WorldWideScience

Sample records for argopecten purpuratus lamarck

  1. Efecto del sustrato en la intensidad del asentamiento de larvas de Argopecten purpuratus Lamarck, 1819 (Bivalvia, Pectinidae) en ambiente controlado Effect of different susbstrates on the larval settlement of the scallop Argopecten purpuratus Lamarck, 1819 (Bivalvia, Pectinidae) in laboratory condition

    OpenAIRE

    Lucio Encomendero; Enrique Dupré

    2003-01-01

    Se estudió el efecto de diferentes tipos de sustrato y del biofilm formado sobre ellos, en la intensidad del asentamiento larval del ostión del norte Argopecten purpuratus. Se postula la hipótesis que sustratos de diferente naturaleza permiten la formación de diferentes biofilm a través del tiempo, los cuales originan distintas intensidades de asentamiento larval sobre ellos. Sustratos de netlón, malla mosquitera, concha de ostión y asbesto-cemento se sometieron a la formación de biofilm por ...

  2. Efecto del sustrato en la intensidad del asentamiento de larvas de Argopecten purpuratus Lamarck, 1819 (Bivalvia, Pectinidae en ambiente controlado Effect of different susbstrates on the larval settlement of the scallop Argopecten purpuratus Lamarck, 1819 (Bivalvia, Pectinidae in laboratory condition

    Directory of Open Access Journals (Sweden)

    Lucio Encomendero

    2003-01-01

    Full Text Available Se estudió el efecto de diferentes tipos de sustrato y del biofilm formado sobre ellos, en la intensidad del asentamiento larval del ostión del norte Argopecten purpuratus. Se postula la hipótesis que sustratos de diferente naturaleza permiten la formación de diferentes biofilm a través del tiempo, los cuales originan distintas intensidades de asentamiento larval sobre ellos. Sustratos de netlón, malla mosquitera, concha de ostión y asbesto-cemento se sometieron a la formación de biofilm por períodos de 6, 12 y 18 días con flujo de agua filtrada a 50 mm. A cada sustrato con biofilm de diferentes edades (6, 12 y 18 días o sin él, contenidos en un recipiente con 300 mL de agua de mar filtrada, se le agregaron 200-300 larvas competentes. Después de 72 h en condiciones de laboratorio (15,3-18,6°C, se contó el número de larvas asentadas. Se determinó que el tipo de sustrato influye en la intensidad del asentamiento larval del ostión. Los mayores asentamientos se obtuvieron sobre asbesto-cemento (29,6-62,3%; seguidos por malla mosquitera (17,1-21,2% y concha de ostión (13-30%. Los niveles más bajos se obtuvieron sobre el netlón (4,3-15,2%. También se observó una relación directa entre el porcentaje de asentamiento larval y la edad del biofilm excepto en asbesto-cemento. El tipo de sustrato y la edad del biofilm mostraron un efecto sinérgico sobre la intensidad del asentamiento larvalThe effects of different types of substrate and of primary biofilm formed on them in relation to their capacity to attract settlement of competent larvae of the northern scallop Argopecten purpuratus, was studied. The hypothesis that different substrates permit the formation of different biofilm over time, which affect the intensity of scallop larval settlement on each different substrate, was tested. Substrates including Netlon @, fly screen, scallop shell, and asbestos-cement were incubated in 50 mm-filtered flowing sea water to allow formation

  3. Artificial collection and early growth of spat of the scallop Argopecten purpuratus (Lamarck, 1819), in La Rinconada Marine Reserve, Antofagasta, Chile

    OpenAIRE

    Avendaño D., Miguel; Cantillánez S., Marcela; Thouzeau, Gérard; Peña, Juan B.

    2007-01-01

    Artificial collection of early juveniles ("spat") of the scallop Argopecten purpuratus in Japanese-type collectors was evaluated between January 2001 and July 2002 in the La Rinconada Marine Reserve, Antofagasta, Chile. This area of Antofagasta Bay has in the past been noted for the retention of scallop larvae by local gyres, in which their numbers can vary between 89 and 34175 larvae m-3, producing larval sets of 400 to 15340 post-larvae (spat) per collector. The results showed no quantitati...

  4. Asociación entre la tasa de autofecundación y la frecuencia de larvas malformadas en poblaciones cultivadas del ostión del norte Argopecten purpuratus (Lamarck, 1819 Association between self-fertilization rates and the frequency of malformed larvae in farmed populations of the northern scallop Argopecten purpuratus (Lamarck, 1819

    Directory of Open Access Journals (Sweden)

    Christopher Concha

    2011-07-01

    Full Text Available El incremento de la frecuencia de malformaciones y la reducción de la viabilidad y fecundidad suelen ser las primeras manifestaciones de la depresión por consanguinidad en animales. El ostión del norte, Argopectenpurpuratus (Lamarck, 1819, es una especie hermnafrodita funcional con autofecundación parcial y durante la reproducción artificial puede presentar altos grados de autofecundación. En este trabajo se analizó la asociación de la tasa de autofecundación con la frecuencia de larvas malformadas y la supervivencia larval. Se desovaron adultos maduros y se recogieron separadamente los gametos femeninos del 5° pulso de liberación en adelante y los masculinos. Los ovocitos fueron fecundados con espermatozoides de otro individuo, formando familias de hermanos completos. La tasa de autofecundación se verificó por la proporción de ovocitos que entra en división en una muestra de ellos sin fecundar. La tasa de autofecundación varió entre familias de 0 a 100%, con distribución de frecuencias normal. La proporción de larvas malformadas se distribuyó al azar entre las familias analizadas, pero se correlacionó negativamente, en forma moderada pero significativa, con la tasa de autofecundación y la temperatura media del cultivo. Los datos sugieren que la autofecundación en las familias de ostiones puede favorecer una mayor homeostasis del desarrollo larval.Increased frequencies of malformations and the reduction of viability and fecundity are some of the first manifestations of inbreeding depression in animals. The northern scallop, Argopecten purpuratus (Lamarck, 1819, is a functional hermaphrodite species with partial self-fertilization. During artificial reproduction, this species may present high degrees of self-fertilization. In this work, the association between the selfing rate and the frequency of larval malformations and survival were analyzed. Mature adults were spawned, and female and male gametes were collected

  5. Evaluación en ambiente natural, del uso de biopelículas marinas en el asentamiento larval de Argopecten purpuratus (Lamarck, 1819 Evaluation in natural environment of use of marine biofilms, in the larval settlement of Argopecten purpuratus (Lamarck, 1819

    Directory of Open Access Journals (Sweden)

    Marcela Cantillánez

    2010-01-01

    Full Text Available En una granja marina ubicada colindante con el área de reserva marina “La Rinconada” (Antofagasta, Chile, se evaluó el asentamiento larval del pectínido Argopecten purpuratus sobre colectores impregnados con películas multi-específicas, de las diatomeas Navicula sp. y Amphora sp., y de la cepa bacteriana NC1, aisladas desde colectores utilizados en captaciones comerciales de esta especie que presentaron altos índices de fijación, y que bajo condiciones controladas de criadero y laboratorio, han mostrando altos niveles de asentamiento larval. Los resultados obtenidos con el uso de estas biopelículas, sobre colectores instalados en forma paralela a los utilizados por la empresa para la captación de semilla con fines comerciales, no mostraron diferencias significativas entre los diferentes tratamientos probados y el control, respecto a las fijaciones ocurridas en un lapso de 30 días de inmersión. Se discute, debido a los tiempos que demandaron las larvas de la primera cohorte en asentarse sobre los colectores tratados, un posible reemplazo de las biopelículas utilizadas, por otra común en todos ellos y atractiva para el asentamiento de las larvas, como causa de la ausencia de efectos significativos de los tratamientos probados en el medio natural. Se recomienda la necesidad de establecer el tiempo de permanencia, en el ambiente natural, de las biopelículas impregnadas a los colectores en laboratorio.In a commercial farm located near the Marine Reserve “La Rinconada” (Antofagasta, Chile the larval settlement of Argopecten purpuratus on artificial collectors impregnated with multiespecific films of marine diatoms Navicula sp. and Amphora sp. and, bacterial strain NC1 were evaluated, These biofilms were isolates from artificial collector used in commercial activities with highest index of settlement in hatchery and laboratory conditions. The results to use this biofilms in collectors installed in same condition of commercial

  6. Sobrevivencia y crecimiento de post-larvas de Argopecten purpuratus (Lamarck, 1819 en Bahía Inglesa, Chile: efectos del origen, distribución en la bahía y bacterioflora larval Postlarval survival and growth of Argopecten purpuratus (Lamarck,1819 in Bahia Inglesa, Chile: effects of origin, distribution in the bay and larval bacterioflora

    Directory of Open Access Journals (Sweden)

    RUBÉN E. AVENDAÑO

    2001-09-01

    Full Text Available Argopecten purpuratus es uno de los recursos marinos de mayor importancia comercial en Chile. Una de las etapas críticas en el cultivo de esta especie, es el traspaso de las post-larvas al medio natural, ya que durante este período se produce un significativo descenso en el número de post-larvas. Los factores que provocan estas bajas sobrevivencias pueden ser diversos, pero aún son desconocidos. En el presente estudio se evaluó la incidencia en la sobrevivencia y crecimiento de las variables origen de las larvas, distribución de los colectores en diferentes estaciones de Bahía Inglesa, III región (27° 03' 24" S, 70° 51' 30" O y los cambios en la bacterioflora asociadas a las post-larvas. Los organismos utilizados en el estudio fueron obtenidas desde los "hatcheries" de Cultivos Marinos Internacionales (III región y Cultivos Guayacán (IV región. Los resultados del estudio indican claramente que la ubicación y origen de las post-larvas en la bahía incide en la sobrevivencia de éstas. Sin embargo, el crecimiento no es afectado por las variables estudiadas (P Argopecten purpuratus is one of the most commercially important marine resources in Chile. One of the most critical steps in the massive culture of this species is the transference of postlarvae from hatchery production to the sea where significant mortality regularly occurs. The factors behind this low survival rate are probably diverse, and are as yet unknown. In the present study, postlarval survival and growth was observed as a function of origin of postlarvae, distribution of postlarvae in the bay, and microbial loading of the postlarvae. Survival rates were measured for different sites in Bahia Inglesa, Chile (27° 03' 24" S, 70° 51' 30" W as well as changes in the bacterioflora of the postlarvae. Postlarvae utilized in the study were obtained from Cultivos Marinos Internacionales (III Región and Cultivos Guayacan (IV Región. Results of the study clearly indicated that

  7. Asociación del color de la concha de reproductores de Argopecten purpuratus (Lamarck, 1819) con la supervivencia, crecimiento y desarrollo larval de sus progenies Association between shell color of breeds (Lamarck, 1819) and the survival, growth and larval development of their progenies

    OpenAIRE

    Ricardo M García; Federico M Winkler

    2012-01-01

    Las conchas de moluscos bivalvos marinos son extremadamente diversas en sus patrones de pigmentación y riqueza de colores. Tal diversidad se debe a factores ambientales y genéticos. En bivalvos marinos adultos, individuos con coloraciones de concha poco comunes en las poblaciones silvestres suelen presentar tasas de crecimiento y supervivencia menores que aquellos con colores de concha más frecuentes. Conociendo que la variación del color de la concha en Argopecten purpuratus está bajo contro...

  8. Asociación del color de la concha de reproductores de Argopecten purpuratus (Lamarck, 1819 con la supervivencia, crecimiento y desarrollo larval de sus progenies Association between shell color of breeds (Lamarck, 1819 and the survival, growth and larval development of their progenies

    Directory of Open Access Journals (Sweden)

    Ricardo M García

    2012-07-01

    Full Text Available Las conchas de moluscos bivalvos marinos son extremadamente diversas en sus patrones de pigmentación y riqueza de colores. Tal diversidad se debe a factores ambientales y genéticos. En bivalvos marinos adultos, individuos con coloraciones de concha poco comunes en las poblaciones silvestres suelen presentar tasas de crecimiento y supervivencia menores que aquellos con colores de concha más frecuentes. Conociendo que la variación del color de la concha en Argopecten purpuratus está bajo control genético, en este trabajo se pone a prueba la hipótesis de que los loci responsables de dicha variación pueden afectar el crecimiento, la supervivencia y la tasa de desarrollo de las larvas de esta especie. Se estimó la supervivencia y el crecimiento en progenies de cruzamientos dirigidos entre individuos de A. purpuratus con colores de concha blanco, naranja y marrón, y se verificó la existencia de diferencias en las tasas de desarrollo. El crecimiento de las larvas producidas en cruzamientos que incluyeron individuos marrones o blancos con naranja no mostraron diferencias entre sí. En cambio, las progenies producto de autofecundaciones de individuos naranja y blancos presentaron tasas de crecimiento significativamente menores que las anteriores y distintas entre sí. Las tasas de desarrollo y de supervivencia, en cambio, no mostraron diferencias entre las progenies de los distintos tipos de cruzamientos. Los resultados sugieren que los genes que controlan la variación del color en las conchas de juveniles y adultos de A. purpuratus afectarían la tasa de crecimiento de sus larvas, pero no la tasa de desarrollo ni su supervivencia.Marine bivalve mollusks are extremely diverse in shell color and pigmentation patterns. Such diversity is affected by environmental and genetic factors. Some evidences in adult marine bivalves shows that individuals with low-frequency shell colors have lower growth rates and/or higher mortalities than those with the

  9. Morphological alterations in cryopreserved spermatozoa of scallop Argopecten purpuratus Alteraciones morfológicas en espermatozoides criopreservados de concha de abanico Argopecten purpuratus

    Directory of Open Access Journals (Sweden)

    Carlos Espinoza

    2010-01-01

    Full Text Available The present work identifies and quantifies the morphological alterations of scallop Argopecten purpuratus spermatozoa caused by long-term cryopreservation. Percentages of motility, fertilization and injured spermatozoa were quantified by optic microscopy and scanned electron microscopy. These parameters were evaluated in sperm without treatment (CTR, spermatozoa incubated in cryoprotective solution but not freezed (ICS and freezed-thawed spermatozoa (FTS. Spermatozoa of ICS treatment remained motile longer than those of CTR, whereas those of FTS treatment were lowest. Morphology of the spermatozoa was affected in several ways by the freeze-thawing treatment; some had their head deformed or swollen, others had their cell membrane folded or broken; acrosome reaction; anomalous positions or absence of mitochondria as well as broken, stiff or loss of lineal structure of tail. CTR and ICS treatments had higher percentages of undamaged sperm (87.7% and 79.0% respectively, while FTS samples had 14.2% of undamaged sperm. The tail was the spermatic structure most commonly injured in FTS (77.0%, the percentage of sperm with head injury was 55.1% and with acrosome reaction was 28.7%, whereas middle piece was affected in 23.9% of sperm. Percentages of fertilization were 68.3%, 67.9% and 58.2% for CTR, ICS and FTS respectively, which were not significantly different. There was a higher correlation between injuries and motility than between injuries and fertilization success. Correlation between motility and fertilization was low (0.605 and 0.668 with motility at 5 and 30 min, respectively.El presente trabajo identifica y cuantifica las alteraciones morfológicas en espermatozoides de concha de abanico A. purpuratus causadas por la criopreservación en nitrógeno líquido. Porcentajes de motilidad, fecundación de ovocitos frescos y espermatozoides lesionados (en cabeza, acrosoma, pieza media y flagelo fueron determinados bajo microscopía óptica y electr

  10. Biomineralization changes with food supply confer juvenile scallops (Argopecten purpuratus) resistance to ocean acidification

    KAUST Repository

    Ramajo, Laura

    2015-12-08

    Future ocean acidification (OA) will affect physiological traits of marine species, with calcifying species being particularly vulnerable. As OA entails high energy demands, particularly during the rapid juvenile growth phase, food supply may play a key role in the response of marine organisms to OA. We experimentally evaluated the role of food supply in modulating physiological responses and biomineralization processes in juveniles of the Chilean scallop, Argopecten purpuratus, that were exposed to control (pH ~ 8.0) and low pH (pH ~ 7.6) conditions using three food supply treatments (high, intermediate, and low). We found that pH and food levels had additive effects on the physiological response of the juvenile scallops. Metabolic rates, shell growth, net calcification, and ingestion rates increased significantly at low pH conditions, independent of food. These physiological responses increased significantly in organisms exposed to intermediate and high levels of food supply. Hence, food supply seems to play a major role modulating organismal response by providing the energetic means to bolster the physiological response of OA stress. On the contrary, the relative expression of chitin synthase, a functional molecule for biomineralization, increased significantly in scallops exposed to low food supply and low pH, which resulted in a thicker periostracum enriched with chitin polysaccharides. Under reduced food and low pH conditions, the adaptive organismal response was to trade-off growth for the expression of biomineralization molecules and altering of the organic composition of shell periostracum, suggesting that the future performance of these calcifiers will depend on the trajectories of both OA and food supply. Thus, incorporating a suite of traits and multiple stressors in future studies of the adaptive organismal response may provide key insights on OA impacts on marine calcifiers.

  11. Biomineralization changes with food supply confer juvenile scallops (Argopecten purpuratus) resistance to ocean acidification.

    Science.gov (United States)

    Ramajo, Laura; Marbà, Núria; Prado, Luis; Peron, Sophie; Lardies, Marco A; Rodriguez-Navarro, Alejandro B; Vargas, Cristian A; Lagos, Nelson A; Duarte, Carlos M

    2016-06-01

    Future ocean acidification (OA) will affect physiological traits of marine species, with calcifying species being particularly vulnerable. As OA entails high energy demands, particularly during the rapid juvenile growth phase, food supply may play a key role in the response of marine organisms to OA. We experimentally evaluated the role of food supply in modulating physiological responses and biomineralization processes in juveniles of the Chilean scallop, Argopecten purpuratus, that were exposed to control (pH ~ 8.0) and low pH (pH ~ 7.6) conditions using three food supply treatments (high, intermediate, and low). We found that pH and food levels had additive effects on the physiological response of the juvenile scallops. Metabolic rates, shell growth, net calcification, and ingestion rates increased significantly at low pH conditions, independent of food. These physiological responses increased significantly in organisms exposed to intermediate and high levels of food supply. Hence, food supply seems to play a major role modulating organismal response by providing the energetic means to bolster the physiological response of OA stress. On the contrary, the relative expression of chitin synthase, a functional molecule for biomineralization, increased significantly in scallops exposed to low food supply and low pH, which resulted in a thicker periostracum enriched with chitin polysaccharides. Under reduced food and low pH conditions, the adaptive organismal response was to trade-off growth for the expression of biomineralization molecules and altering of the organic composition of shell periostracum, suggesting that the future performance of these calcifiers will depend on the trajectories of both OA and food supply. Thus, incorporating a suite of traits and multiple stressors in future studies of the adaptive organismal response may provide key insights on OA impacts on marine calcifiers. PMID:26644007

  12. Congelamiento de espermatozoides de Argopecten pupuratus Congelamiento de espermatozoides del ostión del norte Argopecten purpuratus mediante congelador mecánico Freezing of spermatozoa of the scallop Argopecten purpuratus using a mechanical freezing system

    Directory of Open Access Journals (Sweden)

    Enrique Dupré

    2004-11-01

    Full Text Available El congelamiento de espermatozoides es una técnica utilizada en acuicultura que permite almacenar los excedentes que fueron obtenidos durante la época reproductiva, para utilizarlos posteriormente. El proceso de criopreservación, requiere disminuir la temperatura gradualmente y de manera controlada para minimizar los daños ocasionados por el choque osmótico o por formación de cristales de hielo, lo cual es difícil lograr en terreno donde no se dispone de un equipo automático para realizarlo. Este estudio presenta un dispositivo manual portátil que permite descender gradualmente la temperatura, permitiendo repetir en forma exacta cada uno de los protocolos cada vez que se requiera. El equipo consta de un termo Dewar para nitrógeno líquido, un sistema de poleas graduadas, una placa porta-muestras de acrílico y un termómetro para bajas temperaturas. Para verificar su eficiencia, se procedió a criopreservar trozos de la parte masculina de la gónada de Argopecten purpuratus a diferentes tasas de congelamiento (1,1; 2,2; 4,6; 6,5; 8,8; 12,9; 19,2; 32,2 y 96,5 C°min-1. Se utilizó una solución crioprotectora compuesta por leche descremada liofilizada, ME2SO y sucrosa a una tasa de descongelamiento de 573°C·min-1. La tasa óptima de congelamiento fue de 8,8° C·min-1, con la cual se obtuvo 51,3 ± 6,6% de espermatozoides móviles. El congelador mecánico mostró ser eficiente para la criopreservación de espermatozoides de A. purpuratus a diferentes tasas de congelamiento, ya que permitió regular el descenso de las muestras en los vapores de nitrógeno líquido a diferentes velocidades

  13. The role of Argopecten purpuratus shells structuring the soft bottom community in shallow waters of southern Peru

    Science.gov (United States)

    Lomovasky, Betina J.; Gamero, Patricia A.; Romero, Leonardo; Firstater, Fausto N.; Gamarra Salazar, Alex; Hidalgo, Fernando; Tarazona, Juan; Iribarne, Oscar O.

    2015-12-01

    Accumulation of Argopecten purpuratus shells often occurs after El Niño events in shallow waters of Independencia Bay (14°17‧S-76°10‧W; Pisco, Peru). Here we experimentally investigate the effects of their shell accumulation on macrobenthos assemblages in soft bottom, shallow areas of the bay. A field experiment (from May 2006 to May 2007), including four treatments with different coverage levels of empty shells of A. purpuratus, were randomly arranged in: (1) areas devoid of shells ("Empty" treatment: experimental control), (2) 50% of the plot area covered with shells haphazardly distributed over the bottom ("medium" treatment), (3) 100% of the plot area covered with shells, forming a 10 cm valve layer ("full" treatment) and (4) "natural control". We found a total of 124 taxa throughout the experiment. Polychaetes, crustaceans and mollusks were the most abundant groups in "natural controls", dominated by the gastropod Nassarius gayi and the polychaetes Prionospio peruana, Platynereis bicanaliculata and Mediomastus branchiferus. The abundance of individuals (N) and the species richness (S) were higher in the "medium" treatment, but only in one month under positive sea bottom thermal anomalies. Similarity analysis (Bray-Curtis) showed that "natural control", "empty" and "full" treatments were more similar among them than the "medium" treatment. Multidimensional analysis showed no clear species association among treatments and a higher grouping among the samplings of Jun-06, Aug-06 and Nov-06. Our results also showed that the commercial crab Romaleon polyodon and the polyplacophora Tonicia elegans were positively affected by shell accumulations ("medium" treatment), while the limpet Fissurella crassa was negatively affected. Our study shows that directly by changing habitat structure or indirectly by changing sediment characteristics, the addition of scallop shells to the soft bottom can modify the macrobenthic assemblage; however, the seasonal oceanographic

  14. Elimination of vibrio cholerae El Tor, in scallops (Argopecten purpuratus) by gamma radiation and product organoleptic evaluation

    International Nuclear Information System (INIS)

    V. cholerae D10 value in scallops (Argopecten purpuratus) was determined in vivo. D10 was found to be 0,143 kGy, requiring therefore the application of 8D in scallops, equivalent to a 1,14 kGy dose, the optimal dose for life span extension of samples kept under refrigeration conditions (0-1o), and examined periodically under different analytic method criteria. Life span for the appearance characteristic reaches the acceptability limit of 3, after 11 days for control samples, and 16 and 13 days for samples radiated at 1 and 2 kGy. Smell of control samples was accepted only until the 13th day while samples radiated at 1 and 2 kGy went beyond this level, reaching 19 and 17 days respectively. In the same way, life span for the flavor characteristic was extended to 19 and 20 days for samples radiated at 1 and 2 kGy, respectively, while control samples only reached 15 days. Control sample texture remained within acceptable limits until the 18th day, whereas samples radiated at 1 and 2 kGy reached 21 and 17 days, respectively. Use of ph and nitrogen volatile bases were also evaluated as quality indicators. (authors)

  15. Temperatura superficial del mar de satélites NOAA y captación de semilla de Argopecten purpuratus en Bahía Inglesa, Chile Sea surface temperature of NOAA satellites and seeds' yield of Argopecten purpuratus in Bahía Inglesa, Chile

    Directory of Open Access Journals (Sweden)

    Dinko Galeno D.

    1999-01-01

    Full Text Available Se analiza la relación entre la temperatura superficial del mar (TSM y los rendimientos en la captación de semilla de Argopecten purpuratus en Bahía Inglesa, Chile (27°07'S-70°54'W. La TSM del área de captación se estima a partir de datos de satélites NOAA. Se deduce un modelo de regresión exponencial que relaciona dichos rendimientos con la TSM de tres meses previos (R²=74%The relationship between the sea surface temperature (SST and seed-collection's yield of Argopecten purpuratus is analized in Bahía Inglesa, Chile (27°07'S-70°54'W. The SST of the collection area is estimated from NOAA's satellites data. An exponential regression model that relate the yield collection with the 3 months previous SST it deduced (R²=74%

  16. Comparación del crecimiento de Argopecten purpuratus entre cohortes obtenidas de captación de larvas en ambiente natural y de hatchery Comparison of growth among cohorts obtained Argopecten purpuratus larval recruitment in natural and hatchery

    Directory of Open Access Journals (Sweden)

    Eduardo P Pérez

    2012-11-01

    Full Text Available En Chile los cultivos del ostión del norte Argopecten purpuratus han sido desarrollados intensivamente a partir de la captación de semillas en ambiente natural y desde principios de 1980 con semillas obtenidas en hatchery. Para aportar información sobre el desempeno de semillas de ostión del norte en este estudio se comparó, mediante ANCOVA, el crecimiento en longitud entre cohortes producidas a partir de semillas de ambiente natural y de hatchery en Tongoy, Chile. Se evaluó la consistencia de esta comparación en distintos anos y estaciones, comparándose parejas de cohortes producidas simultáneamente en los anos 2003 (primavera, 2005 (invierno y 2006 (verano. El análisis estadístico mostró que existen diferencias estadísticas significativas entre cohortes obtenidas en ambiente natural y aquellas obtenidas en hatchery. La prueba de Tukey evidenció diferencias significativas entre CN2003 y CH2003 como también entre CN2005 y CH2005, pero no así entre CN2006 y CH2006. Estas diferencias indican que las cohortes de semillas de ambiente natural crecieron más rápido que las de hatchery. La comparación interanual evidenció diferencias estadísticas significativas. Estos resultados son discutidos a la luz de dos factores: la temperatura de cultivo y la heterocigocidad de la población de cultivo.In Chile crops of the northern scallop Argopecten purpuratus have been developed intensively from seeds obtained in natural environment, and since 1980 from hatchery's seed, when this technique could be controlled and developed. In order to provide information on the performance of seeds of northern scallops in this study growth in length between cohorts produced from seeds obtained in natural environment (CN and hatchery (CH in Tongoy (Chile was compared using ANCOVA. We assessed the consistency of this comparison in different years and seasons. The compared cohorts are pairs of cohorts produced simultaneously in the years 2003 (spring, 2005

  17. Crecimiento y estructura demográfica de Argopecten purpuratus en la Reserva Marina La Rinconada, Antofagasta, Chile

    Directory of Open Access Journals (Sweden)

    2005-01-01

    Full Text Available Se presentan los parámetros de crecimiento L∞ = 120.38 mm y K = 0.9668 para el banco de Argopecten purpuratus de la Reserva Marina La Rinconada (Antofagasta, Chile, obtenidos entre marzo de 2001 y mayo de 2003 usando métodos de marcaje y recaptura de ejemplares. La elevada recaptura de individuos marcados (60–80% indica baja mortalidad natural y una conducta sedentaria del recurso. Las evaluaciones anuales realizadas para estimar el tamaño del banco confirmaron tal conducta, encontrándose la mayoría de los individuos agregados en el centro, con densidades que variaron entre años de 9 a 14.8 ind m–2. La abundancia de ejemplares también mostró variabilidad interanual, con cifras de 10.1 × 106 en 2001, 8.2 × 106 en 2002 y 12.4 × 106 en 2003. Estas evaluaciones mostraron, además, una disminución en la talla media de la estructura demográfica del banco entre un año y otro, reduciéndose de 75.8 mm en 2001 a 62.1 mm en 2002 y a 51.7 mm en 2003. Esta disminución también ocurrió con el número de ejemplares mayores o iguales a la talla mínima legal (90 mm, reduciéndose de 2.6 × 106 ejemplares presentes en 2001 a 3.7 × 105 ejemplares en 2003. La aplicación de los parámetros de crecimiento sobre la estructura poblacional del banco entre 2002 y 2003 señaló la integración de una nueva clase anual de 6.5 × 106 de ejemplares en 2002 y de 11.2 × 106 de individuos en 2003. El descuento de estas cifras, del número total de ejemplares presentes en ambos años, demuestra una pérdida cercana a los 8.4 × 106 de ostiones en 2002 y de cerca de 7.0 × 106 de individuos en 2003. Estas pérdidas correspondieron a ejemplares con tallas superiores a los 60 mm, lo cual es corroborado con el análisis de la curva de captura realizado con el programa Fisat, cuyos resultados señalan una mortalidad Z = 2.15 en 2002 para el segmento de la población entre 67.5 y 115.5 mm, y Z = 3.08 en 2003 para el segmento de 64.3 a 112.5 mm. Los

  18. Molecular characterization of two ferritins of the scallop Argopecten purpuratus and gene expressions in association with early development, immune response and growth rate.

    Science.gov (United States)

    Coba de la Peña, Teodoro; Cárcamo, Claudia B; Díaz, María I; Brokordt, Katherina B; Winkler, Federico M

    2016-08-01

    Ferritin is involved in several iron homoeostasis processes in molluscs. We characterized two ferritin homologues and their expression patterns in association with early development, growth rate and immune response in the scallop Argopecten purpuratus, a species of economic importance for Chile and Peru. Two ferritin subunits (Apfer1 and Apfer2) were cloned. Apfer1 cDNA is a 792bp clone containing a 516bp open reading frame (ORF) that corresponds to a novel ferritin subunit in A. purpuratus. Apfer2 cDNA is a 681bp clone containing a 522bp ORF that corresponds to a previously sequenced EST. A putative iron responsive element (IRE) was identified in the 5'-untranslated region of both genes. The deduced protein sequences of both cDNAs possessed the motifs and domains characteristic of functional ferritin subunits. Both genes showed differential expression patterns at tissue-specific and early development stage levels. Apfer1 expression level increased 40-fold along larval developmental stages, decreasing markedly after larval settlement. Apfer1 expression in mantle tissue was 2.8-fold higher in fast-growing than in slow-growing scallops. Apfer1 increased 8-fold in haemocytes 24h post-challenge with the bacterium Vibrio splendidus. Apfer2 expression did not differ between fast- and slow-growing scallops or in response to bacterial challenge. These results suggest that Apfer1 and Apfer2 may be involved in iron storage, larval development and shell formation. Apfer1 expression may additionally be involved in immune response against bacterial infections and also in growth; and thus would be a potential marker for immune capacity and for fast growth in A. purpuratus. PMID:27040527

  19. Molecular characterization of an inhibitor of NF-κB in the scallop Argopecten purpuratus: First insights into its role on antimicrobial peptide regulation in a mollusk.

