

    Full Text Available Jerusalem artichoke (JA is a low-requirement crop, which does not interfere with food chain, and is a promising carbon source for industrial fermentation. Microbial conversion of such a renewable raw material to useful products, such as ethanol, is an important objective in industrial biotechnology. In this study, ethanol was efficiently produced from the hydrolyzates of JA obtained at different pH values (pH 2.5, pH 3.0 and pH 3.5, temperature (120, 130, 132 and 134°C and hold time (30 and 60 min by Saccharomyces cerevisiae. The efficient degradation of JA by HCl under certain experimental conditions was confirmed by thin-layer chromatography. Ethanol concentration of 7.52% (w/w, which corresponds to 93.89 % of the theoretical yield is achieved by ethanol fermentation of JA hydrolyzate obtained at pH 2.5. [Projekat Ministarstva nauke Republike Srbije, br. TR-31002

  19. Effect of Seawater Stress on Physiological and Biochemical Responses of Five Jerusalem Artichoke Ecotypes

    Institute of Scientific and Technical Information of China (English)

    LONG Xiao-Hua; CHI Jin-He; LIU Ling; LI Qing; LIU Zhao-Pu

    2009-01-01

    Three treatments consisting of 0%,15%,and 30% seawater were investigated to analyse the ecotypic variabilities among five populations of Jerusalem artichoke (Helianthus tuberosus) regarding their responses to seawater stress under a hydroponic culture system.Analyses were done 2,4,and 6 days after treatments.The 15% and 30% seawater treatments reduced the growth rates of roots and shoots of H.tuberosus populations.The activities of superoxide dismutase,peroxidase,and catalase majored in the leaves were stimulated under the seawater stress.The electrolyte leakage and malondialdehyde contents of the leaves were also stimulated owing to seawater stress.The contents of proline and solublesugars in the leaves increased significantly with increasing seawater concentrations.The concentrations of Na+,K+,and Cl-in the aerial parts and roots increased with an increase in the seawater concentration throughout the experimental period.There were ccotypic differences among the five populations of H.tuberosus as evidenced by the analyses of the above items in both aerial parts and roots under seawater treatment.The magnitude of the ecotypic variance components indicated that a substantial proportion of the total variation for these physiological and biochemical responses were owing to ecotype,indicating the possibility of improvement through hybridization and selection.

  20. Quality of Jerusalem Artichoke (Helianthus tuberosus L. Tubers in Relation to Storage Conditions

    Directory of Open Access Journals (Sweden)

    Honorata DANILČENKO

    2008-08-01

    Full Text Available The influence of storage conditions on quality parameters of Jerusalem artichoke cv. 'Swojecki' was investigated. Tubers were kept in a cold chamber at the temperature of 20C and RH 90-95% for a period of four months. Three methods of storage were applied: in polypropylene (PP net bags, in the sand or the peat. During storage period there were systematically determined, using standard methods: weight loss, dry matter, soluble solids, total and reducing sugars content and sucrose content. Results showed that the method of storage strongly affected quality degradation of the tubers. The biggest weight loss after two months of storage were noticed for tubers kept in PP net bags. Storage in the sand or the peat significantly reduced weight loss. When tubers were kept in PP net bags, dry matter after four months of storage was 2.2 times bigger, compared with tubers kept in the sand or the peat. The highest loss of soluble solids (4% was found after four months of storage in the case of storage tubers in PP net bags. Irrespective of storage conditions, the lowest content of total sugars and sucrose in tubers were found after two months of storage. The biggest concentration of reducing sugars in tissue was found in tubers kept in PP net bags.

  1. Database replication

    OpenAIRE

    Popov, P. T.; Stankovic, V.

    2014-01-01

    A fault-tolerant node for synchronous heterogeneous database replication and a method for performing a synchronous heterogenous database replication at such a node are provided. A processor executes a computer program to generate a series of database transactions to be carried out at the fault-tolerant node. The fault-tolerant node comprises at least two relational database management systems, each of which are different relational database management system products, each implementing snapsh...

  2. Communicative Databases

    OpenAIRE

    Yu, Kwang-I

    1981-01-01

    A hierarchical organization stores its information in a la rge number of databases. These databases are interrelated , forming a closely-coupled database system. Traditional information systems and current database management systems do not have a means of expressing these relationships. This thesis describes a model of the information structure of the hierarchical organization that identifies the nature of database relationships. It also describes the design and implementatio...

  3. CitEST libraries

    Directory of Open Access Journals (Sweden)

    Maria Luísa P. Natividade Targon

    2007-01-01

    Full Text Available In order to obtain a better understanding of what is citrus, 33 cDNA libraries were constructed from different citrus species and genera. Total RNA was extracted from fruits, leaves, flowers, bark, seeds and roots, and subjected or not to different biotic and abiotic stresses (pathogens and drought and at several developmental stages. To identify putative promoter sequences, as well as molecular markers that could be useful for breeding programs, one shotgun library was prepared from sweet orange (Citrus sinensis var. Olimpia. In addition, EST libraries were also constructed for a citrus pathogen, the oomycete Phythophthora parasitica in either virulent or avirulent form. A total of 286,559 cDNA clones from citrus were sequenced from their 5’ end, generating 242,790 valid reads of citrus. A total of 9,504 sequences were produced in the shotgun library and the valid reads were assembled using CAP3. In this procedure, we obtained 1,131 contigs and 4,083 singletons. A total of 19,200 cDNA clones from P. parasitica were sequenced, resulting in 16,400 valid reads. The number of ESTs generated in this project is, to our knowledge, the largest citrus sequence database in the world.

  4. Artichoke compound cynarin differentially affects the survival, growth and stress response of normal, immortalized and cancerous human cells

    DEFF Research Database (Denmark)

    Gezer, Ceren; Yücecan, Sevinç; Rattan, Suresh Inder Singh

    2015-01-01

    Cynarin (CYN) is the main derivative of caffeoylquinic acid, found in leaves and heads of artichoke. Potential health-beneficial effects of CYN include as being choloretic-cholesterol lowering, hepatoprotective, anti-atherosclerotic, and antioxidative. We have tested the effects of various doses of...... CYN on the proliferative potential, survival, morphology, and stress response (SR) markers haemoxygenase-1 (HO-1) and heat shock protein-70 (HSP70) in normal human skin fibroblasts (FSF-1), telomerase-immortalized mesenchymal stem cells (hTERT-MSC) and cervical cancer cells, HeLa. Effects of CYN on...

  5. Relational databases

    CERN Document Server

    Bell, D A

    1986-01-01

    Relational Databases explores the major advances in relational databases and provides a balanced analysis of the state of the art in relational databases. Topics covered include capture and analysis of data placement requirements; distributed relational database systems; data dependency manipulation in database schemata; and relational database support for computer graphics and computer aided design. This book is divided into three sections and begins with an overview of the theory and practice of distributed systems, using the example of INGRES from Relational Technology as illustration. The

  6. EST-PAC a web package for EST annotation and protein sequence prediction

    Directory of Open Access Journals (Sweden)

    Strahm Yvan

    2006-10-01

    Full Text Available Abstract With the decreasing cost of DNA sequencing technology and the vast diversity of biological resources, researchers increasingly face the basic challenge of annotating a larger number of expressed sequences tags (EST from a variety of species. This typically consists of a series of repetitive tasks, which should be automated and easy to use. The results of these annotation tasks need to be stored and organized in a consistent way. All these operations should be self-installing, platform independent, easy to customize and amenable to using distributed bioinformatics resources available on the Internet. In order to address these issues, we present EST-PAC a web oriented multi-platform software package for expressed sequences tag (EST annotation. EST-PAC provides a solution for the administration of EST and protein sequence annotations accessible through a web interface. Three aspects of EST annotation are automated: 1 searching local or remote biological databases for sequence similarities using Blast services, 2 predicting protein coding sequence from EST data and, 3 annotating predicted protein sequences with functional domain predictions. In practice, EST-PAC integrates the BLASTALL suite, EST-Scan2 and HMMER in a relational database system accessible through a simple web interface. EST-PAC also takes advantage of the relational database to allow consistent storage, powerful queries of results and, management of the annotation process. The system allows users to customize annotation strategies and provides an open-source data-management environment for research and education in bioinformatics.

  7. EST and EST-SSR marker resources for Iris

    Directory of Open Access Journals (Sweden)

    Taylor Christopher A

    2009-06-01

    Full Text Available Abstract Background Limited DNA sequence and DNA marker resources have been developed for Iris (Iridaceae, a monocot genus of 200–300 species in the Asparagales, several of which are horticulturally important. We mined an I. brevicaulis-I. fulva EST database for simple sequence repeats (SSRs and developed ortholog-specific EST-SSR markers for genetic mapping and other genotyping applications in Iris. Here, we describe the abundance and other characteristics of SSRs identified in the transcript assembly (EST database and the cross-species utility and polymorphisms of I. brevicaulis-I. fulva EST-SSR markers among wild collected ecotypes and horticulturally important cultivars. Results Collectively, 6,530 ESTs were produced from normalized leaf and root cDNA libraries of I. brevicaulis (IB72 and I. fulva (IF174, and assembled into 4,917 unigenes (1,066 contigs and 3,851 singletons. We identified 1,447 SSRs in 1,162 unigenes and developed 526 EST-SSR markers, each tracing a different unigene. Three-fourths of the EST-SSR markers (399/526 amplified alleles from IB72 and IF174 and 84% (335/399 were polymorphic between IB25 and IF174, the parents of I. brevicaulis × I. fulva mapping populations. Forty EST-SSR markers were screened for polymorphisms among 39 ecotypes or cultivars of seven species – 100% amplified alleles from wild collected ecotypes of Louisiana Iris (I.brevicaulis, I.fulva, I. nelsonii, and I. hexagona, whereas 42–52% amplified alleles from cultivars of three horticulturally important species (I. pseudacorus, I. germanica, and I. sibirica. Ecotypes and cultivars were genetically diverse – the number of alleles/locus ranged from two to 18 and mean heterozygosity was 0.76. Conclusion Nearly 400 ortholog-specific EST-SSR markers were developed for comparative genetic mapping and other genotyping applications in Iris, were highly polymorphic among ecotypes and cultivars, and have broad utility for genotyping applications within

  8. Community Database

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This excel spreadsheet is the result of merging at the port level of several of the in-house fisheries databases in combination with other demographic databases...

  9. Biofuel Database

    Science.gov (United States)

    Biofuel Database (Web, free access)   This database brings together structural, biological, and thermodynamic data for enzymes that are either in current use or are being considered for use in the production of biofuels.

  10. Analysis of expressed sequence tags from Actinidia: applications of a cross species EST database for gene discovery in the areas of flavor, health, color and ripening

    OpenAIRE

    Richardson Annette C; Rassam Maysoon; McNeilage Mark A; Nain Bhawana; MacDiarmid Robin M; Lo Kim R; Klages Karin; Janssen Bart J; Hellens Roger P; Gera Emma; Fraser Lena G; Ferguson A Ross; Eckloff Rheinhart; Davy Marcus W; Bowen Judith H

    2008-01-01

    Abstract Background Kiwifruit (Actinidia spp.) are a relatively new, but economically important crop grown in many different parts of the world. Commercial success is driven by the development of new cultivars with novel consumer traits including flavor, appearance, healthful components and convenience. To increase our understanding of the genetic diversity and gene-based control of these key traits in Actinidia, we have produced a collection of 132,577 expressed sequence tags (ESTs). Results...

  11. In vitro callus-induction in globe artichoke (Cynara cardunculus L. var. scolymus) as a system for the production of caffeoylquinic acids

    NARCIS (Netherlands)

    Menin, B.; Moglia, A.; Comino, C.; Hakkert, J.C.; Lanteri, S.; Beekwilder, M.J.

    2013-01-01

    Globe artichoke (Cynara cardunculus L. var. scolymus) provides a rich dietary source of bio-active compounds derived from phenylpropanoid metabolism, notably caffeoylquinic acids (CQAs) and flavonoids. Micropropagation techniques have been established for this species, but in vitro cultures have not

  12. Genetic mapping and characterization of the globe artichoke (+)-germacrene A synthase gene, encoding the first dedicated enzyme for biosynthesis of the bitter sesquiterpene lactone cynaropicrin

    NARCIS (Netherlands)

    Menin, B.; Comino, C.; Portis, E.; Moglia, A.; Cankar, K.; Bouwmeester, H.J.; Lanteri, S.; Beekwilder, M.J.

    2012-01-01

    Globe artichoke (Cynara cardunculus var. scolymus L., Asteraceae) is a perennial crop traditionally consumed as a vegetable in the Mediterranean countries and rich in nutraceutically and pharmaceutically active compounds, including phenolic and terpenoid compounds. Its bitter taste is caused by its

  13. Free-range pigs foraging on Jerusalem artichokes (Helianthus tuberosus L.) – Effect of feeding strategy on growth, feed conversion and animal behaviour

    DEFF Research Database (Denmark)

    Kongsted, Anne Grete; Horsted, Klaus; Hermansen, John Erik

    2013-01-01

    The nutritional contributions from free-range foraging, growth, feed conversion and behaviour were investigated in 36 growing pigs foraging on Jerusalem artichokes (JA) and fed concentrates restrictedly (30% of energy recommendations) or ad libitum. Compared to the ad libitum fed pigs, the pigs fed...

  14. Database Administrator

    Science.gov (United States)

    Moore, Pam

    2010-01-01

    The Internet and electronic commerce (e-commerce) generate lots of data. Data must be stored, organized, and managed. Database administrators, or DBAs, work with database software to find ways to do this. They identify user needs, set up computer databases, and test systems. They ensure that systems perform as they should and add people to the…

  15. Effect of NO-3-N Enrichment on Seawater Stress Tolerance of Jerusalem Artichoke(Helianthus tuberosus)

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    A hydroponic experiment with six treatments,i.e.,0% seawater(control),10% seawater,25% seawater,0% seawater +N(7.5 mmol L-1 NaNO3),10% seawater + N(7.5 mmol L-1 NaNO3),and 25% seawater +N(7.5 mmol L-1 NaNO3),was carried out to study the effect of nitrogen addition on the growth and physiological and biochemical characteristics of Jerusalem artichoke(Helianthus tuberosus)seedlings under seawater stress.The 10% seawater stress treatment had the least effect on plant growth while at 25% seawater growth was significantly inhibited.The malondialdehyde content and electrolyte leakage in leaves under 10% seawater were similar to those of the control,but significantly higher under the 25% seawater stress.The activities of superoxide dismutase,peroxidase and catalase in the leaves increased concomitantly with increasing seawater concentration and time.Proline and soluble-sugars in the leaves and Na+,K+,and Cl- contents in shoots and roots increased significantly with the concentration of seawater increasing.Nitrogen addition resulted in increasing fresh and dry weights of shoots and roots compared with seawater treatment without N.Nitrogen supplemen-tation also significantly enhanced the activities of antioxidant enzymes in leaves.Addition of N to seawater enhanced the contents of proline and soluble-sugars in the leaves and K+ and total-N in the aerial parts and roots of H.tuberosus,but it resulted in declined concentrations of Na+ and Cl- in the aerial parts and roots.Nitrogen addition ameliorated the toxicity of seawater by improving the antioxidative enzymes,accumulating of proline and soluble-sugars,and altering the distribution of inorganic ions in H.tuberosus.

  16. Preparative separation of polyphenols from artichoke by polyamide column chromatography and high-speed counter-current chromatography

    Energy Technology Data Exchange (ETDEWEB)

    Shu, Xikai; Wang, Mei; Liu, Daicheng [College of Life Science, Shandong Normal University, Jinan, Shandong (China); Wang, Daijie; Lin, Xiaojing; Liu, Jianhua; Wang, Xiao; Huang, Luqi, E-mail: wxjn1998@126.com [Shandong Analysis and Test Center, Shandong Academy of Sciences, Jinan, Shandong (China)

    2013-09-01

    An efficient method for the rapid separation and purification of polyphenols from artichoke by polyamide column chromatography in combination with high-speed counter-current chromatography (HSCCC) was successfully built. The crude ethanol extracts from dry artichoke were first pre-separated by polyamide column chromatography and divided in two parts as sample 1 and sample 2. Then, the samples were further separated by HSCCC and yielded 7.8 mg of chlorogenic acid (compound I), 24.5 mg of luteolin-7-O-{beta}-D-rutinoside (compound II), 18.4 mg of luteolin-7-O-{beta}-D-glucoside (compound III), and 33.4 mg of cynarin (compound IV) with purity levels of 92.0%, 98.2%, 98.5%, and 98.0%, respectively, as determined by high-performance liquid chromatography (HPLC) method. The chemical structures of these compounds were identified by electrospray ionization-mass spectrometry (ESI-MS) and nuclear magnetic resonance (NMR). (author)

  17. New method for determining sensory shelf life using fuzzy logic: canned marinated artichoke hearts (Cynara scolymus L. case

    Directory of Open Access Journals (Sweden)

    Víctor Vásquez-Villalobos

    2015-06-01

    Full Text Available The sensory preference (sp and shelf life of sensory acceptability (SLSA of canned artichoke hearts were modeled using fuzzy logic (FL and accelerated testing. The artichoke hearts were marinated in oil of sacha inchi (Plukenetia volubilis, soybean (Glycine max and olive (Olea europea; and evaluated using a Ranking test with a semi-trained panel, to identify the best preference both for flavor (f and limpidity (l. We evaluated a global sp through intersection (AND and union (OR fuzzy operations of f and l, using functions of triangular membership with the Mamdani method for defuzzificacion through 25 linguistic rules. The intersection showed the best modeling performance, with the highest sp value at 3.30 for the treatment with sacha inchi (50%, olive (25% and soybean (25% (p << 0.05 oil, which was subjected to accelerated testing at 37 °C, 49 °C, 55 °C and evaluated according to their sensory acceptability (SA through an unstructured scale test in terms of f and l. The SLSA was determined using accelerated testing with FL through intersection fuzzy operation of f and l, triangular membership functions for f and l, and also 25 linguistic rules. A SLSA at 20 ºC was determined for a "high" SA of 296 days, and 569 days for a SA between "high and beginning of medium SA". Both values were lower than the 892 days’ time determined by accelerated testing when evaluating the peroxide index in canned products.

  18. Preparative separation of polyphenols from artichoke by polyamide column chromatography and high-speed counter-current chromatography

    International Nuclear Information System (INIS)

    An efficient method for the rapid separation and purification of polyphenols from artichoke by polyamide column chromatography in combination with high-speed counter-current chromatography (HSCCC) was successfully built. The crude ethanol extracts from dry artichoke were first pre-separated by polyamide column chromatography and divided in two parts as sample 1 and sample 2. Then, the samples were further separated by HSCCC and yielded 7.8 mg of chlorogenic acid (compound I), 24.5 mg of luteolin-7-O-β-D-rutinoside (compound II), 18.4 mg of luteolin-7-O-β-D-glucoside (compound III), and 33.4 mg of cynarin (compound IV) with purity levels of 92.0%, 98.2%, 98.5%, and 98.0%, respectively, as determined by high-performance liquid chromatography (HPLC) method. The chemical structures of these compounds were identified by electrospray ionization-mass spectrometry (ESI-MS) and nuclear magnetic resonance (NMR). (author)

  19. Database Manager

    Science.gov (United States)

    Martin, Andrew

    2010-01-01

    It is normal practice today for organizations to store large quantities of records of related information as computer-based files or databases. Purposeful information is retrieved by performing queries on the data sets. The purpose of DATABASE MANAGER is to communicate to students the method by which the computer performs these queries. This…

  20. Maize databases

    Science.gov (United States)

    This chapter is a succinct overview of maize data held in the species-specific database MaizeGDB (the Maize Genomics and Genetics Database), and selected multi-species data repositories, such as Gramene/Ensembl Plants, Phytozome, UniProt and the National Center for Biotechnology Information (NCBI), ...

  1. The European general thoracic surgery database project.

    Science.gov (United States)

    Falcoz, Pierre Emmanuel; Brunelli, Alessandro

    2014-05-01

    The European Society of Thoracic Surgeons (ESTS) Database is a free registry created by ESTS in 2001. The current online version was launched in 2007. It runs currently on a Dendrite platform with extensive data security and frequent backups. The main features are a specialty-specific, procedure-specific, prospectively maintained, periodically audited and web-based electronic database, designed for quality control and performance monitoring, which allows for the collection of all general thoracic procedures. Data collection is the "backbone" of the ESTS database. It includes many risk factors, processes of care and outcomes, which are specially designed for quality control and performance audit. The user can download and export their own data and use them for internal analyses and quality control audits. The ESTS database represents the gold standard of clinical data collection for European General Thoracic Surgery. Over the past years, the ESTS database has achieved many accomplishments. In particular, the database hit two major milestones: it now includes more than 235 participating centers and 70,000 surgical procedures. The ESTS database is a snapshot of surgical practice that aims at improving patient care. In other words, data capture should become integral to routine patient care, with the final objective of improving quality of care within Europe. PMID:24868445

  2. Database Replication

    CERN Document Server

    Kemme, Bettina

    2010-01-01

    Database replication is widely used for fault-tolerance, scalability and performance. The failure of one database replica does not stop the system from working as available replicas can take over the tasks of the failed replica. Scalability can be achieved by distributing the load across all replicas, and adding new replicas should the load increase. Finally, database replication can provide fast local access, even if clients are geographically distributed clients, if data copies are located close to clients. Despite its advantages, replication is not a straightforward technique to apply, and

  3. Probabilistic Databases

    CERN Document Server

    Suciu, Dan; Koch, Christop

    2011-01-01

    Probabilistic databases are databases where the value of some attributes or the presence of some records are uncertain and known only with some probability. Applications in many areas such as information extraction, RFID and scientific data management, data cleaning, data integration, and financial risk assessment produce large volumes of uncertain data, which are best modeled and processed by a probabilistic database. This book presents the state of the art in representation formalisms and query processing techniques for probabilistic data. It starts by discussing the basic principles for rep

  4. RDD Databases

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This database was established to oversee documents issued in support of fishery research activities including experimental fishing permits (EFP), letters of...

  5. Dealer Database

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The dealer reporting databases contain the primary data reported by federally permitted seafood dealers in the northeast. Electronic reporting was implemented May...

  6. National database

    DEFF Research Database (Denmark)

    Kristensen, Helen Grundtvig; Stjernø, Henrik

    1995-01-01

    Artikel om national database for sygeplejeforskning oprettet på Dansk Institut for Sundheds- og Sygeplejeforskning. Det er målet med databasen at samle viden om forsknings- og udviklingsaktiviteter inden for sygeplejen.......Artikel om national database for sygeplejeforskning oprettet på Dansk Institut for Sundheds- og Sygeplejeforskning. Det er målet med databasen at samle viden om forsknings- og udviklingsaktiviteter inden for sygeplejen....

  7. Effect of the application of sulphur for the control of oidiosis “leveillula taurica” in the culture of artichoke (Cynara scolymus L. var. imperial star

    Directory of Open Access Journals (Sweden)

    L. Mauricio

    2011-09-01

    Full Text Available One of the important reasons for the decay of the production of artichoke is for the disease known with the name of oidium or oidiosis or ash, " Leveillula taurica ", which provokes powdery formations in the back of the leaves, and then they invade the bundle.; inducing to a loss of mass to foliate, death of the plant and reduction in performance. With the purpose of being able to offset the effect of infection and advance of the mushroom it raise the work of investigation which was to determine the suitable dose of the sulphur for the control of oidiosis (Leveillula taurica in the culture of artichoke Cynara scolymus L var. imperial. The experiment was carried out in Victor Larco District, Trujillo, La Libertad; soil of texture clayey, a system of irrigation being used by gravity which frequency of irrigation is fortnightly for the conduction of the culture. There was used a Design of Complete Blocks at random, with four treatments and a witness, and with four repetitions. There was realized an analysis of variance and Duncan's test by a level of significant of 5 %. The results showed that the applied treatments of sulphur reduce and control the advance of the mushroom, being the best the T2, with dose 1 kg/cil. It concludes that these treatments are adapted to there be applied in the culture of artichoke for the control of oidium (Leveillula taurica.

  8. Biological Databases

    Directory of Open Access Journals (Sweden)

    Kaviena Baskaran

    2013-12-01

    Full Text Available Biology has entered a new era in distributing information based on database and this collection of database become primary in publishing information. This data publishing is done through Internet Gopher where information resources easy and affordable offered by powerful research tools. The more important thing now is the development of high quality and professionally operated electronic data publishing sites. To enhance the service and appropriate editorial and policies for electronic data publishing has been established and editors of article shoulder the responsibility.

  9. Characterization and selection of globe artichoke and cardoon germplasm for biomass, food and biocompound production

    OpenAIRE

    Ciancolini, Anna

    2012-01-01

    L'artichaut et le cardon, appartenant à la famille des Asteraceae (Compositae), sont des plantes pérennes herbacées natives du bassin méditerranéen, et qui sont traditionnellement cultivées comme plantes maraîchères, respectivement pour leurs têtes et leurs cardes. L'Italie est le pays possédant la plus importante collection de germoplasmes autochtones d'artichaut. Dans le centre de l'Italie, le type Romanesco est étendu. Ces dernières années, le développement des techniques in vitro a permis...

  10. GDR (Genome Database for Rosaceae): integrated web-database for Rosaceae genomics and genetics data

    OpenAIRE

    Jung, Sook; Staton, Margaret; Lee, Taein; Blenda, Anna; Svancara, Randall; Abbott, Albert; Main, Dorrie

    2007-01-01

    The Genome Database for Rosaceae (GDR) is a central repository of curated and integrated genetics and genomics data of Rosaceae, an economically important family which includes apple, cherry, peach, pear, raspberry, rose and strawberry. GDR contains annotated databases of all publicly available Rosaceae ESTs, the genetically anchored peach physical map, Rosaceae genetic maps and comprehensively annotated markers and traits. The ESTs are assembled to produce unigene sets of each genus and the ...

  11. The extracellular matrix protein artichoke is required for integrity of ciliated mechanosensory and chemosensory organs in Drosophila embryos.

    Science.gov (United States)

    Andrés, Marta; Turiégano, Enrique; Göpfert, Martin C; Canal, Inmaculada; Torroja, Laura

    2014-04-01

    Sensory cilia are often encapsulated by an extracellular matrix (ECM). In Caenorhabditis elegans, Drosophila melanogaster, and vertebrates, this ECM is thought to be directly involved in ciliary mechanosensing by coupling external forces to the ciliary membrane. Drosophila mechano- and chemosensory cilia are both associated with an ECM, indicating that the ECM may have additional roles that go beyond mechanosensory cilium function. Here, we identify Artichoke (ATK), an evolutionarily conserved leucine-rich repeat ECM protein that is required for normal morphogenesis and function of ciliated sensilla in Drosophila. atk is transiently expressed in accessory cells in all ciliated sensory organs during their late embryonic development. Antibody stainings show ATK protein in the ECM that surrounds sensory cilia. Loss of ATK protein in atk null mutants leads to cilium deformation and disorientation in chordotonal organs, apparently without uncoupling the cilia from the ECM, and consequently to locomotion defects. Moreover, impaired chemotaxis in atk mutant larvae suggests that, based on ATK protein localization, the ECM is also crucial for the correct assembly of chemosensory receptors. In addition to defining a novel ECM component, our findings show the importance of ECM integrity for the proper morphogenesis of ciliated organs in different sensory modalities. PMID:24496014

  12. Salinity altered root distribution and increased diversity of bacterial communities in the rhizosphere soil of Jerusalem artichoke.

    Science.gov (United States)

    Yang, Hui; Hu, Jinxiang; Long, Xiaohua; Liu, Zhaopu; Rengel, Zed

    2016-01-01

    The interaction between roots and bacterial communities in halophytic species is poorly understood. Here, we used Jerusalem artichoke cultivar Nanyu 1 (NY-1) to characterise root distribution patterns and determine diversity and abundance of bacteria in the rhizosphere soil under variable salinity. Root growth was not inhibited within the salinity range 1.2 to 1.9 g salt/kg, but roots were mainly confined to 0-20 cm soil layer vertically and 0-30 cm horizontally from the plant centre. Root concentrations of K(+), Na(+), Mg(2+) and particularly Ca(2+) were relatively high under salinity stress. High salinity stress decreased soil invertase and catalase activity. Using a next-generation, Illumina-based sequencing approach, we determined higher diversity of bacteria in the rhizosphere soil at high than low salinity. More than 15,500 valid reads were obtained, and Proteobacteria, Acidobacteria, Bacteroidetes and Actinobacteria predominated in all samples, accounting for >80% of the reads. On a genus level, 636 genera were common to the low and high salinity treatments at 0-5 cm and 5-10 cm depth. The abundance of Steroidobacter and Sphingomonas was significantly decreased by increasing salinity. Higher Shannon and Chao 1 indices with increasing severity of salt stress indicated that high salt stress increased diversity in the bacterial communities. PMID:26852800

  13. EFFECTS OF ARTICHOKE (CYNARA SCOLYMUS L. EXTRACT ADDITION ON MICROBIOLOGICAL AND PHYSICO-CHEMICAL PROPERTIES OF PROBIOTIC YOGURT

    Directory of Open Access Journals (Sweden)

    Jalal Ehsani

    2015-06-01

    Full Text Available In this study, the effects of addition of artichoke (Cynara scolymus L. leaf extract into yogurt (0 or 0.5% on biochemical parameters (pH, titrable acidity and the viability of probiotic bacteria (Lactobacillus acidophilus LA-5, Bifidobacterium lactis BB-12 during fermentation and over 28 days of refrigerated storage (4°C were investigated. Moreover, the amounts of syneresis, total phenolic content, antioxidant activity and sensory attributes of yogurts at the end of fermentation were assessed. Yogurts contained the two yogurt bacteria (Streptococcus thermophilus and Lactobacillus delbrueckii ssp. bulgaricus: ABY or only S. thermophilus (ABT as adjunct culture to probiotics. Yogurts containing Cynara scolymus L. (ABT-C and ABY-C had faster acidity increase, shorter incubation time and greater final titrable acidity than control yogurts (ABT and ABY. Also, yogurts containing Cynara scolymus L. had lower syneresis, higher total phenolic content and greater antioxidant activity. ABT-C yogurt had the ever greatest viability of probiotics. In case of samples sensory evaluation, generally, the highest total score was related to ABT yogurt whereas lowest total score belonged to ABT-C yogurt.

  14. A Two-Step Nanofiltration Process for the Production of Phenolic-Rich Fractions from Artichoke Aqueous Extracts

    Directory of Open Access Journals (Sweden)

    Alfredo Cassano

    2015-04-01

    Full Text Available Commercial nanofiltration (NF membranes in spiral-wound configuration (NP030 from Microdyn Nadir and Desal DK from GE Water & Process Technologies were used in a sequential design in order to produce a separated fraction of phenolic and sugar compounds from an aqueous artichoke extract. For both membranes, the effect of transmembrane pressure (TMP on the permeation flux was evaluated. In optimized conditions of TMP, the NP030 membrane exhibited high rejections of apigenin, cynarin and chlorogenic acid (higher than 85%; on the other hand, very low rejections of fructose, glucose and sucrose (lower than 4% were measured. Starting from an extract with a total antioxidant activity (TAA of 5.28 mM trolox a retentate fraction with a TAA of 47.75 mM trolox was obtained. The NF permeate from the NP030 membrane was processed with the Desal DK membrane in optimized conditions of TMP producing a permeate stream free of phenolic and sugar compounds. Accordingly, as most part of phenolic compounds was removed in the first NF step, the concentration of sugar compounds in the NF retentate had much higher results than that of phenolic compounds.

  15. Extraction of bioactive carbohydrates from artichoke (Cynara scolymus L.) external bracts using microwave assisted extraction and pressurized liquid extraction.

    Science.gov (United States)

    Ruiz-Aceituno, Laura; García-Sarrió, M Jesús; Alonso-Rodriguez, Belén; Ramos, Lourdes; Sanz, M Luz

    2016-04-01

    Microwave assisted extraction (MAE) and pressurized liquid extraction (PLE) methods using water as solvent have been optimized by means of a Box-Behnken and 3(2) composite experimental designs, respectively, for the effective extraction of bioactive carbohydrates (inositols and inulin) from artichoke (Cynara scolymus L.) external bracts. MAE at 60 °C for 3 min of 0.3 g of sample allowed the extraction of slightly higher concentrations of inositol than PLE at 75 °C for 26.7 min (11.6 mg/g dry sample vs. 7.6 mg/g dry sample). On the contrary, under these conditions, higher concentrations of inulin were extracted with the latter technique (185.4 mg/g vs. 96.4 mg/g dry sample), considering two successive extraction cycles for both techniques. Both methodologies can be considered appropriate for the simultaneous extraction of these bioactive carbohydrates from this particular industrial by-product. To the best of our knowledge this is the first time that these techniques are applied for this purpose. PMID:26593602

  16. Salinity altered root distribution and increased diversity of bacterial communities in the rhizosphere soil of Jerusalem artichoke

    Science.gov (United States)

    Yang, Hui; Hu, Jinxiang; Long, Xiaohua; Liu, Zhaopu; Rengel, Zed

    2016-01-01

    The interaction between roots and bacterial communities in halophytic species is poorly understood. Here, we used Jerusalem artichoke cultivar Nanyu 1 (NY-1) to characterise root distribution patterns and determine diversity and abundance of bacteria in the rhizosphere soil under variable salinity. Root growth was not inhibited within the salinity range 1.2 to 1.9 g salt/kg, but roots were mainly confined to 0–20 cm soil layer vertically and 0–30 cm horizontally from the plant centre. Root concentrations of K+, Na+, Mg2+ and particularly Ca2+ were relatively high under salinity stress. High salinity stress decreased soil invertase and catalase activity. Using a next-generation, Illumina-based sequencing approach, we determined higher diversity of bacteria in the rhizosphere soil at high than low salinity. More than 15,500 valid reads were obtained, and Proteobacteria, Acidobacteria, Bacteroidetes and Actinobacteria predominated in all samples, accounting for >80% of the reads. On a genus level, 636 genera were common to the low and high salinity treatments at 0–5 cm and 5–10 cm depth. The abundance of Steroidobacter and Sphingomonas was significantly decreased by increasing salinity. Higher Shannon and Chao 1 indices with increasing severity of salt stress indicated that high salt stress increased diversity in the bacterial communities. PMID:26852800

  17. Optimization of microwave-assisted drying of Jerusalem artichokes (Helianthus tuberosus L. by response surface methodology and genetic algorithm

    Directory of Open Access Journals (Sweden)

    E. KARACABEY

    2016-03-01

    Full Text Available The objective of the present study was to investigate microwave-assisted drying of Jerusalem artichoke tubers to determine the effects of the processing conditions. Drying time (DT and effectivemoisture diffusivity (EMD were determined to evaluate the drying process in terms of dehydration performance, whereas the rehydration ratio (RhR was considered as a significant quality index. A pretreatment of soaking in a NaCl solution was applied before all trials. The output power of the microwave oven, slice thickness and NaCl concentration of the pretreatment solution werethe three investigated parameters. The drying process was accelerated by altering the conditions while obtaining a higher quality product. For optimization of the drying process, response surface methodology (RSM and genetic algorithms (GA were used. Model adequacy was evaluated for each corresponding mathematical expression developed for interested responses by RSM. The residual of the model obtained by GA was compared to that of the RSM model. The GA was successful in high-performance prediction and produced results similar to those of RSM. The analysis and results of the present study show that both RSM and GA models can be used in cohesion to gain insight into the bioprocessing system.

  18. Nursery inoculation with the arbuscular mycorrhizal fungus Glomus viscosum and its effect on the growth and physiology of hybrid artichoke seedlings

    Directory of Open Access Journals (Sweden)

    Angela Campanelli

    2011-09-01

    Full Text Available Most nurseries operating in Italy adopt high technologies and produce transplants that well suit and satisfy the grower’s need to produce high value crops. Mycorrhizas are discussed as a tool for improving and developing plant production in the nursery. Much research has been carried out on mycorrhizal symbiosis and we now know more about the symbiontic relationship between fungi and host plants. Plants receive numerous benefits from this symbiosis which are more macroscopic the earlier in the ontogenetic cycle this symbiosis is established. Therefore, it appears that the most effective period in which the inoculum should be made corresponds to the in-nursery growing stage. The earlier the plant is inoculated, the more evident the effect will be. In this study, several aspects related to the physiological foundations of arbuscular mycorrhiza in artichoke plants are presented. The main goal was to study the effects of mycorrhiza on the growth and physiological parameters of three hybrids of artichokes growing in the nursery. The experimental 3¥2 design included two treatments (with or without arbuscular mycorrhizal fungi and three hybrids of artichokes marketed by Nunhems (Opal F1, Madrigal F1, Concerto F1. Mycorrhizal plants have greater shoot length, leaf area, shoot and root fresh and dry mass, and root density. This also corresponded with increased photosynthetic rates and stomatal conductance of mycorrhizal plants. Mycorrhizal colonization improves relative water content and increases proline concentration in vegetal tissue. Inoculation produced the most beneficial effect on hybrid Madrigal F1 and on hybrid Opal F1; the best mycorrhizal affinity was enhanced when compared to hybrid Concerto F1. The results showed that mycorrhizal symbiosis stimulated the growth of inoculated seedlings providing a qualitatively good propagation material.

  19. Nursery inoculation with the arbuscular mycorrhizal fungus Glomus viscosum and its effect on the growth and physiology of hybrid artichoke seedlings

    Directory of Open Access Journals (Sweden)

    Angela Campanelli

    2011-07-01

    Full Text Available Most nurseries operating in Italy adopt high technologies and produce transplants that well suit and satisfy the grower’s need to produce high value crops. Mycorrhizas are discussed as a tool for improving and developing plant production in the nursery. Much research has been carried out on mycorrhizal symbiosis and we now know more about the symbiontic relationship between fungi and host plants. Plants receive numerous benefits from this symbiosis which are more macroscopic the earlier in the ontogenetic cycle this symbiosis is established. Therefore, it appears that the most effective period in which the inoculum should be made corresponds to the in-nursery growing stage. The earlier the plant is inoculated, the more evident the effect will be. In this study, several aspects related to the physiological foundations of arbuscular mycorrhiza in artichoke plants are presented. The main goal was to study the effects of mycorrhiza on the growth and physiological parameters of three hybrids of artichokes growing in the nursery. The experimental 3¥2 design included two treatments (with or without arbuscular mycorrhizal fungi and three hybrids of artichokes marketed by Nunhems (Opal F1, Madrigal F1, Concerto F1. Mycorrhizal plants have greater shoot length, leaf area, shoot and root fresh and dry mass, and root density. This also corresponded with increased photosynthetic rates and stomatal conductance of mycorrhizal plants. Mycorrhizal colonization improves relative water content and increases proline concentration in vegetal tissue. Inoculation produced the most beneficial effect on hybrid Madrigal F1 and on hybrid Opal F1; the best mycorrhizal affinity was enhanced when compared to hybrid Concerto F1. The results showed that mycorrhizal symbiosis stimulated the growth of inoculated seedlings providing a qualitatively good propagation material.

  20. Stackfile Database

    Science.gov (United States)

    deVarvalho, Robert; Desai, Shailen D.; Haines, Bruce J.; Kruizinga, Gerhard L.; Gilmer, Christopher

    2013-01-01

    This software provides storage retrieval and analysis functionality for managing satellite altimetry data. It improves the efficiency and analysis capabilities of existing database software with improved flexibility and documentation. It offers flexibility in the type of data that can be stored. There is efficient retrieval either across the spatial domain or the time domain. Built-in analysis tools are provided for frequently performed altimetry tasks. This software package is used for storing and manipulating satellite measurement data. It was developed with a focus on handling the requirements of repeat-track altimetry missions such as Topex and Jason. It was, however, designed to work with a wide variety of satellite measurement data [e.g., Gravity Recovery And Climate Experiment -- GRACE). The software consists of several command-line tools for importing, retrieving, and analyzing satellite measurement data.

  1. Effects of glucose irradiated by high doses of 60cobalt gamma rays, and of some products of glucose radiolysis on the growth of Jerusalem Artichoke tissue and potato shoots culture in vitro

    International Nuclear Information System (INIS)

    Glucose, irradiated in dry conditions by gamma rays from 5.105 to 107 rad, and incorporated into culture medium, inhibits growth and, simultaneously, increases rhizogenesis of Jerusalem Artichoke tissue in culture. Tuberisation of potato shoots grown in vitro is delayed and partially inhibited. Some substances which result from radiolysis of sugars give the same results, but only at higher concentrations

  2. Infection cycle of Artichoke Italian latent virus in tobacco plants: meristem invasion and recovery from disease symptoms.

    Directory of Open Access Journals (Sweden)

    Elisa Santovito

    Full Text Available Nepoviral infections induce recovery in fully expanded leaves but persist in shoot apical meristem (SAM by a largely unknown mechanism. The dynamics of infection of a grapevine isolate of Artichoke Italian latent virus (AILV-V, genus Nepovirus in tobacco plants, including colonization of SAM, symptom induction and subsequent recovery of mature leaves from symptoms, were characterized. AILV-V moved from the inoculated leaves systemically and invaded SAM in 7 days post-inoculation (dpi, remaining detectable in SAM at least up to 40 dpi. The new top leaves recovered from viral symptoms earliest at 21 dpi. Accumulation of viral RNA to a threshold level was required to trigger the overexpression of RDR6 and DCL4. Consequently, accumulation of viral RNA decreased in the systemically infected leaves, reaching the lowest concentration in the 3rd and 4th leaves at 23 dpi, which was concomitant with recovery of the younger, upper leaves from disease symptoms. No evidence of virus replication was found in the recovered leaves, but they contained infectious virus particles and were protected against re-inoculation with AILV-V. In this study we also showed that AILV-V did not suppress initiation or maintenance of RNA silencing in transgenic plants, but was able to interfere with the cell-to-cell movement of the RNA silencing signal. Our results suggest that AILV-V entrance in SAM and activation of RNA silencing may be distinct processes since the latter is triggered in fully expanded leaves by the accumulation of viral RNA above a threshold level rather than by virus entrance in SAM.

  3. The Effect of Ginger (Zingiber officinalis) and Artichoke (Cynara cardunculus) Extract Supplementation on Functional Dyspepsia: A Randomised, Double-Blind, and Placebo-Controlled Clinical Trial.

    Science.gov (United States)

    Giacosa, Attilio; Guido, Davide; Grassi, Mario; Riva, Antonella; Morazzoni, Paolo; Bombardelli, Ezio; Perna, Simone; Faliva, Milena A; Rondanelli, Mariangela

    2015-01-01

    Objective. Functional dyspepsia (FD) is a frequent clinical finding in western world. The aim of this study is to compare the efficacy of a ginger and artichoke supplementation versus placebo in the treatment of FD. Methods. A prospective multicentre, double blind, randomized, placebo controlled, parallel-group comparison of the supplement and placebo over a period of 4 weeks was performed. Two capsules/day were supplied (before lunch and dinner) to 126 FD patients (supplementation/placebo: 65/61). Results. After 14 days of treatment, only supplementation group (SG) showed a significant amelioration (SG: α S = +1.195 MCA score units (u), P = 0.017; placebo: α P = +0.347 u, P = 0.513). The intercept (α) resulted to be significantly higher in SG than in placebo (α S - α P = +0.848 u, P nausea (β S - β P = -0.398 u, P < 0.001), epigastric fullness (β S - β P = -0.241, P < 0.001), epigastric pain (β S - β P = -0.173 u, P = 0.002), and bloating (β S - β P = -0.167 u, P = 0.017). Conclusions. The association between ginger and artichoke leaf extracts appears safe and efficacious in the treatment of FD and could represent a promising treatment for this disease. PMID:25954317

  4. EST data: 1182 [RED

    Lifescience Database Archive (English)

    Full Text Available CG0194 C26839 C96955 C50194 2 D DPlate 013 F04 5' GAA GGA GGA TCC CAA GAA AG 3' 5' ATT CAA AGA T ... 778, T76313, H76773, T76734 are in 3' untranslated region ; EST T42894 covers intron in 5' untranslated regio ...

  5. EST data: 2498 [RED

    Lifescience Database Archive (English)

    Full Text Available EB0676 C71953 AU172434 no DPlate 027 B01 5' ACA AAG TAG GAT ACG AGG AG 3' 5' GCG AAG CCC ACC GAC ... weak similarity to hypothetical protein PFB0835c - malaria , PID:g3845289; contains EST gb:T42321, R65259, Aa7 ...

  6. EST data: 2257 [RED

    Lifescience Database Archive (English)

    Full Text Available CH3511 C97816 C63511 1 G DPlate 024 A07 5' TGA TTT CTG TCG CAG CAA GG 3' 5' CAG CGC ATA CTC CAA ... nscription initiation factor IID beta chain, fruit fly , Pir2:B49453; contains EST gb:T46756. ...

  7. EST data: 2838 [RED

    Lifescience Database Archive (English)

    Full Text Available EB2435 C72898 AU101192 E02435 5 D DPlate 030 F07 5' TCT TCA GCT CAG CAC ATC AC 3' 5' TTG TGA CCA ... project); similarity to chS-Rex-b - Gallus gallus (chicken ), gb:L10333; contains EST gb:W43040, N65866, Aa597 ...

  8. EST data: 4399 [RED

    Lifescience Database Archive (English)

    Full Text Available EE1520 C91775 AU094763 DPlate 046 G10 GCAGCTGCATACTGTCGTAG CAAGGGGCCCCCTTAAAAAC >ATF9D16_10(AL03 ... project); similarity to chS-Rex-b - Gallus gallus (chicken ), gb:L10333; contains EST gb:W43040, N65866, Aa597 ...

  9. EST data: 1966 [RED

    Lifescience Database Archive (English)

    Full Text Available CH1819 AU063456 AU172312 DPlate 021 F06 5' AGA AGG CCA TGA TCG AAC TG 3' 5' ACA TCG CAA CTA CTA ... project); similarity to chS-Rex-b - Gallus gallus (chicken ), gb:L10333; contains EST gb:W43040, N65866, Aa597 ...

  10. EST data: 8439 [RED

    Lifescience Database Archive (English)

    Full Text Available ST1133 AU174200 AU174201 DPlate 087 G11 5' TGC TGT CAC CTA TTG CCT TG 3' 5' CCA AAA TGC AGC AAT ... project); similarity to chS-Rex-b - Gallus gallus (chicken ), gb:L10333; contains EST gb:W43040, N65866, Aa597 ...

  11. EST data: 2872 [RED

    Lifescience Database Archive (English)

    Full Text Available EB2463 AU165546 AU165547 E02463 2 G no DPlate 030 H11 5' TCG ATA TGA TGT GGT TGG TG 3' 5' ACT GA ... project); similarity to chS-Rex-b - Gallus gallus (chicken ), gb:L10333; contains EST gb:W43040, N65866, Aa597 ...

  12. EST data: 5984 [RED

    Lifescience Database Archive (English)

    Full Text Available RA0688 D23970 AU031708 R00688 6 D no DPlate 062 H04 5' GTC CTA CTG ACG GTA GCA GC 3' 5' CAC GGA ... project); similarity to chS-Rex-b - Gallus gallus (chicken ), gb:L10333; contains EST gb:W43040, N65866, Aa597 ...

  13. EST data: 5477 [RED

    Lifescience Database Archive (English)

    Full Text Available EH1844 AU031556 AU101584 E61844 5 D DPlate 057 E01 5' TCA GGT TGC CAG CTA GAT CC 3' 5' GGT CAA T ... iation factor EIF3-P66 subunit, EST, GSS, STS, CpG island , complete sequence; &HSU54558_1(U54558|pid:g235137 ...

  14. EST data: 2081 [RED

    Lifescience Database Archive (English)

    Full Text Available CH2637 AU063540 M DPlate 022 A09 5' CCC TGC CAG CCC CCT GAT AG 3' 5' GGG CTC ACC TCA TGA CTC GC ... 89aa has no distinguishing features or significant database ... similarities. Further clues to function may be ind ...

  15. Database development and management

    CERN Document Server

    Chao, Lee

    2006-01-01

    Introduction to Database Systems Functions of a DatabaseDatabase Management SystemDatabase ComponentsDatabase Development ProcessConceptual Design and Data Modeling Introduction to Database Design Process Understanding Business ProcessEntity-Relationship Data Model Representing Business Process with Entity-RelationshipModelTable Structure and NormalizationIntroduction to TablesTable NormalizationTransforming Data Models to Relational Databases .DBMS Selection Transforming Data Models to Relational DatabasesEnforcing ConstraintsCreating Database for Business ProcessPhysical Design and Database

  16. Cloud Database Database as a Service

    Directory of Open Access Journals (Sweden)

    Waleed Al Shehri

    2013-05-01

    Full Text Available Cloud computing has been the most adoptable technology in the recent times, and the database has alsomoved to cloud computing now, so we will look intothe details of database as a service and its functioning.This paper includes all the basic information aboutthe database as a service. The working of databaseas aservice and the challenges it is facing are discussed with an appropriate. The structure of database incloud computing and its working in collaboration with nodes is observed under database as a service. Thispaper also will highlight the important things to note down before adopting a database as a serviceprovides that is best amongst the other. The advantages and disadvantages of database as a service will letyou to decide either to use database as a service or not. Database as a service has already been adopted bymany e-commerce companies and those companies are getting benefits from this service.