    Science.gov (United States)

    Oyanedel, D; Gonzalez, R; Flores-Herrera, P; Brokordt, K; Rosa, R D; Mercado, L; Schmitt, P

    2016-05-01

    Inhibitors of nuclear factor kappa B (IκBs) are major control components of the Rel/NF-κB signaling pathway, a key regulator in the modulation of the expression of immune-related genes in vertebrates and invertebrates. The activation of the Rel/NF-κB signaling pathway depends largely in the degradation of IκB proteins and thus, IκBs are a main target for the identification of genes whose expression is controlled by Rel/NF-κB pathway. In order to identify such regulation in bivalve mollusks, the cDNA sequence encoding an IκB protein was characterized in the scallop Argopecten purpuratus, ApIκB. The cDNA sequence of ApIκB is comprised of 1480 nucleotides with a 1086 bp open reading frame encoding for 362 amino acids. Bioinformatics analysis showed that ApIκB displays the conserved features of IκB proteins. The deduced amino acid sequence consists of a 39.7 kDa protein, which has an N-terminal degradation motif, six ankyrin repeats and a C-terminal phosphorylation site motif. Phylogenetic analysis revealed a high degree of identity between ApIκB and other IκBs from mollusks, but also to arthropod cactus proteins and vertebrate IκBs. Tissue expression analysis indicated that ApIκB is expressed in all examined tissues and it is upregulated in circulating hemocytes from scallops challenged with the pathogenic Gram-negative bacterium Vibrio splendidus. After inhibiting ApIκB gene expression using the RNA interference technology, the gene expression of the antimicrobial peptide big defensin was upregulated in hemocytes from non-challenged scallops. Results suggest that ApIκB may control the expression of antimicrobial effectors such as big defensin via a putative Rel/NF-κB signaling pathway. This first evidence will help to deepen the knowledge of the Rel/NF-κB conserved pathway in scallops. PMID:26993612

  20. Simulation model of the scallop (Argopecten purpuratus farming in northern Chile: some applications in the decision making process Modelo de simulación para el cultivo del ostión (Argopecten purpuratus en el norte de Chile: aplicaciones para la toma de decisiones

    Directory of Open Access Journals (Sweden)

    Renato Molina

    2012-09-01

    Full Text Available Aquaculture farming is a complex system integrating several disciplines, including biology, engineering and economics, all which need to be correctly intertwined to have a profitable and environmentally sustainable activity. During the past recent years, scallop (Argopectenpurpuratus farmers in northern Chile have come to comprehend the hard way that aquaculture producers operate in a complex and dynamic environment where natural and economic factors are in constant change. Thus, to keep a profitable and competitive business in today's world, aquaculture farm managers are in need of relatively easy to use tools for efficient and timely decision making. Harvest size and time, mortality and growth rates, stocking rates, costs and market prices are important variables and parameters to monitor, where decisions with respect to their levels or values have to be made. In this context, non-linear and dynamic quantitative bioeconomic models should become valuable tools, for periodic decision making in the aquaculture business. This paper shows how to emulate Chilean scallop farming using a simulation model that mimics some of the industry's features. The model presented here focuses on a scallop aquaculture center that uses the common technology approach of pearl net and lanterns of the northern region of Chile, and analyses the farming strategies based on harvesting size. Also, these strategies were subject to variations in the parameters in order to identify patterns and asses the sensibility of the model to input values.La acuicultura es un sistema complejo que integra varias disciplinas, incluyendo la biología, ingeniería y economía, las cuales deben ser correctamente entrelazadas para lograr una actividad rentable y ambientalmente sostenible. Durante los últimos anos, los cultivadores del ostión del norte (Argopecten purpuratus en Chile han comprendido de la peor manera, que las actividades de acuicultura operan en un entorno complejo y din

  1. Inactivation of Vibrio cholerae O1 El Tor inoculated into Peruvian ''choro'' mussels (Aulacomya ater) and two species of clams (Argopecten purpuratus and Gari solida) using medium-dose irradiation

    International Nuclear Information System (INIS)

    The radiation decimal reduction dose (D10) for Vibrio cholerae O1 biotype El Tor inoculated through the natural feeding system into three species of bivalve mollusks from the Peruvian Pacific coast: ''choro'' mussels (Aulacome ater), ''abanico'' clams (Argopecten purpuratus), and common clams (Gari solida), was determined in vivo. The D10 value obtained in vivo was 0.14 kGy in all mollusks tested. Concurrent studies conducted to determine the potential use of irradiation to extend the microbiological shelf-life of the mollusks during post-irradiation storage at 0-1 deg. C indicated that a dose of 1.0 kGy was optimal for choro mussels and abanico clams, whereas 2.0 kGy produced the best results when treating common clams. Shelf-life extension thus achieved was 31 days for choro mussels, 16 days for abanico clams, and 21 days for common clams. Non-irradiated control samples of all mollusks spoiled after 17 days of refrigerated storage. There were no significant (p<.05) adverse effects from the application of the optimal radiation treatments on the sensory characteristics (i.e. appearance, odor, flavor, and texture) of the mollusks. Total volatile basic nitrogen (VBN) and pH values were examined for use as indexes of seafood freshness. (author)

  2. Neo-Lamarckism in Portugal

    Directory of Open Access Journals (Sweden)

    Almaça, Carlos

    2000-12-01

    Full Text Available

    Darwinism was championed in Portugal by the University and progressionist political parties from the 1860's on. Neo-Darwinism was neglected in its proper time and so the acceptance of the inheritance of acquired characters continued over the first decades of the 20th century. Men of medical education who were professors of Biology at the University of Oporto supported neo-Lamarckian theories in early 20th century. The first one has been Américo Pires de Lima (1886-1966, professor of Botany, whose doctoral dissertation sustaining early Darwinism and neo-Lamarckism was presented in 1912. This thesis, as well as a few neo-Lamarckian publications with antropological significance, are commented and discussed in the present paper.



    El Darwinismo fue defendido en Portugal en la Universidad y por los partidos políticos progresistas durante la década de los años 60 del siglo XIX. El neo-darwinismo fue ignorado en su tiempo y así continuó la aceptación de la herencia de los caracteres adquiridos a lo largo de las primeras décadas del siglo XX. Los profesores de biolog

  3. The complete mitochondrial genome of Saxidomus purpuratus (Veneroida: Veneridae).

    Science.gov (United States)

    Bao, Xiangbo; He, Chongbo; Gao, Xianggang; Li, Yunfeng; Gao, Lei; Jiang, Bing; Liu, Weidong

    2016-09-01

    In this study, the complete mitochondrial genome of Saxidomus purpuratus is determined, which is the first complete mitochondrial genome in the genus Saxidomus. The genome was of 19 637 bp in length, including 2 rRNAs, 22 tRNAs and 12 protein-coding genes with the order of ND3 and ND5 reversed. Maximum likelihood tree based on nucleotide sequences of 12 mitochondrial PCGs was constructed, in which S. purpuratus was clustered with 3 Meretrix species. The results are expected to provide useful data for species identification and further studies of the genus Saxidomus. PMID:26329595

  4. Greek Auditors in the Courses of Jean Lamarck

    Directory of Open Access Journals (Sweden)

    Spyros I. Asdrachas

    2006-01-01

    Full Text Available In the records of Lamarck's audiences, six students of Greek origin could be identified as attending his lectures between 1804-1827. In the catalogue published by Pietro Corsi four of them are listed as Greeks and two as Romanians. All have been properly identified. The Greeks were I. Kokkonis, S. Kanellos, D. Nitsos and D. Taillapierras, while the Romanians were two Greek physicians residing in Romania, I. K. Bouboukis and Th. Georgiades. It is worth noting that after their return to their home country none of them wrote on or advertised Lamarck's doctrines on species transformation.

  5. The genome of the sea urchin Strongylocentrotus purpuratus.

    OpenAIRE

    SEA URCHIN GENOME SEQUENCING CONSORTIUM; SODERGREN E; WEINSTOCK GM; DAVIDSON EH; CAMERON RA; GIBBS RA; ANGERER RC; ANGERER LM; ARNONE MI; BURGESS DR; BURKE RD; COFFMAN JA; Dean, M.; ELPHICK MR; ETTENSOHN CA

    2006-01-01

    We report the sequence and analysis of the 814-megabase genome of the sea urchin Strongylocentrotus purpuratus, a model for developmental and systems biology. The sequencing strategy combined whole-genome shotgun and bacterial artificial chromosome (BAC) sequences. This use of BAC clones, aided by a pooling strategy, overcame difficulties associated with high heterozygosity of the genome. The genome encodes about 23,300 genes, including many previously thought to be vertebrate innovations or ...

  6. Age and intrusive relations of the Lamarck granodiorite and associated mafic plutons, Sierra Nevada, California

    Energy Technology Data Exchange (ETDEWEB)

    Joye, J.L.; Bachl, C.A.; Miller, J.S.; Glazner, A.F. (Univ. of North Carolina, Chapel Hill, NC (United States). Dept. of Geology); Frost, T.P. (Geological Survey, Spokane, WA (United States)); Coleman, D.S. (Massachusetts Inst. of Tech., Cambridge, MA (United States). Dept. of Earth, Atmospheric and Planetary Sciences)

    1993-04-01

    The compositionally zoned Late Cretaceous Lamarck granodiorite, west of Bishop, hosts numerous mafic intrusions ranging from hornblende gabbro to mafic granodiorite. Frost and Mahood (1987) suggested from field relations that the Lamarck and the associated mafic plutons were co-intrusive. Contact relations between the Lamarck host and the mafic intrusions are variable (sharp to diffuse) and in places suggest commingling. In order to constrain the intrusive relationships between the Lamarck and its associated mafic plutons, the authors have analyzed feldspars from the Mt. Gilbert pluton and the Lamarck granodiorite to see if feldspar compositions in the Mt. Gilbert overlap those in the Lamarck host and determined U-Pb zircon ages for the Mt. Gilbert and Lake Sabrina plutons to see if they have the same age as the Lamarck granodiorite. Feldspars from the Lamarck granodiorite are normally zoned and range compositionally from An[sub 38--32]; those in the Mt. Gilbert diorite are also normally zoned but range compositionally from An[sub 49--41] and do not overlap the Lamarck host. Four to five zircon fractions from each pluton were handpicked and dated using U-Pb methods. The Mt. Gilbert mafic diorite has a concordant age of 92.5 Ma and the Lake Sabrina diorite has a concordant age of 91.5 Ma. Ages for the two plutons overlap within error, but multiple fractions from each suggest that the Lake Sabrina pluton is slightly younger than the Mt. Gilbert pluton. These data and field relationships indicate: (1) plagioclase phenocrysts in the Mt. Gilbert pluton were not derived from the Lamarck granodiorite despite their textural similarity; but (2) the Lamarck granodiorite and its associated mafic plutons are co-intrusive as supported by the close agreement of the ages with the crystallization age obtained by Stern and others for the Lamarck granodiorite.

  7. On Pomacea canaliculata (Lamarck, 1822) (Mollusca; Pilidae: Ampullariidae)

    OpenAIRE

    Silvana C. Thiengo; Carlos E. Borda; J. L. Barros Araújo

    1993-01-01

    This paper deals with the morphology of Pomacea caniculata (Lamarck, 1822) collected at Corrientes, Argentina. Comparison is made with Pomacea lineata (Spix, 1827) and Pomacea sordida (Swainson, 1823). The shell is globose, heavy, with greenish or horn-colored periostracum and dark spiral bands; apex subelevated, 5-6 whorls increasing rather rapidly and separated by very deep suture. Aperture large, rounded to subelongated; lip sometimes reddish; umbilicus large and deep; operculum corneous, ...

  8. The genome of the sea urchin Strongylocentrotus purpuratus.

    Science.gov (United States)

    Sodergren, Erica; Weinstock, George M; Davidson, Eric H; Cameron, R Andrew; Gibbs, Richard A; Angerer, Robert C; Angerer, Lynne M; Arnone, Maria Ina; Burgess, David R; Burke, Robert D; Coffman, James A; Dean, Michael; Elphick, Maurice R; Ettensohn, Charles A; Foltz, Kathy R; Hamdoun, Amro; Hynes, Richard O; Klein, William H; Marzluff, William; McClay, David R; Morris, Robert L; Mushegian, Arcady; Rast, Jonathan P; Smith, L Courtney; Thorndyke, Michael C; Vacquier, Victor D; Wessel, Gary M; Wray, Greg; Zhang, Lan; Elsik, Christine G; Ermolaeva, Olga; Hlavina, Wratko; Hofmann, Gretchen; Kitts, Paul; Landrum, Melissa J; Mackey, Aaron J; Maglott, Donna; Panopoulou, Georgia; Poustka, Albert J; Pruitt, Kim; Sapojnikov, Victor; Song, Xingzhi; Souvorov, Alexandre; Solovyev, Victor; Wei, Zheng; Whittaker, Charles A; Worley, Kim; Durbin, K James; Shen, Yufeng; Fedrigo, Olivier; Garfield, David; Haygood, Ralph; Primus, Alexander; Satija, Rahul; Severson, Tonya; Gonzalez-Garay, Manuel L; Jackson, Andrew R; Milosavljevic, Aleksandar; Tong, Mark; Killian, Christopher E; Livingston, Brian T; Wilt, Fred H; Adams, Nikki; Bellé, Robert; Carbonneau, Seth; Cheung, Rocky; Cormier, Patrick; Cosson, Bertrand; Croce, Jenifer; Fernandez-Guerra, Antonio; Genevière, Anne-Marie; Goel, Manisha; Kelkar, Hemant; Morales, Julia; Mulner-Lorillon, Odile; Robertson, Anthony J; Goldstone, Jared V; Cole, Bryan; Epel, David; Gold, Bert; Hahn, Mark E; Howard-Ashby, Meredith; Scally, Mark; Stegeman, John J; Allgood, Erin L; Cool, Jonah; Judkins, Kyle M; McCafferty, Shawn S; Musante, Ashlan M; Obar, Robert A; Rawson, Amanda P; Rossetti, Blair J; Gibbons, Ian R; Hoffman, Matthew P; Leone, Andrew; Istrail, Sorin; Materna, Stefan C; Samanta, Manoj P; Stolc, Viktor; Tongprasit, Waraporn; Tu, Qiang; Bergeron, Karl-Frederik; Brandhorst, Bruce P; Whittle, James; Berney, Kevin; Bottjer, David J; Calestani, Cristina; Peterson, Kevin; Chow, Elly; Yuan, Qiu Autumn; Elhaik, Eran; Graur, Dan; Reese, Justin T; Bosdet, Ian; Heesun, Shin; Marra, Marco A; Schein, Jacqueline; Anderson, Michele K; Brockton, Virginia; Buckley, Katherine M; Cohen, Avis H; Fugmann, Sebastian D; Hibino, Taku; Loza-Coll, Mariano; Majeske, Audrey J; Messier, Cynthia; Nair, Sham V; Pancer, Zeev; Terwilliger, David P; Agca, Cavit; Arboleda, Enrique; Chen, Nansheng; Churcher, Allison M; Hallböök, F; Humphrey, Glen W; Idris, Mohammed M; Kiyama, Takae; Liang, Shuguang; Mellott, Dan; Mu, Xiuqian; Murray, Greg; Olinski, Robert P; Raible, Florian; Rowe, Matthew; Taylor, John S; Tessmar-Raible, Kristin; Wang, D; Wilson, Karen H; Yaguchi, Shunsuke; Gaasterland, Terry; Galindo, Blanca E; Gunaratne, Herath J; Juliano, Celina; Kinukawa, Masashi; Moy, Gary W; Neill, Anna T; Nomura, Mamoru; Raisch, Michael; Reade, Anna; Roux, Michelle M; Song, Jia L; Su, Yi-Hsien; Townley, Ian K; Voronina, Ekaterina; Wong, Julian L; Amore, Gabriele; Branno, Margherita; Brown, Euan R; Cavalieri, Vincenzo; Duboc, Véronique; Duloquin, Louise; Flytzanis, Constantin; Gache, Christian; Lapraz, François; Lepage, Thierry; Locascio, Annamaria; Martinez, Pedro; Matassi, Giorgio; Matranga, Valeria; Range, Ryan; Rizzo, Francesca; Röttinger, Eric; Beane, Wendy; Bradham, Cynthia; Byrum, Christine; Glenn, Tom; Hussain, Sofia; Manning, Gerard; Miranda, Esther; Thomason, Rebecca; Walton, Katherine; Wikramanayke, Athula; Wu, Shu-Yu; Xu, Ronghui; Brown, C Titus; Chen, Lili; Gray, Rachel F; Lee, Pei Yun; Nam, Jongmin; Oliveri, Paola; Smith, Joel; Muzny, Donna; Bell, Stephanie; Chacko, Joseph; Cree, Andrew; Curry, Stacey; Davis, Clay; Dinh, Huyen; Dugan-Rocha, Shannon; Fowler, Jerry; Gill, Rachel; Hamilton, Cerrissa; Hernandez, Judith; Hines, Sandra; Hume, Jennifer; Jackson, Laronda; Jolivet, Angela; Kovar, Christie; Lee, Sandra; Lewis, Lora; Miner, George; Morgan, Margaret; Nazareth, Lynne V; Okwuonu, Geoffrey; Parker, David; Pu, Ling-Ling; Thorn, Rachel; Wright, Rita

    2006-11-10

    We report the sequence and analysis of the 814-megabase genome of the sea urchin Strongylocentrotus purpuratus, a model for developmental and systems biology. The sequencing strategy combined whole-genome shotgun and bacterial artificial chromosome (BAC) sequences. This use of BAC clones, aided by a pooling strategy, overcame difficulties associated with high heterozygosity of the genome. The genome encodes about 23,300 genes, including many previously thought to be vertebrate innovations or known only outside the deuterostomes. This echinoderm genome provides an evolutionary outgroup for the chordates and yields insights into the evolution of deuterostomes. PMID:17095691

  9. Greek Auditors in the Courses of Jean Lamarck

    OpenAIRE

    Spyros I. Asdrachas; Krimbas, Costas B.

    2006-01-01

    In the records of Lamarck's audiences, six students of Greek origin could be identified as attending his lectures between 1804-1827. In the catalogue published by Pietro Corsi four of them are listed as Greeks and two as Romanians. All have been properly identified. The Greeks were I. Kokkonis, S. Kanellos, D. Nitsos and D. Taillapierras, while the Romanians were two Greek physicians residing in Romania, I. K. Bouboukis and Th. Georgiades. It is worth noting that after their return to their h...

  10. A prokaryotic mycoplasma-like organism infection in the scallop Argopecten irradians

    Institute of Scientific and Technical Information of China (English)

    ZHANG Weizhu; WU Xinzhong; SUN Jingfeng; LI Dengfeng

    2007-01-01

    Intracytoplasmic infection with a prokaryotic mycoplasma-like organism (MLO) were characterized in the scallop Argopecten irradians, and the first report of such infection in this scallop was represented. Ultrastructurally these microorganisms are usually pleomorphic and variable in morphology and size, and appear in several cell types such as small spherical body, rod-shaped bodies and longer filament-shaped body. They lack a cell wall. These observations revealed that these types of the prokaryote showed some characteristics of a mycoplasma-like organism (MLO). MLO reproduced in two ways: binary fission and budding. The results of isolation and purification showed that a large number of MLOs existed in the tissues of diseased scallops. The results of experimental infection revealed that the MLO is pathogenic to the scallop Argopecten irradians.

  11. Effect of E. coli coli on Anti-disease Activities of Scallops: Argopecten irradians

    Institute of Scientific and Technical Information of China (English)

    2003-01-01

    The effect of acute E. coli challenge on the anti-disease activity of scallops Argopecten irradians is examined. The treatments of scallop from which hemolymph samples were taken for study included (1) control scallops, (2) sham-injected scallops, (3) PSW-injected scallops and (4) E. coli-injected scallops. From the beginning, the anti-disease activities of scallops are determined at 12 hr and 24 hr. The concentrations of circulating hemocytes, the total serum protein concentrations and the activities of alkaline phosphatase, acid phosphatase and superoxide dismutase in the scallops Argopecten irradians are determined. Injection with E. coli results in a significant elevation in the concentration of circulating hemocytes and in the alkaline phosphatase activity and a significant decline in the total serum protein concentration and in the superoxide dismutase activity at 24 hr postchallenge. It shows that metabolism of bay scallop is expedited to adopt the challenge.

  12. As teorias de Lamarck e Darwin nos livros didáticos de Biologia no Brasil Lamarck's and Darwin's theories in text books of Biology in Brazil

    Directory of Open Access Journals (Sweden)

    Argus Vasconcelos de Almeida

    2010-01-01

    Full Text Available As teorias de Lamarck e Darwin são analisadas numa amostra de livros didáticos brasileiros de biologia, num período de sessenta anos. A de Darwin ocupa, nos livros didáticos, uma área maior do que a de Lamarck. Nestes é variável a extensão do conteúdo de Lamarck. Dentre os livros, destacam-se as edições do BSCS. Nestas, pela primeira vez, é apresentado o exemplo da figura do alongamento do pescoço da girafa, para ilustrar as diferenças de abordagem entre as teorias, e reproduzido desde então na maioria dos livros didáticos. Na teoria de Darwin, o principal conceito referenciado pelos autores é o da seleção natural, e, na de Lamarck, a herança dos caracteres adquiridos. As duas teorias são diferentemente apresentadas nos livros didáticos de biologia no Brasil. Darwin é apresentado como modelo de cientista e Lamarck como um teórico especulativo, tendo a sua teoria consideravelmente deformada, distante da formulação original.Theories formulated by Lamarck and Darwin are analyzed in a sample of Brazilian textbooks on biology published in a period of sixty years. Darwin's theory is covered more than Lamarck's theory. Among the analyzed books, an important mention must be addressed for BSCS editions, since the example of the elongation of the giraffes" necks for illustrating differences between both theories is presented in this series for the first time, and since then has been adopted by the majority of other textbooks on biology. The main concepts presented as representative of Darwin's and Lamarck's theories by all textbooks are natural selection and the inheritance of acquired characters, respectively. Not only theories but also the authors are differently presented in reviewed textbooks: while Darwin is presented as a model of scientist, Lamarck appears as a speculative theoretician, his theoretical propositions being remarkably deformed and changed from their original formulations.

  13. Chekhovichia, a new generic replacement name for Rotalites Leleshus 1970 (Anthozoa: Heliolitoidea) non Lamarck 1801 (Protista: Foraminifera).

    Science.gov (United States)

    Doweld, Alexander B

    2015-01-01

    The genus Rotalites was established by Leleshus (1970: 97) for fossil Upper Silurian heliolitoids (Anthozoa) from Southern Tien Shan. However, the name is preoccupied by Rotalites Lamarck (1801: 401) of Foraminifera (Protista) (cf. Loeblich & Tappan, 1987). In accordance with the International Code of Zoological Nomenclature, Chekhovichia nom. nov. is proposed here as a replacement name for Rotalites Leleshus non Lamarck. PMID:26624450

  14. The sea urchin (Strongylocentrotus purpuratus test and spine proteomes

    Directory of Open Access Journals (Sweden)

    Mann Karlheinz

    2008-08-01

    Full Text Available Abstract Background The organic matrix of biominerals plays an important role in biomineral formation and in determining biomineral properties. However, most components of biomineral matrices remain unknown at present. In sea urchin, which is an important model organism for developmental biology and biomineralization, only few matrix components have been identified and characterized at the protein level. The recent publication of the Strongylocentrotus purpuratus genome sequence rendered possible not only the identification of possible matrix proteins at the gene level, but also the direct identification of proteins contained in matrices of skeletal elements by in-depth, high-accuracy, proteomic analysis. Results We identified 110 proteins as components of sea urchin test and spine organic matrix. Fourty of these proteins occurred in both compartments while others were unique to their respective compartment. More than 95% of the proteins were detected in sea urchin skeletal matrices for the first time. The most abundant protein in both matrices was the previously characterized spicule matrix protein SM50, but at least eight other members of this group, many of them only known as conceptual translation products previously, were identified by mass spectrometric sequence analysis of peptides derived from in vitro matrix degradation. The matrices also contained proteins implicated in biomineralization processes previously by inhibition studies using antibodies or specific enzyme inhibitors, such as matrix metalloproteases and members of the mesenchyme-specific MSP130 family. Other components were carbonic anhydrase, collagens, echinonectin, a α2-macroglobulin-like protein and several proteins containing scavenger receptor cysteine-rich domains. A few possible signal transduction pathway components, such as GTP-binding proteins, a semaphorin and a possible tyrosine kinase were also identified. Conclusion This report presents the most comprehensive

  15. On Pomacea canaliculata (Lamarck, 1822 (Mollusca; Pilidae: Ampullariidae

    Directory of Open Access Journals (Sweden)

    Silvana C. Thiengo

    1993-03-01

    Full Text Available This paper deals with the morphology of Pomacea caniculata (Lamarck, 1822 collected at Corrientes, Argentina. Comparison is made with Pomacea lineata (Spix, 1827 and Pomacea sordida (Swainson, 1823. The shell is globose, heavy, with greenish or horn-colored periostracum and dark spiral bands; apex subelevated, 5-6 whorls increasing rather rapidly and separated by very deep suture. Aperture large, rounded to subelongated; lip sometimes reddish; umbilicus large and deep; operculum corneous, entirely closing the aperture. Ratios: shell width/shell length = 0.78-0.96 (mean 0.86; aperture length/shell length = 0.68-0.77 (mean 0.72. Radula similar to other congeneric species. Testis and spermiduct as in P. lineata and P. sordida; prostate cylindric and short, cream in color as the testis. Penial sheath straight bearing a central outer gland deeply embedded in the tissue of its basal portion and a large wrinkled gland occupying 2/3 of the distal tip of its inner surface; the rigth margin of the sheath overlaps the left one until 2/3 of its proximal end. Female reproductive apparatus similar to that P. lineata; vestigial male copulatory apparatus (penis and its sheath present in all females examined.

  16. Retorno a Limoges. La Adaptación en Lamarck

    Directory of Open Access Journals (Sweden)

    Caponi, Gustavo

    2006-06-01

    Full Text Available In this article I will be analyzing the Darwinist paradigm in the biological science, discussing its capacity to give satisfactory understanding of the new data from biochemistry, microbiology and genetics. The general aim of this analysis is to contribute for the debate about the statute of the scientific theories. Its specific aim is to reflect upon a possible crisis of the Darwinist paradigm, which could corroborate the conception of scientific theories as something historically transitory, and not as definitive discoveries.

    Contrariando las lecturas post-darwinianas de Lamarck, Camille Limoges nos dio algunas claves que, debidamente reconsideradas, nos permiten afirmar que, para el autor de la Filosofía Zoológica, las modificaciones de los perfiles orgánicos producidas por las circunstancias no eran nada semejante a lo que hoy caracterizaríamos como respuestas a las exigencias del medio. Las mismas eran simples trasformaciones producidas por procesos fisiológicos que modelaban lo viviente con total independencia del carácter favorable o desfavorable que pudiesen revestir las modificaciones producidas.

  17. Os gêneros Fasciolaria Lamarck, 1799 e Leucozonia Gray, 1847 no nordeste brasileiro (Mollusca: Gastropoda: Fasciolariidae The genera Fasciolaria Lamarck, 1799 and Leucozonia Gray, 1847 in the northeastern Brazil (Mollusca: Gastropoda: Fasciolariidae

    Directory of Open Access Journals (Sweden)

    Helena Matthews-Cascon

    1989-01-01

    Full Text Available The genera Fasciolaria Lamarck, 1799 and Leucozonia Gray, 1847 are represented in Northeastern Brazil by three species. Fasciolaria aurantiaca Lamarck, 1816; Leucozonia ocellata (Gmelin, 1791 and Leucozonia nassa (Gmelin, 1791. The three species are described and illustrated. An identification key for all the above mentioned taxa is included, together with some ecological data. The anatomy and radula of Fasciolaria aurantiaca and Leucozonia nassa are described and illustrated. Polimorfism in Fasciolaria aurantiaca and Leucozonia nassa is discussed.

  18. Investigations into propagation and characterisation of moringa (moringa oleifera lamarck)

    International Nuclear Information System (INIS)

    Moringa oleifera Lamarck is the predominant species of the thirteen-member monogenus Moringa of the family Moringaceae. Fourteen accessions collected from five regions were evaluated for agro-morphological characteristics. Agro-morphological characterisation revealed that the 14 accessions of Moringa exhibited variability with respect to 18 traits. Experiments were also conducted in the field and laboratory to assess the performance of stem cuttings, shoot tips, stumps of decapitated plantlets and epicotyls under nursery and in vitro conditions. Stem cuttings bearing only three nodes were raised in three different types of soil while in vitro cultures were initiated on Murashige and Skoog (MS) basal medium, supplemented with varying concentrations of 6-Benzyl aminopurine (BAP). Three-node stem cuttings sprouted well in the nursery (up to 70%) with loamy soil emerging as the best medium but the survival of sprouts was low, due to poor root development. In vitro regeneration of plantlets using shoot tips was enhanced by addition of 1.5mg/L of BAP in the culture medium and greater success was achieved with 24-month old donor plants compared to 6-month old donor plants even though the former developed callus. Regeneration was also achieved from stumps of decapitated plantlets as well as epicotyl segments without addition of BAP as this suppressed both survival and root development. In addition, twelve out of the fourteen accessions were assessed with respect to variation in mineral composition, oil content (OC), total phenolics composition (TPC) and antioxidant activity (AOA) of dried leaf samples. Determination of mineral was achieved through the use of fast sequential atomic absorption spectrometer, oil content by the nuclear magnetic resonance equipment and total phenolics content was estimated spectrophotometrically at 760nm based on Folin-Ciocalteau's (FC) method with some modification, using Gallic acid as reference standard. Antioxidant activity was also

  19. Pengendalian Hama Keong Mas (Pomacea canaliculata Lamarck) Dengan Ekstrak Biji Pinang Pada Tanaman Padi

    OpenAIRE

    Yunidawati, Wiwik

    2012-01-01

    Wiwik Yunidawati, 2012. Pest Control of Golden Snails (Pomacea canaliculata Lamarck) by Areca Extract On Rice Plants. Application of Areca extract can be used to control Golden snail in rice planting. The purpose of this research is to obtain the suitable concentration of Areca extracts to control Golden snail. The research was conducted on December 2010 to April 2011 at the screen house of Observation Laboratory of Plant Disease and Biological Agents and “Balai Benih Induk Murni” Deli Se...

  20. Marine Toxin Okadaic Acid Affects the Immune Function of Bay Scallop (Argopecten irradians).

    Science.gov (United States)

    Chi, Cheng; Giri, Sib Sankar; Jun, Jin Woo; Kim, Hyoun Joong; Yun, Saekil; Kim, Sang Guen; Park, Se Chang

    2016-01-01

    Okadaic acid (OA) is produced by dinoflagellates during harmful algal blooms and is a diarrhetic shellfish poisoning toxin. This toxin is particularly problematic for bivalves that are cultured for human consumption. This study aimed to reveal the effects of exposure to OA on the immune responses of bay scallop, Argopecten irradians. Various immunological parameters were assessed (total hemocyte counts (THC), reactive oxygen species (ROS), malondialdehyde (MDA), glutathione (GSH), lactate dehydrogenase (LDH), and nitric oxide (NO) in the hemolymph of scallops at 3, 6, 12, 24, and 48 h post-exposure (hpe) to different concentrations of OA (50, 100, and 500 nM). Moreover, the expression of immune-system-related genes (CLT-6, FREP, HSP90, MT, and Cu/ZnSOD) was also measured. Results showed that ROS, MDA, and NO levels and LDH activity were enhanced after exposure to different concentrations of OA; however, both THC and GSH decreased between 24-48 hpe. The expression of immune-system-related genes was also assessed at different time points during the exposure period. Overall, our results suggest that exposure to OA had negative effects on immune system function, increased oxygenic stress, and disrupted metabolism of bay scallops. PMID:27563864

  1. Effect of the Algaecide Palmitoleic Acid on the Immune Function of the Bay Scallop Argopecten irradians

    Directory of Open Access Journals (Sweden)

    Cheng Chi

    2016-05-01

    Full Text Available Palmitoleic acid (PA, an algicidal compound, is used against the toxin producing dinofagelate Alexandrium tamarense, however, its impact on the edible bay scallop (Argopecten irradians is still unclear. Therefore, we investigated the impacts of effective algicidal concentrations (20, 40, and 80 mg/L of PA on immune responses in A. irradians. Various immune parameters including acid phosphatase (ACP activity, superoxide dismutase (SOD, lysozyme, phagocytic activity, total protein, malondialdehyde (MDA level, and reactive oxygen species (ROS production and the expression of immune-related genes (PrxV, CLT-6, MT, and BD were measured at 3, 6, 12, 24, and 48 h post-exposure (hpe to PA. Lysozyme activity was lower in scallops at 12–48 hpe to 80 mg/L. SOD, ACP activity, ROS production, the total protein, and MDA level was higher at 12 to 48 hpe with different concentrations of PA. Phagocytic activity increased at 6–12 hpe to 40–80 mg/L of PA, but decreased at 24–48 hpe. The expressions of genes PrxV, CLT-6, MT and BD down-regulated at 3 hpe were observed, while differential expressions from 6–48 hpe with different concentrations of PA. The present study demonstrated that immersing A. irradians in PA at effective concentrations could result in differential effects on non-specific immune responses and expressions of immune-related genes.

  2. Effect of the Algaecide Palmitoleic Acid on the Immune Function of the Bay Scallop Argopecten irradians.

    Science.gov (United States)

    Chi, Cheng; Giri, Sib Sankar; Jun, Jin Woo; Kim, Hyoun Joong; Kim, Sang Guen; Yun, Saekil; Park, Se Chang

    2016-01-01

    Palmitoleic acid (PA), an algicidal compound, is used against the toxin producing dinofagelate Alexandrium tamarense, however, its impact on the edible bay scallop (Argopecten irradians) is still unclear. Therefore, we investigated the impacts of effective algicidal concentrations (20, 40, and 80 mg/L) of PA on immune responses in A. irradians. Various immune parameters including acid phosphatase (ACP) activity, superoxide dismutase (SOD), lysozyme, phagocytic activity, total protein, malondialdehyde (MDA) level, and reactive oxygen species (ROS) production and the expression of immune-related genes (PrxV, CLT-6, MT, and BD) were measured at 3, 6, 12, 24, and 48 h post-exposure (hpe) to PA. Lysozyme activity was lower in scallops at 12-48 hpe to 80 mg/L. SOD, ACP activity, ROS production, the total protein, and MDA level was higher at 12 to 48 hpe with different concentrations of PA. Phagocytic activity increased at 6-12 hpe to 40-80 mg/L of PA, but decreased at 24-48 hpe. The expressions of genes PrxV, CLT-6, MT and BD down-regulated at 3 hpe were observed, while differential expressions from 6-48 hpe with different concentrations of PA. The present study demonstrated that immersing A. irradians in PA at effective concentrations could result in differential effects on non-specific immune responses and expressions of immune-related genes. PMID:27171074

  3. Growth and survival larvae of Argopecten nucleus fed with different microalgae diets

    Directory of Open Access Journals (Sweden)

    Yenia Katerine Carreño Hernández

    2012-06-01

    Full Text Available The influence of the diet on larval growth of the scallops Argopecten nucleus was studied, testing six microalgae diets composed by single-algae and mixed diets of the species Isochrysis galbana, Chaetoceros calcitrans y Tetraselmis suecica, handling a concentration per mL equivalent to 40000 cells of I. galbana and the response through the variables surviving, growth, appearance of the eye spot and state of condition (full, half-full and empty larvae was measured. The diets containing I. galbana showed greater results over all the measured variables, with regard to those where it was not present. In particular, the mixed diet I. galbana + C. calcitrans presented superiority over all variables, although in the most cases was statistically similar to I. galbana + C. calcitrans + T. suecica, I. galbana + T. suecica and I. galbana alone. For the opposite, the diets with the lowest results were C. calcitrans and C. calcitrans +T. suecica. The results obtained are principally attributed to the nutritional composition mainly of high unsaturated fatty acids (HUFA of each microalgae and each mixture supply, which is discussed in detail.

  4. La difusión de la teoría evolucionista de Lamarck en la revista La Abeja

    OpenAIRE

    Camós Cabeceran, Agustí

    1997-01-01

    La obra de Lamarck fue difundida, entre los años 1862 y 1865, por la revista La Abeja dirigida por Antoni Bergnes de las Casas y publicada en Barcelona. En dicha revista aparece explicada la teoría evolucionista de Lamarck tanto en la traducción de su obra. Histoire naturelle des végétaux, como en una serie de artículos anónimos sobre la reproducción de los seres vivos. Estos datos pueden revelar que, en la introducción del evolucionismo en España, la teoría evolucionista de Lamarck tuvo mayo...

  5. Anatomia e histologia do aparelho reprodutor masculino de Pomacea canaliculata (Lamarck, 1822 (Mollusca, Gastropoda, Pilidae

    Directory of Open Access Journals (Sweden)

    Eliana de Fátima Marques de Mesquita

    1990-01-01

    Full Text Available In this paper the authors give an anatomical and histological analysis of the male reproductive system of Pomacea canaliculata (Lamarck, 1822. Anatomically, the testis is better evidentiated than the ovary. In the structure of the testis a great number of very small channels converges to a single one. The male copulatory organs result of transformations that take place in the inner surface on the palial membrane. Histologically, the testis of immature males shows seminiferous ducts with round egg-shaped forms. In their lumens we could notice masses of cells that will originate spermatozoids. The penis has a conjunctive muscular sheath that can be seen in van Gieson's coloured preparations.

  6. Histamine is a modulator of metamorphic competence in Strongylocentrotus purpuratus (Echinodermata: Echinoidea

    Directory of Open Access Journals (Sweden)

    Sutherby Josh

    2012-04-01

    Full Text Available Abstract Background A metamorphic life-history is present in the majority of animal phyla. This developmental mode is particularly prominent among marine invertebrates with a bentho-planktonic life cycle, where a pelagic larval form transforms into a benthic adult. Metamorphic competence (the stage at which a larva is capable to undergo the metamorphic transformation and settlement is an important adaptation both ecologically and physiologically. The competence period maintains the larval state until suitable settlement sites are encountered, at which point the larvae settle in response to settlement cues. The mechanistic basis for metamorphosis (the morphogenetic transition from a larva to a juvenile including settlement, i.e. the molecular and cellular processes underlying metamorphosis in marine invertebrate species, is poorly understood. Histamine (HA, a neurotransmitter used for various physiological and developmental functions among animals, has a critical role in sea urchin fertilization and in the induction of metamorphosis. Here we test the premise that HA functions as a developmental modulator of metamorphic competence in the sea urchin Strongylocentrotus purpuratus. Results Our results provide strong evidence that HA leads to the acquisition of metamorphic competence in S. purpuratus larvae. Pharmacological analysis of several HA receptor antagonists and an inhibitor of HA synthesis indicates a function of HA in metamorphic competence as well as programmed cell death (PCD during arm retraction. Furthermore we identified an extensive network of histaminergic neurons in pre-metamorphic and metamorphically competent larvae. Analysis of this network throughout larval development indicates that the maturation of specific neuronal clusters correlates with the acquisition of metamorphic competence. Moreover, histamine receptor antagonist treatment leads to the induction of caspase mediated apoptosis in competent larvae. Conclusions We

  7. Discussion of evolution between neo-lamarckism and neo-darwinism in the Czech lands, 1900-1915

    Czech Academy of Sciences Publication Activity Database

    Hermann, Tomáš; Šimůnek, Michal V.

    2010-01-01

    Roč. 32, č. 3 (2010), s. 283-300. ISSN 1210-0250 R&D Projects: GA ČR GPP410/10/P550 Institutional research plan: CEZ:AV0Z80630520 Keywords : neo-lamarckism * neo-darwinism * history of biology Subject RIV: AB - History

  8. Structural characterization and mechanical behavior of a bivalve shell (Saxidomus purpuratus)

    International Nuclear Information System (INIS)

    The structure and mechanical behavior of Saxidomus purpuratus bivalve shell were investigated. XRD results show that the only form of calcium carbonate present in the shell is aragonite. The inner and middle layers have a cross-lamellar structure, while the outer layer has porosity and does not have tiles, but instead has 'blocky' regions. The hardness of middle and inner layer are close in both plane view and cross section, but the hardness of outer layer is significantly less, especially in the plane view. The compressive strengths with loading along the three orientations were established and significant differences were found. The Weibull strength at 50% of the probability of failure varies between 59 and 148 MPa and is dependent on the loading orientation and in condition of shell (dry vs. hydrated). These differences are interpreted in terms of the anisotropic structure and coarser structure of the external layer.

  9. Effects of chronic gamma radiation on the growth and survival of juvenile clams (Mercenaria mercenaria) and scallops (Argopecten irradians)

    International Nuclear Information System (INIS)

    Juvenile clams (Mercenaria mercenaria) and scallops (Argopecten irradians) from North Carolina were exposed to five intensities of chronic γ radiation for 3 to 14 months during 1973/1974. Exposure rates ranged downward from 37 rads/hr to levels slightly higher than background radiation. Deleterious effects on growth and survival of clams occurred only at the highest exposure rate (37 to 16 rads/hr). Clams exposed to low radiation levels (0.007 to 0.008 rads/hr) increased in weight, but not in length, faster than the controls. One-half of the clams exposed to the highest radiation level survived to 159 days, after a cumulative dose of 132 krads, and only 10 % survived to 14 months after a cumulative dose of 150 to 346 krads. No deleterious effects on growth and survival of scallops were apparent during 84 days of exposure to a cumulative radiation dose of 71.7 krads. (author)

  10. Estudios histológico e histoquímico del sistema digestivo de la almeja catarina Argopecten ventricosus (Sowerby, 1842)

    OpenAIRE

    Cáceres, C.; Alarcón, F.J.

    2002-01-01

    Histological and histochemical studies on the digestive system of Argopecten ventricosus (Sowerby, 1842) was carried out. Lips show a ciliated columnar epithelium with glycoproteins and acid and alkaline phosphatases, and α-D glucosidase activity. Esophagus and lips epitheliums are similar. Acid and alkaline phosphatases, α-D glucosidase and leucil aminopeptidase activities were detected. The epithelium of the stomach is ciliated and contains glands which secrete glycoproteins. Acid and alkal...

  11. "Spiral asters" and cytoplasmic rotation in sea urchin eggs: induction in Strongylocentrotus purpuratus eggs by elevated temperature

    OpenAIRE

    1985-01-01

    "Spiral asters" composed of swirls of subcortical microtubules were recently described in fertilized eggs of the sea urchin Strongylocentrotus purpuratus. In our study, these structures did not occur at culture temperatures below 16 degrees C. When the culture temperature was elevated, however, "spiral asters" routinely appeared during a susceptible period before mitotic prophase when the sperm aster-diaster normally exists. A massive and protracted rotation of the cytoplasm (excluding an imm...

  12. First record of Dichotomaria obtusata (Ellis & Solander Lamarck (Nemaliales, Rhodophyta in the Mediterranean Sea

    Directory of Open Access Journals (Sweden)

    R. HOFFMAN

    2015-07-01

    Full Text Available Global climate change is causing the Mediterranean coastal area of Israel to gradually acquire tropical characteristics. Rising sea surface temperatures in the eastern Mediterranean basin have facilitated the introduction, settlement and establishment of hundreds of alien species (Zenetos et al. 2012. The vast majority of these exotic species are of Indo-Pacific origin. We report the occurrence of the genus Dichotomaria in the eastern Mediterranean on the basis of specimens identified as Dichotomaria cf. obtusata (J. Ellis & Solander Lamarck. Tetrasporophytes with sporangial initials were identified morphologically and confirmed molecularly using plastid rbcL sequences. We also discuss possible paths of introduction of this and other alien species into the Levantine Sea.

  13. Anatomia e histologia do conduto genital feminino de Pomacea canaliculata (Lamarck, 1822 (Mollusca, Gastropoda, Pilidae

    Directory of Open Access Journals (Sweden)

    Eliana de Fátima Marques de Mesquita

    1990-01-01

    Full Text Available In this paper the authors give an anatomical and histological analysis of the genital duct in mature and immature females of Pomacea canaliculata (Lamarck, 1822. Anatomically, the vagina has an equal dimension in its extension, varying in form and volume, according to the maturation period. In the immaturity, it has a smaller diameter and volume. In the maturity, the vagina increases in volume, having the aspect of a tumescent organ, and in certain specimens shows an albuminous pink thread in its lumen. Histologically, the calcigenic activity of the gland is evidentiated by the presence of an amorphous and basophilic mass, without nuclear material. This material has a fragmented aspect in the vagina lumen that reacts positively in van Kossa's coloured preparations for calcareous salts.

  14. Effects of produced water on gametogenesis and gamete performance in the purple sea urchin (Stronglyocentrotus purpuratus)

    International Nuclear Information System (INIS)

    The author examined the effects of a chronic exposure to produced water (an oil production effluent) discharge on the gametogenesis and gamete performance of the purple sea urchin (Strongylocentrotus purpuratus) using an in situ caging experiment. Adult purple urchins were kept in benthic cages arrayed down-field from a discharging diffuser at 13 sites with distances ranging from 5m to 1,000m. Cage exposures were maintained in the field for eight weeks and each cage held 25 urchins. Gametogenesis was examined for each sex by comparing a size-independent measure of gonad mass as determined by analysis of covariance. The author found that there was a significant negative relationship between gonad mass and cage distance for both sexes, indicating that urchins living closer to the outfall produced significantly larger gonads. Gamete performance was measured through a fertilization kinetic bioassay that holds the concentration of eggs constant and varies the amount of sperm added. The proportion of eggs fertilized under each sperm concentration was determined and the response fit to a kinetics model. Significant differences were found in the fertilizability of eggs between cages. This showed a positive relationship with distance away from the outfall. The findings indicate that while adult urchins exposed to a produced water outfall produced larger gonads, they suffered a marked decreases in gamete performance

  15. Identification and developmental expression of the ets gene family in the sea urchin (Strongylocentrotus purpuratus).

    Science.gov (United States)

    Rizzo, Francesca; Fernandez-Serra, Montserrat; Squarzoni, Paola; Archimandritis, Aristea; Arnone, Maria I

    2006-12-01

    A systematic search in the available scaffolds of the Strongylocentrotus purpuratus genome has revealed that this sea urchin has 11 members of the ets gene family. A phylogenetic analysis of these genes showed that almost all vertebrate ets subfamilies, with the exception of one, so far found only in mammals, are each represented by one orthologous sea urchin gene. The temporal and spatial expression of the identified ETS factors was also analyzed during embryogenesis. Five ets genes (Sp-Ets1/2, Sp-Tel, Sp-Pea, Sp-Ets4, Sp-Erf) are also maternally expressed. Three genes (Sp-Elk, Sp-Elf, Sp-Erf) are ubiquitously expressed during embryogenesis, while two others (Sp-Gabp, Sp-Pu.1) are not transcribed until late larval stages. Remarkably, five of the nine sea urchin ets genes expressed during embryogenesis are exclusively (Sp-Ets1/2, Sp-Erg, Sp-Ese) or additionally (Sp-Tel, Sp-Pea) expressed in mesenchyme cells and/or their progenitors. Functional analysis of Sp-Ets1/2 has previously demonstrated an essential role of this gene in the specification of the skeletogenic mesenchyme lineage. The dynamic, and in some cases overlapping and/or unique, developmental expression pattern of the latter five genes suggests a complex, non-redundant function for ETS factors in sea urchin mesenchyme formation and differentiation. PMID:16997294

  16. Lamarck needs Darwin: the search for purpose in the study of evolution and of history

    Directory of Open Access Journals (Sweden)

    Moreno, Juan

    2009-12-01

    Full Text Available Lamarck´s theory of the inheritance of acquired characteristics and immediate responses to environmental challenges has offered a promise of protagonism of human beings and their fellow trvellers, the other organisms, in the evolutionary process. Darwin’s theory about evolution by natural selection does not offer this consolation and does not presuppose anything else other than gradual cahnges in the composition of natural populations. The study of ecology, ethology, neurobiology, animal culture, psichology and human history reveals that the lamarckian interpretations of change and character transmission processes always assume what they intend to explain, that is previous processes of darwinian evolution that guarantee the adaptive nature of the observed responses. The permanent search of direction and intentionality in evolutionary processes by many scientists suggests the limited acceptance of materilaistic explanations as those offered by Darwin’s theory.

    a teoría de Lamarck sobre herencia de caracteres adquiridos y sobre respuestas inmediatas a retos ambientales ha ofrecido una promesa de intencionalidad y protagonismo en el proceso evolutivo al ser humano y a los restantes organismos. La teoría de Darwin sobre evolución por selección natural no ofrece este consuelo y no presupone nada más que procesos de recambio gradual en poblaciones naturales. El estudio de la ecología, la etología, la neurobiología, la cultura animal, la psicología y la historia humana revela que las interpretaciones lamarckianas de los cambios y procesos de transmisión de caracteres presuponen siempre lo que pretenden explicar, es decir procesos previos de evolución darwiniana que garantizan la naturaleza adaptativa de las respuestas observadas. La búsqueda continua de dirección y de intención en los procesos evolutivos por muchos científicos sugiere la escasa aceptación de explicaciones materialistas como las que ofrece la teoría de

  17. Molecular cloning of the first metazoan beta-1,3 glucanase from eggs of the sea urchin Strongylocentrotus purpuratus.

    OpenAIRE

    Bachman, E S; McClay, D R

    1996-01-01

    We report the molecular cloning of the first beta-1,3 glucanase from animal tissue. Three peptide sequences were obtained from beta-1,3 glucanase that had been purified from eggs of the sea urchin Strongylocentrotus purpuratus and the gene was cloned by PCR using oligonucleotides deduced from the peptide sequences. The full-length cDNA shows a predicted enzyme structure of 499 aa with a hydrophobic signal sequence. A 3.2-kb message is present in eggs, during early embryogenesis, and in adult ...

  18. Caracterización de algunas técnicas de inmunofluorescencia y de fluorescencia en mejillones chilenos Perumytilus purpuratus y Semimytilus algosus

    OpenAIRE

    Orlando Garrido; José Pino

    2014-01-01

    Gametos y estadios larvales de los mejillones P. purpuratus y S. algosus fueron tratados in vitro con técnicas de fluorescencia y no fluorescencia a fin de detectar microfilamentos, DNA y gránulos corticales involucrados con estadios de la reproducción como fertilización y clivaje. En P. purouratus se detectó tubulina a nivel de los cilios y el velum; asimismo, la actina fue detectada desde el estadio de fertilización a los estadios de desarrollo tanto en P purpuratus como en S. algosus, lo q...

  19. The next evolutionary synthesis: from Lamarck and Darwin to genomic variation and systems biology

    Directory of Open Access Journals (Sweden)

    Bard Jonathan BL

    2011-11-01

    Full Text Available Abstract The evolutionary synthesis, the standard 20th century view of how evolutionary change occurs, is based on selection, heritable phenotypic variation and a very simple view of genes. It is therefore unable to incorporate two key aspects of modern molecular knowledge: first is the richness of genomic variation, so much more complicated than simple mutation, and second is the opaque relationship between the genotype and its resulting phenotype. Two new and important books shed some light on how we should view evolutionary change now. Evolution: a view from the 21st century by J.A. Shapiro (2011, FT Press Science, New Jersey, USA. pp. 246. $34.99. examines the richness of genomic variation and its implications. Transformations of Lamarckism: from Subtle Fluids to Molecular Biology edited by S.B. Gissis & E. Jablonka (2011, MIT Press, Cambridge, USA. pp. 457 includes some 40 papers that anyone with an interest in the history of evolutionary thought and the relationship between the environment and the genome will want to read. This review discusses both books within the context of contemporary evolutionary thinking and points out that neither really comes to terms with today's key systems-biology question: how does mutation-induced variation in a molecular network generate variation in the resulting phenotype?

  20. Phosphoproteomes of Strongylocentrotus purpuratus shell and tooth matrix: identification of a major acidic sea urchin tooth phosphoprotein, phosphodontin

    Directory of Open Access Journals (Sweden)

    Mann Matthias

    2010-02-01

    Full Text Available Abstract Background Sea urchin is a major model organism for developmental biology and biomineralization research. However, identification of proteins involved in larval skeleton formation and mineralization processes in the embryo and adult, and the molecular characterization of such proteins, has just gained momentum with the sequencing of the Strongylocentrotus purpuratus genome and the introduction of high-throughput proteomics into the field. Results The present report contains the determination of test (shell and tooth organic matrix phosphoproteomes. Altogether 34 phosphoproteins were identified in the biomineral organic matrices. Most phosphoproteins were specific for one compartment, only two were identified in both matrices. The sea urchin phosphoproteomes contained several obvious orthologs of mammalian proteins, such as a Src family tyrosine kinase, protein kinase C-delta 1, Dickkopf-1 and other signal transduction components, or nucleobindin. In most cases phosphorylation sites were conserved between sea urchin and mammalian proteins. However, the majority of phosphoproteins had no mammalian counterpart. The most interesting of the sea urchin-specific phosphoproteins, from the perspective of biomineralization research, was an abundant highly phosphorylated and very acidic tooth matrix protein composed of 35 very similar short sequence repeats, a predicted N-terminal secretion signal sequence, and an Asp-rich C-terminal motif, contained in [Glean3:18919]. Conclusions The 64 phosphorylation sites determined represent the most comprehensive list of experimentally identified sea urchin protein phosphorylation sites at present and are an important addition to the recently analyzed Strongylocentrotus purpuratus shell and tooth proteomes. The identified phosphoproteins included a major, highly phosphorylated protein, [Glean3:18919], for which we suggest the name phosphodontin. Although not sequence-related to such highly phosphorylated

  1. Caracterización de algunas técnicas de inmunofluorescencia y de fluorescencia en mejillones chilenos Perumytilus purpuratus y Semimytilus algosus

    Directory of Open Access Journals (Sweden)

    Orlando Garrido

    2014-06-01

    Full Text Available Gametos y estadios larvales de los mejillones P. purpuratus y S. algosus fueron tratados in vitro con técnicas de fluorescencia y no fluorescencia a fin de detectar microfilamentos, DNA y gránulos corticales involucrados con estadios de la reproducción como fertilización y clivaje. En P. purouratus se detectó tubulina a nivel de los cilios y el velum; asimismo, la actina fue detectada desde el estadio de fertilización a los estadios de desarrollo tanto en P purpuratus como en S. algosus, lo que sugiere que no son descartados durante el proceso de fertilización. Los microfilamentos detectados en ambos mejillones sugieren que ellos juegan un rol importante como integrante del citoesqueleto durante el desarrollo.

  2. Relative warp and correlation analysis based on distances of the morphological shell shape patterns of Pomacea canaliculata Lamarck from Japan and the Philippines

    OpenAIRE

    Carlo Stephen O. Moneva; Mark Anthony J. Torres; Takashi Wada; Ravindra Joshi; Cesar G. Demayo

    2012-01-01

    The Golden Apple Snail (GAS), Pomacea canaliculata Lamarck is considered one of the serious agricultural pests of rice in Asia. Itis being argued that rapid invasion of this species in many variable habitats suggests genetic variability and differentiation which could be expressedat the level of the phenotype. It is therefore the major objective of the study to explore possible phenotypic differentiation in the organismespecially in the shape of the shell using geometric morphometric (GM) ana...

  3. Effects of increased pCO2 and geographic origin on purple sea urchin (Strongylocentrotus purpuratus calcite elemental composition

    Directory of Open Access Journals (Sweden)

    J. D. Hosfelt

    2012-12-01

    Full Text Available Ocean acidification will likely have negative impacts on invertebrates producing skeletons composed of calcium carbonate. Skeletal solubility is partly controlled by the incorporation of "foreign" ions (such as Mg and Sr into the crystal lattice of these skeletal structures, a process that is sensitive to a variety of biological and environmental factors. Here we explore the effects of life stage, oceanographic region of origin, and changes in the partial pressure of carbon dioxide in seawater (pCO2 on trace elemental composition in the purple sea urchin (Strongylocentrotus purpuratus. We show that, similar to other urchin taxa, adult purple sea urchins have the ability to precipitate skeleton composed of a range of biominerals spanning low to high magnesium calcites. Mg/Ca and Sr/Ca ratios were substantially lower in adult spines compared to adult tests. On the other hand, trace elemental composition was invariant among adults collected from four oceanographically distinct regions along the US west coast (Oregon, Northern California, Central California, and Southern California. Skeletons of newly settled juvenile urchins that originated from adults from the four regions exhibited intermediate Mg/Ca and Sr/Ca between adult spine and test endmembers, indicating that skeleton precipitated during early life stages is more soluble than adult spines and less soluble than adult tests. Mean skeletal Mg/Ca or Sr/Ca of juvenile skeleton did not vary with source region when larvae were reared under present-day, global-average seawater carbonate conditions (400 ppm; pH = 8.02 ± 0.03 1 SD; Ωcalcite = 3.3 ± 0.2 1 SD. However, when reared under elevated CO2 (900 ppm; pH = 7.72 ± 0.03; Ωcalcite = 1.8 ± 0.1, skeletal Sr/Ca in juveniles exhibited increased variance across the four regions. Although larvae from the northern populations (Oregon, Northern California, Central California did not exhibit differences in Mg or Sr incorporation under elevated CO2

  4. Effects of five southern California macroalgal diets on consumption, growth, and gonad weight, in the purple sea urchin Strongylocentrotus purpuratus

    Directory of Open Access Journals (Sweden)

    Matthew C. Foster

    2015-01-01

    Full Text Available Consumer growth and reproductive capacity are direct functions of diet. Strongylocentrotid sea urchins, the dominant herbivores in California kelp forests, strongly prefer giant kelp (Macrocystis pyrifera, but are highly catholic in their ability to consume other species. The biomass of Macrocystis fluctuates greatly in space and time, and the extent to which urchins can use alternate species of algae or a mixed diet of multiple algal species to maintain fitness when giant kelp is unavailable is unknown. We experimentally examined the effects of single and mixed species diets on consumption, growth and gonad weight in the purple sea urchin Strongylocentrotus purpuratus. Urchins were fed single species diets consisting of one of four common species of macroalgae (the kelps Macrocystis pyrifera and Pterygophora californica, and the red algae Chondracanthus corymbiferus and Rhodymenia californica (hereafter referred to by genus or a mixed diet containing all four species ad libitum over a 13-week period in a controlled laboratory setting. Urchins fed Chondracanthus, Macrocystis and a mixed diet showed the highest growth (in terms of test diameter, wet weight and jaw length and gonad weight, while urchins fed Pterygophora and Rhodymenia showed the lowest. Urchins consumed their preferred food, Macrocystis, at the highest rate when offered a mixture, but consumed Chondracanthus or Macrocystis at similar rates when the two algae were offered alone. The differences in urchin feeding behavior and growth observed between these diet types suggest the relative availability of the algae tested here could affect urchin populations and their interactions with the algal assemblage. The fact that the performance of urchins fed Chondracanthus was similar or higher than those fed the preferred Macrocystis suggests that the availability of the former could could sustain growth and reproduction of purple sea urchins during times of low Macrocystis abundance as is

  5. Accumulation, Biotransformation, Histopathology and Paralysis in the Pacific Calico Scallop Argopecten ventricosus by the Paralyzing Toxins of the Dinoflagellate Gymnodinium catenatum

    Science.gov (United States)

    Escobedo-Lozano, Amada Y.; Estrada, Norma; Ascencio, Felipe; Contreras, Gerardo; Alonso-Rodriguez, Rosalba

    2012-01-01

    The dinoflagellate Gymnodinium catenatum produces paralyzing shellfish poisons that are consumed and accumulated by bivalves. We performed short-term feeding experiments to examine ingestion, accumulation, biotransformation, histopathology, and paralysis in the juvenile Pacific calico scallop Argopecten ventricosus that consume this dinoflagellate. Depletion of algal cells was measured in closed systems. Histopathological preparations were microscopically analyzed. Paralysis was observed and the time of recovery recorded. Accumulation and possible biotransformation of toxins were measured by HPLC analysis. Feeding activity in treated scallops showed that scallops produced pseudofeces, ingestion rates decreased at 8 h; approximately 60% of the scallops were paralyzed and melanin production and hemocyte aggregation were observed in several tissues at 15 h. HPLC analysis showed that the only toxins present in the dinoflagellates and scallops were the N-sulfo-carbamoyl toxins (C1, C2); after hydrolysis, the carbamate toxins (epimers GTX2/3) were present. C1 and C2 toxins were most common in the mantle, followed by the digestive gland and stomach-complex, adductor muscle, kidney and rectum group, and finally, gills. Toxin profiles in scallop tissue were similar to the dinoflagellate; biotransformations were not present in the scallops in this short-term feeding experiment. PMID:22822356

  6. Electron Spin Resonance Studies of Mn2+ in Freshwater Snail Shells: Pomacea Canaliculata Lamarck and Fossilized Snail Shell

    Institute of Scientific and Technical Information of China (English)

    N. Udomkan; S. Meejoo; P. Limsuwan; P. Winotai; Y. Chaimanee

    2005-01-01

    @@ We study paramagnetic Mn2+ ions present in the nowadays shells of univalve freshwater snails of Pomacea canaliculata lamarck (PCL) and the fossilized freshwater snail (FFS), Viviparus. All these shells are abundant in Thailand. The PCL shells were ground into fine powder. A set of seven samples were then separately annealed for 2 h in air atmosphere at different annealing temperatures while the FFS powder was characterized as-received.The PCL shells mainly consist of aragonite and a fraction of calcite. The heat treatments of the PCL powder samples at temperature higher than 450 ℃ resulted in an irreversible phase transformation from aragonite to calcite. However, it is found that the FFS shell is mainly made of calcite, with a minor fraction of aragonite. The crystal structure of the high-temperature-annealed PCL samples are quite similar to that of FFS, which indicates that the metamorphosis (aragonite → calcite) in the FFS shell had occurred but was not yet completed, although it had remained under the pressure and temperature of the Earth's crusts over millions of years. Our detailed ESR spectral analyses of PCL and FFS show that Mn2+ ions enter the Ca2+ sites during a biomineralization process. Simulated ESR parameters of PCL-500 of Mn2+ at a uniaxial site of calcite are reported. It is surprising to find that the ratio of Mn2+ concentration present in FFS to those in PCL shells evaluated from ESR spectra is as much as 10:1.

  7. Increased antioxidant activity and changes in phenolic profile of Kalanchoe pinnata (Lamarck) Persoon (Crassulaceae) specimens grown under supplemental blue light.

    Science.gov (United States)

    Nascimento, Luana B S; Leal-Costa, Marcos V; Coutinho, Marcela A S; Moreira, Nattacha dos S; Lage, Celso L S; Barbi, Nancy dos S; Costa, Sônia S; Tavares, Eliana S

    2013-01-01

    Antioxidant compounds protect plants against oxidative stress caused by environmental conditions. Different light qualities, such as UV-A radiation and blue light, have shown positive effects on the production of phenols in plants. Kalanchoe pinnata (Lamarck) Persoon (Crassulaceae) is used for treating wounds and inflammations. Some of these beneficial effects are attributed to the antioxidant activity of plant components. We investigated the effects of blue light and UV-A radiation supplementation on the total phenol content, antioxidant activity and chromatographic profile of aqueous extracts from leaves of K. pinnata. Monoclonal plants were grown under white light, white plus blue light and white plus UV-A radiation. Supplemental blue light improved the antioxidant activity and changed the phenolic profile of the extracts. Analysis by HPLC of supplemental blue-light plant extracts revealed a higher proportion of the major flavonoid quercetin 3-O-α-L-arabinopyranosyl (1→2) α-L-rhamnopyranoside, as well as the presence of a wide variety of other phenolic substances. These findings may explain the higher antioxidant activity observed for this extract. Blue light is proposed as a supplemental light source in the cultivation of K. pinnata, to improve its antioxidant activity. PMID:23057576

  8. Estudio histomorfológico del aparato digestivo y distribución histoquímica de carbohidratos en el ostión Crassostrea angulata (Lamarck, 1819) (Histomorphological study of the digestive tract of the oyster Crassostrea angulata (Lamarck, 1819), and distribution of carbohydrates)

    OpenAIRE

    Rodríguez de la Rúa, Ana; González de Canales, María Luisa; Sarasquete, Carmen

    2002-01-01

    [EN] We present a histomorphological description of the digestive tract of the oyster Crassostrea angulata (Lamarck, 1819), as well as a histochemical study of its carbohydrate distribution. The study shows that, in general, glycogen is found in the connective tissue, and neutral mucopolysaccharides/glycoproteins and/or acid mucosubstances in the epithelium and basal cell layers. Glycogen was not detected in the digestive gland, possibly because of its mobilization to the connective tissu...

  9. Seasonal variation of biochemical components in clam ( Saxidomus purpuratus Sowerby 1852) in relation to its reproductive cycle and the environmental condition of Sanggou Bay, China

    Science.gov (United States)

    Bi, Jinhong; Li, Qi; Zhang, Xinjun; Zhang, Zhixin; Tian, Jinling; Xu, Yushan; Liu, Wenguang

    2016-04-01

    Seasonal variation of biochemical components in clam ( Saxidomus purpuratus Sowerby 1852) was investigated from March 2012 to February 2013 in relation to environmental condition of Sanggou Bay and the reproductive cycle of clam. According to the histological analysis, the reproductive cycle of S. purpuratus includes two distinctive phases: a total spent and inactive stage from November to January, and a gametogenesis stage, including ripeness and spawning, during the rest of the year. Gametes were generated at a low temperature (2.1°C) in February. Spawning took place once a year from June to October. The massive spawning occurred in August when the highest water temperature and chlorophyll a level could be observed. The key biochemical components (glycogen, protein and lipid) in five tissues (gonad, foot, mantle, siphon and adductor muscle) were analyzed. The glycogen content was high before gametogenesis, and decreased significantly during the gonad development in the gonad, mantle and foot of both females and males, suggesting that glycogen was an important energy source for gonad development. The protein and lipid contents increased in the ovary during the gonad development, demonstrating that they are the major organic components of oocytes. The lipid and protein contents decreased in the testis, implying that they can provide energy and material for spermatogenesis. The results also showed that protein stored in the mantle and foot could support the reproduction after the glycogen was depleted.

  10. New approaches to the management of golden apple snail, Pomacea canaliculata (Lamarck): An invasive alien pest species of rice

    International Nuclear Information System (INIS)

    Full text: Golden apple snail (GAS), Pomacea canaliculata (Lamarck) is native to South America. It was introduced to farmers in the Philippines in the 1980s from Argentina via Taiwan, and to other countries in Asia to increase their income and to enrich the protein intake in their diet, and also as an aquarium pet. The Global Invasive Species (IAS) FAO report that it causes 1.2 billion USD losses to aquatic crops particularly rice, taro and morning glory in Asian countries and the USA. Aside from being a serious agricultural pest, it is also an environmental pest. In an attempt to control GAS resource-poor-farmers resort to 'shot-gun approach' of using toxic and non specific agrochemicals thereby aggravating ecosystem pollution, risking their health and causing loss of aquatic biodiversity. GAS is expanding its distribution westwards in Asia and poses new threats of its invasion in Australia, India, Bangladesh and Pakistan. At the Philippine Rice Research Institute (PhilRice), my team focuses on two approaches. First we have to understand the field ecology of the GAS and identify weak-links in their life cycle. Then we use this basic information to manage GAS at the village level within the community in an ecologically sustainable socially acceptable and economically viable ways. I shall discuss how this LAS in transplanted lowland irrigated rice ecologies can be managed using locally available attractants during the vulnerable stage(s) of rice crop growth. New approaches will highlight the innovative and applied techniques on how to prevent the rampant abuse/misuse of agrochemicals, as well as GAS utilisation in weed management in rice fields and as aqua feed. In future, it is necessary to develop collaborative exploratory research with the IAEA and the Philippine Nuclear Research Institute (PNRI) to develop an effective area-wide management of GAS in direct-seeded rice systems that will capitalise on an integrated approach and environment-friendly technologies

  11. El cuento como estrategia didáctica para la enseñanza de las teorías de la evolución de Lamarck y Darwin-Wallace a nivel medio superior

    Directory of Open Access Journals (Sweden)

    María Lorena Yoloxochitl Karla Quintino Salazar

    2013-02-01

    Full Text Available El objetivo de la presente investigación fue analizar el cuento como una estrategia didáctica en el proceso de enseñanza-aprendizaje para la comprensión de las teorías de la evolución de Lamarck y Darwin- Wallace. La naturaleza de la investigación fue del tipo cuantitativo. El tratamiento de resultados fue realizado mediante un Análisis de X2 (chi cuadrado en la frecuencia de las respuestas del pretest y del postest, en función de discriminar entre los grupos estudiados. Con base en la hipótesis alternativa se estableció que la narrativa como estrategia didáctica promueve el aprendizaje de las teorías de Lamarck y Darwin-Wallace

  12. Estudio histomorfológico del aparato digestivo y distribución histoquímica de carbohidratos en el ostión Crassostrea angulata (Lamarck, 1819)

    OpenAIRE

    Rodríguez de la Rúa, A.; González de Canales, M. L.; Sarasquete, C.