  17. Databases and their application

    NARCIS (Netherlands)

    E.C. Grimm; R.H.W Bradshaw; S. Brewer; S. Flantua; T. Giesecke; A.M. Lézine; H. Takahara; J.W.,Jr Williams

    2013-01-01

    During the past 20 years, several pollen database cooperatives have been established. These databases are now constituent databases of the Neotoma Paleoecology Database, a public domain, multiproxy, relational database designed for Quaternary-Pliocene fossil data and modern surface samples. The poll

  18. Unit 66 - Database Creation

    OpenAIRE

    Unit 61, CC in GIS; National Center for Geographic Information and Analysis (UC Santa Barbara, SUNY at Buffalo, University of Maine)

    1990-01-01

    This unit examines the planning and management issues involved in the physical creation of the database. It describes some issues in database creation, key hardware parameters of the system, partitioning the database for tiles and layers and converting data for the database. It illustrates these through an example from the Flathead National Forest in northwestern Montana, where a resource management database was required.

  19. World Religion Database

    OpenAIRE

    Dekker, Jennifer

    2009-01-01

    This article reviews the new database released by Brill entitled World Religion Database (WRD). It compares WRD to other religious demography tools available and rates the database on a 5 point scale.

  20. Main-memory database VS Traditional database

    OpenAIRE

    Rehn, Marcus; Sunesson, Emil

    2013-01-01

    There has been a surge of new databases in recent years. Applications today create a higher demand on database performance than ever before. Main-memory databases have come into the market quite recently and they are just now catching a lot of interest from many different directions. Main-memory databases are a type of database that stores all of its data in the primary memory. They provide a big increase in performance to a lot of different applications. This work evaluates the difference in...

  1. Collecting Taxes Database

    Data.gov (United States)

    US Agency for International Development — The Collecting Taxes Database contains performance and structural indicators about national tax systems. The database contains quantitative revenue performance...

  2. USAID Anticorruption Projects Database

    Data.gov (United States)

    US Agency for International Development — The Anticorruption Projects Database (Database) includes information about USAID projects with anticorruption interventions implemented worldwide between 2007 and...

  3. AcEST: DK945742 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ew generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK945742|Adiantum...J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs

  4. AcEST: DK946712 [AcEST

    Lifescience Database Archive (English)

    Full Text Available David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs...LAST and PSI-BLAST: a new generation of protein database search programs, Nucleic

  5. AcEST: DK945340 [AcEST

    Lifescience Database Archive (English)

    Full Text Available w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402...g, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs

  6. AcEST: DK946879 [AcEST

    Lifescience Database Archive (English)

    Full Text Available new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK946879|Adiantu... J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs

  7. AcEST: DK946819 [AcEST

    Lifescience Database Archive (English)

    Full Text Available LAST: a new generation of protein database search programs, Nucleic Acids Res. 25...Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search program

  8. AcEST: DK958618 [AcEST

    Lifescience Database Archive (English)

    Full Text Available . Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs...d PSI-BLAST: a new generation of protein database search programs, Nucleic Acids

  9. AcEST: BP914202 [AcEST

    Lifescience Database Archive (English)

    Full Text Available David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs...and PSI-BLAST: a new generation of protein database search programs, Nucleic Acid

  10. AcEST: BP914772 [AcEST

    Lifescience Database Archive (English)

    Full Text Available -BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9147...avid J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs

  11. AcEST: BP911825 [AcEST

    Lifescience Database Archive (English)

    Full Text Available eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Q...iller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs

  12. AcEST: DK945511 [AcEST

    Lifescience Database Archive (English)

    Full Text Available a new generation of protein database search programs, Nucleic Acids Res. 25:3389... Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs

  13. AcEST: DK952487 [AcEST

    Lifescience Database Archive (English)

    Full Text Available new generation of protein database search programs, Nucleic Acids Res. 25:3389-3...hang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs

  14. AcEST: DK948732 [AcEST

    Lifescience Database Archive (English)

    Full Text Available f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK948..., and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs

  15. AcEST: BP917801 [AcEST

    Lifescience Database Archive (English)

    Full Text Available n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917801|Adiantum capillus-ve...Gapped BLAST and PSI-BLAST: a new generation of protein database search programs,

  16. AcEST: DK945762 [AcEST

    Lifescience Database Archive (English)

    Full Text Available new generation of protein database search programs, Nucleic Acids Res. 25:3389-3...hang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs

  17. The UCSC genome browser database

    DEFF Research Database (Denmark)

    Kuhn, R M; Karolchik, D; Zweig, A S;

    2007-01-01

    The University of California, Santa Cruz Genome Browser Database contains, as of September 2006, sequence and annotation data for the genomes of 13 vertebrate and 19 invertebrate species. The Genome Browser displays a wide variety of annotations at all scales from the single nucleotide level up...... to a full chromosome and includes assembly data, genes and gene predictions, mRNA and EST alignments, and comparative genomics, regulation, expression and variation data. The database is optimized for fast interactive performance with web tools that provide powerful visualization and querying capabilities......; an expanded SNP annotation track; and many new display options. The Genome Browser, other tools, downloadable data files and links to documentation and other information can be found at http://genome.ucsc.edu/....

  18. A possible general mechanism for ultrasound-assisted extraction (UAE) suggested from the results of UAE of chlorogenic acid from Cynara scolymus L. (artichoke) leaves.

    Science.gov (United States)

    Saleh, I A; Vinatoru, M; Mason, T J; Abdel-Azim, N S; Aboutabl, E A; Hammouda, F M

    2016-07-01

    The use of ultrasound-assisted extraction (UAE) for the extraction of chlorogenic acid (CA) from Cynara scolymus L., (artichoke) leaves using 80% methanol at room temperature over 15 min gave a significant increase in yield (up to a 50%) compared with maceration at room temperature and close to that obtained by boiling over the same time period. A note of caution is introduced when comparing UAE with Soxhlet extraction because, in the latter case, the liquid entering the Soxhlet extractor is more concentrated in methanol (nearly 100%) that the solvent in the reservoir (80% methanol) due to fractionation during distillation. The mechanism of UAE is discussed in terms of the effects of cavitation on the swelling index, solvent diffusion and the removal of a stagnant layer of solvent surrounding the plant material. PMID:26964956

  19. 酒曲应用于菊芋发酵的初步研究%A preliminary study fermentation of Jerusalem artichoke with koji

    Institute of Scientific and Technical Information of China (English)

    冯迪; 隆小华; 辛本荣; 刘兆普

    2011-01-01

    Jerusalem artichoke is a kind of alternative ethanol fermentation of raw materials. Compared with starch materials,the temperature of paste for Jerusalem artichoke is lower,which has the advantage in saving energy.Anqi liquor-making koji, Anqi Liqueur Koji and Xinma Liquor Industry Koji were used to study by one-step fermentation experiment and demonstrate the feasibility of producing ethanol fermentation of Jerusalem artichoke.The results were as follows:In the low raw sugar concentration and general treated conditions ,the alcohol content of Anqi liquor-making koji was higher than the other two koji, up to 5.5 degrees. Fermentation process, the weight loss of carbon dioxide of Anqi liquor-making koji was always higher than the other two koji. Use Anqi liquor-making koji to ferment,the ethanol concentration increased with the experimental time lasting during three days. With the further extension of the fermentation time, pH value of its broth was 6.35. pH value fell to 4.82 after 1 day fermentation and 4.48 after 3 days later,then pH value of the trend was stable. It can be concluded that compared with the other two koji, Anqi liquor-making koji was more suitable for bioethanol production using Jerusalem artichoke.%菊芋是一种极具潜力的乙醇发酵原料,与淀粉质原料相比,菊芋低温条件下即可实现糊化,在节能方面具有优势.本文选取了安琪甜酒曲、安琪酿酒曲和欣马酒业酒曲进行一步法发酵实验,论证不同种类及品种的酒曲应用于菊芋发酵生产乙醇的可行性.结果表明:在原料含糖量不高且未经任何条件优化的情况下,安琪酿酒曲的酒度高于其他两种酒曲,酒度可达5.5度;发酵过程中,安琪酿酒曲的CO2失重量始终高于安琪甜酒曲和欣马酒曲;使用安琪酿酒曲进行发酵,第1d到第3d乙醇含量逐渐升高,在第3d时达到最大值;随着发酵时间的继续延长,安琪酿酒曲发酵液PH为6.35.发酵1d后pH降至4.82,3d后pH降至4

  20. Production of a single cyclic type of fructooligosaccharide structure by inulin-degrading Paenibacillus sp. LX16 newly isolated from Jerusalem artichoke root.

    Science.gov (United States)

    Yao, Zhihua; Guo, Jiqiang; Tang, Wenzhu; Sun, Zhen; Hou, Yingmin; Li, Xianzhen

    2016-05-01

    A novel inulin-degrading bacterium was isolated from a soil sample collected on Jerusalem artichoke roots. It is a Gram-positive, aerobic, motile and central endospore-forming straight rod, and exhibits phenotypic properties being consistent with its classification in the genus Paenibacillus. The predominant cellular fatty acids were anteiso-C15:0, C16:0 and anteiso-C17:0. This strain represents a novel species of the genus Paenibacillus on the basis of phenotypic data together with phylogenetic analysis, and it is here designated as LX16 and deposited in China centre for type collection, China (= CCTCC 2015256). Strain LX16 could produce a cyclofructooligosaccharide fructanotransferase catalysing the formation of one type of fructooligosaccharide (FOS) from inulin. The FOS was identified as a cyclofructooligosaccharide with a degree of polymerization of 6. Such homology in inulin degradation products may be beneficial for the functional FOS production. PMID:26996537

  1. Enzymatic milk clotting activity in artichoke (Cynara scolymus) leaves and alpine thistle (Carduus defloratus) flowers. Immobilization of alpine thistle aspartic protease.

    Science.gov (United States)

    Esposito, Marilena; Di Pierro, Prospero; Dejonghe, Winnie; Mariniello, Loredana; Porta, Raffaele

    2016-08-01

    Two different milk clotting enzymes, belonging to the aspartic protease family, were extracted from both artichoke leaves and alpine thistle flowers, and the latter was covalently immobilized by using a polyacrylic support containing polar epoxy groups. Our findings showed that the alpine thistle aspartic protease was successfully immobilized at pH 7.0 on Immobeads IB-150P beads and that, under these experimental conditions, an immobilization yield of about 68% and a recovery of about 54% were obtained. Since the enzyme showed an optimal pH of 5.0, a value very similar to the one generally used for milk clotting during cheese making, and exhibited a satisfactory stability over time, the use of such immobilized vegetable rennet for the production of novel dairy products is suggested. PMID:26988483

  2. The Effect of Ginger (Zingiber officinalis and Artichoke (Cynara cardunculus Extract Supplementation on Functional Dyspepsia: A Randomised, Double-Blind, and Placebo-Controlled Clinical Trial

    Directory of Open Access Journals (Sweden)

    Attilio Giacosa

    2015-01-01

    Full Text Available Objective. Functional dyspepsia (FD is a frequent clinical finding in western world. The aim of this study is to compare the efficacy of a ginger and artichoke supplementation versus placebo in the treatment of FD. Methods. A prospective multicentre, double blind, randomized, placebo controlled, parallel-group comparison of the supplement and placebo over a period of 4 weeks was performed. Two capsules/day were supplied (before lunch and dinner to 126 FD patients (supplementation/placebo: 65/61. Results. After 14 days of treatment, only supplementation group (SG showed a significant amelioration (SG: αS=+1.195 MCA score units (u, P=0.017; placebo: αP=+0.347 u, P=0.513. The intercept (α resulted to be significantly higher in SG than in placebo (αS-αP=+0.848 u, P<0.001. At the end of the study, the advantage of SG versus placebo persists without variation (βS-βP=+0.077 u, P=0.542. In SG, a significant advantage is observed for nausea (βS-βP=-0.398 u, P<0.001, epigastric fullness (βS-βP=-0.241, P<0.001, epigastric pain (βS-βP=-0.173 u, P=0.002, and bloating (βS-βP=-0.167 u, P=0.017. Conclusions. The association between ginger and artichoke leaf extracts appears safe and efficacious in the treatment of FD and could represent a promising treatment for this disease.

  3. The wild Egyptian artichoke as a promising functional food for the treatment of hepatitis C virus as revealed via UPLC-MS and clinical trials.

    Science.gov (United States)

    Elsebai, Mahmoud Fahmi; Abass, Khaled; Hakkola, Jukka; Atawia, Ahmed Rezk; Farag, Mohamed A

    2016-07-13

    Infection by hepatitis C virus (HCV) and its subsequent complications are a major cause of mortality worldwide. The water extract of the wild Egyptian artichoke (WEA) (Cynara cardunculus L. var. sylvestris (Lam.) Fiori) leaves is a freely available herbal product that is used for treatment of HCV-infection complications such as jaundice and ascites. The purpose of this study was to evaluate whether WEA exhibits activity against HCV, identify bioactive chemicals in its extract and to tentatively examine the potential inhibitory interactions of WEA with human drug-metabolizing enzymes. The current pilot clinical trial revealed that the water extract of a WEA plant decreased the HCV viral load below the detection level in 12 out of 15 patients. Furthermore, the liver enzymes ALT and AST, as well as the level of bilirubin were normalized. The total WEA extract inhibited CYP2B6 (OH-BUP) and CYP2C19 (5-OH-OME) with high affinity, IC50 ∼ 20 μg ml(-1), while moderate inhibitory interactions were observed for CYP1A2, CYP2D6, CYP2E1 and CYP3A4. Results presented herein suggest that the WEA exhibits strong antiviral activity against HCV and may be useful for its treatment. Compared to the artichoke product "Hepar SL Forte(®)", WEA was found to be more enriched in sesquiterpenes versus the abundance of phenolic compounds, especially flavonoids in Hepar SL Forte(®) as revealed via UPLC-MS analysis coupled to chemometrics. PMID:27296047

  4. The ground-based solar observations database BASS 2000

    OpenAIRE

    Paletou, F; Lafon, M.; Maeght, P.; Grimaud, F.; Louge, T.; Aboudarham, J.

    2007-01-01

    BASS 2000 is the French solar database for ground-based instruments. We describe hereafter our organization, our tasks and the products we can deliver to the international community. Our prospects cover data mining into the THeMIS archive, a participation to the EST endeavour and the creation and curation of the ESPaDOnS/NARVAL stellar spectra database.

  5. Rocade est, Bourges

    OpenAIRE

    Guiot, Thibaud

    2014-01-01

    Code INSEE commune : 18033 Lien Atlas (MCC) : http://atlas.patrimoines.culture.fr/atlas/trunk/index.php?ap_theme=DOM_2.01.02&ap_bbox=2.324;47.026;2.473;47.130 Le tracé de la rocade Est de Bourges a fait l’objet d’une évaluation complémentaire afin de traiter tous les terrains qui étaient inaccessibles lors de la première phase. Deux sites ont été étudiés au cours de cette intervention. Deux structures excavées, découvertes aux abords de la route de Nevers (RD 976), ont livré un lot de mobilie...

  6. KALIMER database development

    International Nuclear Information System (INIS)

    KALIMER database is an advanced database to utilize the integration management for liquid metal reactor design technology development using Web applications. KALIMER design database is composed of results database, Inter-Office Communication (IOC), 3D CAD database, and reserved documents database. Results database is a research results database during all phase for liquid metal reactor design technology development of mid-term and long-term nuclear R and D. IOC is a linkage control system inter sub project to share and integrate the research results for KALIMER. 3D CAD database is a schematic overview for KALIMER design structure. And reserved documents database is developed to manage several documents and reports since project accomplishment

  7. Logical database design principles

    CERN Document Server

    Garmany, John; Clark, Terry

    2005-01-01

    INTRODUCTION TO LOGICAL DATABASE DESIGNUnderstanding a Database Database Architectures Relational Databases Creating the Database System Development Life Cycle (SDLC)Systems Planning: Assessment and Feasibility System Analysis: RequirementsSystem Analysis: Requirements Checklist Models Tracking and Schedules Design Modeling Functional Decomposition DiagramData Flow Diagrams Data Dictionary Logical Structures and Decision Trees System Design: LogicalSYSTEM DESIGN AND IMPLEMENTATION The ER ApproachEntities and Entity Types Attribute Domains AttributesSet-Valued AttributesWeak Entities Constraint

  8. Cloud Databases: A Paradigm Shift in Databases

    Directory of Open Access Journals (Sweden)

    Indu Arora

    2012-07-01

    Full Text Available Relational databases ruled the Information Technology (IT industry for almost 40 years. But last few years have seen sea changes in the way IT is being used and viewed. Stand alone applications have been replaced with web-based applications, dedicated servers with multiple distributed servers and dedicated storage with network storage. Cloud computing has become a reality due to its lesser cost, scalability and pay-as-you-go model. It is one of the biggest changes in IT after the rise of World Wide Web. Cloud databases such as Big Table, Sherpa and SimpleDB are becoming popular. They address the limitations of existing relational databases related to scalability, ease of use and dynamic provisioning. Cloud databases are mainly used for data-intensive applications such as data warehousing, data mining and business intelligence. These applications are read-intensive, scalable and elastic in nature. Transactional data management applications such as banking, airline reservation, online e-commerce and supply chain management applications are write-intensive. Databases supporting such applications require ACID (Atomicity, Consistency, Isolation and Durability properties, but these databases are difficult to deploy in the cloud. The goal of this paper is to review the state of the art in the cloud databases and various architectures. It further assesses the challenges to develop cloud databases that meet the user requirements and discusses popularly used Cloud databases.

  9. VitisExpDB: A Database Resource for Grape Functional Genomics

    Science.gov (United States)

    VitisExpDB is an online MySQL-PHP driven relational database that houses annotated EST and gene expression data for Vitis vinifera and non-vinifera grape varieties. Currently, the database stores ~320,000 EST sequences derived from 8 species/hybrids, their annotation details and gene ontology based...

  10. AcEST: DK951550 [AcEST

    Lifescience Database Archive (English)

    Full Text Available n (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search...GRL0011_L08, 5' (757 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total letters Sea...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK951550|Adiantu...m capillus-veneris mRNA, clone: TST38A01NGRL0011_L08, 5' (757 letters) Database: uniprot_trembl.fasta 7,341,...ylation factor 1 OS=Salix bakko GN... 350 4e-96 sp|P51821|ARF1_CHLRE ADP-ribosyla

  11. AcEST: DK963342 [AcEST

    Lifescience Database Archive (English)

    Full Text Available n (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search...GRL0016_E12, 5' (473 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total letters Sea... and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search program...A, clone: TST39A01NGRL0016_E12, 5' (473 letters) Database: uniprot_trembl.fasta 7,341,751 sequences; 2,391,615,440 tota...ylation factor 1 OS=Catharanthus r... 268 7e-72 sp|O48649|ARF1_SALBA ADP-ribosyla

  12. AcEST: DK951255 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database se...A01NGRL0010_O17, 5' (771 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total letters...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK951255|Adi...antum capillus-veneris mRNA, clone: TST38A01NGRL0010_O17, 5' (771 letters) Database: uniprot_trembl.fasta 7,...ibosylation factor 1 OS=Salix bakko GN... 350 4e-96 sp|P51821|ARF1_CHLRE ADP-ribo

  13. AcEST: DK962833 [AcEST

    Lifescience Database Archive (English)

    Full Text Available pillus-veneris mRNA, clone: TST39A01NGRL0014_O19, 5' (613 letters) Database: uniprot_sprot.fasta...997), Gapped BLAST and PSI-BLAST: a new generation of protein database search pro...014_O19, 5' (613 letters) Database: uniprot_trembl.fasta 7,341,751 sequences; 2,391,615,440 total letters Se...-ribosylation factor 3 OS=Bos taurus GN=... 69 5e-19 sp|O48649|ARF1_SALBA ADP-ribosylation factor 1 OS=Salix bak...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK962833|Adiantum ca

  14. AcEST: DK953413 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ew generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK953413|Adiantum... capillus-veneris mRNA, clone: TST39A01NGRL0017_L07, 5' (617 letters) Database: uniprot_sprot.fasta...n (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Re...GRL0017_L07, 5' (617 letters) Database: uniprot_trembl.fasta 7,341,751 sequences; 2,391,615,440 total letter...idopsis th... 355 1e-97 sp|O48649|ARF1_SALBA ADP-ribosylation factor 1 OS=Salix bakko GN... 350

  15. AcEST: BP913948 [AcEST

    Lifescience Database Archive (English)

    Full Text Available I-BLAST: a new generation of protein database search programs, Nucleic Acids Res.... 25:3389-3402. Query= BP913948|Adiantum capillus-veneris mRNA, clone: YMU001_000038_B10. (509 letters) Database: uniprot_sprot.fasta...iller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search p...38_B10. (509 letters) Database: uniprot_trembl.fasta 7,341,751 sequences; 2,391,615,440 tota...se (Fragment) OS=Tricholoma bakamatsutake GN=pol PE=4 SV=1 Length = 434 Score = 48.1 bits (113

  16. AcEST: DK954659 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-34...02. Query= DK954659|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0021_A12, 5' (532 letters) Database: uniprot_sprot.fasta...7), Gapped BLAST and PSI-BLAST: a new generation of protein database search progr...1_A12, 5' (532 letters) Database: uniprot_trembl.fasta 7,341,751 sequences; 2,391,615,440 total letters Sear...KILKDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF 113 >sp|O48650|SUI1_SALBA Protein translation facto

  17. AcEST: DK953942 [AcEST

    Lifescience Database Archive (English)

    Full Text Available new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK953942|Adiantu...m capillus-veneris mRNA, clone: TST39A01NGRL0019_B22, 5' (590 letters) Database: uniprot_sprot.fasta...(1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search p...L0019_B22, 5' (590 letters) Database: uniprot_trembl.fasta 7,341,751 sequences; 2,391,615,440 total letters ...n translation factor SUI1 homolog OS=Salix bakko PE=3 SV=1 Length = 113 Score = 1

  18. Compressing DNA sequence databases with coil

    Directory of Open Access Journals (Sweden)

    Hendy Michael D

    2008-05-01

    Full Text Available Abstract Background Publicly available DNA sequence databases such as GenBank are large, and are growing at an exponential rate. The sheer volume of data being dealt with presents serious storage and data communications problems. Currently, sequence data is usually kept in large "flat files," which are then compressed using standard Lempel-Ziv (gzip compression – an approach which rarely achieves good compression ratios. While much research has been done on compressing individual DNA sequences, surprisingly little has focused on the compression of entire databases of such sequences. In this study we introduce the sequence database compression software coil. Results We have designed and implemented a portable software package, coil, for compressing and decompressing DNA sequence databases based on the idea of edit-tree coding. coil is geared towards achieving high compression ratios at the expense of execution time and memory usage during compression – the compression time represents a "one-off investment" whose cost is quickly amortised if the resulting compressed file is transmitted many times. Decompression requires little memory and is extremely fast. We demonstrate a 5% improvement in compression ratio over state-of-the-art general-purpose compression tools for a large GenBank database file containing Expressed Sequence Tag (EST data. Finally, coil can efficiently encode incremental additions to a sequence database. Conclusion coil presents a compelling alternative to conventional compression of flat files for the storage and distribution of DNA sequence databases having a narrow distribution of sequence lengths, such as EST data. Increasing compression levels for databases having a wide distribution of sequence lengths is a direction for future work.

  19. Development of EST-derived markers in Dendrobium from EST of related taxa

    Directory of Open Access Journals (Sweden)

    Narisa Juejun

    2013-04-01

    Full Text Available Public databases are useful for molecular marker development. The major aim of this study was to develop expressedsequence tag (EST-derived markers in Dendrobium from available ESTs of Phalaenopsis and Dendrobium. A total of 6063sequences were screened for simple sequence repeats (SSRs and introns. Primers flanking these regions were generated andtested on genomic DNAs of Phalaenopsis and Dendrobium. Twenty-three percent of amplifiable Phalaenopsis EST-derivedmarkers were cross-genera transferable to Dendrobium. Forty-one markers from both Phalaenopsis and Dendrobium thatamplified in Dendrobium were assessed on six commercial cultivars and six wild accessions. All of them were transferableamong Dendrobium species. High polymorphism and heterozygosity were observed within wild accessions. Sixteen polymorphic markers were evaluated for linkage analysis on an F1 segregating population. Seven markers were mapped into threelinkage groups, two of which showed syntenic relationship between dendrobium and rice. This relationship will facilitatefurther quantitative trait loci (QTL mapping and comparative genomic studies of Dendrobium. Our results indicate thatPhalaenopsis EST-derived markers are valuable tools for genetic research and breeding applications in Dendrobium.

  20. Directory of IAEA databases

    International Nuclear Information System (INIS)

    The first edition of the Directory of IAEA Databases is intended to describe the computerized information sources available to IAEA staff members. It contains a listing of all databases produced at the IAEA, together with information on their availability

  1. Assessment Database (ADB)

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Assessment Database (ADB) is a relational database application for tracking water quality assessment data, including use attainment, and causes and sources of...

  2. Native Health Research Database

    Science.gov (United States)

    ... APP WITH JAVASCRIPT TURNED OFF. THE NATIVE HEALTH DATABASE REQUIRES JAVASCRIPT IN ORDER TO FUNCTION. PLEASE ENTER ... To learn more about searching the Native Health Database, click here. Keywords Title Author Source of Publication ...

  3. AIDSinfo Drug Database

    Science.gov (United States)

    ... Widgets Order Publications Skip Nav AIDS info Drug Database Home > Drugs Español small medium large Text Size ... health care providers and patients. Search the Drug Database Help × Search by drug name Performs a search ...

  4. E3 Staff Database

    Data.gov (United States)

    US Agency for International Development — E3 Staff database is maintained by E3 PDMS (Professional Development & Management Services) office. The database is Mysql. It is manually updated by E3 staff as...

  5. AcEST: DK947829 [AcEST

    Lifescience Database Archive (English)

    Full Text Available David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, N...g, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search prog...rams, Nucleic Acids Res. 25:3389-3402. Query= DK947829|A

  6. AcEST: DK943809 [AcEST

    Lifescience Database Archive (English)

    Full Text Available avid J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nuc...AST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Qu

  7. AcEST: DK943845 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Gapped BLAST and PSI-BLAST: a new generation of protein database search programs...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK943845|Adiantum capillus-veneris...ler, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of

  8. AcEST: DK946772 [AcEST

    Lifescience Database Archive (English)

    Full Text Available -BLAST: a new generation of protein database search programs, Nucleic Acids Res. ..., Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search progr...ams, Nucleic Acids Res. 25:3389-3402. Query= DK946772|Ad

  9. AcEST: DK945348 [AcEST

    Lifescience Database Archive (English)

    Full Text Available T: a new generation of protein database search programs, Nucleic Acids Res. 25:33...ng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs

  10. AcEST: DK945539 [AcEST

    Lifescience Database Archive (English)

    Full Text Available BLAST: a new generation of protein database search programs, Nucleic Acids Res. 2... Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search progra...ms, Nucleic Acids Res. 25:3389-3402. Query= DK945539|Adi

  11. AcEST: DK946060 [AcEST

    Lifescience Database Archive (English)

    Full Text Available PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Re...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK946060...ang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of p

  12. AcEST: BP911599 [AcEST

    Lifescience Database Archive (English)

    Full Text Available SI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91...eng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs

  13. AcEST: BP917157 [AcEST

    Lifescience Database Archive (English)

    Full Text Available BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91715... Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs

  14. AcEST: DK944295 [AcEST

    Lifescience Database Archive (English)

    Full Text Available SI-BLAST: a new generation of protein database search programs, Nucleic Acids Res...grams, Nucleic Acids Res. 25:3389-3402. Query= DK944295|...ng, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search pro

  15. AcEST: DK944792 [AcEST

    Lifescience Database Archive (English)

    Full Text Available PSI-BLAST: a new generation of protein database search programs, Nucleic Acids R...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK94479...hang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of

  16. AcEST: DK946525 [AcEST

    Lifescience Database Archive (English)

    Full Text Available I-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK946..., and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search prog...rams, Nucleic Acids Res. 25:3389-3402. Query= DK946525|Adiantum capillus-veneris mR

  17. AcEST: BP920861 [AcEST

    Lifescience Database Archive (English)

    Full Text Available er, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs... BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402.

  18. Database Description - Trypanosomes Database | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us Trypanosomes Database... Database Description General information of database Database name Trypanosomes Database...rmation and Systems Yata 1111, Mishima, Shizuoka 411-8540, JAPAN E mail: Database... classification Protein sequence databases Organism Taxonomy Name: Trypanosoma Taxonomy ID: 5690 Taxonomy Na...me: Homo sapiens Taxonomy ID: 9606 Database description The Trypanosomes database is a database providing th

  19. Aviation Safety Issues Database

    Science.gov (United States)

    Morello, Samuel A.; Ricks, Wendell R.

    2009-01-01

    The aviation safety issues database was instrumental in the refinement and substantiation of the National Aviation Safety Strategic Plan (NASSP). The issues database is a comprehensive set of issues from an extremely broad base of aviation functions, personnel, and vehicle categories, both nationally and internationally. Several aviation safety stakeholders such as the Commercial Aviation Safety Team (CAST) have already used the database. This broader interest was the genesis to making the database publically accessible and writing this report.

  20. Web database development

    OpenAIRE

    Tsardas, Nikolaos A.

    2001-01-01

    This thesis explores the concept of Web Database Development using Active Server Pages (ASP) and Java Server Pages (JSP). These are among the leading technologies in the web database development. The focus of this thesis was to analyze and compare the ASP and JSP technologies, exposing their capabilities, limitations, and differences between them. Specifically, issues related to back-end connectivity using Open Database Connectivity (ODBC) and Java Database Connectivity (JDBC), application ar...

  1. IP Geolocation Databases: Unreliable?

    OpenAIRE

    Poese, Ingmar; Uhlig, Steve; Kaafar, Mohamed Ali; Donnet, Benoît; Gueye, Bamba

    2011-01-01

    The most widely used technique for IP geolocation con- sists in building a database to keep the mapping between IP blocks and a geographic location. Several databases are available and are frequently used by many services and web sites in the Internet. Contrary to widespread belief, geolo- cation databases are far from being as reliable as they claim. In this paper, we conduct a comparison of several current geolocation databases -both commercial and free- to have an insight of the limitation...

  2. Refactoring of a Database

    OpenAIRE

    Dsousa, Ayeesha; Bhatia, Shalini

    2009-01-01

    The technique of database refactoring is all about applying disciplined and controlled techniques to change an existing database schema. The problem is to successfully create a Database Refactoring Framework for databases. This paper concentrates on the feasibility of adapting this concept to work as a generic template. To retain the constraints regardless of the modifications to the metadata, the paper proposes a MetaData Manipulation Tool to facilitate change. The tool adopts a Template Des...

  3. Scopus database: a review

    OpenAIRE

    Burnham, Judy F.

    2006-01-01

    The Scopus database provides access to STM journal articles and the references included in those articles, allowing the searcher to search both forward and backward in time. The database can be used for collection development as well as for research. This review provides information on the key points of the database and compares it to Web of Science. Neither database is inclusive, but complements each other. If a library can only afford one, choice must be based in institutional needs.

  4. Future database machine architectures

    OpenAIRE

    Hsiao, David K.

    1984-01-01

    There are many software database management systems available on many general-purpose computers ranging from micros to super-mainframes. Database machines as backened computers can offload the database management work from the mainframe so that we can retain the same mainframe longer. However, the database backend must also demonstrate lower cost, higher performance, and newer functionality. Some of the fundamental architecture issues in the design of high-performance and great-capacity datab...

  5. Library-Generated Databases

    OpenAIRE

    Brattli, Tore

    1999-01-01

    The development of the Internet and the World Wide Web has given libraries many new opportunities to disseminate organized information about internal and external collections to users. One of these possibilities is to make separate databases for information or services not sufficiently covered by the online public access catalog (OPAC) or other available databases. What’s new is that librarians can now create and maintain these databases and make them user-friendly. Library-generated database...

  6. Automated Oracle database testing

    CERN Document Server

    CERN. Geneva

    2014-01-01

    Ensuring database stability and steady performance in the modern world of agile computing is a major challenge. Various changes happening at any level of the computing infrastructure: OS parameters & packages, kernel versions, database parameters & patches, or even schema changes, all can potentially harm production services. This presentation shows how an automatic and regular testing of Oracle databases can be achieved in such agile environment.

  7. Mission and Assets Database

    Science.gov (United States)

    Baldwin, John; Zendejas, Silvino; Gutheinz, Sandy; Borden, Chester; Wang, Yeou-Fang

    2009-01-01

    Mission and Assets Database (MADB) Version 1.0 is an SQL database system with a Web user interface to centralize information. The database stores flight project support resource requirements, view periods, antenna information, schedule, and forecast results for use in mid-range and long-term planning of Deep Space Network (DSN) assets.

  8. CTD_DATABASE - Cascadia tsunami deposit database

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — The Cascadia Tsunami Deposit Database contains data on the location and sedimentological properties of tsunami deposits found along the Cascadia margin. Data have...

  9. Acerca de este sitio web

    Science.gov (United States)

    Página de guía que permite al lector entender la forma en que está organizado el sitio web del Instituto Nacional del Cáncer (NCI), las categorías de información disponibles y las políticas que rigen este sitio web.

  10. Keyword Search in Databases

    CERN Document Server

    Yu, Jeffrey Xu; Chang, Lijun

    2009-01-01

    It has become highly desirable to provide users with flexible ways to query/search information over databases as simple as keyword search like Google search. This book surveys the recent developments on keyword search over databases, and focuses on finding structural information among objects in a database using a set of keywords. Such structural information to be returned can be either trees or subgraphs representing how the objects, that contain the required keywords, are interconnected in a relational database or in an XML database. The structural keyword search is completely different from

  11. Nuclear power economic database

    International Nuclear Information System (INIS)

    Nuclear power economic database (NPEDB), based on ORACLE V6.0, consists of three parts, i.e., economic data base of nuclear power station, economic data base of nuclear fuel cycle and economic database of nuclear power planning and nuclear environment. Economic database of nuclear power station includes data of general economics, technique, capital cost and benefit, etc. Economic database of nuclear fuel cycle includes data of technique and nuclear fuel price. Economic database of nuclear power planning and nuclear environment includes data of energy history, forecast, energy balance, electric power and energy facilities

  12. An Interoperable Cartographic Database

    Directory of Open Access Journals (Sweden)

    Slobodanka Ključanin

    2007-05-01

    Full Text Available The concept of producing a prototype of interoperable cartographic database is explored in this paper, including the possibilities of integration of different geospatial data into the database management system and their visualization on the Internet. The implementation includes vectorization of the concept of a single map page, creation of the cartographic database in an object-relation database, spatial analysis, definition and visualization of the database content in the form of a map on the Internet. 

  13. Judy Estes Hall (1940-2015).

    Science.gov (United States)

    Sammons, Morgan T; Boucher, Andrew

    2016-01-01

    Presents an obituary for Judy Estes Hall, who passed away on November 24, 2015. Hall served as the Executive Officer of the National Register of Health Service Psychologists until her retirement in 2013. She is a recognized expert in the development of education and training standards for the profession of psychology, she also made significant contributions in the field of international psychology, where she was a renowned expert in cross-national credentialing and an advocate for commonality in licensing standards. She was the coauthor of one edited volume and author of more than 60 journal articles, book chapters, and professional publications. A passionate advocate for the advancement of women in psychology, a devoted mother and grandmother, a connoisseur of wine and international traveler extraordinaire, she touched the personal and professional lives of many. (PsycINFO Database Record PMID:27504582

  14. AcEST: DK960322 [AcEST

    Lifescience Database Archive (English)

    Full Text Available RDDRSSN 233 >tr|A8K6G9|A8K6G9_HUMAN cDNA FLJ76871, highly similar to Homo sapiens DEAH (Asp-Glu-Ala-His) box...AAGATTCAAATGTAGTCAGTGAGCGAGAGAGAGAG CATCGACCCTCGGATTCTGCCTCAAACAGGAGGACCTCAAGAGACAATCATACACCATC ■■Homology searc...avid J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nuc...ne: TST39A01NGRL0007_B17, 5' (659 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total letters Searc...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Q

  15. AcEST: BP914611 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389...-3402. Query= BP914611|Adiantum capillus-veneris mRNA, clone: YMU001_000061_A01. (426 letters) Databa... (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search ...061_A01. (426 letters) Database: uniprot_trembl.fasta 7,341,751 sequences; 2,391,615,440 total letters Searc...AUCA ADP-ribosylation factor 1 OS=Daucus carota ... 160 2e-39 sp|O48649|ARF1_SALBA ADP-ribosylation factor 1 OS=Salix bak

  16. AcEST: BP918800 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search pr...997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 2...5:3389-3402. Query= BP918800|Adiantum capillus-veneris mRNA, clone: YMU001_000117_F02. (546 letters) Database: uniprot_trembl.fasta...ograms, Nucleic Acids Res. 25:3389-3402. Query= BP918800|Adiantum capillus-veneris mRNA, clone: YMU001_00011...idopsis th... 181 2e-45 sp|O48649|ARF1_SALBA ADP-ribosylation factor 1 OS=Salix bak

  17. AcEST: BP914699 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Query= BP914699|Adiantum capillus-veneris mRNA, clone: YMU001_000061_H08. (146 letters) Database: uniprot_sprot.fasta...pillus-veneris mRNA, clone: YMU001_000061_H08. (146 letters) Database: uniprot_trembl.fasta..._TULBA Chitinase 1 OS=Tulipa bakeri Align length 42 Score (bit) 64.3 E-value 2.0e...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. .........done Score E Sequences producing significant alignments: (bits) Value sp|Q9SLP4|CHIT1_TULBA Chitinase 1 OS=Tulipa bak

  18. AcEST: DK957032 [AcEST

    Lifescience Database Archive (English)

    Full Text Available David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, N...lone: TST39A01NGRL0027_E19, 5' (639 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 tota...I-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK957...032|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0027_E19, 5' (639 letters) Databa...QVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF 113 >sp|O48650|SUI1_SALBA Protein translation factor SUI1 homolog OS=Salix bak

  19. Database Description - RMG | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us RMG Database... Description General information of database Database name RMG Alternative name Rice Mitochondri...ational Institute of Agrobiological Sciences E-mail : Database classification Nucleotide Sequence Databases ...Organism Taxonomy Name: Oryza sativa Japonica Group Taxonomy ID: 39947 Database description This database co...e of rice mitochondrial genome and information on the analysis results. Features and manner of utilization of database

  20. Bioinformatics glossary based Database of Biological Databases: DBD

    OpenAIRE

    Siva Kiran RR; Setty MVN; Hanumatha Rao G

    2009-01-01

    Database of Biological/Bioinformatics Databases (DBD) is a collection of 1669 databases and online resources collected from NAR Database Summary Papers (http://www.oxfordjournals.org/nar/database/a/) & Internet search engines. The database has been developed based on 437 keywords (Glossary) available in http://falcon.roswellpark.org/labweb/glossary.html. Keywords with their relevant databases are arranged in alphabetic order which enables quick accession of databases by researchers. Dat...

  1. AcEST: DK953737 [AcEST

    Lifescience Database Archive (English)

    Full Text Available b Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database searc...NGRL0018_J05, 5' (579 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 tota...SI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK95...3737|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0018_J05, 5' (579 letters) Database: uniprot_trembl.fasta...|O48649|ARF1_SALBA ADP-ribosylation factor 1 OS=Salix bakko GN... 347 3e-95 sp|P51821|ARF1_CHLRE ADP-ribosyl

  2. AcEST: DK962008 [AcEST

    Lifescience Database Archive (English)

    Full Text Available b Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database searc...neris mRNA, clone: TST39A01NGRL0011_L07, 5' (685 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 tota... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3...402. Query= DK962008|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0011_L07, 5' (685 letters) Database: uniprot_trembl.fasta...|O48649|ARF1_SALBA ADP-ribosylation factor 1 OS=Salix bakko GN... 350 3e-96 sp|P51821|ARF1_CHLRE ADP-ribosyl

  3. AcEST: DK963379 [AcEST

    Lifescience Database Archive (English)

    Full Text Available d BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402.... Query= DK963379|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0016_G03, 5' (550 letters) Database: uniprot_sprot.fasta...g, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database...T39A01NGRL0016_G03, 5' (550 letters) Database: uniprot_trembl.fasta 7,341,751 seq...idopsis th... 332 1e-90 sp|O48649|ARF1_SALBA ADP-ribosylation factor 1 OS=Salix bak

  4. AcEST: DK953191 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ler, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search pro...017_B23, 5' (574 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 tota...d BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402.... Query= DK953191|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0017_B23, 5' (574 letters) Database: uniprot_trembl.fasta...49|ARF1_SALBA ADP-ribosylation factor 1 OS=Salix bakko GN... 343 5e-94 sp|P51821|ARF1_CHLRE ADP-ribosylation

  5. AcEST: DK963098 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database s...9A01NGRL0015_J23, 5' (583 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 tota...d PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= D...K963098|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0015_J23, 5' (583 letters) Database: uniprot_trembl.fasta...4 sp|O48649|ARF1_SALBA ADP-ribosylation factor 1 OS=Salix bakko GN... 339 7e-93 sp|P51821|ARF1_CHLRE ADP-rib

  6. AcEST: DK951657 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ew generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK951657|Adiantum... capillus-veneris mRNA, clone: TST38A01NGRL0011_P20, 5' (478 letters) Database: uniprot_sprot.fasta 412,525 ...97), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25...11_P20, 5' (478 letters) Database: uniprot_trembl.fasta 7,341,751 sequences; 2,391,615,440 total letters Sea...VQ G+ KKEHIKIHGF Sbjct: 89 GDQRKNVSNFLVQAGIVKKEHIKIHGF 115 >sp|O48650|SUI1_SALBA Protein translation factor SUI1 homolog OS=Salix bak

  7. AcEST: DK944194 [AcEST

    Lifescience Database Archive (English)

    Full Text Available (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search ...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Quer...RL0005_E09, 5' (196 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total letters Sear...y= DK944194|Adiantum capillus-veneris mRNA, clone: YMU02A01NGRL0005_E09, 5' (196 letters) Database: uniprot_trembl.fasta...ts) Value tr|Q81ZV7|Q81ZV7_STRAW Putative serine/threonine protein kinase ... 34 3.2 >tr|Q81ZV7|Q81ZV7_STRAW Putative ser

  8. AcEST: DK943836 [AcEST

    Lifescience Database Archive (English)

    Full Text Available an (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Quer...J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic ...y= DK943836|Adiantum capillus-veneris mRNA, clone: YMU02A01NGRL0004_B21, 5' (168 letters) Database...Acids Res. 25:3389-3402. Query= DK943836|Adiantum capillus-veneris mRNA, clone: YMU02A01NGRL0004_B21, 5' (168 letters) Database...Definition sp|Q2KHR3|QSER1_HUMAN Glutamine and serine-rich protein 1 OS=Homo sapiens Align length 32 Score (

  9. AcEST: BP917938 [AcEST

    Lifescience Database Archive (English)

    Full Text Available , and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database se..., and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database sear...: YMU001_000107_E11. (370 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 tota...is mRNA, clone: YMU001_000107_E11. (370 letters) Database: uniprot_trembl.fasta 7,341,751 sequences; 2,391,615,440 total letter...it_id Q6F6W3 Definition sp|Q6F6W3|PSD_ACIAD Phosphatidylserine decarboxylase proenzyme OS=Acinetobacter sp.

  10. AcEST: DK946958 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Quer..., and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database se...y= DK946958|Adiantum capillus-veneris mRNA, clone: YMU02A01NGRL0014_E24, 5' (187 letters) Database: uniprot_sprot.fasta...is mRNA, clone: YMU02A01NGRL0014_E24, 5' (187 letters) Database: uniprot_trembl.fasta 7,341,751 se...s) Value sp|Q1ZXI5|Y1558_DICDI Probable serine/threonine-protein kinase D... 29 6.5 >sp|Q1ZXI5|Y1558_DICDI Probable ser

  11. AcEST: BP919486 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TTGGTATATATACTTCATTCAGATTCTCACAAGCATGGCTGACAGGTATTACAATCTAGA AAGACAAAACAACTTCAATCATCTCATTCCATGCAGCAGTTCACAG...ST and PSI-BLAST: a new generation of protein database search programs, Nucleic A...rs) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total letters Searching.......................dalis glossinidius... 32 1.7 sp|P39641|BACD_BACSU Alanine-anticapsin ligase bacD ... G+R Y+A + +HC+ +DW Sbjct: 111 YAQKYGRRDYRGGGRSSARETAMRVAAGAIAKKYLAQQCGVRVRGYLAQMGDIHCELKDW 170 >sp|P39641|BACD_BACSU Ala

  12. Database design and database administration for a kindergarten

    OpenAIRE

    Vítek, Daniel

    2009-01-01

    The bachelor thesis deals with creation of database design for a standard kindergarten, installation of the designed database into the database system Oracle Database 10g Express Edition and demonstration of the administration tasks in this database system. The verification of the database was proved by a developed access application.

  13. BBGD: an online database for blueberry genomic data

    Directory of Open Access Journals (Sweden)

    Matthews Benjamin F

    2007-01-01

    Full Text Available Abstract Background Blueberry is a member of the Ericaceae family, which also includes closely related cranberry and more distantly related rhododendron, azalea, and mountain laurel. Blueberry is a major berry crop in the United States, and one that has great nutritional and economical value. Extreme low temperatures, however, reduce crop yield and cause major losses to US farmers. A better understanding of the genes and biochemical pathways that are up- or down-regulated during cold acclimation is needed to produce blueberry cultivars with enhanced cold hardiness. To that end, the blueberry genomics database (BBDG was developed. Along with the analysis tools and web-based query interfaces, the database serves both the broader Ericaceae research community and the blueberry research community specifically by making available ESTs and gene expression data in searchable formats and in elucidating the underlying mechanisms of cold acclimation and freeze tolerance in blueberry. Description BBGD is the world's first database for blueberry genomics. BBGD is both a sequence and gene expression database. It stores both EST and microarray data and allows scientists to correlate expression profiles with gene function. BBGD is a public online database. Presently, the main focus of the database is the identification of genes in blueberry that are significantly induced or suppressed after low temperature exposure. Conclusion By using the database, researchers have developed EST-based markers for mapping and have identified a number of "candidate" cold tolerance genes that are highly expressed in blueberry flower buds after exposure to low temperatures.

  14. Genome Statute and Legislation Database

    Science.gov (United States)

    ... Database Welcome to the Genome Statute and Legislation Database The Genome Statute and Legislation Database is comprised ... the National Society of Genetic Counselors . Search the Database Search Tips You may select one or more ...

  15. Kinetic study of the effects of calcium ions on cationic artichoke (Cynara scolymus L.) peroxidase: calcium binding, steady-state kinetics and reactions with hydrogen peroxide.

    Science.gov (United States)

    Hiner, Alexander N P; Sidrach, Lara; Chazarra, Soledad; Varón, Ramón; Tudela, José; García-Cánovas, Francisco; Rodríguez-López, José Neptuno

    2004-01-01

    The apparent catalytic constant (k(cat)) of artichoke (Cynara scolymus L.) peroxidase (AKPC) with 2,2'-azino-bis(3-ethylbenzthiazoline-6-sulphonic acid) (ABTS) increased 130-fold in the presence of calcium ions (Ca2+) but the affinity (K(m)) of the enzyme for ABTS was 500 times lower than for Ca2+-free AKPC. AKPC is known to exhibit an equilibrium between 6-aquo hexa-coordinate and penta-coordinate forms of the haem iron that is modulated by Ca2+ and affects compound I formation. Measurements of the Ca2+ dissociation constant (K(D)) were complicated by the water-association/dissociation equilibrium yielding a global value more than 1000 times too high. The value for the Ca2+ binding step alone has now been determined to be K(D) approximately 10 nM. AKPC-Ca2+ was more resistant to inactivation by hydrogen peroxide (H(2)O(2)) and exhibited increased catalase activity. An analysis of the complex H(2)O(2) concentration dependent kinetics of Ca2+-free AKPC is presented. PMID:15556277

  16. Alkali-based pretreatments distinctively extract lignin and pectin for enhancing biomass saccharification by altering cellulose features in sugar-rich Jerusalem artichoke stem.

    Science.gov (United States)

    Li, Meng; Wang, Jun; Yang, Yuezhou; Xie, Guanghui

    2016-05-01

    Jerusalem artichoke (JA) has been known as a potential nonfood feedstock for biofuels. Based on systems analysis of total 59 accessions, both soluble sugar and ash could positively affect biomass digestibility after dilute sodium hydroxide pretreatment (A). In this study, one representative accession (HEN-3) was used to illustrate its enzymatic digestibility with pretreatments of ultrasonic-assisted dilute sodium hydroxide (B), alkaline peroxide (C), and ultrasonic-assisted alkaline peroxide (D). Pretreatment D exhibited the highest hexose release rate (79.4%) and total sugar yield (10.4g/L), which were 2.4 and 2.6 times higher, respectively, than those of the control. The analysis of cellulose crystalline index (CrI), cellulose degree of polymerization (DP), thermal behavior and SEM suggested that alkali-based pretreatments could distinctively extract lignin and pectin polymers, leading to significant alterations of cellulose CrI and DP for high biomass saccharification. Additionally, hydrogen peroxide (H2O2) could significant reduce the generation of fermentation inhibitors during alkali-based pretreatments. PMID:26918836

  17. Database Optimizing Services

    Directory of Open Access Journals (Sweden)

    Adrian GHENCEA

    2010-12-01

    Full Text Available Almost every organization has at its centre a database. The database provides support for conducting different activities, whether it is production, sales and marketing or internal operations. Every day, a database is accessed for help in strategic decisions. The satisfaction therefore of such needs is entailed with a high quality security and availability. Those needs can be realised using a DBMS (Database Management System which is, in fact, software for a database. Technically speaking, it is software which uses a standard method of cataloguing, recovery, and running different data queries. DBMS manages the input data, organizes it, and provides ways of modifying or extracting the data by its users or other programs. Managing the database is an operation that requires periodical updates, optimizing and monitoring.