    2002-01-01

    We present a histomorphological description of the digestive tract of the oyster Crassostrea angulata (Lamarck, 1819), as well as a histochemical study of its carbohydrate distribution. The study shows that, in general, glycogen is found in the connective tissue, and neutral mucopolysaccharides/glycoproteins and/or acid mucosubstances in the epithelium and basal cell layers. Glycogen was not detected in the digestive gland, possibly because of its mobilization to the connective tissue for rep...

  13. De Darwin à Lamarck

    OpenAIRE

    Kropotkine, Pierre; Garcia, Renaud

    2015-01-01

    Avec L’entraide. Un facteur de l’évolution (1902), le scientifique darwinien et théoricien anarchiste Pierre Kropotkine a essayé d’établir que l’entraide était un facteur de l’évolution autant sinon plus important que la compétition. L’évolution ne pouvait se résumer à la survie des plus aptes dans un cadre malthusien. Mais s’il existe dans la nature une entraide intra-spécifique, qu’en est-il des rapports inter-spécifiques, et entre les organismes en général et le milieu ? Dans une série d...

  14. A construção da oposição entre Lamarck e Darwin e a vinculação de Nietzsche ao eugenismo

    Directory of Open Access Journals (Sweden)

    Wilson Antonio Frezzatti Júnior

    2011-01-01

    Full Text Available A construção da oposição total entre as teorias evolucionistas de Jean-Baptiste Lamarck e de Charles Darwin foi utilizada, em fins do século xix e início do século xx, para classificar autores que escreviam sobre a evolução, mesmo aqueles que não eram cientistas. Claire Richter, em Nietzsche e as teorias biológicas contemporâneas, afirma que o lamarckismo de Nietzsche é muito pronunciado, e, para isso, distingue o que é propriamente darwiniano e propriamente lamarckiano. Em nosso trabalho, pretendemos entender por que essa distinção foi aplicada a um filósofo como Nietzsche. A chave da questão está, para nós, na diferença que a autora faz entre a seleção natural e a herança dos caracteres adquiridos e na relação que ela estabelece entre essas noções e o eugenismo. O objetivo de Richter é transformar Nietzsche em um dos principais e primeiros defensores do eugenismo. O seu esforço em mostrar que o pensamento nietzschiano é lamarckista está a serviço da divulgação de ideias eugenistas. A herança dos caracteres adquiridos, por sua relativa rapidez em alterar os seres vivos, pode embasar e justificar ações educativas e sociais para melhoria da raça.The construction of the total opposition between the Lamarckian and the Darwinian evolutionary theories was employed to classify authors scientists or not _ who wrote about evolution in the late nineteenth and early twentieth century. Claire Richter, in Nietzsche et les theories biologiques contemporaines (1911, argues that Nietzsche's Lamarckism is very pronounced, and, for this, she distinguishes what is properly Darwinian or Lamarckian. In our article, we want to understand why this distinction was applied to a philosopher like Nietzsche. The key issue is the difference made by Richter between the natural selection and the inheritance of acquired characteristics and the relationship that she establishes between these notions and the eugenics. Her goal is to show

  15. Aspectos bioecológicos de Arenaeus cribrarius (Lamarck (Decapoda, Portunidae da Praia da Barra da Lagoa, Florianópolis, Santa Catarina, Brasil Bioecological aspects of Arenaeus cribrarius (Lamarck (Decapoda, Portunidae from Praia da Barra da Lagoa, Florianópolis, Santa Catarina, Brasil

    Directory of Open Access Journals (Sweden)

    Marcelo Gentil Avila

    1996-01-01

    Full Text Available The specimens of Arenaeus cribrarius (Lamarck, 1818 used in this study were collected in the locality of Barra da Lagoa beach, Florianópolis, Santa Catarina, Brazil, in the period of April/1991 to March/1992. In this area temperature and salinity values were observed. A total of 341 samples, that 184 were male and 157 were female were collectted. The maturacion sexual stadium were measured (cm and weightied (g. Expression of relation among weight of body (wt and width of carapace (wid was Wt=0,0567 Wid3,0494 on males and wt=0,074 Wid2,8795 on females. The relation length (Lt width (wid of carapace was Lt=0,4322. wid on males and Lt=0,4578. wid on females.

  16. Effects of anthracene and UV-B radiation on larvae of Argopecten irradians%蒽和UV-B辐射增强对海湾扇贝早期发育的影响

    Institute of Scientific and Technical Information of China (English)

    谭海丽; 王玉堃; 唐学玺; 周斌; 王其翔; 王悠

    2013-01-01

    The effects of anthracene and UV-B radiation on the early stage embryos development of benthos, and the single and joint a-cute toxicological effects of anthracene and UV-B radiation on the trochophore and D larvae of Argopecten irradians under the controlled laboratory conditions were studied. The results showed that with the increase of time and the anthracenes concentration or the increase of days and radiation does, the liabilities of the trochophore and D larvae declined. With the combination of anthracene and UV-B radiation , the liabilities of trochophore and D larvae were lower than those in the single action. Compared to D larvae, the trochophore was more sensitive to anthracene and UV-B radiation.%为了探讨蒽和UV-B辐射对底栖生物早期发育的影响,在实验生态学的条件下,选择海湾扇贝(Argopecten irradians)担轮幼虫和D型幼虫作为受试生物进行单一和联合急性毒性试验.结果表明:在实验的蒽浓度和UV-B辐射剂量下,随着蒽浓度和作用时间的增加,海湾扇贝担轮幼虫和D型幼虫的存活率逐渐降低;随着UV-B辐射剂量和辐射天数的增加,海湾扇贝担轮幼虫和D型幼虫存活率下降;在蒽和UV-B辐射共同作用对担轮幼虫和D型幼虫处理时,其两个发育阶段的存活率较两者单独作用的存活率均低很多;担轮幼虫较D型幼虫对蒽和UV-B辐射更敏感.

  17. The elemental composition of purple sea urchin (Strongylocentrotus purpuratus calcite and potential effects of pCO2 during early life stages

    Directory of Open Access Journals (Sweden)

    M. LaVigne

    2013-06-01

    Full Text Available Ocean acidification will likely have negative impacts on invertebrates producing skeletons composed of calcium carbonate. Skeletal solubility is partly controlled by the incorporation of "foreign" ions (e.g. magnesium into the crystal lattice of these skeletal structures, a process that is sensitive to a variety of biological and environmental factors. Here we explore effects of life stage, oceanographic region of origin, and changes in the partial pressure of carbon dioxide in seawater (pCO2 on trace elemental composition in the purple sea urchin (Strongylocentrotus purpuratus. We show that, similar to other urchin taxa, adult purple sea urchins have the ability to precipitate skeleton composed of a range of biominerals spanning low- to high-Mg calcites. Mg / Ca and Sr / Ca ratios were substantially lower in adult spines compared to adult tests. On the other hand, trace elemental composition was invariant among adults collected from four oceanographically distinct regions spanning a range of carbonate chemistry conditions (Oregon, Northern California, Central California, and Southern California. Skeletons of newly settled juvenile urchins that originated from adults from the four regions exhibited intermediate Mg / Ca and Sr / Ca between adult spine and test endmembers, indicating that skeleton precipitated during early life stages is more soluble than adult spines and less soluble than adult tests. Mean skeletal Mg / Ca or Sr / Ca of juvenile skeleton did not vary with source region when larvae were reared under present-day, global-average seawater carbonate conditions (400 μatm; pHT = 8.02 ± 0.03 1 SD; Ωcalcite = 3.3 ± 0.2 1 SD. However, when reared under elevated pCO2 (900 μatm; pHT = 7.73 ± 0.03; Ωcalcite = 1.8 ± 0.1, skeletal Sr / Ca in juveniles exhibited increased variance across the four regions. Although larvae from the northern populations (Oregon, Northern California, Central California did not exhibit differences in Mg or Sr

  18. The elemental composition of purple sea urchin (Strongylocentrotus purpuratus) calcite and potential effects of pCO2 during early life stages

    Science.gov (United States)

    LaVigne, M.; Hill, T. M.; Sanford, E.; Gaylord, B.; Russell, A. D.; Lenz, E. A.; Hosfelt, J. D.; Young, M. K.

    2013-06-01

    Ocean acidification will likely have negative impacts on invertebrates producing skeletons composed of calcium carbonate. Skeletal solubility is partly controlled by the incorporation of "foreign" ions (e.g. magnesium) into the crystal lattice of these skeletal structures, a process that is sensitive to a variety of biological and environmental factors. Here we explore effects of life stage, oceanographic region of origin, and changes in the partial pressure of carbon dioxide in seawater (pCO2) on trace elemental composition in the purple sea urchin (Strongylocentrotus purpuratus). We show that, similar to other urchin taxa, adult purple sea urchins have the ability to precipitate skeleton composed of a range of biominerals spanning low- to high-Mg calcites. Mg / Ca and Sr / Ca ratios were substantially lower in adult spines compared to adult tests. On the other hand, trace elemental composition was invariant among adults collected from four oceanographically distinct regions spanning a range of carbonate chemistry conditions (Oregon, Northern California, Central California, and Southern California). Skeletons of newly settled juvenile urchins that originated from adults from the four regions exhibited intermediate Mg / Ca and Sr / Ca between adult spine and test endmembers, indicating that skeleton precipitated during early life stages is more soluble than adult spines and less soluble than adult tests. Mean skeletal Mg / Ca or Sr / Ca of juvenile skeleton did not vary with source region when larvae were reared under present-day, global-average seawater carbonate conditions (400 μatm; pHT = 8.02 ± 0.03 1 SD; Ωcalcite = 3.3 ± 0.2 1 SD). However, when reared under elevated pCO2 (900 μatm; pHT = 7.73 ± 0.03; Ωcalcite = 1.8 ± 0.1), skeletal Sr / Ca in juveniles exhibited increased variance across the four regions. Although larvae from the northern populations (Oregon, Northern California, Central California) did not exhibit differences in Mg or Sr

  19. Some aspects of the reproduction in the elongate sunset clam, Gari (Gabraeus elongata (Lamarck 1818 from Banate Bay Area, West Central Philippines

    Directory of Open Access Journals (Sweden)

    Fenelyn Nabuab

    2006-12-01

    Full Text Available The elongate sunset clam, Gari (Gabraeus elongata (Lamarck 1818 is one of the commercially important invertebrates in Panay Island. The reproductive biology of this species from the Banate Bay Area, Panay Island, West Central Philippines was studied over one annual cycle. Elongate sunset clams were gathered monthly every last quarter of the lunar phase from September 2004 to August 2005.The shell length at first maturation, the sex ratio and the spawning periodicity were determined. The different stages of the reproductive cycle were characterized by histological examination. Seven distinguishable gonad stages were determined in both male and female clams namely, immature, early and late developing, mature, partially spawned, redeveloping and spent. Indeterminate gonads were also noted. Gari elongata is a dioecious species but in a few specimens hermaphroditism was observed. It exhibits no sexual dimorphism. The male to female ratio is 1:1.04. Sexual maturity is attained at 45.40 mm SL in the male and 44.80 mm SL in the female. It is therefore recommended that clams smaller than these sizes should not be collected to allow recruitment and proper sustainability of the resource. Based on the GSI and Index of Sexual Maturity elongate sunset clams have a protracted or continuous breeding period. Sexual activity is highest during the wet season while gamete development occurred during the preceding dry season. The latter is supported by higher phytoplankton densities.

  20. Relative warp and correlation analysis based on distances of the morphological shell shape patterns of Pomacea canaliculata Lamarck from Japan and the Philippines

    Directory of Open Access Journals (Sweden)

    Carlo Stephen O. Moneva

    2012-06-01

    Full Text Available The Golden Apple Snail (GAS, Pomacea canaliculata Lamarck is considered one of the serious agricultural pests of rice in Asia. Itis being argued that rapid invasion of this species in many variable habitats suggests genetic variability and differentiation which could be expressedat the level of the phenotype. It is therefore the major objective of the study to explore possible phenotypic differentiation in the organismespecially in the shape of the shell using geometric morphometric (GM analysis. Specifically, this study aimed to determine conchologicalvariation in populations of GAS in the Philippines and Japan. Three aspects of the shell shape were studied, which includes the ventral/aperture,dorsal and the top/whorl portion of the shell using correlation analysis based on distances (CORIANDIS. CORIANDIS was used in order tovisualize congruence of multivariate traits among P. canaliculata populations. The results showed that P. canaliculata shell varies in shape andvariability may signify distinctive genotypes or adaptation to varying environments exhibited by Japan and the Philippines.

  1. Accumulation, Biotransformation, Histopathology and Paralysis in the Pacific Calico Scallop Argopecten ventricosus by the Paralyzing Toxins of the Dinoflagellate Gymnodinium catenatum

    Directory of Open Access Journals (Sweden)

    Rosalba Alonso-Rodriguez

    2012-05-01

    Full Text Available The dinoflagellate Gymnodinium catenatum produces paralyzing shellfish poisons that are consumed and accumulated by bivalves. We performed short-term feeding experiments to examine ingestion, accumulation, biotransformation, histopathology, and paralysis in the juvenile Pacific calico scallop Argopecten ventricosus that consume this dinoflagellate. Depletion of algal cells was measured in closed systems. Histopathological preparations were microscopically analyzed. Paralysis was observed and the time of recovery recorded. Accumulation and possible biotransformation of toxins were measured by HPLC analysis. Feeding activity in treated scallops showed that scallops produced pseudofeces, ingestion rates decreased at 8 h; approximately 60% of the scallops were paralyzed and melanin production and hemocyte aggregation were observed in several tissues at 15 h. HPLC analysis showed that the only toxins present in the dinoflagellates and scallops were the N-sulfo-carbamoyl toxins (C1, C2; after hydrolysis, the carbamate toxins (epimers GTX2/3 were present. C1 and C2 toxins were most common in the mantle, followed by the digestive gland and stomach-complex, adductor muscle, kidney and rectum group, and finally, gills. Toxin profiles in scallop tissue were similar to the dinoflagellate; biotransformations were not present in the scallops in this short-term feeding experiment.

  2. Ranking Population Structure and Sex Ratio of Pomacea canaficulata (Lamarck)in Different Control Approaches%不同控螺方式下稻田福寿螺种群的螺级结构及性比

    Institute of Scientific and Technical Information of China (English)

    秦钟; 方丽; 章家恩; 罗明珠; 赵本良

    2012-01-01

    [Objective] The objective of this study is to research population structure of Pomacea canaliculata (Lamarck) and to provide a scientific basis not only for grasping the dynamics and developmental tendency of P. Canaliculata (Lamarck), but also for evaluating the performance of snail control measures. [Method] Twelve experimental plots for four treatments with three replicates were set in double cropping rice area of Guangdong province, each plot covered an area of 100 m2. Three control measures including raising ducks in the rice field, application of molluscicides and camellia oleifera cake, together with blank control plot were arranged randomly in the plots, in which information on ranking population structure of P. Canaliculata (Lamarck) and sex ratio were collected and analyzed. [Result] Molluscicides application treatment was helpful for immature snails control but noneffective for mature ones. Camellia oleifera cake could be effectively used for control of immature snails, but not as effective as for medium and adult snails. Variation of population structure of P. Canaliculata (Lamarck) over the time in both molluscicides and camellia oleifera cake treatments exhibited greater instability when compared with the rice-duck integrated farming treatment and blank control plot, especially during the growth period of early rice. P. Canaliculata (Lamarck) in the rice-duck farming plot was comprised primarily of mature snails, making a descent style group from a whole during early rice-growing period. Sex ratio of P. Canaliculata (Lamarck) under the same treatment changed over time, while differed considerably among four treatments at the same time. For molluscicides and camellia oleifera cake treatments, sex ratios (female to male) of P. Canaliculata (Lamarck) were relatively high, with greater fluctuations as time passed. [ Conclusion ] Rice-duck farming could provide a sustainable controlling on population of golden apple snails especially to the young and

  3. 海湾扇贝组织蛋白酶L基因编码区的克隆和分析%Cloning and sequence analysis of cathepsin L gene from bay scallop Argopecten irradians

    Institute of Scientific and Technical Information of China (English)

    李娟; 李莉; 张国范

    2011-01-01

    通过cDNA末端快速扩增技术(RACE),从海湾扇贝(Argopecten irradians)中克隆得到了组织蛋白酶L基因(AiCL)的编码区全长,为1095 bp,推测编码364个氨基酸.经比对与分析发现蛋白序列中存在4个组织蛋白酶L活性位点保守氨基酸:Q164,C170,H309,N329;6个极为保守的半胱氨酸残基:C167,C201,C210,C243,C302,C351.预测其N端17个氨基酸为信号肽序列,C端ASYPTV可能也是分泌信号.AiCL成熟蛋白分子由219个氨基酸构成,前体肽的切割位点预计在A145和M146之间.序列同源性分析中,AiCL蛋白序列与软体动物同源蛋白最为相似,序列一致性在50%以上,在系统进化树中与其它无脊椎动物组织蛋白酶L聚合到一起.通过SwISS-MODEL构建的AiCL成熟蛋白三维模型表明该蛋白空间结构高度保守.根据其序列特征,推测~CL可能具有水解多种肌蛋白的活性.%The complete open reading frame (ORF) of cathepsin L was obtained from bay scallop (Argopecten irradians) by RACE technique. The ORF was of 1 095 bp, encoding 364 amino acids. Four conserved residues for enzyme activity (Q164, C170, H309, N329) and six preserved cysteines were found in the protein sequence. 17 amino acids of N terminal were predicted to be the signal peptide and the sequence ASYPTV at C terminal was found to be a possible signal sequence. The mature protein of AICL contained 219 amino acids and the potential cleavage site was between A 145 and M 146. Analysis indicated AiCL shared the highest identities (>50%) with molluscan cathepsin Ls.It clustered with other invertebrate cathepsin Ls in the phylogenetic tree. The 3D-model predicted by SWISS-MODEL demonstrated that cathepsin L was conserved in tertiary structure. Collectively, data showed that AiCL was likely to catalyze the hydrolysis of multiple muscle related proteins.

  4. Permanent genetic resources added to molecular ecology resources database 1 august 2011-30 september 2011

    OpenAIRE

    A'Hara, S.W.; Amouroux, P.; Argo, Emily.E.; Avand-Faghih, A.; Barat, Ashoktaru; Barbieri, Luiz; Bert, Theresa M.; Blatrix, R.; Blin, Aurelie; Bouktila, D.; Broome, A.; Burban, Christian; Capdevielle-Dulac, C.; Casse, N.; Chandra, Suresh

    2012-01-01

    This article documents the addition of 299 microsatellite marker loci and nine pairs of single-nucleotide polymorphism (SNP) EPIC primers to the Molecular Ecology Resources (MER) Database. Loci were developed for the following species: Alosa pseudoharengus, Alosa aestivalis, Aphis spiraecola, Argopecten purpuratus, Coreoleuciscus splendidus, Garra gotyla, Hippodamia convergens, Linnaea borealis, Menippe mercenaria, Menippe adina, Parus major, Pinus densiflora, Portunus trituberculatus, Procon...

  5. 徐闻牡丹珊瑚共附生真菌分离鉴定及多样性分析%Isolation and Identification of Endophytic Fungi Associated with Pavona Lamarck of Xuwen Natural Reserve

    Institute of Scientific and Technical Information of China (English)

    雷晓凌; 李军; 肖胜蓝; 钟敏

    2013-01-01

    本文以牡丹珊瑚为原料,选用2种培养基,采用平板涂布法培养分离菌株,对照真菌鉴定手册,根据菌株的菌落大小、颜色、生长速率等菌落形态以及菌丝体和孢子的个体形态进行分离鉴定,并根据ITS-rRNA基因序列特征进行分子鉴定,依照测序结果建立系统发育树并进行种群多样性分析.结果显示从该样品中共分离到10株共附生真菌,分属于5个属,其中曲霉属有3株、肉座菌属有3株、有2株属于青霉属、1株顶枝孢属及1株白腐菌属.说明曲霉属和肉座菌属是牡丹珊瑚上的优势菌属.牡丹珊瑚与其它种类珊瑚比较分离到的真菌数量较少,但均匀度比较高.从牡丹珊瑚上分离到的肉座菌属和白腐菌属在海洋真菌的研究中未见报道.%To study the diversity of fungi derived from Pavona lamarck,spread-plate method and two different media were used to cultivate and isolate the strains.The strains was identified from the colony morphology,the individual form of mycelium and spores referring to fungi identification manual.Molecule was identified according to the ITS-rRNA gene sequence features.Based on the result of sequencing,a phylogenetic tree was build for population diversty analysis.10 symbiotic fungis were isolated from the Pavona lamarck,belonging to 5generas including 3 Aspergillus spp.,3 Hypocrea spp.,2 Penicillium spp.,1 Cladosporium spp.and 1 Phlebia spp.,indicating that Aspergillus and Hypocrea were the dominant fungi.Compared to other corals,the fungis isolated from Pavona lamarck were fewer,but had a high degree of uniformity.There was no report on marine fungis.

  6. Produção de geléia de jambolão (Syzygium cumini Lamarck: processamento, parâmetros físico - químicos e avaliação sensorial Production of jambolan (Syzygium cumini Lamarck jelly: processing, physical-chemical properties and sensory evaluation

    Directory of Open Access Journals (Sweden)

    Ellen Silva Lago

    2006-12-01

    Full Text Available A fruta jambolão (Syzygium cumini Lamarck é uma fruta de coloração roxa intensa e sabor agradável. Dado que não há na literatura nenhum relato de seu aproveitamento industrial, a produção de geléia de jambolão tornou-se uma interessante atividade de pesquisa. Este trabalho objetivou a elaboração e a avaliação das características físico-químicas e sensoriais da geléia obtida do jambolão. A fruta apresentou a seguinte composição química: cinzas, 0,34%; lipídeos, 0,30%; proteínas, 0,67%; carboidratos, 10,07%; fibras, 0,28%; umidade, 87,75%; frutose, 0,4%; glicose, 0,6%; antocianinas totais, 0,276%; substâncias pécticas, 0,245%; acidez titulável, 5,91%; sólidos solúveis, 9,00%; e pH, 3,9. A geléia obtida apresentou a seguinte composição: açúcares redutores, 20,99%; não-redutores, 18,01%; açúcares totais, 39,00%; pH, 3,42; sólidos solúveis, 67ºBrix; acidez titulável, 5,47%; e umidade, 29,63%. A análise sensorial foi realizada por uma equipe de 50 provadores não treinados que avaliaram os atributos cor, aparência, odor, textura, sabor e avaliação global, pelo método de escala hedônica com nove pontos. Os resultados obtidos mostraram que o atributo cor foi o que mais agradou aos provadores, o atributo odor foi o menos apreciado. Em conclusão, o estudo de análise sensorial revelou uma aceitação satisfatória da geléia de jambolão.Jambolan (Syzygium cumini Lamarck is a purple colored and very tasty fruit. Since there are no reports of its industrial use, the production of this jelly has become a matter of interest for research. The purpose of this work is to develop and evaluate the physical-chemical and sensory characteristics of the jelly made of jambolan. The fruit showed the following chemical composition: ash, 0.34%; lipids, 0.30%; proteins, 0.67%; carbohydrates, 10.07%; fibers, 0.28%; moisture, 87.75%; fructose, 0.4%; glucose, 0.6%; total anthocyanins, 0.276%; pectic substances, 0.245%; acidity

  7. Paléontologie(s et évolution au début du XIXe siècle cuvier et Lamarck

    Directory of Open Access Journals (Sweden)

    Laurent, Goulven

    2000-12-01

    Full Text Available

    La paléontologie, dès sa naissance, a été appelée à fournir des arguments pour ou contre la théorie de l'Évolution, qui venait aussi de naître à la même époque. En effet, Cuvier et Lamarck, les deux fondateurs de la (des paléontologie(s celle des vertébrés et

  8. Nutritional improvement of the commercial production of marine aquaculture species through application of innovative biotechniques

    OpenAIRE

    G Gajardo; Coutteau, P.; Curé, K.; Sorgeloos, P.; Beardmore, J.A.

    1996-01-01

    Marine aquaculture, particularly the salmon farming industry, has expanded very fast in Chile. Currently the country ranks second among the world leading salmon producers. However, there is a growing concern for the diversification of aquaculture activities. Examples are the cultures of flatfishes, either the introduced turbot (Scophthalmus maximus) or the native flounder species Paralichthys microps and P. adspersus, along with the native scallop, Argopecten purpuratus. Although both turbot ...

  9. Rapid species identification of fresh and processed scallops by multiplex PCR

    OpenAIRE

    Marín, Alan; Fujimoto, Takafumi; Arai, Katsutoshi

    2013-01-01

    Food control policies regarding to seafood label authenticity have become a global issue due to increased incidence of species substitution or mislabelling. Proper species-level identification in processed scallop products is hindered by the lack of morphological characters such as their valves. In order to identify four commercially important scallop species (Argopecten purpuratus, A. irradians, Mizuhopecten yessoensis, Pecten albicans) a species-specific multiplex PCR reaction is described ...

  10. 入侵生物金苹果螺在滇池流域的首次记录%A Record of the Invasive Golden Apple Snail Pomacea canaliculata (Lamarck 1819) at Black Dragon Spring, Dianchi Basin

    Institute of Scientific and Technical Information of China (English)

    杜丽娜; Jonathan Davies; 陈小勇; 崔桂华; 杨君兴

    2007-01-01

    2004年10月,中国科学院昆明动物研究所首次发现金苹果螺(Pomacea canaliculata)入侵重要的水源保护区嵩明白邑黑龙潭.金苹果螺起源于中南美洲,在亚洲,它通过有意或无意的传播而逐渐扩散到菲律宾、越南、泰国、老挝、柬埔寨、马来西亚、印尼、巴布几内亚、韩国、日本和中国的南部.金苹果螺已成为水稻产区的最大害虫,给农业生产带来巨大的损失.为防止金苹果螺在云南扩散,目前已经实施了严格的预防、控制措施,同时开展了公众保护教育宣传活动.%The golden apple snail Pomacea canaliculata (Lamarck 1819) was first recorded at Black Dragon Spring, Dianchi Basin, Baiyi Township, Songming County, Kunming City, Yunnan Province, China, in October 2004. The water from the spring flows into the Songhuaba Reservoir, the major drinking water resource for Kunming City, and part of the Dianchi Lake basin. This is the first record of this invasive snail in the Dianchi Lake Basin. Pomacea canaliculata originates from Central and South America, and in Asia the snail has spread through deliberate and accidental introductions to the Philippines, Vietnam, Thailand, Laos, Cambodia, Malaysia, Indonesia, Papua New Guinea, Korea, Japan and South China. It has become a major pest in rice-growing areas, resulting in huge damage to crops. Strict prevention and control measures have to be implemented to prevent the spread of the snail in Yunnan, together with public awareness campaigns to inform the public of the dangers of this invasive snail.

  11. Injury and Yield Loss by the Golden Apple Snail Pomacea canaliculata Lamarck in Rice%福寿螺对水稻的为害及其产量损失研究

    Institute of Scientific and Technical Information of China (English)

    叶建人; 林贤文; 祝增荣

    2015-01-01

    为了明确不同螺口密度和为害始期福寿螺为害与水稻产量损失的关系,于2007—2009年分别在早稻、单季晚稻和连作晚稻田通过人工定量投放福寿螺进行为害损失试验。结果表明:投放的时间越早,危害损失越大;投放的数量越多,危害损失越重。所有这些损失率与福寿螺密度之间的关系,均可采用幂函数方程来描述,以5%产量损失作为经济允许水平计算,秧苗移栽后早稻田福寿螺密度宜控制在1只/m2以下,晚稻宜在3.5只/m2以下。福寿螺在早稻田的存活率在低密度下较高,而在晚稻田的存活率都不高,但是低密度下产卵量明显增多。建议要特别加强对水稻移栽后小苗期田间福寿螺的防控,最好能在移栽前对本田进行必要的防治,另外一旦断垄发生后要及时补苗,减少损失。%To investigate the relationship among rice yield loss, the golden apple snail (GAS) (Pomacea canaliculata Lamarck) density and damage beginning time, the GAS was added to early rice field, late hybrid rice field and single late rice field artificially from 2007 to 2009. The results showed that, the earlier GAS was added to field, the more damage GAS caused. It was also identified that the more GAS added to the field, the more damage GAS caused. The power function equations could be used to describe the relationship between GAS density and yield loss. There should be less than 1 per m2 in early rice and field or 3.5 per m2 in late rice field if the yield loss was expected blow 5%. In early rice field, lower density was beneficial for higher survival rate. Although the survival rate was low in late rice field, the oviposition capacity would be higher with low density. It was important to control GAS after rice transplant. And preventing GAS before rice transplant would be better. To reduce yield loss, rice seedling should be added in time if seedlingless ridges happened.

  12. Lamarck and the adaptive conservation of life

    Directory of Open Access Journals (Sweden)

    Galera, Andrés

    2009-12-01

    Full Text Available This paper studies Lamarck’s evolutionary thought through four analytic elements. Firstly, Lamarckian construction of a founding evolutionary archetype. Secondly, the interpretation of nature as a material system where the organic change represents a continuous process aimed at the adaptative conservation of life. Thirdly, the definition of a genealogical process on the origin of species which identifies the natural method. Fourthly, the redefinition of the concept of species applying the arguments of temporary relativity and individual instability.

    En este artículo se estudia el ideario evolucionista lamarckiano desarrollando cuatro elementos analíticos. Primero, la elaboración de un arquetipo evolutivo fundacional. Segundo, la interpretación de la naturaleza como un sistema material donde el cambio orgánico da sentido a un proceso continuo dirigido a la conservación de la vida. Tercero, la definición de un principio genealógico sobre el origen de las especies que identifica el método natural. Cuarto, la reformulación del concepto de especie utilizando los argumentos de relatividad temporal e inestabilidad individual.

  13. 剑麻提取物对福寿螺的毒理效应%Toxicological effect of Agave sisalana Perrine extract on golden apple snail (Pomacea canaliculata Lamarck)

    Institute of Scientific and Technical Information of China (English)

    李林峰; 徐武兵; 钟秋华; 章家恩; 罗明珠; 赵本良; 秦钟

    2012-01-01

    Pomacea canaliculata Lamarck is an invasive alien species that is very harmful to the ecosystem and rice production in South China.To verify the toxicity and related mechanism of Agave sisalana Perrine to golden apple snail,the toxic effects of aqueous,n-butanol and ethanol extracts of A.Sisalana were tested via the snail-immersed method.The effects of n-butanol (59 mg·L-1,96 mg·L-1) and ethanol (180 mg·L-1,325 mg·L-1) extracts on cholinesterase (ChE),superoxide dismutase (SOD) and adenosine triphosphatase (ATPase) activities in hepatic tissue of golden apple snails were also investigated.Based on the results,aqueous,n-butanol and ethanol extracts of A.Sisalana had toxic effects on golden apple snail.Their semi-lethal concentrations (LC50) on golden apple snail for 72 h toxicity exposure were 35.3 g·L-1,93.3 mg·L-1 and 298.6 mg·L-1,respectively.The corresponding 95%confidence interval ranges were 32.9~37.7 g·L~1,87.6~99.7 mg·L~1 and 272.9~318.7 mg·L-1,respectively.When treated with n-butanol and ethanol extracts for 12 h,SOD activity in snail hepatic tissues showed no obvious change at low concentrations.SOD activity,however,increased significantly at high concentrations.After treatment for 48 h,SOD activity at high concentrations of n-butanol extract was significantly higher than that of the control.However,SOD activity did not show any obvious change in both low and high concentrations of ethanol extract.All A.Sisalana extracts somehow increased ChE activity,with n-butanol extract exhibiting higher effect on ChE activity.When treated with 96 mg·L-1 n-butanol extract for 48 h,ChE activity significantly exceededthat of the control (P < 0.05).Overall,n-butanol extract treatment enhanced ATPase activity at low concentrations and suppressed it at high concentrations.Irrespectively,no obvious pattern change was noted under ethanol extract treatment.In conclusion,A.Sisalana was somehow toxic to golden apple snail.A better mode of application was

  14. Las comunidades de mitilidos del mediolitoral rocoso del departamento de Lima

    Directory of Open Access Journals (Sweden)

    Carlos Paredes

    2014-06-01

    Full Text Available Se estudiaron 34 muestras de los conglomerados de mitilidos de la zona medio litoral rocosa del Departamento de Lima, (10°45'38"S a 12°57'39"S, tomadas periódicamente, entre junio y noviembre de 1972. Utilizando el método del índice biológico, se determinó la existencia de dos comunidades: Comunidad de Perumytilus purpuratus (Lamarck, 1819, en el horizonte medio de la zona mediolitoral. Comunidad de Semimytilus algosus (Gould, 1850, en el horizonte inferior de la zona mediolitoral.