  18. Conditioning Probabilistic Databases

    CERN Document Server

    Koch, Christoph

    2008-01-01

    Past research on probabilistic databases has studied the problem of answering queries on a static database. Application scenarios of probabilistic databases however often involve the conditioning of a database using additional information in the form of new evidence. The conditioning problem is thus to transform a probabilistic database of priors into a posterior probabilistic database which is materialized for subsequent query processing or further refinement. It turns out that the conditioning problem is closely related to the problem of computing exact tuple confidence values. It is known that exact confidence computation is an NP-hard problem. This has lead researchers to consider approximation techniques for confidence computation. However, neither conditioning nor exact confidence computation can be solved using such techniques. In this paper we present efficient techniques for both problems. We study several problem decomposition methods and heuristics that are based on the most successful search techn...

  19. Supply Chain Initiatives Database

    Energy Technology Data Exchange (ETDEWEB)

    None

    2012-11-01

    The Supply Chain Initiatives Database (SCID) presents innovative approaches to engaging industrial suppliers in efforts to save energy, increase productivity and improve environmental performance. This comprehensive and freely-accessible database was developed by the Institute for Industrial Productivity (IIP). IIP acknowledges Ecofys for their valuable contributions. The database contains case studies searchable according to the types of activities buyers are undertaking to motivate suppliers, target sector, organization leading the initiative, and program or partnership linkages.

  20. Database management systems

    CERN Document Server

    Pallaw, Vijay Krishna

    2010-01-01

    The text covers the fundamental concept and a complete guide to the prac- tical implementation of Database Management Systems. Concepts includes SQL, PL/SQL. These concepts include aspects of Database design, Data- base Languages, and Database System implementation. The entire book is divided into five units to ensure the smooth flow of the subject. The extra methodology makes it very useful for students as well as teachers.

  1. An organic database system

    OpenAIRE

    Kersten, Martin; Siebes, Arno

    1999-01-01

    The pervasive penetration of database technology may suggest that we have reached the end of the database research era. The contrary is true. Emerging technology, in hardware, software, and connectivity, brings a wealth of opportunities to push technology to a new level of maturity. Furthermore, ground breaking results are obtained in Quantum- and DNA-computing using nature as inspiration for its computational models. This paper provides a vision on a new brand of database architectures, i.e....

  2. Database Application Schema Forensics

    OpenAIRE

    Hector Quintus Beyers; Olivier, Martin S; Hancke, Gerhard P.

    2014-01-01

    The application schema layer of a Database Management System (DBMS) can be modified to deliver results that may warrant a forensic investigation. Table structures can be corrupted by changing the metadata of a database or operators of the database can be altered to deliver incorrect results when used in queries. This paper will discuss categories of possibilities that exist to alter the application schema with some practical examples. Two forensic environments are introduced where a forensic ...

  3. Web Technologies And Databases

    OpenAIRE

    Irina-Nicoleta Odoraba

    2011-01-01

    The database means a collection of many types of occurrences of logical records containing relationships between records and data elementary aggregates. Management System database (DBMS) - a set of programs for creating and operation of a database. Theoretically, any relational DBMS can be used to store data needed by a Web server. Basically, it was observed that the simple DBMS such as Fox Pro or Access is not suitable for Web sites that are used intensively. For large-scale Web applications...

  4. Fingerprint databases for theorems

    OpenAIRE

    Billey, Sara C.; Tenner, Bridget E.

    2013-01-01

    We discuss the advantages of searchable, collaborative, language-independent databases of mathematical results, indexed by "fingerprints" of small and canonical data. Our motivating example is Neil Sloane's massively influential On-Line Encyclopedia of Integer Sequences. We hope to encourage the greater mathematical community to search for the appropriate fingerprints within each discipline, and to compile fingerprint databases of results wherever possible. The benefits of these databases are...

  5. Categorical Database Generalization

    Institute of Scientific and Technical Information of China (English)

    LIU Yaolin; Martin Molenaar; AI Tinghua; LIU Yanfang

    2003-01-01

    This paper focuses on the issues of categorical database gen-eralization and emphasizes the roles ofsupporting data model, integrated datamodel, spatial analysis and semanticanalysis in database generalization.The framework contents of categoricaldatabase generalization transformationare defined. This paper presents an in-tegrated spatial supporting data struc-ture, a semantic supporting model andsimilarity model for the categorical da-tabase generalization. The concept oftransformation unit is proposed in generalization.

  6. Nuclear Science References Database

    OpenAIRE

    PRITYCHENKO B.; Běták, E.; B. Singh; Totans, J.

    2013-01-01

    The Nuclear Science References (NSR) database together with its associated Web interface, is the world's only comprehensive source of easily accessible low- and intermediate-energy nuclear physics bibliographic information for more than 210,000 articles since the beginning of nuclear science. The weekly-updated NSR database provides essential support for nuclear data evaluation, compilation and research activities. The principles of the database and Web application development and maintenance...

  7. Searching Databases with Keywords

    Institute of Scientific and Technical Information of China (English)

    Shan Wang; Kun-Long Zhang

    2005-01-01

    Traditionally, SQL query language is used to search the data in databases. However, it is inappropriate for end-users, since it is complex and hard to learn. It is the need of end-user, searching in databases with keywords, like in web search engines. This paper presents a survey of work on keyword search in databases. It also includes a brief introduction to the SEEKER system which has been developed.

  8. On Intelligent Database Systems

    OpenAIRE

    Dennis McLeod; Paul Yanover

    1992-01-01

    In response to the limitations of comtemporary database management systems in addressing the requirements of many potential application environments, and in view of the characteristics of emerging interconnected systems, we examine research directions involving adding more ‘intelligence’ to database systems. Three major thrusts in the intelligent database systems area are discussed. The first involves increasing the modeling power to represent an application environment. The second emphasis c...

  9. EST Express: PHP/MySQL based automated annotation of ESTs from expression libraries

    Directory of Open Access Journals (Sweden)

    Pardinas Jose R

    2008-04-01

    Full Text Available Abstract Background Several biological techniques result in the acquisition of functional sets of cDNAs that must be sequenced and analyzed. The emergence of redundant databases such as UniGene and centralized annotation engines such as Entrez Gene has allowed the development of software that can analyze a great number of sequences in a matter of seconds. Results We have developed "EST Express", a suite of analytical tools that identify and annotate ESTs originating from specific mRNA populations. The software consists of a user-friendly GUI powered by PHP and MySQL that allows for online collaboration between researchers and continuity with UniGene, Entrez Gene and RefSeq. Two key features of the software include a novel, simplified Entrez Gene parser and tools to manage cDNA library sequencing projects. We have tested the software on a large data set (2,016 samples produced by subtractive hybridization. Conclusion EST Express is an open-source, cross-platform web server application that imports sequences from cDNA libraries, such as those generated through subtractive hybridization or yeast two-hybrid screens. It then provides several layers of annotation based on Entrez Gene and RefSeq to allow the user to highlight useful genes and manage cDNA library projects.

  10. Veterans Administration Databases

    Science.gov (United States)

    The Veterans Administration Information Resource Center provides database and informatics experts, customer service, expert advice, information products, and web technology to VA researchers and others.

  11. Smart Location Database - Download

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Smart Location Database (SLD) summarizes over 80 demographic, built environment, transit service, and destination accessibility attributes for every census...

  12. Database Publication Practices

    DEFF Research Database (Denmark)

    Bernstein, P.A.; DeWitt, D.; Heuer, A.;

    2005-01-01

    There has been a growing interest in improving the publication processes for database research papers. This panel reports on recent changes in those processes and presents an initial cut at historical data for the VLDB Journal and ACM Transactions on Database Systems.......There has been a growing interest in improving the publication processes for database research papers. This panel reports on recent changes in those processes and presents an initial cut at historical data for the VLDB Journal and ACM Transactions on Database Systems....

  13. Residency Allocation Database

    Data.gov (United States)

    Department of Veterans Affairs — The Residency Allocation Database is used to determine allocation of funds for residency programs offered by Veterans Affairs Medical Centers (VAMCs). Information...

  14. Stanford Rock Physics database

    Energy Technology Data Exchange (ETDEWEB)

    Nolen-Hoeksema, R. (Stanford Univ., CA (United States)); Hart, C. (Envision Systems, Inc., Fremont, CA (United States))

    The authors have developed a relational database for the Stanford Rock Physics (SRP) Laboratory. The database is a flexible tool for helping researchers find relevant data. It significantly speeds retrieval of data and facilitates new organizations of rock physics information to get answers to research questions. The motivation for a database was to have a computer data storage, search, and display capability to explore the sensitivity of acoustic velocities to changes in the properties and states of rocks. Benefits include data exchange among researchers, discovery of new relations in existing data, and identification of new areas of research. The authors' goal was to build a database flexible enough for the dynamic and multidisciplinary research environment of rock physics. Databases are based on data models. A flexible data model must: (1) Not impose strong, prior constraints on the data; (2) not require a steep learning curve of the database architecture; and (3) be easy to modify. The authors' choice of the relational data model reflects these considerations. The database and some hardware and software considerations were influenced by their choice of data model, and their desire to provide a user-friendly interface for the database and build a distributed database system.

  15. IVR EFP Database

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This database contains trip-level reports submitted by vessels participating in Exempted Fishery projects with IVR reporting requirements.

  16. Database principles programming performance

    CERN Document Server

    O'Neil, Patrick

    2014-01-01

    Database: Principles Programming Performance provides an introduction to the fundamental principles of database systems. This book focuses on database programming and the relationships between principles, programming, and performance.Organized into 10 chapters, this book begins with an overview of database design principles and presents a comprehensive introduction to the concepts used by a DBA. This text then provides grounding in many abstract concepts of the relational model. Other chapters introduce SQL, describing its capabilities and covering the statements and functions of the programmi

  17. Transporter Classification Database (TCDB)

    Data.gov (United States)

    U.S. Department of Health & Human Services — The Transporter Classification Database details a comprehensive classification system for membrane transport proteins known as the Transporter Classification (TC)...

  18. Smart Location Database - Service

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Smart Location Database (SLD) summarizes over 80 demographic, built environment, transit service, and destination accessibility attributes for every census...

  19. Database Description - RPSD | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us RPSD Database... Description General information of database Database name RPSD Alternative name Summary inform...n National Institute of Agrobiological Sciences Toshimasa Yamazaki E-mail : Database classification Structure Database...idopsis thaliana Taxonomy ID: 3702 Taxonomy Name: Glycine max Taxonomy ID: 3847 Database description We have...nts such as rice, and have put together the result and related informations. This database contains the basi

  20. AcEST: DK953363 [AcEST

    Lifescience Database Archive (English)

    Full Text Available id J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucle...ic Acids Res. 25:3389-3402. Query= DK953363|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0017_J05, 5' (562 letters) Databa...: a new generation of protein database search programs, Nucleic Acids Res. 25:338...9-3402. Query= DK953363|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0017_J05, 5' (562 letters) Database: uniprot_trembl.fasta...A ADP-ribosylation factor 1 OS=Salix bakko GN... 335 7e-92 sp|P51821|ARF1_CHLRE ADP-ribosylation factor 1 OS

  1. AcEST: DK954934 [AcEST

    Lifescience Database Archive (English)

    Full Text Available BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK95493...4|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0021_M07, 5' (627 letters) Databa...d J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nuclei... TST39A01NGRL0021_M07, 5' (627 letters) Database: uniprot_trembl.fasta 7,341,751 sequences; 2,391,615,440 tota...idopsis th... 355 1e-97 sp|O48649|ARF1_SALBA ADP-ribosylation factor 1 OS=Salix bakko

  2. AcEST: DK963086 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 97), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25...15_J11, 5' (653 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total letters Searchin...ang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein databa...illus-veneris mRNA, clone: TST39A01NGRL0015_J11, 5' (653 letters) Database: uniprot_trembl.fasta 7,341,751 s...SRC3|ARF2_ARATH ADP-ribosylation factor 2 OS=Arabidopsis th... 352 7e-97 sp|O48649|ARF1_SALBA ADP-ribosylation factor 1 OS=Salix bak

  3. AcEST: DK954899 [AcEST

    Lifescience Database Archive (English)

    Full Text Available d David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, ...Nucleic Acids Res. 25:3389-3402. Query= DK954899|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0021_K20, 5' (546 letters) Databa...iller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search p...L0021_K20, 5' (546 letters) Database: uniprot_trembl.fasta 7,341,751 sequences; 2,391,615,440 total letters ...rotein translation factor SUI1 homolog OS=Salix bakko PE=3 SV=1 Length = 113 Score = 185 bits (469), Expect

  4. AcEST: DK949677 [AcEST

    Lifescience Database Archive (English)

    Full Text Available (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res...RL0006_K04, 5' (689 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total letters Sear...g Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein databa... capillus-veneris mRNA, clone: TST38A01NGRL0006_K04, 5' (689 letters) Database: uniprot_trembl.fasta 7,341,7...lation factor 1 OS=Salix bakko GN... 350 3e-96 sp|P51821|ARF1_CHLRE ADP-ribosylation factor 1 OS=Chlamydomon

  5. AcEST: DK960221 [AcEST

    Lifescience Database Archive (English)

    Full Text Available bb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein databa...eneris mRNA, clone: TST39A01NGRL0006_N06, 5' (760 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 tota...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK960221|Adian...tum capillus-veneris mRNA, clone: TST39A01NGRL0006_N06, 5' (760 letters) Database: uniprot_trembl.fasta 7,34...p|O48649|ARF1_SALBA ADP-ribosylation factor 1 OS=Salix bakko GN... 350 4e-96 sp|O

  6. AcEST: DK947388 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Ac...ids Res. 25:3389-3402. Query= DK947388|Adiantum capillus-veneris mRNA, clone: YMU02A01NGRL0015_L18, 5' (587 letters) Databa... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK947388|Adiantum c...apillus-veneris mRNA, clone: YMU02A01NGRL0015_L18, 5' (587 letters) Database: uniprot_trembl.fasta...-ribosylation factor 1 OS=Salix bakko GN... 268 1e-71 sp|P49076|ARF_MAIZE ADP-ribosylation factor OS=Zea may

  7. AcEST: DK947869 [AcEST

    Lifescience Database Archive (English)

    Full Text Available David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nu...cleic Acids Res. 25:3389-3402. Query= DK947869|Adiantum capillus-veneris mRNA, clone: YMU02A01NGRM0001_H12, 5' (589 letters) Databa... David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, N...lone: YMU02A01NGRM0001_H12, 5' (589 letters) Database: uniprot_trembl.fasta 7,341,751 sequences; 2,391,615,440 tota...ALBA ADP-ribosylation factor 1 OS=Salix bakko GN... 329 7e-90 sp|P51821|ARF1_CHLRE ADP-ribosylation factor 1

  8. AcEST: DK946792 [AcEST

    Lifescience Database Archive (English)

    Full Text Available b Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein databa...neris mRNA, clone: YMU02A01NGRL0013_M07, 5' (502 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 tota... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK946792|Adiant...um capillus-veneris mRNA, clone: YMU02A01NGRL0013_M07, 5' (502 letters) Database: uniprot_trembl.fasta...LQGDQRKNVSNFLVQAGIVKKEHIKIHGF 115 >sp|O48650|SUI1_SALBA Protein translation factor SUI1 homolog OS=Salix bak

  9. AcEST: DK955131 [AcEST

    Lifescience Database Archive (English)

    Full Text Available PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK9...55131|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0022_E12, 5' (539 letters) Database: uniprot_sprot.fasta..., Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:33...89-3402. Query= DK955131|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0022_E12, 5' (539 letters) Databa...idopsis th... 329 6e-90 sp|O48649|ARF1_SALBA ADP-ribosylation factor 1 OS=Salix bak

  10. AcEST: DK954993 [AcEST

    Lifescience Database Archive (English)

    Full Text Available n (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Re...s. 25:3389-3402. Query= DK954993|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0021_O18, 5' (230 letters) Databa... and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query...= DK954993|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0021_O18, 5' (230 letters) Database: uniprot_trembl.fasta...F1_SALBA ADP-ribosylation factor 1 OS=Salix bakko GN... 30 2.9 sp|O23778|ARF1_CAT

  11. AcEST: DK955845 [AcEST

    Lifescience Database Archive (English)

    Full Text Available er, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein databa...mRNA, clone: TST39A01NGRL0024_C23, 5' (765 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 tota...LAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Q...uery= DK955845|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0024_C23, 5' (765 letters) Database: uniprot_trembl.fasta...9|ARF1_SALBA ADP-ribosylation factor 1 OS=Salix bakko GN... 350 4e-96 sp|P51821|A

  12. AcEST: DK959557 [AcEST

    Lifescience Database Archive (English)

    Full Text Available nd PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= ...DK959557|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0005_A10, 5' (634 letters) Databa...nd David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs,... clone: TST39A01NGRL0005_A10, 5' (634 letters) Database: uniprot_trembl.fasta 7,341,751 sequences; 2,391,615,440 tota...-ribosylation factor 2 OS=Arabidopsis th... 355 1e-97 sp|O48649|ARF1_SALBA ADP-ribosylation factor 1 OS=Salix bak

  13. AcEST: DK944133 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ed BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-340...2. Query= DK944133|Adiantum capillus-veneris mRNA, clone: YMU02A01NGRL0005_B06, 5' (567 letters) Database: uniprot_sprot.fasta...eng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein databa...um capillus-veneris mRNA, clone: YMU02A01NGRL0005_B06, 5' (567 letters) Database: uniprot_trembl.fasta 7,341...RF1_SALBA ADP-ribosylation factor 1 OS=Salix bakko GN... 105 2e-22 sp|P51821|ARF1_CHLRE ADP-ribosylation fac

  14. AcEST: DK951127 [AcEST

    Lifescience Database Archive (English)

    Full Text Available (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res...RL0010_J02, 5' (679 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total letters Sear...ang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein databa...TST38A01NGRL0010_J02, 5' (679 letters) Database: uniprot_trembl.fasta 7,341,751 sequences; 2,391,615,440 tota...lation factor 1 OS=Salix bakko GN... 342 1e-93 sp|O23778|ARF1_CATRO ADP-ribosylation factor 1 OS=Catharanthu

  15. AcEST: DK959993 [AcEST

    Lifescience Database Archive (English)

    Full Text Available generation of protein database search programs, Nucleic Acids Res. 25:3389-3402.... Query= DK959993|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0006_D03, 5' (444 letters) Database: uniprot_sprot.fasta...id J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucle...ic Acids Res. 25:3389-3402. Query= DK959993|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0006_D03, 5' (444 letters) Databa...0 sp|O48649|ARF1_SALBA ADP-ribosylation factor 1 OS=Salix bakko GN... 129 4e-30 sp|Q5RCF1|ARF4_PONAB ADP-rib

  16. AcEST: DK960400 [AcEST

    Lifescience Database Archive (English)

    Full Text Available b Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein databa...neris mRNA, clone: TST39A01NGRL0007_F02, 5' (768 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 tota...pped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3...402. Query= DK960400|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0007_F02, 5' (768 letters) Database: uniprot_trembl.fasta...|O48649|ARF1_SALBA ADP-ribosylation factor 1 OS=Salix bakko GN... 350 4e-96 sp|P5

  17. AcEST: DK952868 [AcEST

    Lifescience Database Archive (English)

    Full Text Available and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein databa..., clone: TST38A01NGRL0015_E04, 5' (532 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 tota...: a new generation of protein database search programs, Nucleic Acids Res. 25:338...9-3402. Query= DK952868|Adiantum capillus-veneris mRNA, clone: TST38A01NGRL0015_E04, 5' (532 letters) Database: uniprot_trembl.fasta...RF1 ... 195 1e-49 sp|O48649|ARF1_SALBA ADP-ribosylation factor 1 OS=Salix bakko GN... 194 2e-49 sp|Q10943|AR

  18. AcEST: DK962118 [AcEST

    Lifescience Database Archive (English)

    Full Text Available , and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search progra...NA, clone: TST39A01NGRL0013_A02, 5' (602 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 tota.... Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic A...cids Res. 25:3389-3402. Query= DK962118|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0013_A02, 5' (602 letters) Databa...LKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKKEHIKIHGF 115 >sp|O48650|SUI1_SALBA Protein translation factor SUI1 homolog OS=Salix bak

  19. AcEST: DK957555 [AcEST

    Lifescience Database Archive (English)

    Full Text Available David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, N...ucleic Acids Res. 25:3389-3402. Query= DK957555|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0028_K22, 5' (566 letters) Databa...and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query=... DK957555|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0028_K22, 5' (566 letters) Database: uniprot_trembl.fasta...SALBA ADP-ribosylation factor 1 OS=Salix bakko GN... 340 2e-93 sp|P51821|ARF1_CHLRE ADP-ribosylation factor

  20. AcEST: DK955060 [AcEST

    Lifescience Database Archive (English)

    Full Text Available LAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Q...uery= DK955060|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0022_B13, 5' (532 letters) Database: uniprot_sprot.fasta...g Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein databa... capillus-veneris mRNA, clone: TST39A01NGRL0022_B13, 5' (532 letters) Database: uniprot_trembl.fasta 7,341,7...idopsis th... 319 5e-87 sp|O48649|ARF1_SALBA ADP-ribosylation factor 1 OS=Salix bak

  1. AcEST: DK955966 [AcEST

    Lifescience Database Archive (English)

    Full Text Available I-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK955...966|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0024_I03, 5' (629 letters) Databa...vid J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucl...e: TST39A01NGRL0024_I03, 5' (629 letters) Database: uniprot_trembl.fasta 7,341,751 sequences; 2,391,615,440 tota...sylation factor 2 OS=Arabidopsis th... 355 1e-97 sp|O48649|ARF1_SALBA ADP-ribosylation factor 1 OS=Salix bak

  2. AcEST: DK962642 [AcEST

    Lifescience Database Archive (English)

    Full Text Available pped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3...402. Query= DK962642|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0014_G17, 5' (646 letters) Databa...bb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database sear...eneris mRNA, clone: TST39A01NGRL0014_G17, 5' (646 letters) Database: uniprot_trembl.fasta 7,341,751 sequences; 2,391,615,440 tota...F2_ARATH ADP-ribosylation factor 2 OS=Arabidopsis th... 355 1e-97 sp|O48649|ARF1_SALBA ADP-ribosylation factor 1 OS=Salix bak

  3. AcEST: DK954864 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:338... Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database s...s-veneris mRNA, clone: TST39A01NGRL0021_J08, 5' (649 letters) Database: uniprot_trembl.fasta 7,341,751 sequences; 2,391,615,440 tota...9-3402. Query= DK954864|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0021_J...|ARF2_ARATH ADP-ribosylation factor 2 OS=Arabidopsis th... 355 1e-97 sp|O48649|ARF1_SALBA ADP-ribosylation factor 1 OS=Salix bak

  4. AcEST: DK944847 [AcEST

    Lifescience Database Archive (English)

    Full Text Available bb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database sear...1NGRL0007_G02, 5' (293 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 tota...Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Aci...ds Res. 25:3389-3402. Query= DK944847|Adiantum capillus-veneris mRNA, clone: YMU02A01NGRL0007_G02, 5' (293 letters) Databa...J ADP-ribosylation factor 2 OS=Oryza sativa s... 68 2e-11 sp|O48649|ARF1_SALBA ADP-ribosylation factor 1 OS=Salix bak

  5. AcEST: DK957120 [AcEST

    Lifescience Database Archive (English)

    Full Text Available avid J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein databa...ne: TST39A01NGRL0027_I13, 5' (751 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 tota...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK9...57120|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0027_I13, 5' (751 letters) Database: uniprot_trembl.fasta...LBA ADP-ribosylation factor 1 OS=Salix bakko GN... 350 4e-96 sp|P51821|ARF1_CHLRE

  6. AcEST: DK960632 [AcEST

    Lifescience Database Archive (English)

    Full Text Available LAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Q...uery= DK960632|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0007_P03, 5' (526 letters) Database: uniprot_sprot.fasta...ang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein databa...|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0007_P03, 5' (526 letters) Database: uniprot_trembl.fasta...idopsis th... 251 3e-72 sp|O48649|ARF1_SALBA ADP-ribosylation factor 1 OS=Salix bak

  7. AcEST: BP913692 [AcEST

    Lifescience Database Archive (English)

    Full Text Available BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913692|Adia...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913692|Adiantum capillus-vener...ntum capillus-veneris mRNA, clone: YMU001_000033_B12. (601 letters) Database: uniprot_tr...mosome undetermined scaffold_334, who... 84 6e-15 tr|B2ZTQ6|B2ZTQ6_SEPES Muscle myosin heavy chain OS=Sepia escule...9V6R9|A9V6R9_MONBE Predicted protein OS=Monosiga brevicollis... 45 0.003 tr|B2ZTQ5|B2ZTQ5_LOLBL Muscle myosi

  8. AcEST: BP915833 [AcEST

    Lifescience Database Archive (English)

    Full Text Available nd PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915833|Adiantum capi...d BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915833|Adia...in cut-like 1 OS=Homo sapiens... 37 0.11 sp|A8L6J3|CNPD_FRASN 2',3'-cyclic-nucleotide 2'-phosphodiestera...beta ... 38 0.048 sp|O76329|ACTNB_DICDI Interaptin OS=Dictyostelium discoideum GN=... 38 0.048 sp|P39880|CUX1_HUMAN Homeobox prote...ntum capillus-veneris mRNA, clone: YMU001_000077_F03. (622 letters) Database: uniprot_sprot

  9. AcEST: BP912476 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 5CJ83|Q5CJ83_CRYHO Putative uncharacterized protein OS=Crypt... 46 0.001 tr|B2ZTQ6|B2ZTQ6_SEPES Muscle myosin heavy chain OS=Sepia...y= BP912476|Adiantum capillus-veneris mRNA, clone: YMU001_000019_H07. (531 letters) Database: uniprot_sprot..., and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucle...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Quer...bits) Value sp|Q8S2T0|GRIP_ARATH Protein GRIP OS=Arabidopsis thaliana GN=GRI... 121 2e-27 sp|Q5TZA2|CROCC_HUMAN Rootle

  10. AcEST: BP913370 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 1_000029_E04. (480 letters) Database: uniprot_trembl.fasta 7,341,751 sequences; 2,391,615,440 total letters ...mRNA, clone: YMU001_000029_E04. (480 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 tota...tein OS=Solanum ber... 35 2.4 tr|Q9W003|Q9W003_DROME Spinophilin OS=Drosophila melanogaster GN... 35 2.4 tr...ive uncharacterized protein OS=Glossina pallidipes salivary gland hypertrophy virus GN=SGHV062 PE=4 SV...er, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res

  11. AcEST: DK947100 [AcEST

    Lifescience Database Archive (English)

    Full Text Available David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, N...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Quer...ucleic Acids Res. 25:3389-3402. Query= DK947100|Adiantum capillus-veneris mRNA, clone: YMU02A01NGRL0014_M18, 5' (211 letters) Databas...y= DK947100|Adiantum capillus-veneris mRNA, clone: YMU02A01NGRL0014_M18, 5' (211 letters) Database: uniprot_trembl.fasta...ificant alignments: (bits) Value sp|Q55A09|Y9963_DICDI Probable serine/threonine-protein kinase D... 30 3.7

  12. GRAPH DATABASES AND GRAPH VIZUALIZATION

    OpenAIRE

    Klančar, Jure

    2013-01-01

    The thesis presents graph databases. Graph databases are a part of NoSQL databases, which is why this thesis presents basics of NoSQL databases as well. We have focused on advantages of graph databases compared to rela- tional databases. We have used one of native graph databases (Neo4j), to present more detailed processing of graph databases. To get more acquainted with graph databases and its principles, we developed a simple application that uses a Neo4j graph database to...