  15. Chemotaxonomic study of the demosponge Cinachyrella cavernosa (Lamarck)

    Digital Repository Service at National Institute of Oceanography (India)

    Wahidullah, S.; Naik, B.G.; Al-Fadhli, A.A

    previously been identified in Cinachyrella australiensis. To our knowledge, this is the first report of 4α-methyl gorgostanol from a sponge and DPA from a marine source. The probable origin and chemotaxonomic importance of some of the metabolites is discussed...

  16. Improving the Geologic Time Scale (Jean Baptiste Lamarck Medal Lecture)

    Science.gov (United States)

    Gradstein, Felix M.

    2010-05-01

    The Geologic Time Scale (GTS) provides the framework for the physical, chemical and biological processes on Earth. The time scale is the tool "par excellence" of the geological trade, and insight in its construction, strength, and limitations enhances its function and its utility. Earth scientists should understand how time scales are constructed and its myriad of physical and abstract data are calibrated, rather than merely using ages plucked from a convenient chart or card. Calibration to linear time of the succession of events recorded in the rocks on Earth has three components: (1) the standard stratigraphic divisions and their correlation in the global rock record, (2) the means of measuring linear time or elapsed durations from the rock record, and (3) the methods of effectively joining the two scales, the stratigraphic one and the linear one. Under the auspices of the International Commission on Stratigraphy (ICS), the international stratigraphic divisions and their correlative events are now largely standardized, especially using the GSSP (Global Stratigraphic Section and Point) concept. The means of measuring linear time or elapsed durations from the rock record are objectives in the EARTH TIME and GTS NEXT projects, that also are educating a new generation of GTS dedicated scientists. The U/Pb, Ar/Ar and orbital tuning methods are intercalibrated, and external error analysis improved. Existing Ar/Ar ages become almost 0.5% older, and U/Pb ages stratigraphically more realistic. The new Os/Re method has potential for directly dating more GSSP's and its correlative events. Such may reduce scaling uncertainty between the sedimentary levels of an age date and that of a stage boundary. Since 1981, six successive Phanerozoic GTS have been published, each new one achieving higher resolution and more users. The next GTS is scheduled for 2011/2012, with over 50 specialists taking part. New chapters include an expanded planetary time scale, sequence stratigraphy, Osmium, Carbon and Oxygen stratigraphy, the Cryogenian period, history of the plants, hominid prehistory, and last but not least the Anthropocene. The Cambrian Period is radically improved with 10 standard stages and detailed trilobite biochronology. Ordovician now has a stable international stages and graptolites scale. The integration of a refined 100 and 400 ka sedimentary cycles scale and a truly high-resolution U/Pb ages scale for the Mississippian is a major step towards the global Carboniferous GTS. The Devonian GTS leaves to be desired with lack of firm definitions for its upper boundary, and the long Emsian stage; it also lacks age dates. Its stages scaling is disputed. The Rhaetian and Norian stages in the Triassic and the Berriasian stage in the Cretaceous urgently require lower boundary definitions, and also boundary age dates. The single ~400 ka eccentricity component is very stable and can extend orbital tuning from the Cenozoic well into the Mesozoic portion of the GTS. Jurassic and Cretaceous now have long orbitally tuned segments. A completely astronomical-tuned Geological Time Scale (AGTS) for the Cenozoic is within reach showing unprecedented accuracy, precision and resolution. Burdigalian in the Miocene, and Lutetian, Bartonian and Priabonian stages in the Eocene still require formal definition. The K/T boundary will become about 0.5 ± 0.1 Ma older. After 25 years of research and authorship in the GTS it behoves me to especially thank my colleagues James Ogg, Frits Agterberg, John McArthur and Roger Cooper for longstanding collaboration. As a final note I urge construction of more regional time scales(like developed ‘down under') calibrated to the standard global GTS, to scale regional rock units.

  17. Embriologia do siri Arenaeus cribrarius (Lamarck (Crustacea, Brachyura, Portunidae Embryology of the swimming crab Arenaeus cribrarius (Lamarck (Crustacea, Brachyura, Portunidae

    Directory of Open Access Journals (Sweden)

    Marcelo A.A. Pinheiro

    2002-06-01

    Full Text Available Ovigerous females of Arenaeus cribrarius were collected at Ubatuba, São Paulo, and maintaining in aquaria under controlled temperature (25±1ºC, salinity (35±1‰ and photoperiod (12:12. A small sample of eggs was collected for each 24h, for morphological description, chromatic changes and biometric analysis throughout the embryonic development. Eight egg stages were photographed and had their small and large diameters measured under a microscope provided with camera lucida. The egg's shape was low elliptical during all the embryogenesis and showed size increase (24.4% and volume (91.1 %, when the last stage were compared with the first one. According to mean egg diameter and volume, the eggs should be pooled in three different groups (1-3; 4-6; 7-8 corresponding to initial, intermediate and final stages. The attained results were compared with the literature which emphasizing the species of Portunidae's family.

  18. Embriologia do siri Arenaeus cribrarius (Lamarck) (Crustacea, Brachyura, Portunidae) Embryology of the swimming crab Arenaeus cribrarius (Lamarck) (Crustacea, Brachyura, Portunidae)

    OpenAIRE

    Marcelo A. A. Pinheiro; Gustavo Yomar Hattori

    2002-01-01

    Ovigerous females of Arenaeus cribrarius were collected at Ubatuba, São Paulo, and maintaining in aquaria under controlled temperature (25±1ºC), salinity (35±1‰) and photoperiod (12:12). A small sample of eggs was collected for each 24h, for morphological description, chromatic changes and biometric analysis throughout the embryonic development. Eight egg stages were photographed and had their small and large diameters measured under a microscope provided with camera lucida. The egg's shape w...

  19. Contaminación de alimentos marinos por cadmio en Lima, 2015

    Directory of Open Access Journals (Sweden)

    Gloria Marín Vallejos

    2015-12-01

    Full Text Available Los objetivos fueron determinar las concentraciones de cadmio en ocho especies de alimentos marinos y comparar con los valores máximos permitidos según la Comisión de la Unión Europea en su Reglamento (CE Nº 1881/2006 y su modificatoria Reglamento (UE N° 488/2014. La investigación fue de carácter descriptivo, trasversal. Las muestras fueron de 100 g de cada ejemplar de pescado en tres oportunidades; los ejemplares fueron: jurel (Trachurus picturatus murphyi, langostinos (Penaeus vannamei, conchas abanico (Argopecten purpuratus, conchas blancas (Semele sp, choros (Aulacomya ater, almejas (Gari solida, machas (Mesonesma donacium y pota (Dosidicus gigas recolectadas al azar en el terminal pesquero de Villa María del Triunfo, provenientes del litoral de la región Lima, sub área 3: Chorrillos – Islas Pachacámac. El proceso de análisis se realizó por espectrofotometría de absorción atómica. Como resultados de los promedios de las concentraciones de cadmio tenemos: en pescados, jurel (Trachurus picturatus murphyi fue 0,35 mg/kg peso fresco; en crustáceos, langostino (Penaeus vannamei fue 0,42 mg/kg peso fresco; en moluscos bivalvos tenemos conchas blancas (Semele sp, conchas abanico (Argopecten purpuratus, choros (Aulacomya ater, machas (Mesonesma donacium y almejas (Gari solida fueron 0,82 – 0,83 – 1,00 – 1,28 y 1,39 mg/kg peso fresco respectivamente. Con este estudio se concluyó que las concentraciones de cadmio en pescados, en moluscos bivalvos y cefalópodos superan los límites permitidos, pero en crustáceos no superan estos límites.

  20. Investigations into Lamarckism, Baldwinism and Local Search in Grammatical Evolution Guided by Reinforcement

    OpenAIRE

    Jack Mario Mingo; Ricardo Aler; Darío Maravall; Javier de Lope

    2013-01-01

    Grammatical Evolution Guided by Reinforcement is an extension of Grammatical Evolution that tries to improve the evolutionary process adding break a learning process for all the individuals in the population. With this aim, each individual is given a chance to learn through a reinforcement learning mechanism during its lifetime. The learning process is completed with a Lamarckian mechanism in which an original genotype is replaced by the best learnt genotype for the individual. In a way, Gram...

  1. Epigenética, evolución y la sombra de Lamarck

    OpenAIRE

    Dressino, Vicente

    2009-01-01

    Desde la formulación por Waddington del término epigenética este campo disciplinar ha manifestado un desarrollo lento pero sostenido. Sin embargo, en los últimos veinte años se produjo, debido al progreso tecnológico y conceptual experimentado por la biología, un gran crecimiento que está cambiando muchos conceptos en diversos campos de la biomedicina y de la biología evolutiva. La herencia epigenética describe la transmisión de la información sobre la base de la expresión genética, a diferen...

  2. Physical-chemical, caloric and sensory characterization of light jambolan (Syzygium cumini Lamarck jelly

    Directory of Open Access Journals (Sweden)

    Ellen Silva Lago-Vanzela

    2011-09-01

    Full Text Available In Brazil, several little economically explored fruits have good potential as raw material for the agro-industry. This study aimed to produce and determine the physical-chemical and sensory characteristics of light jambolan jelly. This fruit has intense purple color, which gave the jellies - both standard and light - a quite attractive visual aspect. The light jellies exhibited similar physical-chemical characteristics to the ones developed through the conventional method and; with the proportion of sweeteners used, the caloric values of the formulations were reduced to the range of 41 to 53%, attending the requirements of the Brazilian legislation for this type of product. The sensory profile obtained for the 4 light formulations developed, clearly showed the tasters' preference for the jelly elaborated with the association of cyclamate and saccharin. Thus, the results revealed good perspectives for the application of this fruit in the food industry.

  3. The first troglomorphic species of the genus Phrynus Lamarck, 1801 (Amblypygi: Phrynidae) from Mexico.

    Science.gov (United States)

    Guzmán, Ali Abadallan; Joya, Daniel Chirivi; Francke, Oscar F

    2015-01-01

    A new troglomorphic species, Phrynus perrii sp. nov., is described from two adult females from Cueva del Naranjo, Municipio Cintalapa, Chiapas, Mexico. This is the first continental record of a troglomorphic Phrynus species, and the second troglomorphic species of the genus. With the description of this species, in Mexico there are ten extant species, plus one fossil of the genus Phrynus, and it is the seventh species of troglobitic whip spiders from Mexico, making it the country with the highest richness of amblypygids species worldwide. PMID:25781262

  4. Sensitivity to UV radiation in early life stages of the Mediterranean sea urchin Sphaerechinus granularis (Lamarck)

    Energy Technology Data Exchange (ETDEWEB)

    Nahon, Sarah [UPMC Univ Paris 06, UMR 7621, LOBB, Observatoire Oceanologique, F-66651, Banyuls/mer (France); CNRS, UMR 7621, LOBB, Observatoire Oceanologique, F-66651, Banyuls/mer (France); Castro Porras, Viviana A. [UPMC Univ Paris 06, UMR 7621, LOBB, Observatoire Oceanologique, F-66651, Banyuls/mer (France); Pruski, Audrey M. [UPMC Univ Paris 06, UMR 7621, LOBB, Observatoire Oceanologique, F-66651, Banyuls/mer (France); CNRS, UMR 7621, LOBB, Observatoire Oceanologique, F-66651, Banyuls/mer (France); Charles, Francois [UPMC Univ Paris 06, UMR 7621, LOBB, Observatoire Oceanologique, F-66651, Banyuls/mer (France); CNRS, UMR 7621, LOBB, Observatoire Oceanologique, F-66651, Banyuls/mer (France)], E-mail: charles@obs-banyuls.fr

    2009-03-01

    The sea urchin Sphaerechinus granularis was used to investigate the impact of relevant levels of UV-B radiation on the early life stages of a common Mediterranean free spawning benthic species. Sperm, eggs and embryos were exposed to a range of UV radiation doses. The resulting endpoints were evaluated in terms of fertilisation success, development and survival rates. Above a weighted UV radiation dose of 0.0029 kJ m{sup -2}, fertilisation capability of irradiated sperm decreased rapidly. The exposure of the eggs to 0.0175 kJ m{sup -2} and more led to delayed and inhibited development with ensuing embryonic morphological abnormalities. One-day old larvae remained strongly sensitive to UV radiation as shown by the 50% decrease of the larval survival rate for a dose of 0.025 kJ m{sup -2} UVR. The elevated sensitivity of embryos to experimental UVR went along with a lack of significant amount of sunscreen compounds (e.g., mycosporine-like amino acids) in the eggs. The present results demonstrated that gamete viability and embryonic development may be significantly impaired by solar UV radiation in S. granularis, compromising in this way the reproduction of the species. Unless adaptive behavioural reproductive strategies exist, the influence of ambient UV radiation appears as a selective force for population dynamics of broadcast spawners in the shallow benthic Mediterranean environment.

  5. Evaluation of Paracentrotus lividus (Lamarck, 1816) exotrophic larvae as live feed for marine decapod crustacean larvae

    OpenAIRE

    Repolho, Tiago Filipe Baptista da Rosa, 1974-

    2012-01-01

    Tese de doutoramento, Biologia (Biologia Marinha e Aquacultura), Universidade de Lisboa, Faculdade de Ciências, 2012 In the present study, we have evaluated 4‐arm exotrophic larvae of sea urchin Paracentrotus lividus (Echinodermata: Echinoidea) as live feed in marine decapod crustacean larviculture, in comparison to Artemia spp. naupliar stages, a commonly used live prey in marine hatcheries. We therefore investigated several key parameters to assess the potential of P. lividus plutei as l...

  6. Feeding preference of the sea urchin Lytechinus variegatus (Lamarck, 1816 on seaweeds

    Directory of Open Access Journals (Sweden)

    Camilla Ferreira Souza

    2008-09-01

    Full Text Available Seaweeds exhibit different strategies to minimize the damage caused by herbivores and also to influence the feeding preference of these consumers. This study evaluated the feeding preference of the sea urchin Lytechinus variegatus through multiple-choice experiments using the seaweeds Caulerpa racemosa, Dictyota menstrualis, Osmundaria obtusiloba, Plocamium brasiliense, Sargassum sp., and Ulva sp. In order to verify the importance of morphological and chemical aspects on this feeding preference, two assay-types were carried out using live and powdered macroalgae, respectively. Two different methods were employed to analyze the results obtained: comparison between biomass losses versus autogenic changes, and inclusion of autogenic values in biomass loss through herbivory. In both experiments a clear differential consumption of certain species of seaweeds by L. variegatus was observed, in the following decreasing order of preference: C. racemosa ≈ Ulva sp. > O. obtusiloba ≈ Sargassum sp. > P. brasiliense > D. menstrualis. It was also verified that both methods of analysis used yielded similar results. According to the results obtained, feeding preference of L. variegatus is probably established by the defensive chemicals produced by P. brasiliense and D. menstrualis, and by morphological aspects of C. racemosa, Ulva sp., O. obtusiloba and Sargassum sp.As macroalgas apresentam diversos tipos de estratégias para minimizar os danos gerados por herbívoros que influenciam a preferência alimentar dos consumidores. Este estudo avaliou a preferência alimentar do ouriço-do-mar Lytechinus variegatus em experimentos de múltipla escolha utilizando as macroalgas bentônicas Caulerpa racemosa, Dictyota menstrualis, Osmundaria obtusiloba, Plocamium brasiliense, Sargassum sp., e Ulva sp. Para verificar a importância dos aspectos morfológicos e químicos na preferência, os ensaios foram realizados com algas vivas e em pó, respectivamente. Foram utilizados dois métodos distintos de análise de dados: comparação entre a perda de biomassa e as mudanças por autogenia, e a incorporação dos valores de autogenia à perda de biomassa por herbivoria. Em ambos os experimentos observou-se uma clara preferência de L. variegatus por certas espécies de macroalgas em relação a outras, em ordem decrescente de preferência: C. racemosa ≈ Ulva sp. > O. obtusiloba ≈ Sargassum sp. > P. brasiliense > D. menstrualis. Além disso, constatou-se que os dois métodos de análise produziram resultados muito similares. De acordo com os resultados, a preferência alimentar de L. variegatus é provavelmente condicionada pela química defensiva produzida por P. brasiliense e D. menstrualis e aspectos morfológicos presentes em C. racemosa, Ulva sp., O. obtusiloba e Sargassum sp.

  7. FAKE SPAWNING OF THE MUSKY OCTOPUS, Eledone moschata (LAMARCK, 1798), IN EXPERIMENTAL CONDITIONS

    OpenAIRE

    Damir Valić

    2005-01-01

    Musky octopus, Eledone moschata is widespread in the Mediterranean on various bottom types. Although it is common in fishery landings its ecology is still poorly known. The life span of this species is up to two years. Females can spawn in wide period, ranging from couple of days to few months. This study was designed as an attempt to culture octopus paralarvae and to determine food requirements of the newly hatched individuals. »Fake« spawning in experimental conditions was observed. Conditi...

  8. Dynamic of population-dynamics in a medically important snail species Lymnaea (Radix Luteola (Lamarck

    Directory of Open Access Journals (Sweden)

    T. K. Misra

    1993-09-01

    Full Text Available The life-cycle parameters of the snail Lymnaea (Radix luteola and the factors influencing the same have been studied under laboratory conditions. Ins each month, from July 1990 to June 1991, a batch of 100 zero-day old individual were considered for studies. The snails of April batch survived for 19.42 days while those in December batch survived for 87.45 days. The May batch individual though survived for 65.67 days gained maximum shell size (15.84 mm in length and body weight (419.87 mg. All individuals of April batch died prior to attainment of sexual maturity. In the remaining 11 batches the snails became sexually mature between 32 and 53 days. At this stage, they were with varying shell lengths, 9.3 mm to 13,11 mm in respect to batches. The reproduction period varied from 1-67 days. An individual laid, on an average, 0,25 (March batch to 443.67 (May batch eggs in its life-span. A batch of such snails would leave 24312, 22520, 720268, 80408, 76067, 418165, 214, 9202, 0, 0, 2459386 and 127894 individuals at the end of 352nd day. Since the environmental conditions were almost similar the 'dynamic' of population dynamics seems to be involved with the 'strain' of the snail individuals of the batches concerned.

  9. Permanent genetic resources added to Molecular Ecology Resources Database 1 August 2011-30 September 2011.

    Science.gov (United States)

    A'Hara, S W; Amouroux, P; Argo, Emily E; Avand-Faghih, A; Barat, Ashoktaru; Barbieri, Luiz; Bert, Theresa M; Blatrix, R; Blin, Aurélie; Bouktila, D; Broome, A; Burban, C; Capdevielle-Dulac, C; Casse, N; Chandra, Suresh; Cho, Kyung Jin; Cottrell, J E; Crawford, Charles R; Davis, Michelle C; Delatte, H; Desneux, Nicolas; Djieto-Lordon, C; Dubois, M P; El-Mergawy, R A A M; Gallardo-Escárate, C; Garcia, M; Gardiner, Mary M; Guillemaud, Thomas; Haye, P A; Hellemans, B; Hinrichsen, P; Jeon, Ji Hyun; Kerdelhué, C; Kharrat, I; Kim, Ki Hwan; Kim, Yong Yul; Kwan, Ye-Seul; Labbe, Ellen M; LaHood, Eric; Lee, Kyung Mi; Lee, Wan-Ok; Lee, Yat-Hung; Legoff, Isabelle; Li, H; Lin, Chung-Ping; Liu, S S; Liu, Y G; Long, D; Maes, G E; Magnoux, E; Mahanta, Prabin Chandra; Makni, H; Makni, M; Malausa, Thibaut; Matura, Rakesh; McKey, D; McMillen-Jackson, Anne L; Méndez, M A; Mezghani-Khemakhem, M; Michel, Andy P; Paul, Moran; Muriel-Cunha, Janice; Nibouche, S; Normand, F; Palkovacs, Eric P; Pande, Veena; Parmentier, K; Peccoud, J; Piatscheck, F; Puchulutegui, Cecilia; Ramos, R; Ravest, G; Richner, Heinz; Robbens, J; Rochat, D; Rousselet, J; Saladin, Verena; Sauve, M; Schlei, Ora; Schultz, Thomas F; Scobie, A R; Segovia, N I; Seyoum, Seifu; Silvain, J-F; Tabone, Elisabeth; Van Houdt, J K J; Vandamme, S G; Volckaert, F A M; Wenburg, John; Willis, Theodore V; Won, Yong-Jin; Ye, N H; Zhang, W; Zhang, Y X

    2012-01-01

    This article documents the addition of 299 microsatellite marker loci and nine pairs of single-nucleotide polymorphism (SNP) EPIC primers to the Molecular Ecology Resources (MER) Database. Loci were developed for the following species: Alosa pseudoharengus, Alosa aestivalis, Aphis spiraecola, Argopecten purpuratus, Coreoleuciscus splendidus, Garra gotyla, Hippodamia convergens, Linnaea borealis, Menippe mercenaria, Menippe adina, Parus major, Pinus densiflora, Portunus trituberculatus, Procontarinia mangiferae, Rhynchophorus ferrugineus, Schizothorax richardsonii, Scophthalmus rhombus, Tetraponera aethiops, Thaumetopoea pityocampa, Tuta absoluta and Ugni molinae. These loci were cross-tested on the following species: Barilius bendelisis, Chiromantes haematocheir, Eriocheir sinensis, Eucalyptus camaldulensis, Eucalyptus cladocalix, Eucalyptus globulus, Garra litaninsis vishwanath, Garra para lissorhynchus, Guindilla trinervis, Hemigrapsus sanguineus, Luma chequen. Guayaba, Myrceugenia colchagüensis, Myrceugenia correifolia, Myrceugenia exsucca, Parasesarma plicatum, Parus major, Portunus pelagicus, Psidium guayaba, Schizothorax richardsonii, Scophthalmus maximus, Tetraponera latifrons, Thaumetopoea bonjeani, Thaumetopoea ispartensis, Thaumetopoea libanotica, Thaumetopoea pinivora, Thaumetopoea pityocampa ena clade, Thaumetopoea solitaria, Thaumetopoea wilkinsoni and Tor putitora. This article also documents the addition of nine EPIC primer pairs for Euphaea decorata, Euphaea formosa, Euphaea ornata and Euphaea yayeyamana. PMID:22136175

  10. PRODUCCIÓN DE ENZIMAS EXTRACELLARES POR BACTERIAS AISLADAS DE INVERTEBRADOS MARINOS

    Directory of Open Access Journals (Sweden)

    Jorge León

    2014-06-01

    Full Text Available Con el fin de seleccionar las bacterias marinas con la capacidad de producir enzimas extracelulares ( CEE , se analizaron muestras de Argopecten purpuratus y Crassostrea gigas en el cultivo , así como de otros invertebrados interticlal y bentónicos. La selección de cepas de la CEE de productores se llevó a cabo en Agar Marino ( MA con la adición del sustrato relevante ( almidón , caseína , Tween - 80 , lecitina , ADN y gelatina . La CEE evaluación cepas productoras se llevó a cabo en 102 aislamientos . Los resultados muestran que las bacterias asociadas TOA . purpuratusand C. gigashave las mejores actividades multienzimáticos ; Sin embargo , Semimytilus algosus, Tetrapigus niger y Thais chocolata también son fuentes importantes de productores de bacterias de la CEE. La actividad multienzimático cualitativa en MA ( zonas claras u opacas alrededor de las colonias en mm de diámetro varió de 6 a > 16 mm . La frecuencia de la producción multienzimático fue caseinase 62,74 % , entre esterasa 57,84 % , 52,94 % de la amilasa , la gelatinasa 38,23 % , 33,3 % DNAsa , agarasa 5,43 % y 90,0 % lecitinasa . Los resultados sugieren la posibilidad de usar cepas nativas para fines biotecnológicos

  11. Paleobiogeography and taxonomy of the genus Concholepas (Lamarck, 1801: a review and new evidences Paleobiogeografía y taxonomía del género Concholepas (Lamarck, 1801: una revisión y nuevas evidencias

    Directory of Open Access Journals (Sweden)

    LEYLA CÁRDENAS

    2008-09-01

    Full Text Available The muricid gastropod Concholepas concholepas, known in Chile as 'loco', is an important component of intertidal and shallow subtidal communities, and is one of the main invertebrates targeted by small-scale fishers (divers in Chile. Because of its ecological importance and economical value, numerous studies have been conducted to describe its life history, ecology and to understand population dynamics, fishery and management. However, little effort has been done to address the causal factor (s behind its current geographic distribution and moreover little is known about the past distribution of the different species in the genus. In this paper, first we review the paleobiogeography, historical relationships, taxonomy and geographical distribution of Concholepas species, so to contribute in the reconstruction on the past history of the genus. Second, we discuss the robustness of using shell traits when classifying specimens of the genus Concholepas. Third, we evaluate the taxonomic status of C. concholepas including samples from Peru, the continental coast of Chile and Juan Fernández Archipelago, using a molecular approach. Four main conclusions are reached: (1 the evolutionary history of the genus Concholepas has been characterized by successive phenotypically different forms where the fossils species appear to be distinguishable states in the same evolving lineage; (2 the historical biogeography of Concholepas was probably the result of a southward direction process of expansions and extinctions, with the ancestral species being located in south-central Peru; (3 C. concholepas corresponds to a single taxonomic unit along its continental geographical range of distribution; (4 the mtDNA variation present in C. concholepas does not support the existence of the subspecies C. concholepas fernandizianus in the Juan Fernández Archipelago. We suggest that these results should be considered in future ecological, fishery, management and conservation studies on C. concholepas along the Peruvian and Chilean coast and in the Juan Fernández Archipelago.El gastrópodo muricido Concholepas concholepas, conocido en Chile como 'loco', es un importante componente de comunidades marinas intermareales y submareales y es una de las principales especies de invertebrados en la pesquería artesanal chilena. Debido a su importancia y valor económico, se han realizado numerosos estudios para describir su historia de vida, ecología y entender las dinámicas poblacionales, pesquería y manejo. Sin embargo, menores esfuerzos han sido realizados para entender los factores causales detrás de su actual distribución geográfica y más aún poco es conocido acerca de la pasada distribución de las diferentes especies del género. En este trabajo, nosotros primero revisamos la paleobiogeografía, relaciones históricas y taxonomía, de las especies del género Concholepas para contribuir en la reconstrucción de la historia pasada del género. Segundo, discutimos la robustez de usar caracteres morfológicos en la taxonomía del género. Tercero, usando una aproximación molecular evaluamos el estatus taxonómico de C. concholepas incluyendo muestras desde Perú, la costa continental de Chile y del archipiélago de Juan Fernández. Se obtuvieron cuatro conclusiones principales: (1 la historia evolutiva del género Concholepas ha sido caracterizada por sucesivas formas fenotípicamente diferentes, donde las especies fósiles parecen ser estados morfológicos distinguibles de un único linaje evolutivo; (2 la biogeografía histórica de Concholepas parece ser resultado de un proceso continuo de expansión y extinción con dirección sur, con las especies ancestrales localizadas en el centro-sur de Perú; (3 C. concholepas corresponde a una sola unidad taxonómica a lo lago de su rango de distribución continental; (4 la variación en el ADNmt detectada en C. concholepas no apoya la existencia de la subespecie C. concholepas fernandizianus en el Archipiélago de Juan Fernández. Sugerimos que estos resultados deberán ser considerados en futuros estudios de ecología, pesquería, conservación y manejo en C. concholepas a lo largo de la costa chileno-peruana y en el archipiélago de Juan Fernández.

  12. Thais (Stramonita rustica (Lamarck, 1822 (Mollusca: Gastropoda: Thaididae, a potential bioindicator of contamination by organotin northeast Brazil

    Directory of Open Access Journals (Sweden)

    Ítalo Braga de Castro

    2004-06-01

    Full Text Available The use of antifouling paints containing the biocide compound tributyltin (TBT has been shown as an inductor of imposex in neogastropods mollusks. Imposex is characterized by the development of male features in females, mainly the appearance of a no functional vas deferens and penis. Samples of Thais rustica were collected in eight sites in the metropolitan area of Natal city, Rio Grande do Norte state, northeast Brazil, and examined for occurrence of imposex, which was found in many females. The higher imposex levels were presented by samples from sites near city harbor.A utilização de tintas antiincrustrantes contendo o composto biocida tributilestanho (TBT tem induzido moluscos neogastrópodes ao imposex. O imposex é caracterizado pelo surgimento de caracteres sexuais masculinos, sobretudo, pênis e vaso deferente não funcionais em fêmeas desses moluscos. Foram coletadas amostras de Thais rústica em oito estações ao longo da costa da cidade de Natal no Rio Grande do Norte. Esses animais foram analisados quanto a presença e o grau de imposex que apresentavam. Os níveis mais elevados de imposex foram observados na estação mais próxima ao porto.

  13. Use of Moringa oleífera Lamarck leaf extract as sugarcane juice clarifier: effects on clarifed juice and sugar

    Directory of Open Access Journals (Sweden)

    Gustavo Henrique Gravatim Costa

    2014-03-01

    Full Text Available The objective of this study was to evaluate the effect of Moringa oleifera Lam. leaf extract on the sedimentation of impurities in the treatment of sugarcane juice and the effects on sugar quality and on the clarified juice. The experimental design used was a 4x2 factorial arrangement with four replications. The main treatments performed included the extracted original sugarcane juice, the synthetic polyelectrolyte (Flomex 9076, the leaf extract, and a control. The secondary treatments consisted of the sugarcane varieties RB92579 and RB867515. The clarification process used was simple defecation, in which the flocculating agents and the juice, limed and heated, were poured simultaneously into a decanter. The microbiological and chemico-technological characteristics of the extracted and clarified juices were evaluated. The clarified juice was concentrated up to 60° Brix (syrup and subjected to boiling in a pilot pan using seeds to perform the graining: The sugar was recovered by centrifugation and analyzed for microbiological and chemico-technological characteristics. It was concluded that the use of the Moringa oleifera Lam. leaves extract resulted in a better quality of clarified juice and sugar.

  14. Experimental evidence that intra-specific competition in seagrass meadows reduces reproductive potential in the sea urchin Paracentrotus lividus (Lamarck)

    OpenAIRE

    Tomàs Nash, Fiona; Romero, Javier; Turon Barrera, Xavier

    2005-01-01

    To better understand the biological controls that regulate sea urchin dynamics, we studied the effects of potential inter- and intra-specific competition for food on several biological variables of the main sea urchin in the Mediterranean (Paracentrotus lividus). We carried out a caging experiment in which we manipulated sea urchin density (natural vs. high density) and herbivorous fish (Sarpa salpa) accessibility (free access vs. exclusion) in a Posidonia oceanica meadow. No evidence of comp...

  15. Effect of increased pCO2 on early shell development in great scallop (Pecten maximus Lamarck larvae

    Directory of Open Access Journals (Sweden)

    T. Harboe

    2013-02-01

    Full Text Available As a result of high anthropogenic emission of CO2, partial pressure of carbon dioxide (pCO2 in the oceans has increased causing a drop in pH, known as ocean acidification (OA. Numerous studies have shown negative effects on marine invertebrates, and that the early life stages are the most sensitive to OA. We studied the effects on embryo and larvae of great scallop (Pecten maximus L., using mean pCO2-levels of 477 (ambient, 821, 1184, and 1627 ppm. OA affected both survival and shell growth negatively after seven days. Growth was reduced with 5–10% when pCO2 increased from ambient 477 ppm to 1627 ppm, and survival based on egg number was reduced from 40.4% in the ambient group to 10.7% in the highest pCO2-group. Larvae/embryos stained with calcein one day after fertilization, showed fluorescence in the newly formed shell area indicating calcification of the shell already at the trochophore stage. Shell hinge deformities were observed at elevated pCO2-levels in trochophore larvae after two days. After seven days, deformities in both shell hinge and shell edge were observed in veliger larvae at elevated pCO2-levels. Although the growth showed a moderate reduction, survival rate and increased amount of deformed larvae indicates that P. Maximus larvae are affected by elevated pCO2 levels within the range of what is projected for the next century.

  16. Histology and Cytochemistry of the Neurosecretory Cells (NSC of the Freshwater Snail Lymnaea luteola (Lamarck Mollusca: Gastropoda

    Directory of Open Access Journals (Sweden)

    Vijaya Kumar Kanapala

    2015-01-01

    Full Text Available Four types of neurosecretory (NS cells are noticed in the cerebral, pleural, buccal and pedal ganglion of the freshwater snail Lymnaea luteola. According to the size and staining properties they are classified as A, B, C and D type cells. These are giant cells, medium cells, small cells and smallest cells. Type ‘A’ cells are largest of the all cells and measures about 0.0600-0.0800 mm in diameter. The B cells are smaller than ‘A’ cells and are ranges from 0.035-0.040 mm in diameter. The ‘C’ and ‘D’ cells are smaller than the ‘A’ and ‘B ‘cells and more or less oval in shape. The histochemical observations reveal that the neurosecretory material is rich in carbohydrates, disulphides, sulfhydryl group, protein bound amino groups, glycoprotein and lipids.

  17. Disease prevalence and snail predation associated with swell-generated damage on the threatened coral, Acropora palmata (Lamarck)

    Science.gov (United States)

    Bright, Allan J.; Rogers, Caroline S.; Brandt, Marilyn E.; Muller, Erinn; Smith, Tyler B.