  13. CDS - Database Administrator's Guide

    Science.gov (United States)

    Day, J. P.

    This guide aims to instruct the CDS database administrator in: o The CDS file system. o The CDS index files. o The procedure for assimilating a new CDS tape into the database. It is assumed that the administrator has read SUN/79.

  14. Directory of IAEA databases

    International Nuclear Information System (INIS)

    This second edition of the Directory of IAEA Databases has been prepared within the Division of Scientific and Technical Information (NESI). Its main objective is to describe the computerized information sources available to staff members. This directory contains all databases produced at the IAEA, including databases stored on the mainframe, LAN's and PC's. All IAEA Division Directors have been requested to register the existence of their databases with NESI. For the second edition database owners were requested to review the existing entries for their databases and answer four additional questions. The four additional questions concerned the type of database (e.g. Bibliographic, Text, Statistical etc.), the category of database (e.g. Administrative, Nuclear Data etc.), the available documentation and the type of media used for distribution. In the individual entries on the following pages the answers to the first two questions (type and category) is always listed, but the answers to the second two questions (documentation and media) is only listed when information has been made available

  15. A Quality System Database

    Science.gov (United States)

    Snell, William H.; Turner, Anne M.; Gifford, Luther; Stites, William

    2010-01-01

    A quality system database (QSD), and software to administer the database, were developed to support recording of administrative nonconformance activities that involve requirements for documentation of corrective and/or preventive actions, which can include ISO 9000 internal quality audits and customer complaints.

  16. An organic database system

    NARCIS (Netherlands)

    Kersten, M.L.; Siebes, A.P.J.M.

    1999-01-01

    The pervasive penetration of database technology may suggest that we have reached the end of the database research era. The contrary is true. Emerging technology, in hardware, software, and connectivity, brings a wealth of opportunities to push technology to a new level of maturity. Furthermore, gro

  17. Atomic Spectra Database (ASD)

    Science.gov (United States)

    SRD 78 NIST Atomic Spectra Database (ASD) (Web, free access)   This database provides access and search capability for NIST critically evaluated data on atomic energy levels, wavelengths, and transition probabilities that are reasonably up-to-date. The NIST Atomic Spectroscopy Data Center has carried out these critical compilations.

  18. Children's Culture Database (CCD)

    DEFF Research Database (Denmark)

    Wanting, Birgit

    a Dialogue inspired database with documentation, network (individual and institutional profiles) and current news , paper presented at the research seminar: Electronic access to fiction, Copenhagen, November 11-13, 1996......a Dialogue inspired database with documentation, network (individual and institutional profiles) and current news , paper presented at the research seminar: Electronic access to fiction, Copenhagen, November 11-13, 1996...

  19. Dictionary as Database.

    Science.gov (United States)

    Painter, Derrick

    1996-01-01

    Discussion of dictionaries as databases focuses on the digitizing of The Oxford English dictionary (OED) and the use of Standard Generalized Mark-Up Language (SGML). Topics include the creation of a consortium to digitize the OED, document structure, relational databases, text forms, sequence, and discourse. (LRW)

  20. Biological Macromolecule Crystallization Database

    Science.gov (United States)

    SRD 21 Biological Macromolecule Crystallization Database (Web, free access)   The Biological Macromolecule Crystallization Database and NASA Archive for Protein Crystal Growth Data (BMCD) contains the conditions reported for the crystallization of proteins and nucleic acids used in X-ray structure determinations and archives the results of microgravity macromolecule crystallization studies.

  1. Neutrosophic Relational Database Decomposition

    OpenAIRE

    Meena Arora; Ranjit Biswas; Dr. U.S.Pandey

    2011-01-01

    In this paper we present a method of decomposing a neutrosophic database relation with Neutrosophic attributes into basic relational form. Our objective is capable of manipulating incomplete as well as inconsistent information. Fuzzy relation or vague relation can only handle incomplete information. Authors are taking the Neutrosophic Relational database [8],[2] to show how imprecise data can be handled in relational schema.

  2. AcEST: BP919978 [AcEST

    Lifescience Database Archive (English)

    Full Text Available J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res...7X5_ENT38 Periplasmic binding protein OS=Enterobact... 34 4.2 tr|A6DD58|A6DD58_9PROT Transcription-repair coupling fact...GCCCAAATGCTTGACTCTGT CCATGAAGTTTTCAACACACTTCGCTAATTCACTATCCTTGGCAGTACCACAAACTTGCC ■■Homology search res... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919978|A...ults ■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swiss-Prot sp_hit_id A9L1I0 Definition

  3. AcEST: BP911777 [AcEST

    Lifescience Database Archive (English)

    Full Text Available tr|B6YYG2|B6YYG2_9RHOB Binding-protein-dependent transport systems inner membrane component, putative OS=Pseudovibr...terized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_111045 PE=4 SV=1 Length = 4...AST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Qu... J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acid...nts: (bits) Value tr|A7GQV4|A7GQV4_BACCN Putative uncharacterized protein OS=Baci

  4. AcEST: BP916028 [AcEST

    Lifescience Database Archive (English)

    Full Text Available EGHFAREC 934 >tr|A1TQ72|A1TQ72_ACIAC Binding-protein-dependent transport systems inner membra...terized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_124711 PE=4 SV=1 Length = 39...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9160... J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acid...ne component OS=Acidovorax avenae subsp. citrulli (strain AAC00-1) GN=Aave_2537 PE=3 SV=1 Length

  5. AcEST: DK951528 [AcEST

    Lifescience Database Archive (English)

    Full Text Available enylpyruvate dioxygenase OS=Mycosphaerella graminicola GN=HPPD PE=3 SV=1 Length = 419 Score = 56.2 bits (134), Expec..., and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search progra...|Q9HYB8|RNFC_PSEAE Electron transport complex protein rnfC OS=... 32 4.1 sp..., and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search progra...1 Length = 443 Score = 157 bits (398), Expect = 5e-37 Identities = 95/214 (44%), Positives = 116/214 (54%), Gaps = 3/214 (1%) Fra

  6. AcEST: BP920166 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_G12 149 Adiantum capillus-veneris mRNA. clone: YMU001_000133_G12. BP920166 - Show BP92016...is mRNA. clone: YMU001_000133_G12. Accession BP920166 Tissue type prothallium Developmental stage - Contig I...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92016...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920166|Adiantum capillus-veneris

  7. AcEST: BP920169 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_H03 505 Adiantum capillus-veneris mRNA. clone: YMU001_000133_H03. BP920169 - Show BP92016...is mRNA. clone: YMU001_000133_H03. Accession BP920169 Tissue type prothallium Developmental stage - Contig I...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92016...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920169|Adiantum cap

  8. AcEST: BP920165 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_G11 301 Adiantum capillus-veneris mRNA. clone: YMU001_000133_G11. BP920165 - Show BP92016...is mRNA. clone: YMU001_000133_G11. Accession BP920165 Tissue type prothallium Developmental stage - Contig I...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920165...and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92016

  9. AcEST: BP920161 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_G06 542 Adiantum capillus-veneris mRNA. clone: YMU001_000133_G06. BP920161 - Show BP92016...is mRNA. clone: YMU001_000133_G06. Accession BP920161 Tissue type prothallium Developmental stage - Contig I...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9201...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92016

  10. AcEST: BP921378 [AcEST

    Lifescience Database Archive (English)

    Full Text Available p_hit_id Q03091 Definition sp|Q03091|BSN1_BACAM Extracellular ribonuclease OS=Bacillus amyloliquefaciens Ali...1e-10 sp|O32150|BSN2_BACSU Extracellular ribonuclease OS=Bacillus subt... 64 7e-10 sp|A6QR56|A16A1_BOVIN Ald...CATGCAGAACATTG AAAAAGACAATGATGCCTCGTATTTTCAAACATCTGTAATTATGGTACGTTATTGAGATG TAACACTATTGTTATGTGT ■■Homology searc...(1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search p...49_B07. (559 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total letters Searching..

  11. AcEST: BP913060 [AcEST

    Lifescience Database Archive (English)

    Full Text Available AAGGGAGGTCAGCAAACTCTGCAT CTCCCATTTTGGCAATTGTTTGGTGGTCGAGCAAATTTTCAAATTTGACGTGGAGGCATA CATTAGAATGTGTAAATTGACA..._id Q5FLW6 Definition sp|Q5FLW6|SYA_LACAC Alanyl-tRNA synthetase OS=Lactobacillus acidophilus Al...d J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nuclei... YMU001_000026_A08. (451 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total letters Searc...gnments: (bits) Value sp|Q5FLW6|SYA_LACAC Alanyl-tRNA synthetase OS=Lactobacillus

  12. AcEST: DK956810 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TCATGACAGATGGTTTCAATAGTTGCAGAAACATCACTTTGCAATTTCACTGAAGGTGC CAT ■■Homology search results ■■ - Swiss-Prot (release 56.9) Link to Bla...pped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3... 5' (603 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total letters Searching.........Value sp|Q54MJ7|ALAM_DICDI Probable alanine aminotransferase, mitochon... 147 3e-...36 sp|P52894|ALA2_HORVU Alanine aminotransferase 2 OS=Hordeum vulga... 140 7e-35 sp|P34106|ALA2_PANMI Alanin

  13. AcEST: BP916356 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CTTCTAGTGGCTCA CAAAGTGCGAGGTTAGATCCTAAGCTGACTAAGACTGATGCTG ■■Homology search results ■■ - Swiss-Prot (release 56.9) Link to Bla...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. ...rot.fasta 412,525 sequences; 148,809,765 total letters Searching...............................................r_hit_id A8IZF4 Definition tr|A8IZF4|A8IZF4_CHLRE Predicted protein (Fragment) OS=Chlamydomonas reinhardtii Al...1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search pr

  14. AcEST: DK951776 [AcEST

    Lifescience Database Archive (English)

    Full Text Available GAGTGAATCTTAGGAGGGATTGGGAACAATATTGCGCAGCCAAATG ATTAAATGTAGTGTAGTTTGGGTCTTTTGGAGTC ■■Homology searc...Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Aci...etters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total letters Searc...attus norvegicus G... 30 8.6 sp|O86786|ALR_STRCO Alanine racemase OS=Streptomyces coelicolor ... 30 8.6 >sp|...++ Q V+Q Sbjct: 3 RDFGEPGPSSGAGSAY-GRPAQPQQAQTQTVQQ 34 >sp|O86786|ALR_STRCO Alanine racemase OS=Streptomyces

  15. AcEST: BP913935 [AcEST

    Lifescience Database Archive (English)

    Full Text Available |Q95K74|CL053_MACFA Uncharacterized protein C12orf53 homolog OS=Macaca fascicularis Al...AGCTAGAAGAGCTGCTGGACGAGG AATCGGGGCTGGTTGGAGCGACGCCGGAGAGGCAGGGGACAGAGGAGCAGCTGGTGTAAG GGCGAAC ■■Homology searc...an (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids R...00038_A09. (427 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total letters Searchin...iens GN=... 32 0.82 sp|Q60HH4|ASAH1_MACFA Acid ceramidase OS=Macaca fascicularis

  16. AcEST: DK955177 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 0. 5' end sequence. DK955177 CL331Contig1 Show DK955177 Clone id TST39A01NGRL0022_G10 Library TST39 Length 5...94 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0022_G10. 5' end sequence. Accession DK955177... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK955177|Adia...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK955177

  17. AcEST: BP917787 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_D11 582 Adiantum capillus-veneris mRNA. clone: YMU001_000105_D11. BP917787 - Show BP9177...is mRNA. clone: YMU001_000105_D11. Accession BP917787 Tissue type prothallium Developmental stage - Contig I...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917787|Adiantum capillus-veneris mRNA,...apped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177

  18. AcEST: BP911772 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000009_A06 326 Adiantum capillus-veneris mRNA. clone: YMU001_000009_A06. BP911772 - Show BP91177...is mRNA. clone: YMU001_000009_A06. Accession BP911772 Tissue type prothallium Developmental stage - Contig I...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91177...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91177

  19. AcEST: BP917741 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_H02 445 Adiantum capillus-veneris mRNA. clone: YMU001_000104_H02. BP917741 - Show BP9177...is mRNA. clone: YMU001_000104_H02. Accession BP917741 Tissue type prothallium Developmental stage - Contig I... Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177

  20. AcEST: BP917740 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_G12 396 Adiantum capillus-veneris mRNA. clone: YMU001_000104_G12. BP917740 - Show BP9177...is mRNA. clone: YMU001_000104_G12. Accession BP917740 Tissue type prothallium Developmental stage - Contig I...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917740|Adiantum capillus-veneris mR...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917740|Adiantum ...: 4 DLLKAYVTEVDQRDQWKNHSPLVEYVYNYSTHTSTRKTLFKVTEERLKIRLIVKTLG--K 177 D+L+A V +D +

  1. AcEST: BP917700 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_D02 544 Adiantum capillus-veneris mRNA. clone: YMU001_000104_D02. BP9177...00 CL272Contig1 Show BP917700 Clone id YMU001_000104_D02 Library YMU01 Length 544 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000104_D02. Accession BP917700 Tissue type prothallium Developmental stage... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917700|Adiantum capillus-ven...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917700|Adiantum capillus-vener

  2. AcEST: BP917775 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_C08 544 Adiantum capillus-veneris mRNA. clone: YMU001_000105_C08. BP917775 - Show BP9177...is mRNA. clone: YMU001_000105_C08. Accession BP917775 Tissue type prothallium Developmental stage - Contig I...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917775|Adiantum capill

  3. AcEST: BP917780 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_D03 505 Adiantum capillus-veneris mRNA. clone: YMU001_000105_D03. BP917780 - Show BP9177...is mRNA. clone: YMU001_000105_D03. Accession BP917780 Tissue type prothallium Developmental stage - Contig I...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917780|Ad...) Frame = +1 Query: 229 TLGN*FDLFGPPIRRLPF-WIVLWSILGLA*GGAC 330 TLG D+F P ++LP W+ LWS LG GG C Sbjct: 177

  4. AcEST: BP911775 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000009_A09 285 Adiantum capillus-veneris mRNA. clone: YMU001_000009_A09. BP91177...5 CL2064Contig1 Show BP911775 Clone id YMU001_000009_A09 Library YMU01 Length 285 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000009_A09. Accession BP911775 Tissue type prothallium Developmental stag...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911775...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911775|Adiantum capillus

  5. AcEST: BP917799 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_F02 443 Adiantum capillus-veneris mRNA. clone: YMU001_000105_F02. BP917799 - Show BP9177...is mRNA. clone: YMU001_000105_F02. Accession BP917799 Tissue type prothallium Developmental stage - Contig I...BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91779...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917799|Adiantum capillus

  6. AcEST: DK951177 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 6. 5' end sequence. DK951177 CL490Contig1 Show DK951177 Clone id TST38A01NGRL0010_L06 Library TST38 Length 6...29 Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0010_L06. 5' end sequence. Accession DK951177...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK951177|Adiantum capillus-vene...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK951177|Adiantum capillus-veneris m

  7. AcEST: BP917785 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_D09 516 Adiantum capillus-veneris mRNA. clone: YMU001_000105_D09. BP917785 - Show BP9177...is mRNA. clone: YMU001_000105_D09. Accession BP917785 Tissue type prothallium Developmental stage - Contig I...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917785|Adiantum capillus-veneris mRNA,

  8. AcEST: BP916177 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000084_C01 435 Adiantum capillus-veneris mRNA. clone: YMU001_000084_C01. BP916177 - Show BP916177...is mRNA. clone: YMU001_000084_C01. Accession BP916177 Tissue type prothallium Developmental stage - Contig I...AST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916177...d PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916177

  9. AcEST: BP917716 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_E09 452 Adiantum capillus-veneris mRNA. clone: YMU001_000104_E09. BP9177...16 CL2904Contig1 Show BP917716 Clone id YMU001_000104_E09 Library YMU01 Length 452 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000104_E09. Accession BP917716 Tissue type prothallium Developmental stag...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917716|Adiant...T and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177

  10. AcEST: BP917771 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_C03 433 Adiantum capillus-veneris mRNA. clone: YMU001_000105_C03. BP917771 - Show BP9177...is mRNA. clone: YMU001_000105_C03. Accession BP917771 Tissue type prothallium Developmental stage - Contig I...LAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177

  11. AcEST: DK948177 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 1. 5' end sequence. DK948177 CL759Contig1 Show DK948177 Clone id TST38A01NGRL0002_K01 Library TST38 Length 6...19 Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0002_K01. 5' end sequence. Accession DK948177...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK948177|Adiantu...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK948177

  12. AcEST: BP914124 [AcEST

    Lifescience Database Archive (English)

    Full Text Available jandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BL...2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Mille...ery= BP914124|Adiantum capillus-veneris mRNA, clone: YMU001_000042_B06. (320 letters) Database: uniprot_spro...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914124|Adiantum capillus...YMU001_000042_B06 320 Adiantum capillus-veneris mRNA. clone: YMU001_000042_B06. BP9

  13. AcEST: BP919971 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ce: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Mille...affer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gappe...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919971|Adiantum capillus-veneris mRNA.... Query= BP919971|Adiantum capillus-veneris mRNA, clone: YMU001_000131_D09. (312 letters) Database: uniprot_...YMU001_000131_D09 312 Adiantum capillus-veneris mRNA. clone: YMU001_000131_D09. BP9

  14. AcEST: DK955101 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 6. 5' end sequence. DK955101 CL152Contig1 Show DK955101 Clone id TST39A01NGRL0022_D06 Library TST39 Length 6...07 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0022_D06. 5' end sequence. Accession DK955101...apped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK955101...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK955101|Adiantum capillus-veneris ...IPAYLTGEVPGDYGYDPFGLSKKPEDFDRYQAYEL 101 Query: 370 IHARWAMLGAAGFVLPEAFNKYGAICGPEAVWFKTGALLLDGGSLEYFGATVPVNLA

  15. AcEST: DK959101 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 0. 5' end sequence. DK959101 CL3467Contig1 Show DK959101 Clone id TST39A01NGRL0003_M10 Library TST39 Length ...684 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0003_M10. 5' end sequence. Accession DK959101...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK959101...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25...:3389-3402. Query= DK959101|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0003_M10, 5' (684 letters) Da

  16. AcEST: BP919715 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_C11 494 Adiantum capillus-veneris mRNA. clone: YMU001_000128_C11. BP91971...5 CL3828Contig1 Show BP919715 Clone id YMU001_000128_C11 Library YMU01 Length 494 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000128_C11. Accession BP919715 Tissue type prothallium Developmental stag...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91971... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919715|Adia

  17. AcEST: BP920355 [AcEST

    Lifescience Database Archive (English)

    Full Text Available sphosulfate reductase OS=Serratia proteamaculans (strain 568) GN=cysH PE=3 SV=1 L...20355 - Show BP920355 Clone id YMU001_000136_B07 Library YMU01 Length 298 Definition Adiantum capillus-vener...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920355|Adiantum capillus-vener...1 AWQEARYGKLWE---QGVEGIERYNDLN-KVEPMNRALE 145 >sp|Q8JGS1|STIL_DANRE SCL-interrupting locus protein homolog OS=Danio rerio GN=sti...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920355|Adiantum capillus-vener

  18. AcEST: DK961199 [AcEST

    Lifescience Database Archive (English)

    Full Text Available and PSI-BLAST: a new generation of protein database search programs, Nucleic Aci...ds Res. 25:3389-3402. Query= DK961199|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0009_H11, 5' (442 letters) Databa...nd PSI-BLAST: a new generation of protein database search programs, Nucleic Acids... Res. 25:3389-3402. Query= DK961199|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0009_H11, 5' (442 letters) Databa...tharanthus r... 197 2e-50 sp|O48649|ARF1_SALBA ADP-ribosylation factor 1 OS=Salix bak

  19. AcEST: DK958993 [AcEST

    Lifescience Database Archive (English)

    Full Text Available . Query= DK958993|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0003_H17, 5' (639 letters) Database: uniprot_trembl.fasta...993 Tissue type prothallia with plantlets Developmental stage gametophytes with s...clone: TST39A01NGRL0003_H17, 5' (639 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total let...ion sp|O14014|RGA3_SCHPO Probable Rho-type GTPase-activating protein 3 OS=Schizosaccharomyces pombe Align le...: (bits) Value sp|O14014|RGA3_SCHPO Probable Rho-type GTPase-a

  20. AcEST: DK953183 [AcEST

    Lifescience Database Archive (English)

    Full Text Available diantum capillus-veneris mRNA, clone: TST39A01NGRL0017_B15, 5' (544 letters) Database: uniprot_trembl.fasta ...3 Tissue type prothallia with plantlets Developmental stage gametophytes with spo...ters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total let...ucing significant alignments: (bits) Value sp|Q6IR37|ZDH24_MOUSE Probable palmitoyltransferase ZDHHC24 OS=M....3.4 >sp|Q6IR37|ZDH24_MOUSE Probable palmitoyltransferase ZDHHC24 OS=Mus musculus GN=Zdhhc24 PE=2 SV=2 Length = 284 Score = 32.3 bits

  1. AcEST: DK954459 [AcEST

    Lifescience Database Archive (English)

    Full Text Available . Query= DK954459|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0020_H23, 5' (623 letters) Database: uniprot_trembl.fasta...459 Tissue type prothallia with plantlets Developmental stage gametophytes with s...y= DK954459|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0020_H23, 5' (623 letters) Datab...ase 56.9) Link to BlastX Result : Swiss-Prot sp_hit_id O04848 Definition sp|O04848|H2AXA_ARATH Probable......................................done Score E Sequences producing significant alignments: (bits) Value sp|

  2. AcEST: DK961715 [AcEST

    Lifescience Database Archive (English)

    Full Text Available diantum capillus-veneris mRNA, clone: TST39A01NGRL0010_O14, 5' (507 letters) Database: uniprot_trembl.fasta ...ype prothallia with plantlets Developmental stage gametophytes with sporophytes C...ters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total let...roducing significant alignments: (bits) Value sp|Q9K0N0|UBIB_NEIMB Probable ubiquinone biosynthesis protein ...nition sp|Q9K0N0|UBIB_NEIMB Probable ubiquinone biosynthesis protein ubiB OS=Neisseria meningitidis serogroup B Align le

  3. AcEST: DK954881 [AcEST

    Lifescience Database Archive (English)

    Full Text Available hesin OS=Mus musculus GN=Zan PE=2 SV=1 30 3.8 sp|Q09630|GRM1_CAEEL Probable metabotropic glutamate receptor ...RAGESCMVANFTRGC 5257 >sp|Q09630|GRM1_CAEEL Probable metabotropic glutamate receptor mgl-1 OS=Caenorhabditis ele...81|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0021_K02, 5' (365 letters) Database: uniprot_trembl...ype prothallia with plantlets Developmental stage gametophytes with sporophytes C...apillus-veneris mRNA, clone: TST39A01NGRL0021_K02, 5' (365 letters) Database: uniprot_sprot.fasta 412,525 se

  4. AcEST: DK954116 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ery= DK954116|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0019_J09, 5' (532 letters) Database: uniprot_trembl.fasta...16 Tissue type prothallia with plantlets Developmental stage gametophytes with sp...mRNA, clone: TST39A01NGRL0019_J09, 5' (532 letters) Database: uniprot_sprot.fasta...e Score E Sequences producing significant alignments: (bits) Value sp|Q54F40|Y1133_DICDI Probable serine/thr... sp_hit_id Q54F40 Definition sp|Q54F40|Y1133_DICDI Probable serine/threonine-protein kinase DDB_G0291133 OS=

  5. AcEST: DK961278 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ne: TST39A01NGRL0009_K23, 5' (657 letters) Database: uniprot_trembl.fasta 7,341,7...278 Tissue type prothallia with plantlets Developmental stage gametophytes with s...neris mRNA, clone: TST39A01NGRL0009_K23, 5' (657 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total let...roducing significant alignments: (bits) Value sp|Q93WT0|WRK31_ARATH Probable WRKY..._id Q93WT0 Definition sp|Q93WT0|WRK31_ARATH Probable WRKY transcription factor 31 OS=Arabidopsis thaliana Align le

  6. AcEST: DK961567 [AcEST

    Lifescience Database Archive (English)

    Full Text Available : TST39A01NGRL0010_H20, 5' (654 letters) Database: uniprot_trembl.fasta 7,341,751...ype prothallia with plantlets Developmental stage gametophytes with sporophytes C...ters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total letters Searc... ■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swiss-Prot sp_hit_id Q9SB58 Definition sp|Q9SB58|ZDH19_ARATH Probable...) Value sp|Q9SB58|ZDH19_ARATH Probable S-acyltransferase At4g24630 OS=Ar.

  7. AcEST: DK957813 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 1NGRL0029_F16, 5' (581 letters) Database: uniprot_trembl.fasta 7,341,751 sequences; 2,391,615,440 tota...ype prothallia with plantlets Developmental stage gametophytes with sporophytes C...s mRNA, clone: TST39A01NGRL0029_F16, 5' (581 letters) Database: uniprot_sprot.fasta...one Score E Sequences producing significant alignments: (bits) Value sp|Q2RZI8|GCP_SALRD Probable O-sialogly... sp_hit_id Q2RZI8 Definition sp|Q2RZI8|GCP_SALRD Probable O-sialoglycoprotein endopeptidase OS=Salinibacter

  8. AcEST: DK959698 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 4|PHXR4_MOUSE Putative per-hexamer repeat protein 4 OS=M... 29 8.2 >sp|Q69566|U88...PAGNTVKFR-CPS-------AGNPTPGIRW--LKNGREFGGEH 214 Query: 231 RSTG 242 R G Sbjct: 215 RIGG 218 >sp|P15974|PHXR4_MOUSE Putative per-hexam...avid J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs...Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389...ype prothallia with plantlets Developmental stage gametophytes with sporophytes C

  9. AcEST: DK962988 [AcEST

    Lifescience Database Archive (English)

    Full Text Available phoribosyltransferase (Homohexame... 107 7e-22 tr|A7NN37|A7NN37_ROSCS ATP phosphoribosyltransferase OS=Rosei...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK962988...eng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs...988 Tissue type prothallia with plantlets Developmental stage gametophytes with s...ngth = 230 Score = 86.7 bits (213), Expect = 1e-16 Identities = 58/143 (40%), Positives = 80/143 (55%), Gaps = 4/143 (2%) Fram

  10. AcEST: DK948229 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ult : Swiss-Prot sp_hit_id P15974 Definition sp|P15974|PHXR4_MOUSE Putative per-hexamer repeat protein 4 OS=...quences producing significant alignments: (bits) Value sp|P15974|PHXR4_MOUSE Putative per-hexamer repeat pro...PHXR4_MOUSE Putative per-hexamer repeat protein 4 OS=Mus musculus GN=Phxr4 PE=2 S...d J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs...I-BLAST: a new generation of protein database search programs, Nucleic Acids Res.

  11. AcEST: DK953727 [AcEST

    Lifescience Database Archive (English)

    Full Text Available E=1 SV=2 32 3.4 sp|P15974|PHXR4_MOUSE Putative per-hexamer repeat protein 4 OS=M... 31 5.8 sp|Q96AN5|TM143_H...bjct: 2035 EGSFRCICPPGYEVKSENCIDINECDEDPNICLFGSCTNTP 2075 >sp|P15974|PHXR4_MOUSE Putative per-hexam... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK953727|Adia...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK953727|Adian...27 Tissue type prothallia with plantlets Developmental stage gametophytes with sp

  12. AcEST: DK959476 [AcEST

    Lifescience Database Archive (English)

    Full Text Available PHXR5_MOUSE Putative per-hexamer repeat protein 5 OS=M... 30 4.9 sp|O60184|CYC8_SCHPO General transcriptiona... Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs...d PSI-BLAST: a new generation of protein database search programs, Nucleic Acids ...ype prothallia with plantlets Developmental stage gametophytes with sporophytes C...musculus GN=... 30 4.9 sp|Q8AVG9|QRSL1_XENLA Glutamyl-tRNA(Gln) amidotransferase subuni... 30 4.9 sp|P08399|

  13. AcEST: DK955649 [AcEST

    Lifescience Database Archive (English)

    Full Text Available osphoribosyltransferase (Homohexame... 96 1e-18 tr|B8GCM4|B8GCM4_9CHLR ATP phosphoribosyltransferase OS=Chlo... Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK955649|...649 Tissue type prothallia with plantlets Developmental stage gametophytes with s...xpect = 2e-13 Identities = 42/104 (40%), Positives = 60/104 (57%), Gaps = 1/104 (0%) Fram

  14. AcEST: DK958298 [AcEST

    Lifescience Database Archive (English)

    Full Text Available N2_HUMAN Fibrillin-2 OS=Homo sapiens GN=FBN2 PE=1 SV=2 32 3.9 sp|P15974|PHXR4_MOUSE Putative per-hexamer rep...EDPNICLFGSCTNTP 2075 >sp|P15974|PHXR4_MOUSE Putative per-hexamer repeat protein 4 OS=Mus musculus GN=Phxr4 P...d J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nuclei...7), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:...98 Tissue type prothallia with plantlets Developmental stage gametophytes with sp

  15. AcEST: DK951889 [AcEST

    Lifescience Database Archive (English)

    Full Text Available PHXR4_MOUSE Putative per-hexamer repeat protein 4 OS=M... 31 5.2 sp|Q6CXW3|ATG7_K...AIKAL S LD+ Sbjct: 1098 GSLPQTRNGQTFTSTKDKKTVQAFTNGAIKALLSINLDD 1136 >sp|P15974|PHXR4_MOUSE Putative per-hexam...Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Aci...ng, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs...89 Tissue type prothallia Developmental stage gametophyte Contig ID CL985Contig1

  16. AcEST: DK949029 [AcEST

    Lifescience Database Archive (English)

    Full Text Available e protein 3 OS=Homo sapiens GN=LAN... 36 0.21 sp|P04148|SI25_BOMMO Fibrohexamerin... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK949029|Adiant...BLAST and PSI-BLAST: a new generation of protein database search programs, Nuclei...ype prothallia Developmental stage gametophyte Contig ID - Sequence CTCTTCGAGAACG... 33 1.8 sp|Q9HBA9|PSMAL_HUMAN Prostate-specific membrane antigen-like pr... 31 6.8 sp|Q04609|FOLH1_HUMAN Glutam

  17. AcEST: DK960356 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 19 2e-25 tr|A5UY38|A5UY38_ROSS1 ATP phosphoribosyltransferase (Homohexame... 109 1e-22 tr|A7NN37|A7NN37_ROSC...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= D... PSI-BLAST: a new generation of protein database search programs, Nucleic Acids R...356 Tissue type prothallia with plantlets Developmental stage gametophytes with s...SV=1 Length = 230 Score = 92.0 bits (227), Expect = 3e-18 Identities = 61/147 (41%), Positives = 83/147 (56%

  18. AcEST: DK958775 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 9. 5' end sequence. DK958775 CL3350Contig1 Show DK958775 Clone id TST39A01NGRL0002_O09 Library TST39 Length ...633 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0002_O09. 5' end sequence. Accession DK958775...d PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK958775...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:

  19. AcEST: DK956775 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 3. 5' end sequence. DK956775 CL16Contig1 Show DK956775 Clone id TST39A01NGRL0026_J23 Library TST39 Length 61...9 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0026_J23. 5' end sequence. Accession DK956775...and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK956775... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK956775|Adiantum capillus-ven

  20. AcEST: DK955775 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 1. 5' end sequence. DK955775 CL123Contig1 Show DK955775 Clone id TST39A01NGRL0024_A01 Library TST39 Length 6...07 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0024_A01. 5' end sequence. Accession DK955775...and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK955775...), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK955775

  1. AcEST: DK947775 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 9. 5' end sequence. DK947775 - Show DK947775 Clone id YMU02A01NGRL0016_P09 Library YMU02 Length 451 Definiti...on Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0016_P09. 5' end sequence. Accession DK947775 Tissue t... database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK947775|Adian...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK947775|Adiantum capillus-veneris mRNA,

  2. AcEST: BP913775 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000035_B05 311 Adiantum capillus-veneris mRNA. clone: YMU001_000035_B05. BP913775 - Show BP913775...is mRNA. clone: YMU001_000035_B05. Accession BP913775 Tissue type prothallium Developmental stage - Contig I...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913775|Adiantum capillus...d PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913775

  3. AcEST: BP914367 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000058_B03 578 Adiantum capillus-veneris mRNA. clone: YMU001_000058_B03. BP914367 - Show BP914367...is mRNA. clone: YMU001_000058_B03. Accession BP914367 Tissue type prothallium Developmental stage - Contig I...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914367|Adiantum ...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914367|

  4. AcEST: BP917367 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000100_A02 384 Adiantum capillus-veneris mRNA. clone: YMU001_000100_A02. BP917367 - Show BP917367...is mRNA. clone: YMU001_000100_A02. Accession BP917367 Tissue type prothallium Developmental stage - Contig I...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917367|Adiantum capill...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917367|Adiantum capillus-veneris mR

  5. AcEST: BP913677 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000033_A08 517 Adiantum capillus-veneris mRNA. clone: YMU001_000033_A08. BP913677 - Show BP91367...is mRNA. clone: YMU001_000033_A08. Accession BP913677 Tissue type prothallium Developmental stage - Contig I...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91367...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91367

  6. AcEST: BP913679 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000033_A11 505 Adiantum capillus-veneris mRNA. clone: YMU001_000033_A11. BP91367...9 CL11Contig1 Show BP913679 Clone id YMU001_000033_A11 Library YMU01 Length 505 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000033_A11. Accession BP913679 Tissue type prothallium Developmental stage ...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91367...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913679|Adiantum cap

  7. AcEST: DK962367 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 2. 5' end sequence. DK962367 CL65Contig1 Show DK962367 Clone id TST39A01NGRL0013_K22 Library TST39 Length 77...4 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0013_K22. 5' end sequence. Accession DK962367...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK962367|Adiantum capillus-vene...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK962367|Adian

  8. AcEST: DK953677 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 4. 5' end sequence. DK953677 - Show DK953677 Clone id TST39A01NGRL0018_G14 Library TST39 Length 523 Definiti...on Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0018_G14. 5' end sequence. Accession DK953677 Tissue t... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK953677|Adiant...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK95367...TST39A01NGRL0018_G14 523 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0018_G1

  9. AcEST: BP912343 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000018_A05 305 Adiantum capillus-veneris mRNA. clone: YMU001_000018_A05. BP912343 - Show BP91234...is mRNA. clone: YMU001_000018_A05. Accession BP912343 Tissue type prothallium Developmental stage - Contig I... and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91234...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912343|Adiantum capill

  10. AcEST: BP921234 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_C09 556 Adiantum capillus-veneris mRNA. clone: YMU001_000147_C09. BP921234... CL2723Contig1 Show BP921234 Clone id YMU001_000147_C09 Library YMU01 Length 556 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000147_C09. Accession BP921234 Tissue type prothallium Developmental stag... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921234|Adiantum capillus-veneris mRNA, ...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921234|A

  11. AcEST: BP920648 [AcEST

    Lifescience Database Archive (English)

    Full Text Available on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920648|Adiantu...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920648|Adiantum capillus-veneris ...YMU001_000139_G01 166 Adiantum capillus-veneris mRNA. clone: YMU001_000139_G01. BP920648 CL768Conti...g1 Show BP920648 Clone id YMU001_000139_G01 Library YMU01 Length 166 Definition Adiantum cap...on sp|Q5G872|SCUB2_DANRE Signal peptide, CUB and EGF-like domain-cont

  12. AcEST: BP920120 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_C05 434 Adiantum capillus-veneris mRNA. clone: YMU001_000133_C05. BP920120 - Show BP92012...is mRNA. clone: YMU001_000133_C05. Accession BP920120 Tissue type prothallium Developmental stage - Contig I...T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920120|Ad...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920120|

  13. AcEST: BP920127 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_D02 541 Adiantum capillus-veneris mRNA. clone: YMU001_000133_D02. BP92012...7 CL3843Contig1 Show BP920127 Clone id YMU001_000133_D02 Library YMU01 Length 541 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_D02. Accession BP920127 Tissue type prothallium Developmental stag...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920127|Adiantum capillus-ve... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920127|Adian

  14. AcEST: BP920125 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_C12 422 Adiantum capillus-veneris mRNA. clone: YMU001_000133_C12. BP920125 - Show BP92012...is mRNA. clone: YMU001_000133_C12. Accession BP920125 Tissue type prothallium Developmental stage - Contig I...nd PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92012...and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92012

  15. AcEST: BP920129 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_D04 550 Adiantum capillus-veneris mRNA. clone: YMU001_000133_D04. BP92012...9 CL1276Contig1 Show BP920129 Clone id YMU001_000133_D04 Library YMU01 Length 550 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_D04. Accession BP920129 Tissue type prothallium Developmental stag...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920129|Adiantum capillus-ve...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920129|Adiantum capillus-vener

  16. Protein sequence databases.

    Science.gov (United States)

    Apweiler, Rolf; Bairoch, Amos; Wu, Cathy H

    2004-02-01

    A variety of protein sequence databases exist, ranging from simple sequence repositories, which store data with little or no manual intervention in the creation of the records, to expertly curated universal databases that cover all species and in which the original sequence data are enhanced by the manual addition of further information in each sequence record. As the focus of researchers moves from the genome to the proteins encoded by it, these databases will play an even more important role as central comprehensive resources of protein information. Several the leading protein sequence databases are discussed here, with special emphasis on the databases now provided by the Universal Protein Knowledgebase (UniProt) consortium. PMID:15036160

  17. Un ami qui est toujours

    Institute of Scientific and Technical Information of China (English)

    王艳

    2012-01-01

    Un jour,pendant la récréation,je suis descendue dans le bureau du secrétariat.Quand je préparais un café,une femme professeur d'espagnol s'est exclamée:《Tiens! Tu es de bonne humeur ce matin ! 》 (E)tonnée,je lui ai demandé pourquoi.Elle a répondu:《 Parce que tu prends un ca fé.》Quelle réponse inattendue! Ce n'est qu'un café instantané,un peu fade,pas très bon,à dire vrai.Si j'en prends une petite tasse,ce n'est pas que je suis de bonne humeur.C'est plut(o)t mon habitude,ou bien c'est que le café me donne une belle humeur.

  18. Database and Expert Systems Applications

    DEFF Research Database (Denmark)

    Viborg Andersen, Kim; Debenham, John; Wagner, Roland

    submissions. The papers are organized in topical sections on workflow automation, database queries, data classification and recommendation systems, information retrieval in multimedia databases, Web applications, implementational aspects of databases, multimedia databases, XML processing, security, XML...... schemata, query evaluation, semantic processing, information retrieval, temporal and spatial databases, querying XML, organisational aspects of databases, natural language processing, ontologies, Web data extraction, semantic Web, data stream management, data extraction, distributed database systems...

  19. AcEST: DK954188 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0019_M13 564 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0019_M13. 5' end seq ... A2R961|A2R961_ASPNC Similarity to many A. thaliana patent ... EST... 47 2e-08 tr|A4R228|A4R228_MAGGR Putative un ...

  20. Oomycete transcriptomics database: A resource for oomycete transcriptomes

    Directory of Open Access Journals (Sweden)

    Tripathy Sucheta

    2012-07-01

    Full Text Available Abstract Background Oomycete pathogens have attracted significant attention in recent years due to their economic impact. With improving sequencing technologies, large amounts of oomycete transcriptomics data are now available which have great biological utility. A known bottleneck with next generation sequencing data however lies with their analysis, interpretation, organization, storage and visualization. A number of efforts have been made in this respect resulting in development of a myriad of resources. Most of the existing NGS browsers work as standalone applications that need processed data to be uploaded to the browser locally for visualization. At the same time, several oomycete EST databases such as PFGD, ESTAP and SPC, are not available anymore, so there is an immediate need for a database resource that can store and disseminate this legacy information in addition to NGS data. Description Oomycetes Transcriptomics Database is an integrated transcriptome and EST data resource for oomycete pathogens. The database currently stores processed ABI SOLiD transcript sequences from Phytophthora sojae and its host soybean (P. sojae mycelia, healthy soybean and P. sojae-infected soybean as well as Illumina transcript sequences from five Hyaloperonospora arabidopsidis libraries. In addition to those resources, it has also a complete set of Sanger EST sequences from P. sojae, P. infestans and H. arabidopsidis grown under various conditions. A web-based transcriptome browser was created for visualization of assembled transcripts, their mapping to the reference genome, expression profiling and depth of read coverage for particular locations on the genome. The transcriptome browser merges EST-derived contigs with NGS-derived assembled transcripts on the fly and displays the consensus. OTD possesses strong query features and the database interacts with the VBI Microbial Database as well as the Phytophthora Transcriptomics Database. Conclusion Oomycete

  1. Hazard Analysis Database Report

    International Nuclear Information System (INIS)

    The Hazard Analysis Database was developed in conjunction with the hazard analysis activities conducted in accordance with DOE-STD-3009-94, Preparation Guide for U S . Department of Energy Nonreactor Nuclear Facility Safety Analysis Reports, for HNF-SD-WM-SAR-067, Tank Farms Final Safety Analysis Report (FSAR). The FSAR is part of the approved Authorization Basis (AB) for the River Protection Project (RPP). This document describes, identifies, and defines the contents and structure of the Tank Farms FSAR Hazard Analysis Database and documents the configuration control changes made to the database. The Hazard Analysis Database contains the collection of information generated during the initial hazard evaluations and the subsequent hazard and accident analysis activities. The Hazard Analysis Database supports the preparation of Chapters 3 ,4 , and 5 of the Tank Farms FSAR and the Unreviewed Safety Question (USQ) process and consists of two major, interrelated data sets: (1) Hazard Analysis Database: Data from the results of the hazard evaluations, and (2) Hazard Topography Database: Data from the system familiarization and hazard identification

  2. Hazard Analysis Database Report

    Energy Technology Data Exchange (ETDEWEB)

    GRAMS, W.H.

    2000-12-28

    The Hazard Analysis Database was developed in conjunction with the hazard analysis activities conducted in accordance with DOE-STD-3009-94, Preparation Guide for U S . Department of Energy Nonreactor Nuclear Facility Safety Analysis Reports, for HNF-SD-WM-SAR-067, Tank Farms Final Safety Analysis Report (FSAR). The FSAR is part of the approved Authorization Basis (AB) for the River Protection Project (RPP). This document describes, identifies, and defines the contents and structure of the Tank Farms FSAR Hazard Analysis Database and documents the configuration control changes made to the database. The Hazard Analysis Database contains the collection of information generated during the initial hazard evaluations and the subsequent hazard and accident analysis activities. The Hazard Analysis Database supports the preparation of Chapters 3 ,4 , and 5 of the Tank Farms FSAR and the Unreviewed Safety Question (USQ) process and consists of two major, interrelated data sets: (1) Hazard Analysis Database: Data from the results of the hazard evaluations, and (2) Hazard Topography Database: Data from the system familiarization and hazard identification.

  3. Hellenic Woodland Database

    OpenAIRE

    Fotiadis, Georgios; Tsiripidis, Ioannis; Bergmeier, Erwin; Dimopolous, Panayotis

    2012-01-01

    The Hellenic Woodland Database (GIVD ID EU-GR-006) includes relevés from 59 sources, approximately, as well as unpublished relevés. In total 4,571 relevés have already been entered in the database, but the database is going to continue growing in the near future. Species abundances are recorded according the 7-grade Braun-Blanquet scale. The oldest relevés date back to 1963. For the majority of relevés (more than 90%) environmental data (e.g. altitude, slope aspect, inclination) exis...

  4. MySQL Database

    OpenAIRE

    Jimoh, Morufu

    2010-01-01

    The main objectives of this thesis were to show how it is much easier and faster to find required information from computer database than from other data storage systems or old fashioned way. We will be able to add, retrieve and update data in a computer database easily. Using computer database for company to keep the information for their customer is the objective of my thesis. It is faster which makes it economically a better solution. The project has six tables which are branch, st...

  5. Product Licenses Database Application

    CERN Document Server

    Tonkovikj, Petar

    2016-01-01

    The goal of this project is to organize and centralize the data about software tools available to CERN employees, as well as provide a system that would simplify the license management process by providing information about the available licenses and their expiry dates. The project development process is consisted of two steps: modeling the products (software tools), product licenses, legal agreements and other data related to these entities in a relational database and developing the front-end user interface so that the user can interact with the database. The result is an ASP.NET MVC web application with interactive views for displaying and managing the data in the underlying database.

  6. Unit 43 - Database Concepts I

    OpenAIRE

    Unit 61, CC in GIS; White, Gerald (ACER)

    1990-01-01

    This unit outlines fundamental concepts in database systems and their integration with GIS, including advantages of a database approach, views of a database, database management systems (DBMS), and alternative database models. Three models—hierarchical, network and relational—are discussed in greater detail.

  7. Some operations on database universes

    OpenAIRE

    Brock, E.O. de

    1997-01-01

    Operations such as integration or modularization of databases can be considered as operations on database universes. This paper describes some operations on database universes. Formally, a database universe is a special kind of table. It turns out that various operations on tables constitute interesting operations on database universes as well.