    2016-01-01

    Disturbances such as tropical storms cause coral mortality and reduce coral cover as a direct result of physical damage. Storms can be one of the most important disturbances in coral reef ecosystems, and it is crucial to understand their long-term impacts on coral populations. The primary objective of this study was to determine trends in disease prevalence and snail predation on damaged and undamaged colonies of the threatened coral species, Acropora palmata, following an episode of heavy ocean swells in the US Virgin Islands (USVI). At three sites on St. Thomas and St. John, colonies of A. palmata were surveyed monthly over 1 year following a series of large swells in March 2008 that fragmented 30–93% of colonies on monitored reefs. Post-disturbance surveys conducted from April 2008 through March 2009 showed that swell-generated damage to A. palmata caused negative indirect effects that compounded the initial direct effects of physical disturbance. During the 12 months after the swell event, white pox disease prevalence was 41% higher for colonies that sustained damage from the swells than for undamaged colonies (df = 207, p = 0.01) with greatest differences in disease prevalence occurring during warm water months. In addition, the corallivorous snail, Coralliophila abbreviata, was 46% more abundant on damaged corals than undamaged corals during the 12 months after the swell event (df = 207, p = 0.006).

  18. Taxonomy Icon Data: purple urchin [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available purple urchin Strongylocentrotus purpuratus Echinodermata Strongylocentrotus_purpuratus_L.png Strongylocentr...otus_purpuratus_NL.png Strongylocentrotus_purpuratus_S.png Strongylocentrotus_purpu...ratus_NS.png http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Strongylocentrotus+purpuratus&t=L http://biosc...iencedbc.jp/taxonomy_icon/icon.cgi?i=Strongylocentrotus+purpuratus&t=NL http://bi...osciencedbc.jp/taxonomy_icon/icon.cgi?i=Strongylocentrotus+purpuratus&t=S http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Strongylocentrotus+purpuratus&t=NS ...

  19. Gene : CBRC-CJAC-01-0861 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ein [Strongylocentrotus purpuratus] 4e-12 30% MGLSLGPKFLGGAFPRQGLPWAWFSLKGRWGGFPRVGLSLGGAFSGWGFLWVELSLDVAVSG...GFLWVELSLDGALPGWGFSGRGFPWVGLFLGRGFLGGAFPGRGFLWARLFLGEVFLGGAFPEWGFPWVGLFWVGFFPGWGFSWVRLFSGQGFSWVGLFWAGLFLSGSL...SGQGFSWVGLFSGQGFPWARLFLSGSLWVELFWMGYFSLGGAFPEQGFSWVGLFVGGAFLGGLFPWAWLSLSGAFPWVGLSGWSFFGWAFSLGGAFPGLVFFPVWAFLSWDLCIPGPCLVTSF ...

  20. The occurrence of domoic acid linked to a toxic diatom bloom in a new potential vector: the tunicate Pyura chilensis (piure).

    Science.gov (United States)

    López-Rivera, Américo; Pinto, Maricela; Insinilla, Andrea; Suárez Isla, Benjamín; Uribe, Eduardo; Alvarez, Gonzalo; Lehane, Mary; Furey, Ambrose; James, Kevin J

    2009-11-01

    The tunicate Pyura chilensis (Molina, 1782); Phylum Chordata; Subphylum Urochordata; Class Ascidiacea, common local name "piure" or sea squirt; a filter-feeder (plankton and suspended particles) sessile species; may play an important role in monitoring domoic acid (DA) the principal toxic component of Amnesic Shellfish Poisoning (ASP). Significant DA concentrations have been determined in tunicate samples, collected during a recent ASP outbreak in Bahía Inglesa, an important scallop (Argopecten purpuratus) farming area. Several infaunal species were tested for the presence of DA, in addition to the usual scallop monitoring programme. DA was found at sub-toxic levels in filtering bivalves such as mussels (Mytilus chilensis), large mussels (Aulacomya ater) and clams (Protothaca thaca) (6.4, 5.4 and 4.7 microg DA/g tissue respectively). Of particular interest was the observation of significant accumulations of toxic Pseudo-nitzschia sp. diatoms in the internal siphon and atrium spaces of the tunicate. Toxin distribution within major tunicate organs was heterogeneous with 8.7-15.5 microg DA/g in edible tissues, 14.9-17.9 microg DA/g in the fecal material and 13.6-32.7 microg DA/g in the gut content. DA was determined by HPLC-UV and confirmed by diode-array detection and LC-MS/MS analysis. This is the first report of the presence of DA in a tunicate that is regularly consumed by coastal populations. These results confirm the need to include these organisms in sanitation programs for marine toxins. PMID:19505493

  1. High-resolution facies analysis and sequence stratigraphy of fluvio-deltaic depositional systems in tectonically-active basins (Jean Baptiste Lamarck Medal)

    Science.gov (United States)

    Mutti, E.

    2012-04-01

    In ancient tectonically-active basins fed by relatively small and high-gradient rivers, both marine and lacustrine fluvio-deltaic systems display similar vertical stacking patterns which are primarily controlled by high-frequency variations of sediment flux to the basin. These variations are superimposed over higher-order cycles of tectonic uplift and relative quiescence recorded by changes in the source areas, basin configuration and overall style of sedimentation.Spectacular examples of these cyclically stacked successions crop out in the upper Cretaceous and Paleogene deposits of the south-central Pyrenean foreland basin. Similar stacking patterns are also common in other basins (e.g., the Jurassic-Cretaceous Nequen basin, Argentina and the Tertiary Piedmont Basin, northwestern Italy). Sediment flux to the sea controls the high-frequency stacking pattern of ancient fluvio-deltaic depositional systems through cyclic variations in flow efficiency which is mainly a function of the magnitude and sediment concentration of river outflows during floods. These variations result in periods of inertia- and friction-dominated jet flows followed by periods during which fluvial activity dramatically decreases. These cyclic variations, which are ultimately controlled by climate and baselevelchanges (Milankowitch cycles), are recorded by m- to dam-thick facies successions that can be interpreted as the basic "building block" (in sequence-stratigraphic parlance) of larger-scale depositional sequences. Inertia-dominated periods are characterized by large-volume highly erosive hyperpycnal flows typically containing abundant skeletal debris and mudstone clasts. These flows bypass river mouths and carry sand tonearshore and shelfal regions forming m-thick packets of tabular graded sandstone beds with HCS alternating with muddier facies. These sandstones, which extend up to several km in shelfal regions and grade distally into prodeltaic sediments, are a typical and volumetrically dominant deltaic element herein referred to as "flood-generated delta-front sandstone lobes". Their facies tracts closely resemble those observed in deep-water turbidites. Unfortunately, because of the presence of HCS, these shallow-marine sediment gravity flow deposits have been and are still commonly mistaken in most literature for "storm-dominated" shoreface deposits. Friction-dominated periods are expressed by mouth-bar progradation produced by river outflows of limited volume and efficiency that dissipate their energy at river mouths and are thus able to carry seaward only their fine-grained sediment load through buoyant plumes and dilute hyperpycnal flows. When rivers dramatically decrease their activity, fluvio-deltaic systems aggrade through marine mudstone facies that pass landward into flood-plain mudstones with paleosols. Marine diffusion processes are restricted to local tidal reworking that occurs in river mouth regions and, more extensively, in large estuaries where fluvial processes mix with strong tidal action during early periods of base-level rise. Following decreased river activity, carbonate deposition may locally occur forming generally thin units at the top of fluvio-deltaic sandstones. Several problems arise as to the sequence stratigraphic interpretation of these fluvio-deltaic systems and their cyclic stacking patterns. In particular, these problems concern the significance of the "shoreface" and "parasequence" concepts that can be misleading if not viewed within a robust framework of stratigraphic and faciesconstraints.

  2. Assessment of recent and chalcolithic period environmental pollution using Mytilus galloprovincialis Lamarck, 1819 from Yarimburgaz Cave, the northern Marmara Sea and Bosphorus coasts

    Directory of Open Access Journals (Sweden)

    Ipek F. Barut

    2016-04-01

    Full Text Available Marine or freshwater mussel species are found in large quantities around populated areas and accumulate metals in aquatic systems. Therefore, these organisms are used to monitor environmental pollution. Mytilus galloprovincialis is a generally accepted bioindicator of metal pollution and is used in this study. The aim of this study is to determine the changes in the environmental conditions since antiquity. M. galloprovincialis shells were used to monitor Chalcolithic pollution levels in Yarimburgaz Cave, one of the oldest settlements in Europe. Recent samples were collected from 12 stations on the coasts of the Northern Marmara Sea and the Bosphorus between May–September 2004. The environmental pollution substantially changed over the last 7500 years. The comparison of the geochemical characteristics of the environmental pollution observed in the Chalcolithic period and today revealed that pollution from both household and industrial chemicals has increased in Istanbul.

  3. Habitat traits and patterns of abundance of the purple sea urchin, Paracentrotus lividus (Lamarck, 1816), at multiple scales along the north Portuguese coast

    Science.gov (United States)

    Domínguez, Rula; Domínguez Godino, Jorge; Freitas, Cristiano; Machado, Inês; Bertocci, Iacopo

    2015-03-01

    Spatial and temporal patterns of abundance and distribution of sea urchins (Paracentrotus lividus) from intertidal rockpools of the north Portuguese coast were examined in relation to physical (surface, altitude, depth, topographic complexity and exposure) and biological (substrate cover by dominant organisms) habitat traits. The methodology was based on a multi-factorial design where the total number and the abundance of urchins in each of six size classes were sampled over a range of spatial scales, from 10s of cm to kms, and a temporal scale of five months. The results highlighted three main features of the studied system: (1) the largest proportion of variability of sea urchins occurred at the smallest scale examined; (2) urchins from different size classes showed different patterns of abundance in relation to habitat traits; (3) variables normally invoked as potential drivers of distribution of urchins at a range of scales, such as hydrodynamics and shore height, were relatively less important than other abiotic (i.e. pool area, pool mean depth calculated over five replicate measures and sand cover) and biological (i.e. space occupancy by the reef-forming polychaete Sabellaria alveolata and mussels vs. availability of bare rock) variables to provide a considerable contribution to the variability of sea urchins. Intertidal populations of sea urchins are abundant on many rocky shores, where they are socially and economically important as food resource and ecologically key as habitat modelers. This study provides new clues on relatively unstudied populations, with relevant implications for possible management decisions, including the implementation of protection schemes able to preserve the main recruitment, settlement and development areas of P. lividus.

  4. The Mediterranean Plio-Pleistocene: A reference frame for astronomically paced low and high latitude climate changes (Jean Baptiste Lamarck Medal Lecture)

    Science.gov (United States)

    Lourens, Lucas

    2016-04-01

    The astronomical theory of climate has revolutionized our understanding of past climate change and the development of highly accurate geologic time scales for the entire Cenozoic. Most of this understanding has started with the construction of high-resolution stable oxygen isotope (18O) records from planktonic and benthic foraminifera of open ocean deep marine sediments explored by the international drilling operations of DSDP, ODP and IODP. These efforts culminated into global ocean isotopic stacked records, which give a clear picture of the evolution of the climate state through time. Fundamental for these reconstructions are the assumptions made between the astronomical forcing and the tuned time series and the accuracy of the astronomical solution. In the past decades, an astronomically calibrated time scale for the Pliocene and Pleistocene of the Mediterranean has been developed, which has become the reference for the standard Geologic Time Scale. Characteristic of the studied marine sediments are the cyclic lithological alternations, reflecting the interference between obliquity and precession-paced low latitude climate variability. These interference patterns allowed to evaluate the accuracy of astronomical solutions and to constrain the dynamical ellipticity of the Earth and tidal dissipation by the Sun and the Moon, which in turn provided the backbone for the widely applied LR04 open ocean benthic isotope stack of the past 5 Myr. So far, the assumed time lags between orbital forcing and the global climate response as reflected in LR04 have not been tested, while these assumptions hark back to SPECMAP, using simple ice sheet models and a limited number of radiometric dates. In addition, LR04 adopted a shorter response time for the smaller ice caps during the Pliocene. Here I present the first benthic 18O record of the Mediterranean reference scale, which strikingly mirrors the LR04. I will use this record to discuss the assumed phase relations and its potential to constrain global sea level changes and their cause over the past 5.3 million years.

  5. Biomonitoring of Pb and Cd in two impacted watersheds in Southeast Brazil, using the freshwater mussel Anodontites trapesialis (Lamarck, 1819 (Bivalvia : Mycetopodidae as a biological monitor

    Directory of Open Access Journals (Sweden)

    Andréa C. Tomazelli

    2003-12-01

    Full Text Available Studies were carried out to investigate the contamination of Piracicaba and Mogi-Guaçu River basins (São Paulo State, Southeastern, Brazil for heavy metals (Cd and Pb, using the limnic bivalve Anodontites trapesialis as a biological monitor. The results showed that the concentrations of Pb were higher than the control group in both basins, showing the bioavailability of this non-essential element in the basins. The concentrations were higher in the Mogi-Guaçu than in the Piracicaba basin, and in the slightly contaminated sites in both basins. There was no correlation between the degree of human impact and Cd and Pb concentrations, it was not possible to infer about concentrations of these heavy metals in the bivalves based only in a broad evaluation of human impact.O principal objetivo deste estudo foi investigar a contaminação pelos metais pesados Cd e Pb nas bacias dos rios Piracicaba e Mogi-Guaçu (Estado de São Paulo, Brasil, utilizando o bivalve limnico Anodontites trapesialis como indicador biológico. As bacias estudadas apresentam diferentes graus de impacto, sendo a qualidade da água geralmente melhor na bacia do rio Mogi-Guaçu. Os teores de Pb detectados nos bivalves não podem ser considerados críticos, contudo, houve acúmulo em relação ao grupo de controle em ambas as bacias, especialmente na bacia do rio Mogi-Guaçu. As maiores concentrações dos elementos, especialmente Pb, foram observadas nos locais menos poluídos e na bacia menos degradada. Este fato sugere que estas concentrações não estão sendo afetadas apenas pelas atividades antrópicas nas bacias, mas deve-se considerar também fatores que afetem a biodisponibilidade ou fontes específicas e não pontuais.

  6. EFFECT OF DIET QUALITY ON NUTRIENT ALLOCATION TO THE TEST AND ARISTOTLE’S LANTERN IN THE SEA URCHIN LYTECHINUS VARIEGATUS (LAMARCK, 1816)

    OpenAIRE

    Heflin, Laura Elizabeth; Gibbs, Victoria K; Powell, Mickie L.; Makowsky, Robert; Lawrence, Addison L.; Lawrence, John M.

    2012-01-01

    Small adult (19.50 ± 2.01g wet weight) Lytechinus variegatus were fed eight formulated diets with different protein (12 to 36% dry weight as fed) and carbohydrate (21 to 39 % dry weight) levels. Each sea urchin (n = 8 per treatment) was fed a daily ration of 1.5% of the average body weight of all individuals for 9 weeks. Akaike information criterion scores were used to compare six different dietary composition hypotheses for eight growth measurements. For each physical growth response, differ...

  7. Controlling golden apple snail,Pomacea canaliculata Lamarck for no-tillage cultivation in rice%免耕稻福寿螺防除技术

    Institute of Scientific and Technical Information of China (English)

    李金旺; 周海; 卢曦

    2004-01-01

    田间调查发现,每年4~6月和8~10月是福寿螺产卵和孵化高峰期,也是成螺和高龄幼螺集中危害的盛期,主要是吞食小苗稻叶,造成少苗缺株.不同杀螺剂防除试验表明,最经济、安全的方法是在免耕稻抛栽前,每hm2用45~75kg茶麸饼浸出液喷施田面,防效达90.49%左右,hm2用2.25kg85%五氯酚钠杀螺颗粒剂、0.75kg 70%贝螺杀、0.75kg 45%百螺敌可湿性粉剂喷施田面,防效也较好.

  8. NCBI nr-aa BLAST: CBRC-BTAU-01-1564 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-1564 ref|YP_001382287.1| ATP synthase F0 subunit 6 [Argopecten irradia...ns] gb|ABS17670.1| ATP synthase F0 subunit 6 [Argopecten irradians] YP_001382287.1 1.1 24% ...

  9. NCBI nr-aa BLAST: CBRC-DNOV-01-0458 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-0458 ref|YP_001382296.1| NADH dehydrogenase subunit 4 [Argopecten irra...dians] gb|ABS17679.1| NADH dehydrogenase subunit 4 [Argopecten irradians] YP_001382296.1 0.79 24% ...

  10. NCBI nr-aa BLAST: CBRC-XTRO-01-0090 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-0090 ref|YP_001382287.1| ATP synthase F0 subunit 6 [Argopecten irradia...ns] gb|ABS17670.1| ATP synthase F0 subunit 6 [Argopecten irradians] YP_001382287.1 0.13 26% ...

  11. Relação entre diferentes espécies de formigas e a mirmecófita Cordia nodosa Lamarck (Boraginaceae em áreas de mata ripária na Amazônia mato-grossense Relationship among different plant-ants and its myrmecophite host Cordia nodosa Lamarck (Boraginaceae in a riparian Mato Grosso Amazonian forest

    Directory of Open Access Journals (Sweden)

    Thiago Junqueira Izzo

    2011-01-01

    Full Text Available Os benefícios obtidos por um organismo em uma associação mutualística podem variar em função de fatores ambientais, bem como entre as diferentes espécies que podem estar associadas. Neste trabalho demonstramos que quatro espécies de formigas, Crematogaster brasiliensis, Allomerus octoarticulatus e duas não identificadas do gênero Azteca podem ser encontradas associadas à mirmecófita Cordia nodosa em florestas ripárias sul-amazônicas. Essa composição de espécies de formigas é mais similar a encontrada na Amazônia Andina do que aquela da Amazônia Central brasileira. A colonização por formigas parece ser determinante, pois diminuiu a herbivoria e, consequentemente, aumentou a probabilidade de C. nodosa produzir frutos. Adicionalmente, mesmo não havendo diferença na herbivoria entre plantas colonizadas pelas diferentes espécies de formigas, a probabilidade de uma planta colonizada por formigas do gênero Allomerus produzir frutos é menor do que quando colonizadas pelas outras espécies de formigas. Esse estudo demonstra a dependência de C. nodosa pela colonização de formigas para sua reprodução. Contudo, conforme outros estudos realizados em outras áreas da Amazônia demonstram, nossos resultados também sugerem que Allomerus pode estar castrando as plantas hospedeiras, agindo como parasita em toda a sua distribuição geográfica.The benefits obtained by an organism when involved in a mutualistic interaction vary depending on environmental factors, as well as among the identity of the involved species. In this study, we showed that four ant species, Crematogaster brasiliensis, Allomerus octoarticulatus, and two unidentified Azteca species can be found associated to the myrmecophite Cordia nodosa in riparian forests in the South of Amazonia. This composition of ant-associated species is more similar in forests of Andean Amazon than in Central Amazonia. The colonization of an ant colony on C. nodosa seems to be vital in order to decrease herbivory, as increased the probability of a plant sets fruits. Moreover, even though we did not find significant differences in herbivory among plants colonized by different ant species, the probability of a plant produces fruits is much lower when it is colonized by Allomerus ants. Overall, this study shows that C. nodosa depends on ants to reproduce. However, based on other empirical studies across the Amazon, our results also suggest that Allomerus ants can act as flower castrator, acting as a parasite over its geographic range.

  12. Hermaphroditism among dioecious Tagelus plebeius (Lightfoot, 1786 (Mollusca, Psammobiidae and Iphigenia brasiliana (Lamarck, 1818 (Mollusca, Donacidae on the Cachoeira River Estuary, Ilhéus, Bahia, Brazil Hermafroditismo nos moluscos dióicos Tagelus plebeius (Lightfoot, 1786 (Mollusca, Psammobiidae e Iphigenia brasiliana (Lamarck, 1818 (Mollusca, Donacidae na região estuarina do Rio Cachoeira, Ilhéus, Bahia, Brasil

    Directory of Open Access Journals (Sweden)

    LO. Ceuta

    2010-02-01

    Full Text Available The samples of Tagelus plebeius and Iphigenia brasiliana were manually collected on the Cachoeira River estuary region (Ilhéus, BA, Brazil between August 2005 and August 2006, with a periodicity of 15 days, with 20 animals collected/sampled, performing 500 samples from each species. The animals were measured, eviscerated and kept in solution of Davidson and after 24-30 hours, they were transferred to ethanol 70%. The material was processed for routine histology, with paraffin embedding, obtaining 7 μm thick slices, stained with Harris hematoxilin and Eosin (HE. By light microscopy analysis, 2 cases of hermaphroditism (0.4% in T. plebeius samples and one case (0.2% in I. brasiliana were registered with predominance of female over male follicles.Os exemplares de Tagelus plebeius e Iphigenia brasiliana foram manualmente coletados na região estuarina do Rio Cachoeira (Ilhéus, Bahia, entre agosto de 2005 e agosto de 2006, com coleta quinzenal de 20 animais, totalizando 500 exemplares/espécie. Os animais foram mensurados, eviscerados e fixados em solução de Davidson por 24-30 horas e depois transferidos para etanol a 70%. O material foi processado por técnica rotineira de histologia, com inclusão em parafina, obtenção de cortes com 7 μm de espessura e coloração por hematoxilina de Harris e Eosina (HE. A análise em microscopia de luz evidenciou 2 casos de hermafroditismo (0,4% em T. plebeius e um caso (0,2% em I. brasiliana (0,2%, com predominância de folículos femininos sobre os masculinos.

  13. Larval settlement and spat recovery rates of the oyster Crassostrea brasiliana (Lamarck, 1819) using different systems to induce metamorphosis Taxas de assentamento larval e recuperação de sementes da ostra Crassostrea brasiliana (Lamarck, 1819) com uso de diferentes sistemas de indução à metamorfose

    OpenAIRE

    RC Silveira; FC Silva; CHM Gomes; JF Ferreira; CMR Melo

    2011-01-01

    This study aimed at the assessment, in the laboratory, of the larval settlement and spat recovery rates of oysters of the species Crassostrea brasiliana using plastic collectors, epinephrine (C9H13NO3 C4H6O6) and shell powder in settlement tanks. Polypropylene was used attached to bamboo frames. The material was chosen due to its pliability - that favours the spat detachment. Two experiments were carried out; the first between February and April 2008, and the second between November and Decem...

  14. Variabilidad geográfica en la tolerancia térmica y economía hídrica del gastrópodo intermareal Nodilittorina peruviana (Gastropoda: Littorinidae, Lamarck, 1822 Geographic variability in thermal tolerance and water economy of the intertidal gastropod Nodilittorina peruviana. (Gastropoda: Littorinidae, Lamarck, 1822

    Directory of Open Access Journals (Sweden)

    JOSE MIGUEL ROJAS

    2000-09-01

    Full Text Available El gastrópodo Nodilittorina peruviana es un habitante común de la zona intermareal rocosa de la costa norte y centro de Chile. Las poblaciones de esta especie se caracterizan por presentar distribuciones agregadas. Por medio de mediciones de terreno y ensayos de laboratorio se evaluó la influencia de la agregación sobre las habilidades de termorregulación y conservación de agua, en individuos pertenecientes a dos localidades de la costa de Chile que presentan distintos regímenes termales (Taltal 25º 25' S; 70º 29' W y Las Cruces 33º 35' S; 71º 38' W. Los resultados indican que la influencia de la agregación sobre las habilidades termorregulatorias es dependiente de las condiciones locales. A pesar de que los individuos de ambas localidades presentaron puntos de tolerancia térmica similares, los caracoles de Taltal mostraron tasas de pérdidas de agua menores. El tamaño de las agregaciones se relacionó en forma negativa con la tasa de pérdida de agua de los individuos de ambas localidades. En el caso de Taltal se observó un límite de tolerancia menor que en Las Cruces y una relación positiva entre tamaño de la agregación y temperatura grupal. Los resultados demuestran que las condiciones ambientales locales puede ser determinante para la efectividad de los mecanismos de termorregulación.The gastropod Nodilittorina peruviana inhabit rocky intertidal of the north and center Chile. Populations of this species exhibits aggregated distributions. Through field and lab records we studied the effect of spatial distribution of snails on their thermoregulatory and water conservation efficiencies. We studied individuals from two localities of the Chilean coast with different climatic conditions (Taltal 25° 25 ` S; 70° 29 ` W and Las Cruces 33° 35 ` S; 71° 38 ` W. Results indicate that the influence of spatial distribution thermoregulatory efficiency is dependent of the local conditions. Although individuals from both localities presented similar thermal tolerances, snails from Taltal showed lower rates of water loss. Aggregations size were negatively related with the rate of water loss in individuals from both localities. Only, individuals from Taltal decreased their limit of thermal tolerance, and exhibited a positive relationship between aggregation size and the temperature of the group. Results demonstrated that the local environmental conditions are determinate thermoregulatory strategies.

  15. A estrutura histórico-conceitual dos programas de pesquisa de Darwin e Lamarck e sua transposição para o ambiente escolar Darwin and Lamarck research programs hitoric-conceptual structure and its conversion to the school environment

    Directory of Open Access Journals (Sweden)

    Argus Vasconcelos de Almeida

    2005-04-01

    Full Text Available O presente trabalho tenta estabelecer uma complementaridade teórica entre uma abordagem epistemológica - a metodologia dos programas de pesquisa de Lakatos - e uma psicológico-cognitivista - a teoria dos campos conceituais de Vergnaud - objetivando a compreensão dos programas de pesquisa lamarckiano e darwiniano em seus respectivos campos de validade. Através da análise da estrutura histórico-conceitual dos dois programas e sua transposição para o ambiente escolar, são constatados e discutidos problemas nos livros didáticos de Biologia e na pesquisa atual sobre o conceito de Evolução entre alunos de diversos níveis escolares. Como resultado destas reflexões é apontada a teoria dos campos conceituais como um instrumento analítico frutífero do processo de conceitualização dos sujeitos diante de situações envolvendo processos evolutivos.The present work tries to establish a theoretical similarities in complementary among an epistemological approaches between - the methodology of the programs of research of Lakatos - and (a psychological-cognitivist and - the theory of the conceptual fields of Vergnaud. It - aimsing at the understanding of the programs of research Llamarckian and Ddarwinian programmes of research in theirr respective validity fields. Through the analysis of the historical-conceptual structure of the two programs and itsyour conversion for the school environment, verified and discussed problems in the text books of Biology are identified and discussed as is and in the current research on the concept of Evolution among students atof several school levels. As a result of these reflections the theory of the conceptual fields is pointed out as a fruitful analytical instrument of the conceptualization process inof the subjects front to situations involving evolutionary processes.

  16. Poliploidia en moluscos de importancia comercial (almeja catarina Argopecten ventricosus Sowerby ii, 1842; almeja mano de leon Nodipecten subnodosus Sowerby 1835; y abulón rojo Haliotis rufescens Swainson 1822)

    OpenAIRE

    Maldonado, R.

    2003-01-01

    La poliploidía ha sido una de las biotecnologías más empleadas en la ultima década para el mejoramiento genético de moluscos bivalvos por ser una de las mejores alternativas a corto plazo para incrementar la producción. Los organismos triploides presentan tres juegos completos de cromosomas homólogos que afectan la sinapsis, lo cual da como resultado una esterilidad parcial o total, la cual teóricamente repercute favorablemente en el crecimiento. Sin embargo, la inducción a la triploidía pres...

  17. Procesos naturales y antropogénicos asociados al evento de mortalidad de conchas de abanico ocurrido en la bahía de Paracas (Pisco, Perú en junio del 2000

    Directory of Open Access Journals (Sweden)

    Rita Cabello

    2013-06-01

    Full Text Available Con la finalidad de determinar los procesos que desencadenaron el evento de mortalidad de concha de abanico (Argopecten purpuratus el 6 de junio del 2000, se analizaron las condiciones ambientales naturales y antropogénicas en la Bahía de Paracas (Pisco, Perú durante el período de actividad pesquera industrial pesquera, entre el 17 de mayo y el 13 de junio del 2000. Se evaluaron diariamente las variables oceanográficas de temperatura, oxígeno disuelto, volumen de fitoplancton y variables de calidad acuática, aceites y grasas, sólidos suspendidos totales, DBO5 , pH, sulfuros y coliformes termotolerantes, en 5 estaciones de la Bahía de Paracas. Desde mediados de mayo, se registraron altos contenidos de aceites y grasas provenientes de efluentes pesqueros. A fines de mayo se observó la presencia de una marea roja asociada a un incremento en los sólidos suspendidos totales, pH y oxígeno disuelto, especialmente frente a Atenas y El Chaco. A inicios de junio en superficie se produjo una disminución de los sólidos suspendidos totales (< 25 mg.L-1 y oxígeno (< 3 mL.L-1, llegando a un máximo las concentraciones de grasa (m·x.: 10,1 mg.L-1, mientras que en los fondos el proceso acumulativo de carga orgánica produjo un estado anóxico con alto contenido de sulfuros (m·x.: 19,73 µg-at.L-1. Estas condiciones redujeron la calidad del ambiente marino, y produjeron la mortalidad de los organismos bentónicos. El aporte de materia org·nica proveniente de efluentes pesqueros, junto con el aporte proveniente de la floración algal nociva, ejerció un efecto sinérgico negativo sobre la calidad de la columna de agua y los sedimentos, lo que provocó la mortalidad de especies bentónicas, entre ellas la concha de abanico.

  18. Acción patogénica de Heterorhabditis bacteriophora (Poinar) sobre el caracol manzana (Pomacea canaliculata Lamarck), plaga de los cultivos de arroz (Oriza sativa) en la cuenca baja del río Daule, Guayas, Ecuador

    OpenAIRE

    G. A. Salcedo

    2013-01-01

    Los cultivos de arroz en la cuenca baja del río Daule, Ecuador, son afectados por el caracol manzana. La pérdida estimada es de 40 al 60% de la producción/ha. El agricultor, para evitar pérdidas considerables, aplica agroquímicos en dosis elevadas, desequilibrando la fauna y microfauna nativa, agravando el problema. Razón por la cual, se evaluó la patogenicidad de H. bacteriophora sobre el caracol manzana, con tres dosis; mediante un diseño completamente al azar (DCA) con cuatro tratamientos ...

  19. Acción patogénica de Heterorhabditis bacteriophora (Poinar sobre el caracol manzana (Pomacea canaliculata Lamarck, plaga de los cultivos de arroz (Oriza sativa en la cuenca baja del río Daule, Guayas, Ecuador

    Directory of Open Access Journals (Sweden)

    G. A. Salcedo

    2013-01-01

    Full Text Available Los cultivos de arroz en la cuenca baja del río Daule, Ecuador, son afectados por el caracol manzana. La pérdida estimada es de 40 al 60% de la producción/ha. El agricultor, para evitar pérdidas considerables, aplica agroquímicos en dosis elevadas, desequilibrando la fauna y microfauna nativa, agravando el problema. Razón por la cual, se evaluó la patogenicidad de H. bacteriophora sobre el caracol manzana, con tres dosis; mediante un diseño completamente al azar (DCA con cuatro tratamientos y cinco repeticiones. Los resultados muestran el 100% de mortalidad por septicemia a las 96 horas de la inoculación, con relación al testigo.

  20. Bioaccumulation and Distribution of Heavy Metals (Cd, Cu, Fe, Ni, Pb and Zn in the Different Tissues of Chicoreus capucinus Lamarck (Mollusca: Muricidae Collected from Sungai Janggut, Kuala Langat, Malaysia

    Directory of Open Access Journals (Sweden)

    Franklin Edward Berandah

    2010-01-01

    Full Text Available Knowledge on accumulation and distribution of metals in the soft tissues may help us to understand the processes involved in the uptake and excretion of metals in the different parts of molluscs such as Chicoreus capucinus. Chicoreus capucinus was collected from intertidal areas of Sungai Janggut mudflat, Kuala Langat, Selangor and analysed for heavy metals content in the tissues. The capability of the different parts to accumulate heavy metal from the environment was measured by calculating their Biota-Sediment Accumulation Factor (BSAF values. From this preliminary investigation, it was found that the highest concentrations of Cu were found in the caecum (194±24.4 µg/g dw, Cd in digestive gland (32.9±0.000 µg/g dw and Fe in operculum (971±2.50 µg/g dw. For Ni and Pb, high concentrations in shell were observed and Zinc high levels in most of the tissues studied except shell and operculum. On the other hand, highest BSAF values were obtained in caecum for Cu (101.2, Zn (27.4 and Cd (53.1, while highest BSAF values were obtained in shell for Pb (32.6 and Ni (8.88. However, in general, most of the different parts of the gastropod could be suggested as macro concentrator organs, since the BSAF values were greater than 2. More studies should be conducted in the future to determine the potential of C. capucinus as biomonitor.

  1. Trophic relationships between macroinvertebrates and fish in a pampean lowland stream (Argentina)

    OpenAIRE

    María V. López van Oosterom; Carolina S. Ocón; Florencia Brancolini; Maroñas, Miriam E.; Eduardo D. Sendra; Alberto Rodrigues Capítulo

    2013-01-01

    The diet and trophic relationships between the macroinvertebrates Phyllogomphoides joaquini Rodrigues Capítulo, 1992 and Coenagrionidae (Odonata), Chironomidae (Diptera), Diplodon delodontus (Lamarck, 1919) (Bivalvia: Hyriidae), and Pomacea canaliculata (Lamarck, 1822) (Gastropoda: Ampulariidae) and the fishes Pimelodella laticeps Eigenmann, 1917 (Heptapteridae) and Bryconamericus iheringii (Boulenger, 1887) (Characidae) in a temperate lowland lotic system in Argentina were assessed on the ba...