  8. Effects of Artichoke (Cynara scolymus L. Leaf Meal and Vitamin E on Productive Performance, Intestinal Microflora and Morphology in Japanese Quail

    Directory of Open Access Journals (Sweden)

    Samadi F

    2015-06-01

    Full Text Available A total of 240, one-day-old quail chicks (Coturnix coturnix japonica were used to study the effects of Artichoke leaf meal (ALM and vitamin E in diet on growth performance, ileal microbial populations and intestinal morphology in a 42-d trial. This experiment was performed as a completely randomized design with 4 replicates of 15 quails each, using a 4 × 2 factorial arrangement with diet and gender as the main effects. Four dietary treatments were formulated by addition of 2 levels (1.5 and 3 percent of ALM and 300 mg/Kg vitamin E to the basal diet. Supplementing basal diet with ALM did not improve growth performance at different rearing periods, whereas dietary vitamin E increased feed intake and body weight gain at day 21 of age (P. The ileal populations of lactobacillus and coliforms was not affected by dietary ALM treatments, whereas vitamin E increased the population of total aerobic bacteria (P≤0.04. The ileal villus height (P≤0.01 and crypt depth (P≤0.008 were reduced in quails fed on diets with ALM and vitamin E. The quails fed diets containing 3 percent ALM and 300 mg/Kg vitamin E had higher villus height:crypt depth ratio. The thickness of muscularies (P≤0.04 and mucosa (P≤0.0007 layers were decreased in birds fed diets containing ALM than control birds. Birds treated with ALM and vitamin E showed a shorter intestinal length (P≤0.02 and a lower pancereas relative weight. The results of this study showed that supplementing diet by ALM (1.5 and 3% and 300 mg/Kg vitamin E did not improve growth performance, ileal microbiota pupolations and intestinal morphometric indices in Japanese quail.

  9. The effects of inulin, dried Jerusalem artichoke tuber and a multispecies probiotic preparation on microbiota ecology and immune status of the large intestine in young pigs.

    Science.gov (United States)

    Barszcz, Marcin; Taciak, Marcin; Skomiał, Jacek

    2016-08-01

    The study aimed at determining the effect of two types of prebiotics and a multispecies probiotic on microbiota activity and composition, as well as mucosal immunity in the large intestine of young pigs. In total 48 piglets were divided into 6 groups (n = 8), which received from day 10 of life probiotic-unsupplemented (PU) or probiotic-supplemented (PS) diets. Probiotics were added at 0.5 g/kg diet and contained: Lactococcus lactis, Carnobacterium divergens, Lactobacillus casei, Lactobacillus plantarum and Saccharomyces cerevisiae. The PU and PS diets were formulated without prebiotic addition (control) or with addition of 2% of inulin from chicory root (IN) or 4% of dried Jerusalem artichoke tubers (DJA). After 40 days of feeding, digesta and tissue samples were taken from the caecum and three sections of the colon for analyses of microbiota activity and composition, secretory immunoglobulin A (sIgA) and intraepithelial lymphocytes (IEL). IN diets decreased the caecal digesta pH and β-glucosidase activity but increased propionic, valeric and total short chain fatty acid (SCFA) concentrations compared to control diets. Feeding DJA diets increased caecal valeric acid level, decreased the concentration of isoacids in the colon, reduced β-glucosidase and β-glucuronidase activity in the middle colon and increased Bifidobacterium spp. populations in the proximal and distal colon. PS diets increased the caecal acetic acid and total SCFA level, and Clostridium spp. populations in the distal colon. Neither probiotic nor prebiotics affected sIgA level or IEL number in the large intestine. In conclusion, DJA modified the microbiota ecology in the large intestine of young pigs to a greater extent than IN and the applied probiotic did not enhance effects of prebiotics. PMID:27216555

  10. Navigating public microarray databases.

    Science.gov (United States)

    Penkett, Christopher J; Bähler, Jürg

    2004-01-01

    With the ever-escalating amount of data being produced by genome-wide microarray studies, it is of increasing importance that these data are captured in public databases so that researchers can use this information to complement and enhance their own studies. Many groups have set up databases of expression data, ranging from large repositories, which are designed to comprehensively capture all published data, through to more specialized databases. The public repositories, such as ArrayExpress at the European Bioinformatics Institute contain complete datasets in raw format in addition to processed data, whilst the specialist databases tend to provide downstream analysis of normalized data from more focused studies and data sources. Here we provide a guide to the use of these public microarray resources. PMID:18629145

  11. Dietary Supplement Label Database

    Data.gov (United States)

    U.S. Department of Health & Human Services — The database is designed to help both the general public and health care providers find information about ingredients in brand-name products, including name, form,...

  12. ARTI Refrigerant Database

    Energy Technology Data Exchange (ETDEWEB)

    Calm, J.M. [Calm (James M.), Great Falls, VA (United States)

    1994-05-27

    The Refrigerant Database consolidates and facilitates access to information to assist industry in developing equipment using alternative refrigerants. The underlying purpose is to accelerate phase out of chemical compounds of environmental concern.

  13. Mouse Phenome Database (MPD)

    Data.gov (United States)

    U.S. Department of Health & Human Services — The Mouse Phenome Database (MPD) has characterizations of hundreds of strains of laboratory mice to facilitate translational discoveries and to assist in selection...

  14. Nuclear Science References Database

    International Nuclear Information System (INIS)

    The Nuclear Science References (NSR) database together with its associated Web interface, is the world's only comprehensive source of easily accessible low- and intermediate-energy nuclear physics bibliographic information for more than 210,000 articles since the beginning of nuclear science. The weekly-updated NSR database provides essential support for nuclear data evaluation, compilation and research activities. The principles of the database and Web application development and maintenance are described. Examples of nuclear structure, reaction and decay applications are specifically included. The complete NSR database is freely available at the websites of the National Nuclear Data Center (http://www.nndc.bnl.gov/nsr) and the International Atomic Energy Agency (http://www-nds.iaea.org/nsr)

  15. Records Management Database

    Data.gov (United States)

    US Agency for International Development — The Records Management Database is tool created in Microsoft Access specifically for USAID use. It contains metadata in order to access and retrieve the information...

  16. Food Habits Database (FHDBS)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NEFSC Food Habits Database has two major sources of data. The first, and most extensive, is the standard NEFSC Bottom Trawl Surveys Program. During these...

  17. OTI Activity Database

    Data.gov (United States)

    US Agency for International Development — OTI's worldwide activity database is a simple and effective information system that serves as a program management, tracking, and reporting tool. In each country,...

  18. Global Volcano Locations Database

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NGDC maintains a database of over 1,500 volcano locations obtained from the Smithsonian Institution Global Volcanism Program, Volcanoes of the World publication....

  19. Uranium Location Database

    Data.gov (United States)

    U.S. Environmental Protection Agency — A GIS compiled locational database in Microsoft Access of ~15,000 mines with uranium occurrence or production, primarily in the western United States. The metadata...

  20. Medicaid CHIP ESPC Database

    Data.gov (United States)

    U.S. Department of Health & Human Services — The Environmental Scanning and Program Characteristic (ESPC) Database is in a Microsoft (MS) Access format and contains Medicaid and CHIP data, for the 50 states...

  1. IVR RSA Database

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This database contains trip-level reports submitted by vessels participating in Research Set-Aside projects with IVR reporting requirements.

  2. Reach Address Database (RAD)

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Reach Address Database (RAD) stores the reach address of each Water Program feature that has been linked to the underlying surface water features (streams,...

  3. Kansas Cartographic Database (KCD)

    Data.gov (United States)

    Kansas Data Access and Support Center — The Kansas Cartographic Database (KCD) is an exact digital representation of selected features from the USGS 7.5 minute topographic map series. Features that are...

  4. Dissolution Methods Database

    Data.gov (United States)

    U.S. Department of Health & Human Services — For a drug product that does not have a dissolution test method in the United States Pharmacopeia (USP), the FDA Dissolution Methods Database provides information...

  5. Consumer Product Category Database

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Chemical and Product Categories database (CPCat) catalogs the use of over 40,000 chemicals and their presence in different consumer products. The chemical use...

  6. 1988 Spitak Earthquake Database

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The 1988 Spitak Earthquake database is an extensive collection of geophysical and geological data, maps, charts, images and descriptive text pertaining to the...

  7. Eldercare Locator Database

    Data.gov (United States)

    U.S. Department of Health & Human Services — The Eldercare Locator is a searchable database that allows a user to search via zip code or city/ state for agencies at the State and local levels that provide...

  8. National Assessment Database

    Data.gov (United States)

    U.S. Environmental Protection Agency — The National Assessment Database stores and tracks state water quality assessment decisions, Total Maximum Daily Loads (TMDLs) and other watershed plans designed to...

  9. Household Products Database

    Data.gov (United States)

    U.S. Department of Health & Human Services — This database links over 4,000 consumer brands to health effects from Material Safety Data Sheets (MSDS) provided by the manufacturers and allows scientists and...

  10. Disaster Debris Recovery Database

    Data.gov (United States)

    U.S. Environmental Protection Agency — The US EPA Region 5 Disaster Debris Recovery Database includes public datasets of over 3,500 composting facilities, demolition contractors, haulers, transfer...

  11. Toxicity Reference Database

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Toxicity Reference Database (ToxRefDB) contains approximately 30 years and $2 billion worth of animal studies. ToxRefDB allows scientists and the interested...

  12. Drycleaner Database - Region 7

    Data.gov (United States)

    U.S. Environmental Protection Agency — THIS DATA ASSET NO LONGER ACTIVE: This is metadata documentation for the Region 7 Drycleaner Database (R7DryClnDB) which tracks all Region7 drycleaners who notify...

  13. The Danish Urogynaecological Database

    DEFF Research Database (Denmark)

    Guldberg, Rikke; Brostrøm, Søren; Hansen, Jesper Kjær;

    2013-01-01

    INTRODUCTION AND HYPOTHESIS: The Danish Urogynaecological Database (DugaBase) is a nationwide clinical database established in 2006 to monitor, ensure and improve the quality of urogynaecological surgery. We aimed to describe its establishment and completeness and to validate selected variables....... This is the first study based on data from the DugaBase. METHODS: The database completeness was calculated as a comparison between urogynaecological procedures reported to the Danish National Patient Registry and to the DugaBase. Validity was assessed for selected variables from a random sample of 200...... women in the DugaBase from 1 January 2009 to 31 October 2010, using medical records as a reference. RESULTS: A total of 16,509 urogynaecological procedures were registered in the DugaBase by 31 December 2010. The database completeness has increased by calendar time, from 38.2 % in 2007 to 93.2 % in 2010...

  14. National Geochemical Database: Sediment

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Geochemical analysis of sediment samples from the National Geochemical Database. Primarily inorganic elemental concentrations, most samples are of stream sediment...

  15. Fine Arts Database (FAD)

    Data.gov (United States)

    General Services Administration — The Fine Arts Database records information on federally owned art in the control of the GSA; this includes the location, current condition and information on artists.

  16. Medicare Coverage Database

    Data.gov (United States)

    U.S. Department of Health & Human Services — The Medicare Coverage Database (MCD) contains all National Coverage Determinations (NCDs) and Local Coverage Determinations (LCDs), local articles, and proposed NCD...

  17. Venus Crater Database

    Data.gov (United States)

    National Aeronautics and Space Administration — This web page leads to a database of images and information about the 900 or so impact craters on the surface of Venus by diameter, latitude, and name.

  18. Rat Genome Database (RGD)

    Data.gov (United States)

    U.S. Department of Health & Human Services — The Rat Genome Database (RGD) is a collaborative effort between leading research institutions involved in rat genetic and genomic research to collect, consolidate,...

  19. The CAPEC Database

    DEFF Research Database (Denmark)

    Nielsen, Thomas Lund; Abildskov, Jens; Harper, Peter Mathias; Papaeconomou, Eirini; Gani, Rafiqul

    2001-01-01

    The Computer-Aided Process Engineering Center (CAPEC) database of measured data was established with the aim to promote greater data exchange in the chemical engineering community. The target properties are pure component properties, mixture properties, and special drug solubility data. The...... database divides pure component properties into primary, secondary, and functional properties. Mixture properties are categorized in terms of the number of components in the mixture and the number of phases present. The compounds in the database have been classified on the basis of the functional groups in...... the compound. This classification makes the CAPEC database a very useful tool, for example, in the development of new property models, since properties of chemically similar compounds are easily obtained. A program with efficient search and retrieval functions of properties has been developed....

  20. Wheat EST resources for functional genomics of abiotic stress

    Directory of Open Access Journals (Sweden)

    Links Matthew G

    2006-06-01

    Full Text Available Abstract Background Wheat is an excellent species to study freezing tolerance and other abiotic stresses. However, the sequence of the wheat genome has not been completely characterized due to its complexity and large size. To circumvent this obstacle and identify genes involved in cold acclimation and associated stresses, a large scale EST sequencing approach was undertaken by the Functional Genomics of Abiotic Stress (FGAS project. Results We generated 73,521 quality-filtered ESTs from eleven cDNA libraries constructed from wheat plants exposed to various abiotic stresses and at different developmental stages. In addition, 196,041 ESTs for which tracefiles were available from the National Science Foundation wheat EST sequencing program and DuPont were also quality-filtered and used in the analysis. Clustering of the combined ESTs with d2_cluster and TGICL yielded a few large clusters containing several thousand ESTs that were refractory to routine clustering techniques. To resolve this problem, the sequence proximity and "bridges" were identified by an e-value distance graph to manually break clusters into smaller groups. Assembly of the resolved ESTs generated a 75,488 unique sequence set (31,580 contigs and 43,908 singletons/singlets. Digital expression analyses indicated that the FGAS dataset is enriched in stress-regulated genes compared to the other public datasets. Over 43% of the unique sequence set was annotated and classified into functional categories according to Gene Ontology. Conclusion We have annotated 29,556 different sequences, an almost 5-fold increase in annotated sequences compared to the available wheat public databases. Digital expression analysis combined with gene annotation helped in the identification of several pathways associated with abiotic stress. The genomic resources and knowledge developed by this project will contribute to a better understanding of the different mechanisms that govern stress tolerance in

  1. Clinical Genomic Database

    OpenAIRE

    Solomon, Benjamin D.; Nguyen, Anh-Dao; Bear, Kelly A.; Wolfsberg, Tyra G.

    2013-01-01

    Technological advances have greatly increased the availability of human genomic sequencing. However, the capacity to analyze genomic data in a clinically meaningful way lags behind the ability to generate such data. To help address this obstacle, we reviewed all conditions with genetic causes and constructed the Clinical Genomic Database (CGD) (http://research.nhgri.nih.gov/CGD/), a searchable, freely Web-accessible database of conditions based on the clinical utility of genetic diagnosis and...

  2. ORACLE DATABASE SECURITY

    OpenAIRE

    Cristina-Maria Titrade

    2011-01-01

    This paper presents some security issues, namely security database system level, data level security, user-level security, user management, resource management and password management. Security is a constant concern in the design and database development. Usually, there are no concerns about the existence of security, but rather how large it should be. A typically DBMS has several levels of security, in addition to those offered by the operating system or network. Typically, a DBMS has user a...

  3. Fashion Information Database

    Institute of Scientific and Technical Information of China (English)

    LI Jun; WU Hai-yan; WANG Yun-yi

    2002-01-01

    In the field of fashion industry, it is a bottleneck of how to control and apply the information in the procedure of fashion merchandising. By the aid of digital technology,a perfect and practical fashion information database could be established so that high- quality and efficient,low-cost and characteristic fashion merchandising system could be realized. The basic structure of fashion information database is discussed.

  4. Database computing in HEP

    International Nuclear Information System (INIS)

    The major SSC experiments are expected to produce up to 1 Petabyte of data per year each. Once the primary reconstruction is completed by farms of inexpensive processors. I/O becomes a major factor in further analysis of the data. We believe that the application of database techniques can significantly reduce the I/O performed in these analyses. We present examples of such I/O reductions in prototype based on relational and object-oriented databases of CDF data samples

  5. Taxes in Europe Database

    OpenAIRE

    European Commission DG Taxation and Customs Union

    2009-01-01

    The Taxes in Europe database is the European Commission's on-line information tool covering the main taxes in force in the EU Member States. Access is free for all users. The system contains information on around 650 taxes, as provided to the European Commission by the national authorities. The "Taxes in Europe" database contains, for each individual tax, information on its legal basis, assessment base, main exemptions, applicable rate(s), economic and statistical classification, as well as t...

  6. Database on Wind Characteristics

    DEFF Research Database (Denmark)

    Højstrup, J.; Ejsing Jørgensen, Hans; Lundtang Petersen, Erik;

    1999-01-01

    his report describes the work and results of the project: Database on Wind Characteristics which was sponsered partly by the European Commision within the framework of JOULE III program under contract JOR3-CT95-0061......his report describes the work and results of the project: Database on Wind Characteristics which was sponsered partly by the European Commision within the framework of JOULE III program under contract JOR3-CT95-0061...

  7. AcEST: BP913444 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res...BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. ... TATAATCCGTAAGAGATTAAATTTGCTTGAGCTCCAGAATCAAGCAATGCCGTTGATTCA ACTTGATTGCTACCCAGTTTGACTGCAATTATTGGCTCCACTGTG ■■Homology search res...P7S_PEA Stromal 70 kDa heat shock-related protein, c... 29 8.7 sp|O75952|CABYR_HUMAN Calcium-binding tyrosine phosphorylation-r...FVDAQGHTHYF 91 TrEMBL (release 39.9) Link to BlastX Result : TrEMBL tr_hit_id A5C9C9 Definition tr|A5C9C9|A5C9C9_VITVI Putative unch

  8. AcEST: BP914997 [AcEST

    Lifescience Database Archive (English)

    Full Text Available J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res...b Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search...ATATCTCAAGGGCGAATTCGCG ■■Homology search results ■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swis...s ... 32 2.1 sp|O42924|EAF7_SCHPO Probable chromatin modification-re...p|Q07G43|CA055_XENTR UPF0667 protein C1orf55 homolog OS=Xenopus... 32 2.7 sp|P0A1K6|SPAN_SHISO Surface presentation of anti

  9. AcEST: DK953851 [AcEST

    Lifescience Database Archive (English)

    Full Text Available |P49429|HPPD_MOUSE 4-hydroxyphenylpyruvate dioxygenase OS=Mus ... 32 3.1 sp|Q9HYB8|RNFC_PSEAE Electron tra...enylpyruvate dioxygenase OS=Mycosphaerella graminicola GN=HPPD PE=3 SV=1 Length = 419 Score = 44.7 bits (104), Expect...heng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search progra...nd PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK953851|Adiantum cap...|Q09JZ2|Q09JZ2_BRARP 4-hydroxyphenylpyruvate dioxygenase OS=Brassica rapa subsp. pekinensis P

  10. AcEST: DK961719 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ... 41 0.067 tr|Q0ISK1|Q0ISK1_ORYSJ Os11g0506800 protein OS=Oryza sativa subs... 41 0.067 tr|A2ZEJ9|A2ZEJ9_ORYSI Putati...N Sbjct: 601 STELSMLAKSTDVANNDFAVNQESN 625 >tr|B8AFA4|B8AFA4_ORYSI Putative uncharacterized protein OS=Oryza sativa sub... Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0010_O18. 5' end sequence. Accession DK961719 Tis...BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Quer...1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Quer

  11. AcEST: DK962016 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 5. 5' end sequence. DK962016 - Show DK962016 Clone id TST39A01NGRL0011_L15 Library TST39 Length 642 Definiti...on Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0011_L15. 5' end sequence. Accession DK962016 Tissue t...T and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK962016...97), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25...TST39A01NGRL0011_L15 642 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0011_L1

  12. AcEST: BP918087 [AcEST

    Lifescience Database Archive (English)

    Full Text Available g, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search program...ed BLAST and PSI-BLAST: a new generation of protein database search programs, Nuc...21338|SPT5H_CAEEL Transcription elongation factor SPT5 OS=Ca... 32 1.5 sp|Q8DK04|IF2_THEEB Translation initiation fa...0.88 sp|P31629|ZEP2_HUMAN Transcription factor HIVEP2 OS=Homo sapiens... 32 1.2 sp|P85972|VINC_RAT Vinculin OS=Rat...nt RNA helic... 32 2.0 sp|Q9EQW6|OLIG2_MOUSE Oligodendrocyte transcription factor 2 OS=... 32 2.0 s

  13. AcEST: BP917824 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 917824|Adiantum capillus-veneris mRNA, clone: YMU001_000105_H08. (518 letters) Database: uniprot_sprot.fasta 412,525 seq..._3, whole genome shotgun sequence OS=Vitis vinifera Align length 27 Score (bit) 39.7 E-value 0.091 Report BL...24|Adiantum capillus-veneris mRNA, clone: YMU001_000105_H08. (518 letters) Database: uniprot_trembl.fasta 7,341,751 seq...erized protein OS=Magna... 33 8.5 >tr|A7NYZ9|A7NYZ9_VITVI Chromosome chr6 scaffold_3, whole genome shotgun sequence OS=Vitis...9) Link to BlastX Result : Swiss-Prot sp_hit_id P04929 Definition sp|P04929|HRPX_PLALO His

  14. AcEST: BP918529 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 29p OS=Yarrowia lipolytica GN=YA... 33 9.8 tr|Q2UKB0|Q2UKB0_ASPOR Histone acetyltransferase...YMU001_000114_E12. (549 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total letters ...phosphoglycerate-dependent phosphoglycerate mutase OS=Bordetella bronchiseptica GN=gpmA PE=3 SV=1 Length = 2...DDIVGVNIPTGQP 211 >sp|Q9JI69|ORC1_CRIGR Origin recognition complex subunit 1 OS=Cricetulus griseus GN=ORC1L ... YMU001_000114_E12. (549 letters) Database: uniprot_trembl.fasta 7,341,751 sequences; 2,391,615,440 total le

  15. AcEST: DK955827 [AcEST

    Lifescience Database Archive (English)

    Full Text Available |Q6NV74|CB055_HUMAN Uncharacterized protein C2orf55 OS=Homo sa... 32 2.0 sp|P72204|TONB_PASHA Protein tonB OS=Pasteur...4.4 sp|Q96QH2|PRAM_HUMAN PML-RARA-regulated adapter molecule 1 OS=Ho... 31 5.6 sp|Q05516|ZBT16_HUMAN Zinc fi... PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK955827|Adiantum cap...31 5.7 sp|Q01285|CHS4_NEUCR Chitin synthase 4 OS=Neurospora crassa GN=c... 31 5.7 sp|P53958|BOP3_YEAST Prote...T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK955827|Adiantum cap

  16. AcEST: BP920192 [AcEST

    Lifescience Database Archive (English)

    Full Text Available .. 54 3e-06 tr|B2HMD5|B2HMD5_MYCMM Conserved hypothetical membrane protein O... 54 4e-06 tr|A0PTZ3|A0PTZ3_MYCUA Conserve...ation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920192|Adiantum capillus-vener...YMU001_000134_B06 410 Adiantum capillus-veneris mRNA. clone: YMU001_000134_B06. BP9...20192 CL1019Contig1 Show BP920192 Clone id YMU001_000134_B06 Library YMU01 Length 410 Definition Adiantum capillus-vener...pped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Quer

  17. AcEST: BP912754 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ized protein OS=Sacch... 33 8.6 tr|A6ZKK8|A6ZKK8_YEAS7 Conserved protein OS=Saccharomyces...W+D Sbjct: 264 -FKWLD 268 >tr|A6ZKK8|A6ZKK8_YEAS7 Conserved protein OS=Saccharomyces cer...ation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912754|Adiantum capillus-vener...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912754|Adiantum capillus-veneris mRNA, clone...YMU001_000022_E05 587 Adiantum capillus-veneris mRNA. clone: YMU001_000022_E05. BP9

  18. AcEST: BP921109 [AcEST

    Lifescience Database Archive (English)

    Full Text Available in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921109|Adiantum capillus-vener...ation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921109|Adiantum capillus-vener... Predicted 4-hydroxybenzoate decarboxylase... 34 4.6 tr|B7N6W8|B7N6W8_ECOLX Conserved putative non-oxidative...NF 99 >tr|B7N6W8|B7N6W8_ECOLX Conserved putative non-oxidative hydroxyarylic acid decarboxylase activity OS=Escher...YMU001_000145_G04 506 Adiantum capillus-veneris mRNA. clone: YMU001_000145_G04. BP9

  19. AcEST: DK955988 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Definition tr|A6WEV4|A6WEV4_KINRD Putative conserved membrane protein OS=Kineococcus radiotolerans (strain ... Score E Sequences producing significant alignments: (bits) Value tr|A6WEV4|A6WEV4_KINRD Putative conserve...hatidate cytidylyltransferase OS=Azo... 34 7.3 >tr|A6WEV4|A6WEV4_KINRD Putative conserved membrane protein OS=Kineococcus radiotoler...ation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK955988|Adiantum capillus-veneris mRNA, clone...ation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK955988|Adiantum capillus-veneris mRNA, clone

  20. AcEST: BP919352 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 3RHC3|B3RHC3_YEAS1 Factor arrest protein 10 OS=Saccharomyces... 33 9.3 tr|A7A1C1|A7A1C1_YEAS7 Conserved protein OS=Saccharomyces cer...CNHFTLLTFGTISIGIIAIVFKILS 476 >tr|A7A1C1|A7A1C1_YEAS7 Conserved protein OS=Saccharomyces cer...ation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919352|Adiantum capillus-vener...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919352|Adiantum capillus-veneris mRNA, clone...YMU001_000124_B01 420 Adiantum capillus-veneris mRNA. clone: YMU001_000124_B01. BP9