  2. Gametogênese e dinâmica da reprodução de Anodontites trapesialis (Lamarck (Unionoida, Mycetopodidae no lago Baía do Poço, planície de inundação do rio Cuiabá, Mato Grosso, Brasil Gametogenesis and dynamics of the reproduction of Anodontites trapesialis (Lamarck (Unionoida, Mycetopodidae from Baia do Poço Lake at the Cuiabá River wetland, Mato Grosso, Brazil

    Directory of Open Access Journals (Sweden)

    Cláudia T. Callil

    2007-01-01

    Full Text Available O ciclo reprodutivo de Anodontites trapesialis foi estudado entre os meses de maio de 1998 a abril de 1999. Análises quantitativas dos elementos celulares revelaram que a espécie é exclusivamente hermafrodita com folículos masculinos e femininos separados. A gametogênese é contínua com picos de maturação e eliminação de gametas durante a estação seca. A ovogênese tem seu período de maturação máxima em abril e maio, momento em que óvulos maduros são observados preenchendo os folículos e gonoductos. A espermatogênese foi reconhecida por uma fase proliferativa com células em desenvolvimento e apresentou seu período de maturação entre abril e julho. Estas células se diferenciaram dando origem às mórulas espermáticas e espermatozóides livres, organizando a série espermática radial. Durante o período de liberação dos gametas, a maioria dos folículos apresentou agregados de espematozóides formando esferas espermáticas as "spermballs", as quais caracterizam a espécie como espermatozeugmata.The reproductive cycle of Anodontites trapesialiswas studied from May 1998 to April 1999. Quantitative analysis of the sexual cycle revealed that the species is exclusively hermaphrodite with separate male and female follicles. Gametogenesis is continuous with peaks of maturation and elimination of gametes during dry season. The period of maximum maturation of the oogenesis was in April and May, when mature oocytes were observed filling the follicles and gonoducts. Spermatogenesis was recognized by a proliferation phase with developing cells with period of maturation since April to July. These cells started to differentiate giving origin to spermatic morulae and free spermatozoa organizing the radial spermatic series. During the period of discharge of the gamets, the majority of follicles presented aggregates of spermatozoa forming the spermballs, which characterize the species as spermatozeugmata.

  3. NCBI nr-aa BLAST: CBRC-DDIS-04-0105 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DDIS-04-0105 ref|XP_795306.2| PREDICTED: similar to mind bomb [Strongylocentro...tus purpuratus] ref|XP_001195978.1| PREDICTED: similar to mind bomb [Strongylocentrotus purpuratus] XP_795306.2 0.003 64% ...

  4. NCBI nr-aa BLAST: CBRC-OCUN-01-0862 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OCUN-01-0862 ref|NP_999775.1| spicule matrix protein SM50 [Strongylocentrotus ...purpuratus] sp|P11994|SM50_STRPU 50 kDa spicule matrix protein precursor gb|AAA30071.1| spicule matrix protein SM50 precursor [Strongylocentrotus purpuratus] NP_999775.1 2e-15 34% ...

  5. NCBI nr-aa BLAST: CBRC-DNOV-01-0174 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-0174 ref|XP_786035.2| PREDICTED: similar to autism-related protein 1 [...Strongylocentrotus purpuratus] ref|XP_001191209.1| PREDICTED: similar to autism-related protein 1 [Strongylocentrotus purpuratus] XP_786035.2 2.3 34% ...

  6. NCBI nr-aa BLAST: CBRC-XTRO-01-1055 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-1055 ref|XP_782654.2| PREDICTED: similar to Cpsf6 protein, partial [St...rongylocentrotus purpuratus] ref|XP_001180349.1| PREDICTED: similar to Cpsf6 protein, partial [Strongylocentrotus purpuratus] XP_782654.2 1e-34 51% ...

  7. NCBI nr-aa BLAST: CBRC-RMAC-09-0027 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RMAC-09-0027 ref|XP_797403.2| PREDICTED: similar to Aminopeptidase N (rAPN) (Alanyl aminope ... inopeptidase M) (APM) (Kidney Zn peptidase) (KZP) (CD13 ... antigen) [Strongylocentrotus purpuratus] ref|XP_00 ... inopeptidase M) (APM) (Kidney Zn peptidase) (KZP) (CD13 ... antigen) [Strongylocentrotus purpuratus] XP_797403 ...

  8. NCBI nr-aa BLAST: CBRC-OCUN-01-0528 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OCUN-01-0528 ref|XP_795774.2| PREDICTED: similar to plus agglutinin [Strongylo...centrotus purpuratus] ref|XP_001192339.1| PREDICTED: similar to plus agglutinin [Strongylocentrotus purpuratus] XP_795774.2 0.062 32% ...

  9. NCBI nr-aa BLAST: CBRC-OANA-01-1904 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-1904 ref|XP_796436.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001187269.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_796436.2 6e-81 42% ...

  10. NCBI nr-aa BLAST: CBRC-OANA-01-1491 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-1491 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 2e-35 36% ...

  11. NCBI nr-aa BLAST: CBRC-OANA-01-1904 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-1904 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 1e-84 42% ...

  12. NCBI nr-aa BLAST: CBRC-OANA-01-1738 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-1738 ref|XP_787857.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001191368.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_787857.2 0.007 30% ...

  13. NCBI nr-aa BLAST: CBRC-OANA-01-2167 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-2167 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 3e-11 31% ...

  14. NCBI nr-aa BLAST: CBRC-XTRO-01-3457 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-3457 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 6e-17 38% ...

  15. NCBI nr-aa BLAST: CBRC-OANA-01-0997 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-0997 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 3e-49 40% ...

  16. NCBI nr-aa BLAST: CBRC-OANA-01-1470 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-1470 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 6e-44 36% ...

  17. NCBI nr-aa BLAST: CBRC-OANA-01-2284 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-2284 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 2e-64 41% ...

  18. NCBI nr-aa BLAST: CBRC-MDOM-01-0521 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-01-0521 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 8e-10 30% ...

  19. NCBI nr-aa BLAST: CBRC-XTRO-01-2405 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-2405 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 9e-45 37% ...

  20. NCBI nr-aa BLAST: CBRC-GACU-23-0138 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GACU-23-0138 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 1e-119 39% ...

  1. NCBI nr-aa BLAST: CBRC-XTRO-01-0211 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-0211 ref|XP_796436.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001187269.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_796436.2 6e-05 63% ...

  2. NCBI nr-aa BLAST: CBRC-OLAT-01-0021 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OLAT-01-0021 ref|XP_787857.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001191368.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_787857.2 4e-65 42% ...

  3. NCBI nr-aa BLAST: CBRC-OANA-01-2105 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-2105 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 5e-79 43% ...

  4. NCBI nr-aa BLAST: CBRC-OANA-01-1879 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-1879 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 3e-61 42% ...

  5. NCBI nr-aa BLAST: CBRC-GACU-11-0007 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GACU-11-0007 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 1e-120 40% ...

  6. NCBI nr-aa BLAST: CBRC-OANA-01-2234 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-2234 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 1e-59 42% ...

  7. NCBI nr-aa BLAST: CBRC-XTRO-01-3296 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-3296 ref|XP_796436.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001187269.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_796436.2 7e-11 32% ...

  8. NCBI nr-aa BLAST: CBRC-XTRO-01-0211 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-0211 ref|XP_787857.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001191368.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_787857.2 6e-05 51% ...

  9. NCBI nr-aa BLAST: CBRC-OLAT-26-0032 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OLAT-26-0032 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 5e-63 48% ...

  10. NCBI nr-aa BLAST: CBRC-FRUB-02-0514 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0514 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 3e-87 40% ...

  11. NCBI nr-aa BLAST: CBRC-MDOM-11-0167 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-11-0167 ref|XP_796436.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001187269.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_796436.2 0.48 28% ...

  12. NCBI nr-aa BLAST: CBRC-OLAT-01-0021 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OLAT-01-0021 ref|XP_796436.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001187269.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_796436.2 2e-64 41% ...

  13. NCBI nr-aa BLAST: CBRC-OANA-01-1048 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-1048 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 2e-28 40% ...

  14. NCBI nr-aa BLAST: CBRC-OLAT-01-0021 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OLAT-01-0021 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 8e-65 44% ...

  15. NCBI nr-aa BLAST: CBRC-XTRO-01-3296 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-3296 ref|XP_787857.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001191368.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_787857.2 3e-10 41% ...

  16. NCBI nr-aa BLAST: CBRC-OANA-01-2231 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-2231 ref|XP_796436.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001187269.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_796436.2 5e-19 43% ...

  17. NCBI nr-aa BLAST: CBRC-OANA-01-1934 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-1934 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 8e-29 37% ...

  18. NCBI nr-aa BLAST: CBRC-OANA-01-1148 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-1148 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 1e-38 41% ...

  19. Het lamarckisme van J.A. Bierens de Haan (1883-1958)

    OpenAIRE

    R. Röell

    1989-01-01

    J.A. Bierens de Haan's Lamarckism

    Peter Bowler has shown that at the turn of the century neo-Lamarckism flourished in western Europe and the United States. With regard to neo-Lamarckism in the Netherlands little is known. The aim of this article is to examine the thoughts of the most outspoken Dutch neo-Lamarckist, the animal psychologist J.A. Bierens de Haan. I argue that his thoughts on the subject are somewhat superficial and only vaguely expres...

  20. Radular marks produced by grazing gastropods of the rocky intertidal

    Directory of Open Access Journals (Sweden)

    Yván Reyes

    2014-06-01

    Full Text Available We had used artificial surfaces to examine the radular marks of four common grazing gastropods from Ancon Bay. In this work we show radular marks on dental wax surface of the trochid Tegula atra (Lesson, 1830, the fissurellid Fissurella peruviana Lamarck, 1822, the lottid Lottia ceciliana (Orbigny, 1841 and the littorinid Nodilittorina peruviana (Lamarck, 1822. In addition, the radular type is described to each species to relate it to the produced mark.

  1. Dicty_cDB: Contig-U15067-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available apiens chromosome 13q34 schizophrenia regio... 36 1.7 9 ( AC177006 ) Strongylocentrotus purpuratus clone R3-...andidatus Carsonella ruddii PV DNA, complete gen... 34 1.1 10 ( AE014303 ) Homo s

  2. Dicty_cDB: Contig-U01139-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 179314 ) Strongylocentrotus purpuratus clone R3-1102P16, W... 32 6.6 5 ( FG289388 ) 1108793297216 New World ...Screwworm Egg 9261 ESTs C... 38 6.9 2 ( FG286433 ) 1108770714983 New World Screww

  3. Dicty_cDB: SHK759 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available hl*lqlvmy qvqlqlq*llqfnqllmnlqvviiimitviqqllqqlqllqq*mieikqprqfkrhgkii vvsnnlkkklklknylkilvncylimkeihlkiikh*ilksmmmkiminhktitim... Shewanella sp. W3-18-1, complet... 38 0.71 AB110082_1( AB110082 |pid:none) Bacillus ehim...1_A04_T7A Strongylocentrotus purpuratus, purple sea urchin , sperm genomic BAC library Strongylocentrotus purpuratus genomi...c 40.0 %: nuclear 4.0 %: cytoskeletal 4.0 %: Golgi 4.0 %: mitochondri...ATGAAGAAGATCAAATCGAAAATTAAATATATAAAAAATTTTAAATAAAAATAAAAA TAAAGAAATAATAAAAAAAATATTATTTTTTTA sequence update

  4. Spatial distribution pattern of egg masses of the golden apple snail, Pomacea canaliculata Lamarck, and a sampling plan for their detection invaded in subtropical transplanted rice fields%入侵移栽稻田的福寿螺卵块空间分布型及其抽样技术

    Institute of Scientific and Technical Information of China (English)

    符明龙; 谢淑玲; 祝增荣; 陈辉珍; 王华弟

    2008-01-01

    福寿螺Pomacea canaliculata Lamarck是重要外来入侵有害生物,严重危害水稻苗期至分蘖期的秧苗植株.为明确福寿螺在水稻田的空间分布,以1、4丛水稻为取样单位(样方)调查了14块移栽稻、每块田300个样方的福寿螺卵块密度,并利用聚集度指标法、Taylor幂法则和Iwao的M-m回归法进行分析.结果表明,移栽稻田中的福寿螺卵块主要呈聚集分布,部分田块呈随机或均匀分布.根据福寿螺卵块的分布型,通过计算抽样时间和抽样准确率的关系、不同样方和误差条件下的理论抽样数,确定以准确估计田间卵块密度为目标的最佳抽样方法,以横(行)向平行线跳跃法间隔30~45行调查1行,共调查6行90个4丛水稻样方,即两人以常规速度按上述方法取样18min以上,可达85%以上的取样准确率.

  5. Molecular characteristics and expression analysis of ScHsc70 cDNA in agamaki clam (Sinonovacula constricta)%缢蛏ScHsc70cDNA的分子特性和表达分析

    Institute of Scientific and Technical Information of China (English)

    冯冰冰; 牛东红; 钟玉民; 陈慧; 林国文; 李家乐

    2012-01-01

    Heat shock proteins consist of several families of highly conserved proteins that play an essential role in a number of cellular processes. Among the 70 kD family of heat shock proteins, heat shock cognate protein 70 kD (Hsc70) and inducible heat shock protein 70 kD (Hsp70) have been extensively studied in vertebrates and invertebrates. Several cDNAs encoding HSP70 have been described in molluscs, including the oyster (Crassostrea gigas), bay scallop (Argopecten irradians), Zhikong scallop (Chlamys farreri), mussel (Mytilus galloprovincialis), and Asiatic hard clam (Meretrix meretrix). Recent studies examining HSP70 expression in different species of mollusc have recognized the physiological and ecological importance of heat-shock gene expression in response to changing environments. We isolated an EST sequence with high homology with heat shock protein 70 gene from the cDNA library of Sinonovacula constricta. Then, the complete express sequence of this gene was obtained using PCR and 5'RACE. The cDNA of this gene was 2 335 bp, and consisted of a 76 bp 5' untranslated region (UTR), a 1 950 bp open reading frame (ORF) and a 309 bp 3' UTR. The translated protein consisted of 649 amino acids (70.89 kD)and its calculated isoelectric point was 5.28. Sequence analysis of the protein revealed that this gene contained three signature sequences of the heat shock protein 70 family (HSP70 family), two glycosylation sites and one ATP-GTP binding site. Four terapeptides of GGXP and a cytoplasm characteristic motif of EEVD were detected in the carboxyl terminal region of the deduced amino acid sequence. This HSP70 is a member of the HSC70 (constitutive genes) subfamily in the HSP70 family, and is designated as ScHsc70. Phylogenetic analysis suggested that the protein was most similar to those of 5. Constricta, Laternula elliptica, and M. Meretrix. Quantitative reverse transcriptase (qRT-PCR) analyses revealed that ScHsc70 mRNA was expressed constitutively in all the tissues

  6. Macrocyclis peruvianus (Gastropoda, Acavidae, an endemic land snail from Chile Macrocyclis peruvianus (Gastropoda, Acavidae, um caracol terrestre endêmico do Chile

    Directory of Open Access Journals (Sweden)

    Leticia F. da Silva

    2009-06-01

    Full Text Available Macrocyclis peruvianus (Lamarck, 1822 is a large terrestrial snail which is endemic in Chile. A detailed description of its shell structure, jaw, radula, palial cavity and reproductive system is presented here for the first time.Macrocyclis peruvianus (Lamarck, 1822 é um grande caracol terrestre endêmico do Chile. Uma descrição detalhada da esculturação de sua concha, rádula, mandíbula, cavidade palial e sistema reprodutor são apresentados aqui pela primeira vez.

  7. ERGO

    DEFF Research Database (Denmark)

    Jensen, Hans Siggaard; Engelhardt, Robin

    trækker blandt andet linjerne fra den antikke geometri til den moderne abstrakte matematik, fra Lamarcks spæde udviklingstanker til Darwins evolutionsteori og fra Babbages differensmaskine til den moderne computer - og videre igen til muligheden for kvantecomputere i fremtiden. ERGO går bag om de...

  8. Life history parameters of the biocontrol agent Gratiana spadicea (Chrysomelidae), reared on the natural host plant Solanum sisymbriifolium and the non-target crop Solanum melongena (Solanaceae)

    Science.gov (United States)

    Gratiana spadicea (Klug), a leaf-feeding tortoise beetle native to South America, was released in South Africa for the biological control of Solanum sisymbriifolium Lamarck (wild tomato), despite its ability to develop on cultivated eggplant (Solanum melongena L.) during laboratory host-specificity ...

  9. Dicty_cDB: Contig-U11022-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 35 5 ( EH079886 ) PMECF85TO Perkinsus marinus large insert cDNA lib... 42 0.048 2 ( ET095291 ) QM0AAA22BH01FM1 CCL1...gylocentrotus purpuratus clone R3-3085L11, W... 40 0.14 2 ( AC180454 ) Strongylocentrotus purpuratus clone R...022-1Q) /CSM_Contig/Contig-U11022-1Q.Seq.d CAAATACACTCAGACAGGGTTGCAAATGCGTTGAATTGGACGTTTGGGAT GGTAATGATGGTGATCC...DNA sequence from clone CH211-51L17 in ... 52 0.060 1 ( BX324154 ) Zebrafish DNA ... SP_1031_A2_E05_SP6E Strongylocentrotus purpuratus... 42 0.075 2 ( EL354039 ) CCEM10702.b4_L12.ab1 CC

  10. NCBI nr-aa BLAST: CBRC-DDIS-04-0127 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DDIS-04-0127 ref|XP_786416.2| PREDICTED: similar to Xotch protein - African clawed frog ... [St ... EDICTED: similar to Xotch protein - African clawed frog ... [Strongylocentrotus purpuratus] XP_786416.2 1e-22 ...

  11. NCBI nr-aa BLAST: CBRC-DSIM-08-0061 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DSIM-08-0061 ref|XP_786416.2| PREDICTED: similar to Xotch protein - African clawed frog ... [St ... EDICTED: similar to Xotch protein - African clawed frog ... [Strongylocentrotus purpuratus] XP_786416.2 4e-42 ...

  12. NCBI nr-aa BLAST: CBRC-PHAM-01-1530 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-1530 ref|NP_999775.1| spicule matrix protein SM50 precursor [Strongylo...centrotus purpuratus] sp|P11994|SM50_STRPU RecName: Full=50 kDa spicule matrix protein; Flags: Precursor gb|AAA30071.1| spic

  13. Dicty_cDB: Contig-U13236-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .3 4 ( AC173720 ) Strongylocentrotus purpuratus clone R3-1008M14, W... 38 2.4 5 ( AY858561 ) Hermeuptychia hermes...6 2.6 2 ( AY858562 ) Hermeuptychia hermes isolate CTBEH144 cytochrome ... 36 2.7 2 ( CU442744 ) Pig DNA sequ...ence *** SEQUENCING IN PROGRESS *** f... 40 2.7 2 ( AY858563 ) Hermeuptychia hermes

  14. Estrategias reproductivas de moluscos bivalvos y equinoideos

    OpenAIRE

    Calvo, J.; Morriconi, E.; Orler, P.

    1998-01-01

    The theoretical aspects of reproductive strategies and life histories are analyzed. The gonadal structures and the main features of gametogenesis of bivalves and echinoids are described. Research on the reproductive characteristics and gametogenic cycles of the bivalve molluscs in the Argentinian littoral and the echinoid Loxechinus albus is reviewed. Special references to Mytilus edulis, Aulacomya ater, Brachidontes purpuratus, Aequipecten tehuelchus, Zygochlamys patagonica, Ostrea puelchana...

  15. Dicty_cDB: Contig-U01942-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available W... 46 0.75 1 ( AC179610 ) Strongylocentrotus purpuratus clone R3-1028M04, W... 46 0.75 1 ( FG646102 ) CSRLCD001_05-G10-pAL17d Heal...thy leaf tissue Solan... 46 0.75 1 ( BM579253 ) 17000687237959 A.Gam.ad.cDNA.blood1

  16. Dicty_cDB: Contig-U05840-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lone R3-12G8, WORK... 52 0.017 1 ( AC180970 ) Strongylocentrotus purpuratus clone R3-3059B02, W... 52 0.017 1 ( AC139728 ) Carol...lia perspicillata clone 29G20, complete sequ... 48 0.27 1 ( AC150467 ) Carol

  17. Dicty_cDB: Contig-U05052-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nom... 34 2.7 3 ( AC149914 ) Strongylocentrotus purpuratus clone R3-12I13, WOR... 36 2.8 9 ( AC146769 ) Carol... HindIII BAC Library Solanum lycoper... 36 5.9 3 ( AC146829 ) Carollia perspicillata clone 9I15, WORKING DRA

  18. Dicty_cDB: Contig-U15705-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ... 32 5.8 2 ( AC180698 ) Strongylocentrotus purpuratus clone R3-3087F16, W... 38 5.9 7 ( CB939163 ) IpCGJ...x13_43_E10_23 IpCGJx13 Ictalurus punctatus c... 38 5.9 2 ( EJ010891 ) 1095403698687

  19. Proteome-wide dataset supporting the study of ancient metazoan macromolecular complexes

    OpenAIRE

    Sadhna Phanse; Cuihong Wan; Blake Borgeson; Fan Tu; Kevin Drew; Greg Clark; Xuejian Xiong; Olga Kagan; Julian Kwan; Alexandr Bezginov; Kyle Chessman; Swati Pal; Graham Cromar; Ophelia Papoulas; Zuyao Ni

    2015-01-01

    Our analysis examines the conservation of multiprotein complexes among metazoa through use of high resolution biochemical fractionation and precision mass spectrometry applied to soluble cell extracts from 5 representative model organisms Caenorhabditis elegans, Drosophila melanogaster, Mus musculus, Strongylocentrotus purpuratus, and Homo sapiens. The interaction network obtained from the data was validated globally in 4 distant species (Xenopus laevis, Nematostella vectensis, Dictyostelium ...

  20. The status of the name Alysium holtingii C. Agardh, a red alga described from Brazil, and a depiction of the type specimen

    Directory of Open Access Journals (Sweden)

    Michael J. Wynne

    2008-06-01

    Full Text Available The type specimen of the red alga Alysium holtingii C. Agardh, described from Brazil, is located in the Lund Herbarium, and it is depicted for the first time in a publication. It is taxonomically identical to Dichotomaria obtusata (J. Ellis and Solander Lamarck and thus can be treated as a later taxonomic synonym. Alysium is regarded as congeneric with Dichotomaria.O espécime tipo da alga vermelha Alysium holtingii C. Agardh, descrito para o Brasil, está localizado no Herbário Lund, e é aqui apresentado. Ele é taxonomicamente idêntico a Dichotomaria obtusata (J. Ellis e Solander Lamarck e portanto deve ser tratado como um sinônimo taxonômico posterior. Alysium é considerado como congenérico com Dichotomaria.

  1. Grammatical Evolution Guided by Reinforcement

    OpenAIRE

    Mingo, Jack Mario; Aler, Ricardo

    2007-01-01

    Grammatical evolution is an evolutionary algorithm able to develop, starting from a grammar, programs in any language. Starting from the point that individual learning can improve evolution, in this paper it is proposed an extension of Grammatical evolution that looks at learning by reinforcement as a learning method for individuals. This way, it is possible to incorporate the Baldwinian mechanism to the evolutionary process. The effect is widened with the introduction of the Lamarck hypothes...

  2. Oyster culture in European countries

    OpenAIRE

    Heral, Maurice; Deslous-paoli, Jean-marc

    1991-01-01

    Three species of oysters have been or are cultivated in Europe: Crassostrea angulata, C. gigas, and Ostrea edulis. If we follow the taxonomic critera of Grassé, the European oysters belong to the group of Mollusca, class of Lamellibranchia or Bivalves, order of Filibranchia, family Ostreidae with two genera: C. angulata (Lamarck), Portuguese, cupped oyster; C. gigas, (Thunberg), Japanese or Pacific, cupped oyster; Ostrea edulis (Linné), fiat European oyster. Some authors think that C. gi...

  3. Consequences of Physical Disturbance by Tadpoles and Snails on Chironomid Larvae

    OpenAIRE

    Gargi Pal; Gautam Aditya; Niladri Hazra

    2014-01-01

    Indirect interactions among community members impact on organisms. The effects of two snails, banded pond snail, Bellamya bengalensis (Lamarck), and Red-rimmed melania, Melanoides tuberculata (Müller), and tadpoles of Asian common toad, Duttaphrynus melanostictus (Schneider), on nonbiting midge larvae, Chironomus striatipennis Kieffer, were observed in experimental microcosm. Decrease in tube number and tube length of midge larvae was observed compared to control condition due to introduction...

  4. Nuevos registros de gasterópodos para el mar tropical del Perú

    Directory of Open Access Journals (Sweden)

    Carlos Paredes

    2008-12-01

    Full Text Available Cinco especies de gasterópodos: Northia pristis (Deshayes in Lamarck, 1844, Macron aethiops (Reeve, 1847, Latirus concentricus (Reeve, 1847, Terebra elata, Hinds, 1844 y Carinodrilla adonis Pilsbry & Lowe, 1932, se reportan por primera vez para aguas tropicales del mar peruano. Se da información sobre la distribución, el hábitat y comentarios relevantes sobre cada una de las especies.

  5. Simultaneous Determination of Crypto-Chlorogenic Acid, Isoquercetin, and Astragalin Contents in Moringa oleifera Leaf Extracts by TLC-Densitometric Method

    OpenAIRE

    Boonyadist Vongsak; Pongtip Sithisarn; Wandee Gritsanapan

    2013-01-01

    Moringa oleifera Lamarck (Moringaceae) is used as a multipurpose medicinal plant for the treatment of various diseases. Isoquercetin, astragalin, and crypto-chlorogenic acid have been previously found to be major active components in the leaves of this plant. In this study, a thin-layer-chromatography (TLC-)densitometric method was developed and validated for simultaneous quantification of these major components in the 70% ethanolic extracts of M. oleifera leaves collected from 12 locations. ...

  6. Eugenics and Social Security in France before and after the Vichy Regime

    OpenAIRE

    Rosental, Paul-André

    2012-01-01

    Historiography of French eugenics has long been hindered by a mechanistic conception derived from history of ideas, which postulated that it was incompatible with pronatalism and catholicism, with republicanism and Lamarckism; and that it simply collapsed after World War II. The reference to the transnational model of «Latin eugenics» redirects the thinking around a more plastic definition of eugenics that stresses its connections with social hygiene, in order to better understand the convers...

  7. Bacteria are not Lamarckian

    OpenAIRE

    Danchin, Antoine

    2007-01-01

    Instructive influence of environment on heredity has been a debated topic for centuries. Darwin's identification of natural selection coupled to chance variation as the driving force for evolution, against a formal interpretation proposed by Lamarck, convinced most scientists that environment does not specifically instruct evolution in an oriented direction. This is true for multicellular organisms. In contrast, bacteria were long thought of as prone to receive oriented influences from their ...

  8. Trace element kinetics in caged Mytilus galloprovincialis

    OpenAIRE

    Richir, Jonathan; Lepoint, Gilles; Donnay, Annick; Gobert, Sylvie

    2014-01-01

    Trace elements (TEs) remain contaminants of concern because of their persistence, ability to concentrate in organisms and toxicity. The Mediterranean mussel Mytilus galloprovincialis Lamarck, 1819 is a relevant bioindicator of TE coastal contamination. However, little research has studied the combined influence of environmental condition changes and physiological processes on their kinetics in that species. Caged M. galloprovincialis were thus immerged in 2 contrasted pristine Corsican (Franc...

  9. La Familia Calyptraeidae en el Perú (Gastropoda: Caenogastropoda)

    OpenAIRE

    Carlos Paredes; Franz Cardoso

    2013-01-01

    En el presente trabajo se realiza una revisión taxonómica de la familia Calyptraeidae Lamarck, 1809, en la costa Peruana. Se confirma la presencia de 17 especies de las 19 reportadas por diversos autores. Crepidula arenata (Broderip, 1834) es sinónimo de C. excavata (Broderip, 1834). Se da información sobre la distribución geográfica y algunas relaciones ecológicas.

  10. The contribution of cytogenetics and flow cytometry for understanding the karyotype evolution in three Dorstenia (Linnaeus, 1753) species (Moraceae)

    OpenAIRE

    Amaral-Silva, Paulo Marcos; Clarindo, Wellington Ronildo; Carrijo, Tatiana Tavares; Carvalho, Carlos Roberto; Praça-Fontes, Milene Miranda

    2016-01-01

    Abstract Chromosome morphometry and nuclear DNA content are useful data for cytotaxonomy and for understanding the evolutionary history of different taxa. However, the chromosome number is the only karyotype aspect reported for the species of Dorstenia so far. In this study, the nuclear genome size of Dorstenia arifolia (Lamarck, 1786), Dorstenia bonijesu (Carauta & C. Valente, 1983) and Dorstenia elata (Hooker, 1840) was evaluated and their karyotype morphometry accomplished, with the aim of...

  11. Biological control of golden apple snail, Pomacea canaliculata by Chinese soft-shelled turtle, Pelodiscus sinensis in the wild rice, Zizania latifolia field

    OpenAIRE

    Shengzhang Dong; Guowan Zheng; Xiaoping Yu; Changhuan Fu

    2012-01-01

    The wild rice, Zizania latifolia Turcz, used to be one of the important aquatic vegetables cultivated in China. Recently, the golden apple snail - GAS (Pomacea canaliculata (Lamarck)) was found to be a major invasive pest attacking Z. latifolia. To control efficiently GAS, predation by the Chinese soft-shelled turtles (Pelodiscus sinensis) on GAS was evaluated in laboratory and field trials. P. sinensis had a strong predatory capacity and selectivity for GAS both in laboratory and field condi...

  12. Development of an Intelligent Robot for an Agricultural Production Ecosystem : New Concept of Robot and Dynamics of a Golden Apple Snail in Paddy

    OpenAIRE

    Luna Maldonado, Alejandro Isabel; Nakaji, Kei

    2008-01-01

    A new concept of an intelligent robot for agriculture was discussed from the viewpoint of agricultural production ecosystem. In the case of the paddy field in temperate and subtropical zones, a mollusk named golden apple snail (Pomacea canaliculata (Lamarck)) often causes serious damage to the rice plant seedlings, however, the snail is very useful in the control of weeds that cause also detriment of the production of rice, especially in organic agriculture. After the golden apple snails in...

  13. Inventario de la fauna asociada a hidrozoos en la ría de Ferrol (NO península Ibérica)

    OpenAIRE

    Varela, C.; Moreira, J.; Urgorri Carrasco, Victoriano, 1951-

    2009-01-01

    Los hidrozoos (Cnidaria: Hydrozoa) constituyen un sustrato de asentamiento para numerosas especies de organismos marinos. El estudio de cinco especies de hidrozoos coloniales (Sertularella polyzonias (Linneo, 1758), Nemertesia antennina (Linneo, 1758), N. ramosa Lamarck, 1816, Kirchenpaueria pinnata (Linneo, 1758), Aglaophenia pluma (Linneo, 1758)) en la Punta da Redonda (ría de Ferrol, NO península Ibérica) ha revelado que dichas especies albergan una fauna asociada muy diversa. ...

  14. Dicty_cDB: Contig-U09442-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available uct DNA, clone: pF... 39 0.13 DQ120651_1( DQ120651 |pid:none) Pan troglodytes RBM1 gene, partia...nomi... 37 0.51 AB325927_1( AB325927 |pid:none) Sorogena stoianovitchae stf4 mRNA ... 37 0.51 AP008210_766( ... Entamoeba histolytica small heat shock protein (H... 40 0.23 2 ( AC177962 ) Strongylocentrotus purpuratus c...lone R3-3049H23, W... 48 0.42 1 ( AC177453 ) Strongylocentrotus purpuratus clone R3-1030K24, W... 48 0.42 1 ...m clone CH211-67N10 in ... 46 1.7 1 ( AC149872 ) Xenopus tropical

  15. Karyotypes of three species of the marine Veneroida molluscs

    Institute of Scientific and Technical Information of China (English)

    Sun Zhenxing; Shao Yanqun; Guo Shengchao; Qin Yan; Yang Aiguo

    2003-01-01

    The karyotypes of three species of marine Veneroida molluscs, Solen grandis Dunker,Saxidomus purpuratus Sowerby and Mactra chinensis Philippi were studied by using the adult gill tissues. The chromosomes were prepared through injecting phytohemagglutinin (PHA) and colchicine, hypotonic treatment, chopping air-dry, and squashing technology. The results show that the diploid chromosome numbers of the three Veneroida species are the same as 2 n = 38. The karyotype of Solen grandis is 26m + 6sm + 2st + 4t, NF = 70, the karyotype of Saxidomus purpuratus is 32m + 2sm + 4st/t, NF = 72, and the karyotype of Mactra chinensis is 20m + 16sm + 2st/t, NF = 74. Satellite and sex chromosome were not found among the chromosomes of three species.

  16. Dicty_cDB: SHF413 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nnesssqgsnnessnnesnnqnsnnesshkeesesnshqss eteskdqvsnsgsmnqssessessslseqssafessssss...kdqvsnsgsmnqssessessslseqssafessssssgnsqsksse Frame B: lyylnnymyifvfk**kiifl*fffnikr...k*iivfirtklcf*ifviiew*fsikik*k Homology vs CSM-cDNA Score E Sequences producing s...ology vs DNA Score E Sequences producing significant alignments: (bits) Value N A... SEQUENCE, 40 unordered pieces. 32 0.010 3 AC180650 |AC180650.1 Strongylocentrotus purpuratus clone R3-3090E

  17. Cis-regulatory control of the nodal gene, initiator of the sea urchin oral ectoderm gene network

    OpenAIRE

    Nam, Jongmin; Su, Yi-Hsien; Lee, Pei Yun; Robertson, Anthony J; Coffman, James A.; Davidson, Eric H.

    2007-01-01

    Expression of the nodal gene initiates the gene regulatory network which establishes the transcriptional specification of the oral ectoderm in the sea urchin embryo. This gene encodes a TGFβ ligand, and in Strongylocentrotus purpuratus its transcription is activated in the presumptive oral ectoderm at about the 30-cell stage. Thereafter Nodal signaling occurs among all cells of the oral ectoderm territory, and nodal expression is required for expression of oral ectoderm regulatory genes. The ...

  18. Reconstructing SALMFamide neuropeptide precursor evolution in the phylum Echinodermata: ophiuroid and crinoid sequence data provide new insights

    OpenAIRE

    Elphick, Maurice R; Semmens, Dean C.; Blowes, Liisa M.; Judith eLevine; Lowe, Christopher J.; Maria Ina Arnone; Clark, Melody S.

    2015-01-01

    The SALMFamides are a family of neuropeptides that act as muscle relaxants in echinoderms. Analysis of genome/transcriptome sequence data from the sea urchin Strongylocentrotus purpuratus (Echinoidea), the sea cucumber Apostichopus japonicus (Holothuroidea) and the starfish Patiria miniata (Asteroidea) reveals that in each species there are two types of SALMFamide precursor: an L-type precursor comprising peptides with a C-terminal LxFamide-type motif and an F-type precursor solely or largely...

  19. Reconstructing SALMFamide Neuropeptide Precursor Evolution in the Phylum Echinodermata: Ophiuroid and Crinoid Sequence Data Provide New Insights

    OpenAIRE

    Elphick, Maurice R; Semmens, Dean C.; Blowes, Liisa M.; Levine, Judith; Lowe, Christopher J.; Arnone, Maria I.; Clark, Melody S.

    2015-01-01

    The SALMFamides are a family of neuropeptides that act as muscle relaxants in echinoderms. Analysis of genome/transcriptome sequence data from the sea urchin Strongylocentrotus purpuratus (Echinoidea), the sea cucumber Apostichopus japonicus (Holothuroidea), and the starfish Patiria miniata (Asteroidea) reveals that in each species there are two types of SALMFamide precursor: an L-type precursor comprising peptides with a C-terminal LxFamide-type motif and an F-type precursor solely or largel...

  20. Dynamic Evolution of Toll-Like Receptor Multigene Families in Echinoderms

    OpenAIRE

    Buckley, Katherine M; Rast, Jonathan P.

    2012-01-01

    The genome sequence of the purple sea urchin, Strongylocentrotus purpuratus, a large and long-lived invertebrate, provides a new perspective on animal immunity. Analysis of this genome uncovered a highly complex immune system in which the gene families that encode homologs of the pattern recognition receptors that form the core of vertebrate innate immunity are encoded in large multigene families. The sea urchin genome contains 253 Toll-like receptor (TLR) sequences, more than 200 Nod-like re...

  1. RNA Deep Sequencing Reveals Differential MicroRNA Expression during Development of Sea Urchin and Sea Star

    OpenAIRE

    Kadri, Sabah; Hinman, Veronica F.; Benos, Panayiotis V.

    2011-01-01

    microRNAs (miRNAs) are small (20–23 nt), non-coding single stranded RNA molecules that act as post-transcriptional regulators of mRNA gene expression. They have been implicated in regulation of developmental processes in diverse organisms. The echinoderms, Strongylocentrotus purpuratus (sea urchin) and Patiria miniata (sea star) are excellent model organisms for studying development with well-characterized transcriptional networks. However, to date, nothing is known about the role of miRNAs d...

  2. Lectins with Potential for Anti-Cancer Therapy

    OpenAIRE

    Tammy Yau; Xiuli Dan; Charlene Cheuk Wing Ng; Tzi Bun Ng

    2015-01-01

    This article reviews lectins of animal and plant origin that induce apoptosis and autophagy of cancer cells and hence possess the potential of being developed into anticancer drugs. Apoptosis-inducing lectins encompass galectins, C-type lectins, annexins, Haliotis discus discus lectin, Polygonatum odoratum lectin, mistletoe lectin, and concanavalin A, fucose-binding Dicentrarchus labrax lectin, and Strongylocentrotus purpuratus lectin, Polygonatum odoratum lectin, and mistletoe lectin, Polygo...

  3. Aislamiento de enterobacterias en algunos moluscos del mar peruano

    OpenAIRE

    Dora A. Taboada P.; Haydée Russac; Carolina Ramos de Ormachea

    2014-01-01

    En este trabajo se da a conocer el resultado de un estudio bacteriológico en 5 especies de moluscos que se utilizan en la alimentación humana, ellos fueron: Aulacomya ater, Gari sp., Mesodesma donacium, Aequipecten purpuratus y Thais chocolata, obtenidos de diversos centros de expendio del Callao y Lima. Se aisló Salmonella enteritidis serotipo Derby y Edwardsiella de Gari sp. Otras bacterias como Proteus, Citrobacter, Enterobacter y Serratia estuvieron presentes en los diversos molusco...

  4. Proteome Sci.

    OpenAIRE

    Mann Matthias; Poustka Albert J; Mann Karlheinz

    2010-01-01

    Abstract Background Sea urchin is a major model organism for developmental biology and biomineralization research. However, identification of proteins involved in larval skeleton formation and mineralization processes in the embryo and adult, and the molecular characterization of such proteins, has just gained momentum with the sequencing of the Strongylocentrotus purpuratus genome and the introduction of high-throughput proteomics into the field. Results The present report contains the deter...

  5. A Genomic View of the Sea Urchin Nervous System

    OpenAIRE

    Burke, RD; Angerer, LM; Elphick, MR; Humphrey, GW; Yaguchi, S; Kiyama, T.; Liang, S.; Mu, X.; Agca, C; Klein, WH; Brandhorst, BP; Rowe, M.; Wilson, K.; Churcher, AM; Taylor, JS

    2006-01-01

    The sequencing of the Strongylocentrotus purpuratus genome provides a unique opportunity to investigate the function and evolution of neural genes. The neurobiology of sea urchins is of particular interest because they have a close phylogenetic relationship with chordates, yet a distinctive pentaradiate body plan and unusual neural organization. Orthologues of transcription factors that regulate neurogenesis in other animals have been identified and several are expressed in neurogenic domains...

  6. Organization of an echinoderm Hox gene cluster

    OpenAIRE

    Martinez, Pedro; Rast, Jonathan P.; Arenas-Mena, César; Davidson, Eric H.

    1999-01-01

    The Strongylocentrotus purpuratus genome contains a single ten-gene Hox complex >0.5 megabase in length. This complex was isolated on overlapping bacterial artificial chromosome and P1 artificial chromosome genomic recombinants by using probes for individual genes and by genomic walking. Echinoderm Hox genes of Paralog Groups (PG) 1 and 2 are reported. The cluster includes genes representing all paralog groups of vertebrate Hox clusters, except that there is a sing...

  7. Rapid accumulation of an interleukin 17 homolog transcript in Crassostrea gigas hemocytes following bacterial exposure

    OpenAIRE

    Roberts, S; Gueguen, Yannick; De Lorgeril, Julien; Goetz, F

    2008-01-01

    Interleukin-17 (IL-17) gene models have been found in the sequenced genomes of Strongylocentrotus purpuratus and Caenorhabditis elegans. However, there have been no published reports on the empirical cloning and characterization of any interleukin cDNAs in invertebrates. From a Pacific oyster (Crossostrea gigas) hemocyte cDNA library, two clones were obtained that encoded a protein similar to vertebrate IL-17s. The putative oyster IL-17 homolog (CgIL-17) was 27% identical to rainbow trout IL-...

  8. Innate immune complexity in the purple sea urchin: diversity of the Sp185/333 system

    OpenAIRE

    L Courtney Smith

    2012-01-01

    The California purple sea urchin, Strongylocentrotus purpuratus, is a long-lived echinoderm with a complex and sophisticated innate immune system. Several large gene families that function in immunity in this species includes the Sp185/333 gene family with ~50 (±10) members. The family shows intriguing sequence diversity and encodes a broad array of diverse yet similar proteins. The genes have two exons of which the second encodes the mature protein and has repeats and blocks of sequence...

  9. Dicty_cDB: Contig-U05011-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4 1.0 3 ( FG289817 ) 1108793307980 New World Screwworm Egg 9261 ESTs C... 38 1.3 3 ( AC176252 ) Strongylocen...trotus purpuratus clone R3-3060I22, W... 40 1.3 4 ( FG290522 ) 1108793323765 New World... Screwworm Egg 9261 ESTs C... 38 1.4 3 ( FG286635 ) 1108770723708 New World Screwworm Egg 9261 ESTs C..

  10. Lectins with Potential for Anti-Cancer Therapy

    Directory of Open Access Journals (Sweden)

    Tammy Yau

    2015-02-01

    Full Text Available This article reviews lectins of animal and plant origin that induce apoptosis and autophagy of cancer cells and hence possess the potential of being developed into anticancer drugs. Apoptosis-inducing lectins encompass galectins, C-type lectins, annexins, Haliotis discus discus lectin, Polygonatum odoratum lectin, mistletoe lectin, and concanavalin A, fucose-binding Dicentrarchus labrax lectin, and Strongylocentrotus purpuratus lectin, Polygonatum odoratum lectin, and mistletoe lectin, Polygonatum odoratum lectin, autophagy inducing lectins include annexins and Polygonatum odoratum lectin.

  11. Sea Urchin Recruitment: Effect of Substrate Selection on Juvenile Distribution

    OpenAIRE

    Cameron, R. A.; Schroeter, S. C.

    1980-01-01

    Intertidal field observations have shown that juvenile purple sea urchins Strongylocentwtus purpuratus are found in higher densities near adults . The same is true for subtidal populations of juvenile red sea urchins 5. franciscanus. These distribution patterns could be influenced by any of three elements: substrate selection, early juvenile mortality or juvenile migration. Using laboratory-reared larvae, we conducted experiments designed to gauge the effect of substrate selection on ju...

  12. Sea urchin vault structure, composition, and differential localization during development

    OpenAIRE

    Dickey-Sims Carrie; Lang Jennifer; Makabi Miriam; Stewart Phoebe L; Robertson Anthony J; Coffman James A; Suprenant Kathy A

    2005-01-01

    Abstract Background Vaults are intriguing ribonucleoprotein assemblies with an unknown function that are conserved among higher eukaryotes. The Pacific coast sea urchin, Strongylocentrotus purpuratus, is an invertebrate model organism that is evolutionarily closer to humans than Drosophila and C. elegans, neither of which possesses vaults. Here we compare the structures of sea urchin and mammalian vaults and analyze the subcellular distribution of vaults during sea urchin embryogenesis. Resul...

  13. La omnipresente selección natural

    OpenAIRE

    Galera, Andrés

    2010-01-01

    El concepto de selección natural da título y sirve de pretexto para reflexionar sobre el modelo de naturaleza representado por el principio biológico de evolución: desde Lamarck en adelante con parada en el giro darwiniano que mediado el siglo modela la idea en clave selectiva. La naturaleza está así sometida al azaroso principio de sobrevivir por competencia obligada (selección natural), definiendo la adaptación al medio como un proceso fortuito frente a la necesaria ...

  14. Evaluación de actividades dirigidas al estudio de la evolución en educación secundaria

    OpenAIRE

    García Barros, Susana; Tiburzi, M.; Martinez Losada, Cristina

    2009-01-01

    Se evalúan una selección de actividades, correspondientes a una propuesta didáctica dirigidas al estudio de la evolución en educación secundaria, que fueron realizadas por 35 alumnos. Se especifica el procedimiento de análisis de las producciones escritas de los alumnos. Éstos tuvieron más problemas para emplear las ideas de Lamarck que las de Darwin en determinadas situaciones (resistencia a insecticida, características físicas de prototipos animales). Sin embargo, les resultó mas sencillo u...

  15. El progreso biológico

    OpenAIRE

    Barahona, Ana; Ayala, Francisco J.

    1997-01-01

    Not available.La idea de progreso en Biología está ligada al concepto de scala naturae o la gran cadena del ser que se puede trazar hasta Aristóteles. Esta noción de que los organismos vivientes pueden clasificarse en una jerarquía de inferior a superior tomó formas nuevas en los siglos XVII y XVIII. En el siglo XVIII, naturalistas como Buffon, Bonnet y Robinet se habían preguntado si podíamos hablar de un patrón definido de desarrollo. En el siglo XIX, Lamarck postula la idea de que existe u...

  16. Relectura de las Disertaciones de Cavanilles

    Directory of Open Access Journals (Sweden)

    Valderas, José María

    1991-12-01

    Full Text Available A survey on the historic relevance and botanical importance today of the Dissertationes of A. J. Cavanilles is offered.

    Este trabajo, dedicado al examen interno de una obra capital de la botánica del siglo XVIII. que incorpora buena parte del método de las familias sin dejar de abrazar el método linneano, aborda los conceptos sistemáticos fundamentales de Cavanilles y coteja, en análisis textual comparativo, su perspicuidad descriptiva frente a Lamarck y A. L. de Jussieu.

  17. Reflexos da clarificação do caldo de cana com moringa sobre compostos inorgânicos do açúcar VHP

    OpenAIRE

    Gustavo H. G. Costa; Igor S. Masson; Lidyane A. de Freita; Juliana P. Roviero; Márcia J. R. Mutton

    2015-01-01

    Objetivou-se, neste trabalho, avaliar os reflexos da clarificação do caldo de cana utilizando extrato de folhas e sementes de moringa (Moringa oleifera Lamarck) como auxiliares de sedimentação sobre os teores dos compostos inorgânicos do caldo clarificado e do açúcar VHP (Very High Purity - Tipo Exportação) produzido. O delineamento experimental utilizado foi o fatorial 5 x 2 com quatro repetições; o primeiro fator correspondeu aos auxiliares de sedimentação: extrato de folhas e sementes de m...

  18. Isognomon bicolor (C.B. Adams (Bivalvia, Isognomonidae: primeiro registro para o Brasil, redescrição da espécie e considerações sobre a ocorrência e distribuição de Isognomon na costa brasileira Isognomon bicolor (C.B. Adams (Bivalvia, Isognomonidae: first record to the Brazilian littoral, redescription of the species and comments on the occurrence and distribution of Isognomon in the Brazilian coast

    Directory of Open Access Journals (Sweden)

    Osmar Domaneschi

    2002-06-01

    Full Text Available The bivalve family Isognomonidae is represented in the Western Atlantic by the living genera Crenatula Lamarck, 1804 and Isognomon Solander, 1786. I. alatus (Gmelin, 1791 and I. radiatus (Anton, 1839 are the only Isognomonidae referred to the Brazilian malacofauna. The present work refers to the first record and geographic distribution of I. bicolor along the Brazilian littoral, and presents a re-description of the species based on shell characters, which include those of the prodissoconch. The occurrence of I. alatus and I. radiatus along the Brazilian littoral could not be confirmed, despite the intensive search for these Isognomonidae from Rio Grande do Norte through Rio Grande do Sul.

  19. Transformisme et création littéraire chez Marcel Proust

    OpenAIRE

    Moret-Jankus, Pauline

    2014-01-01

    Although several studies have explored the role of science in Proust’s works, few have focused on the aesthetics of biology in À la recherche du temps perdu. This article looks at the influence of transformist theories (Darwinism or Lamarckism) in Proust’s novel. It shows that naturalists such as Cuvier or Geoffroy Saint-Hilaire, who did not support the theory of the transmutation of species, are missing from the novel. Furthermore, the article analyses the themes of metamorphosis and hybridi...

  20. Determination of radionuclides in Mytilus galloprovicialis by Alpha And Gamma-Spectroscopy

    Directory of Open Access Journals (Sweden)

    H. FLOROU

    2012-12-01

    Full Text Available The natural radionuclides 238U ,234Th, 40K and the main man-made 137Cs, have been studied in Mytilus galloprovincialis (Lamarck, 1819 sampled in the Thermaikos gulf – North Aegean Sea, considered as a bioindicator for radiological assessment in the Mediterranean. The ratio 234U/238U has also been determined. In terms of 137Cs, the activity concentrations in seawater from the studied area have been measured as well, and the concentration factors of 137Cs in Mytilus galloprovincialis are given as a parameter of the organism response to radioactive pollution.

  1. Trophic relationships between macroinvertebrates and fish in a pampean lowland stream (Argentina Relaciones tróficas entre los macroinvertebrados y peces en un arroyo de la llanura pampeana (Argentina

    Directory of Open Access Journals (Sweden)

    María V. López van Oosterom

    2013-03-01

    Full Text Available The diet and trophic relationships between the macroinvertebrates Phyllogomphoides joaquini Rodrigues Capítulo, 1992 and Coenagrionidae (Odonata, Chironomidae (Diptera, Diplodon delodontus (Lamarck, 1919 (Bivalvia: Hyriidae, and Pomacea canaliculata (Lamarck, 1822 (Gastropoda: Ampulariidae and the fishes Pimelodella laticeps Eigenmann, 1917 (Heptapteridae and Bryconamericus iheringii (Boulenger, 1887 (Characidae in a temperate lowland lotic system in Argentina were assessed on the basis of gut contents and stable-isotope analyses. The feeding strategies were analyzed by the AMUNDSEN method. Relative food items contribution for the taxa studied indicated a generalist-type trophic strategy. In macroinvertebrates, in general, the values of stable isotope confirmed the result of the analysis of gut contents. With the fish, stable-isotope analysis demonstrated that both species are predators, although B. iheringii exhibited a more omnivorous behaviour. These feeding studies allowed us to determine the trophic relationships among taxa studied. Detritus and diatoms were a principal source of food for all the macroinvertebrates studied. In La Choza stream the particulate organic matter is a major no limited food resource, has a significant influence upon the community.Se evaluó la dieta y las relaciones tróficas entre los macroinvertebrados Phyllogomphoides joaquini Rodrigues Capítulo, 1992 y Coenagrionidae (Odonata, Chironomidae (Diptera, Diplodon delodontus (Lamarck, 1919 (Bivalvia: Hyriidae, Pomacea canaliculata (Lamarck, 1822 (Gastropoda: Ampulariidae y los peces Pimelodella laticeps Eigenmann, 1917 (Heptapteridae y Bryconamericus iheringii (Boulenger, 1887 (Characidae en un ecosistema lótico pampásico, sobre la base del contenido estomacal y el análisis de isótopos estables. La estrategia alimentaria fue analizada mediante el método de AMUNDSEN. La contribución relativa de cada categoría alimenticia para los taxa estudiados indicó que

  2. Evolution by Process, Not by Consequence: Implications of the New Molecular Genetics on Development and Evolution

    OpenAIRE

    Ho, Mae-Wan

    1987-01-01

    There is much in common between comparative psychologyand biological tradition that includes such distinguished figures as poetscientist Goethe, evolutionist Lamarck, embryologist Driesch; andcloser to our time, D'Arcy Thompson, Alfi-ed North Whitehead, JosephNeedham, Richard Goldschmidt and Conrad Waddington. This traditionhas been variously referred to as organized, holist, neovitalist, and soon, though none of the labels are completely accurate. Its chiefconcernis the study of living organ...

  3. Descripción del desarrollo gonadal de Mesodesma Donacium (bivalvia: Mesodesmatidae), durante el periodo 2006 - 2014, en el litoral de Tacna

    OpenAIRE

    Gálvez Escudero, Marie Anne

    2015-01-01

    Mesodesma donacium (Lamarck, 1818), ha disminuido su abundancia durante los últimos 30 años, debido a los eventos El Niño más recientes y a la sostenida extracción sin medidas de control, lo que generado repercusiones sobre los grupos de pescadores que se dedicaban únicamente a la extracción de este recurso. Para lograr una recuperación y administración sostenible de este recurso, se requiere actualizar conocimientos biológicos básicos en temas reproductivos como el desarrollo gonadal y su va...

  4. Role of Golden Apple Snail in Organic Rice Cultivation and Weed Management

    OpenAIRE

    R.C. Joshi; Martin, E. C.; Wada, T.; Sebastian, L. S.

    2005-01-01

    The Golden Apple Snail (GAS), Pomacea canaliculata (Lamarck), is a major pest of rice and other aquatic crops in many Asian farms. Farmers’ first line of defense is to use non-specific chemicals for “instant” kill of GAS, without considering its effect on their health, the environment, and non-target organisms. However, some organic rice farmers in Japan, Korea, and the Philippines do not kill GAS but manage them as bio-weeders in rice fields. We evaluated organic farmers’ innovation at the P...

  5. Studies in the genus Riccia (Marchantiales from southern Africa. 9. R. nigrella and the status of R. capensis

    Directory of Open Access Journals (Sweden)

    S. M. Perold

    1988-12-01

    Full Text Available R. nigrella DC. (Lamarck & De Candolle 1815, with which R. capensis auct. non Steph.: S. Amell (1952, 1963, is conspecific, is now also recognized from southern Africa. The thallus is brown marginally and dorsally and has shiny black scales with smooth margins at which coloured and hyaline cells alternate irregularly. Arnell's (1961 records of R. capensis Steph. from the Canary Islands are to be regarded as erroneous. R. capensis Steph. (Stephani in Brunnthaler 1913 is now placed in synonymy under R. limbata Bisch.

  6. Dicty_cDB: Contig-U10445-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 6 1e-66 AF526233_1( AF526233 |pid:none) Argopecten irradians isolate iolsa... 255 2e-66 ( P50880 ) RecName: Full=60S riboso...7 |pid:none) Mus musculus strain BALB/c ribosomal p... 155 2e-36 CP001400_1281( CP001400 |pid:none) Sulfolobus islandi...1(... 108 4e-22 CP001399_1368( CP001399 |pid:none) Sulfolobus islandicus L.S.2.15,... 107 6e-22 (Q3IMY8) RecName: Full=50S riboso...4 FN316316_1( FN316316 |pid:none) Schistosoma japonicum isolate Anhu... 248 4e-64 FN357411_20( FN357411 |pid:none) Schistosoma manso...382_30(A... 42 0.033 CP001277_1681( CP001277 |pid:none) Candidatus Hamiltonella defensa... 42 0.033 (Q47LJ3)

  7. Dicty_cDB: Contig-U06051-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 12 CP001400_1281( CP001400 |pid:none) Sulfolobus islandicus M.14.25, ... 75 2e-12 (B0R656) RecName: Full=50S riboso...mal protein L3P; &(Q9HPD4) Rec... 75 2e-12 CP001399_1368( CP001399 |pid:none) Sulfolobus islandicus L...22_1( EU752622 |pid:none) Populus tremula isolate swl21-002 ... 56 7e-07 AF526233_1( AF526233 |pid:none) Argopecten irradians isol...e-60 FN316317_1( FN316317 |pid:none) Schistosoma japonicum isolate Anhu... 233 4e-60 CR940347_663( CR940347 |pid:none) Theileria an...169 5e-41 DQ206525_1( DQ206525 |pid:none) Suberites fuscus isolate TOA20 rib... 157 3e-37 AM494969_341( AM494969 |pid:none) Leishman

  8. Dicty_cDB: Contig-U16269-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1( FN320319 |pid:none) Schistosoma japonicum isolate Anhu... 325 2e-87 CR380948_179( CR380948 |pid:none) Candi...F526207_1( AF526207 |pid:none) Argopecten irradians isolate iolsa... 212 2e-53 EU558306_1( EU558306 |pid:none) Novocrania an..._1282( CP001400 |pid:none) Sulfolobus islandicus M.14.25, ... 133 1e-29 (A6UV67) RecName: Full=50S ribosomal...mal protein L4P; &BA000011_329... 134 6e-30 CP001403_1389( CP001403 |pid:none) Sulfolobus islandicus Y.G...red marine group II euryar... 132 2e-29 CP001399_1369( CP001399 |pid:none) Sulfolobus islandicus L.S.2.15,..

  9. Dicty_cDB: Contig-U16272-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available muelleri putative 60S rib... 251 7e-71 AF526233_1( AF526233 |pid:none) Argopecten irradians isolate iols... &CP000477_169... 142 2e-40 CP001400_1281( CP001400 |pid:none) Sulfolobus islandicus M.14.25, ... 132 4e-40 ...CP001399_1368( CP001399 |pid:none) Sulfolobus islandicus L.S.2.15,... 130 1e-39 AK297711_1( AK297711 |pid:no...39... 42 0.046 FM992695_51( FM992695 |pid:none) Candida dubliniensis CD36 chromos... 42 0.046 (A1T4N9) RecName: Full=50S riboso...6 (B6EPS5) RecName: Full=50S ribosomal protein L3; &FM178379_320(... 42 0.046 CP001277_1681( CP001277 |pid:none) Candi

  10. Dicty_cDB: Contig-U06081-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available N320319_1( FN320319 |pid:none) Schistosoma japonicum isolate Anhu... 275 2e-72 CR380948_179( CR380948 |pid:none) Candi...AF526207 |pid:none) Argopecten irradians isolate iolsa... 212 2e-53 CP000080_113( CP000080 |pid:none) Leishman.... 104 6e-21 CP001399_1369( CP001399 |pid:none) Sulfolobus islandicus L.S.2.15,... 103 1e-20 (A7I5P0) RecName: Full=50S riboso...d:none) Staphylothermus marinus F1, com... 106 2e-21 CP001403_1389( CP001403 |pid:none) Sulfolobus islandicu...00_1282( CP001400 |pid:none) Sulfolobus islandicus M.14.25, ... 104 5e-21 EU68663

  11. Dicty_cDB: Contig-U15098-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available mal protein L32; AltName: Full=... 118 2e-32 AF526230_1( AF526230 |pid:none) Argopecten irradians isolate iols...mal protein L32e; &AP006878_15... 57 4e-07 CP001399_1385( CP001399 |pid:none) Sulfolobus islandi...9 6e-32 (Q8WRF3) RecName: Full=60S ribosomal protein L32; AltName: Full=... 119 6e-32 AB244986_1( AB244986 |pid:none) Polypedi...-21 FM992693_149( FM992693 |pid:none) Candida dubliniensis CD36 chromo... 96 6e-21 CR382125_297( CR382125 |p... |pid:none) Lutzomyia intermedia isolate IAFrp... 77 3e-13 AJ965641_1( AJ965641 |pid:none) Nyctotherus ovalis

  12. Dicty_cDB: Contig-U05942-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available APV-2005 mRNA for ri... 181 4e-44 AF526207_1( AF526207 |pid:none) Argopecten irradians isolate iols... (Q9UXA6) RecName: Full=50S ribosomal protein L4P; &AE006641_651... 85 5e-15 CP001403_1389( CP001403 |pid:none) Sulfolobus islandi...cus Y.G.57.14... 83 2e-14 CP001399_1369( CP001399 |pid:none) Sulfolobus islandi...cus L.S.2.15,... 82 3e-14 CP001400_1282( CP001400 |pid:none) Sulfolobus islandicus M.14....yzae RIB40 genomic... 175 4e-78 FM992688_1292( FM992688 |pid:none) Candida dubliniensis

  13. Dicty_cDB: Contig-U15146-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF526198_1( AF526198 |pid:none) Argopecten irradians isolate iolsa... 135 3e-31 DQ440259_1( DQ440259 |pid:no...P001399 |pid:none) Sulfolobus islandicus L.S.2.15,... 66 3e-10 CP001398_1924( CP001398 |pid:none) Thermococcus gammatoleran...53 ) Mus Musculus Strain C57BL6/J chromosome 3 BAC, RP... 48 0.25 1 ( EF134343 ) Oxyrrhis marina isol...ate Om-5p-21-2 ribosomal prot... 48 0.25 1 ( EF134342 ) Oxyrrhis marina isolate Om-5p-21-1 riboso.... 124 8e-28 EF134343_1( EF134343 |pid:none) Oxyrrhis marina isolate Om-5p-21-2... 124 8e-28 BT046434_1( BT04

  14. Trophic relationships between macroinvertebrates and fish in a pampean lowland stream (Argentina

    Directory of Open Access Journals (Sweden)

    María V. López van Oosterom

    2013-03-01

    Full Text Available The diet and trophic relationships between the macroinvertebrates Phyllogomphoides joaquini Rodrigues Capítulo, 1992 and Coenagrionidae (Odonata, Chironomidae (Diptera, Diplodon delodontus (Lamarck, 1919 (Bivalvia: Hyriidae, and Pomacea canaliculata (Lamarck, 1822 (Gastropoda: Ampulariidae and the fishes Pimelodella laticeps Eigenmann, 1917 (Heptapteridae and Bryconamericus iheringii (Boulenger, 1887 (Characidae in a temperate lowland lotic system in Argentina were assessed on the basis of gut contents and stable-isotope analyses. The feeding strategies were analyzed by the AMUNDSEN method. Relative food items contribution for the taxa studied indicated a generalist-type trophic strategy. In macroinvertebrates, in general, the values of stable isotope confirmed the result of the analysis of gut contents. With the fish, stable-isotope analysis demonstrated that both species are predators, although B. iheringii exhibited a more omnivorous behaviour. These feeding studies allowed us to determine the trophic relationships among taxa studied. Detritus and diatoms were a principal source of food for all the macroinvertebrates studied. In La Choza stream the particulate organic matter is a major no limited food resource, has a significant influence upon the community.

  15. Is Lamarckian evolution relevant to medicine?

    Directory of Open Access Journals (Sweden)

    Handel Adam E

    2010-05-01

    Full Text Available Abstract Background 200 years have now passed since Darwin was born and scientists around the world are celebrating this important anniversary of the birth of an evolutionary visionary. However, the theories of his colleague Lamarck are treated with considerably less acclaim. These theories centre on the tendency for complexity to increase in organisms over time and the direct transmission of phenotypic traits from parents to offspring. Discussion Lamarckian concepts, long thought of no relevance to modern evolutionary theory, are enjoying a quiet resurgence with the increasing complexity of epigenetic theories of inheritance. There is evidence that epigenetic alterations, including DNA methylation and histone modifications, are transmitted transgenerationally, thus providing a potential mechanism for environmental influences to be passed from parents to offspring: Lamarckian evolution. Furthermore, evidence is accumulating that epigenetics plays an important role in many common medical conditions. Summary Epigenetics allows the peaceful co-existence of Darwinian and Lamarckian evolution. Further efforts should be exerted on studying the mechanisms by which this occurs so that public health measures can be undertaken to reverse or prevent epigenetic changes important in disease susceptibility. Perhaps in 2059 we will be celebrating the anniversary of both Darwin and Lamarck.

  16. Scaling of feeding biomechanics in the horn shark Heterodontus francisci: ontogenetic constraints on durophagy.

    Science.gov (United States)

    Kolmann, Matthew A; Huber, Daniel R

    2009-01-01

    Organismal performance changes over ontogeny as the musculoskeletal systems underlying animal behavior grow in relative size and shape. As performance is a determinant of feeding ecology, ontogenetic changes in the former can influence the latter. The horn shark Heterodontus francisci consumes hard-shelled benthic invertebrates, which may be problematic for younger animals with lower performance capacities. Scaling of feeding biomechanics was investigated in H. francisci (n=16, 19-59cm standard length (SL)) to determine the biomechanical basis of allometric changes in feeding performance and whether this performance capacity constrains hard-prey consumption over ontogeny. Positive allometry of anterior (8-163N) and posterior (15-382N) theoretical bite force was attributed to positive allometry of cross-sectional area in two jaw adducting muscles and mechanical advantage at the posterior bite point (0.79-1.26). Mechanical advantage for anterior biting scaled isometrically (0.52). Fracture forces for purple sea urchins Strongylocentrotus purpuratus consumed by H. francisci ranged from 24 to 430N. Comparison of these fracture forces to the bite force of H. francisci suggests that H. francisci is unable to consume hard prey early in its life history, but can consume the majority of S. purpuratus by the time it reaches maximum size. Despite this constraint, positive allometry of biting performance appears to facilitate an earlier entry into the durophagous niche than would an isometric ontogenetic trajectory. The posterior gape of H. francisci is significantly smaller than the urchins capable of being crushed by its posterior bite force. Thus, the high posterior bite forces of H. francisci cannot be fully utilized while consuming prey of similar toughness and size to S. purpuratus, and its potential trophic niche is primarily determined by anterior biting capacity. PMID:19428230

  17. Identification and comparative analysis of complement C3-associated microRNAs in immune response of Apostichopus japonicus by high-throughput sequencing

    OpenAIRE

    Lei Zhong; Feng Zhang; Yu Zhai; Yanhui Cao; Si Zhang; Yaqing Chang

    2015-01-01

    MicroRNAs (miRNAs) are important effectors in mediating host–pathogen interaction. In this report, coelomocytes miRNA libraries of three Japanese sea cucumbers Apostichopus japonicus were built by Illumina® Hiseq2000 from different time points after lipopolysaccharide challenge (at time 0 h, 6 h and 12 h). The clean data received from high throughput sequencing were used to sequences analysis. Referenced to the Strongylocentrotus purpuratus genome, 38 conserved miRNAs were found, and three mi...

  18. Dicty_cDB: Contig-U01465-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ngylocentrotus purpuratus clone R3-3039C22, W... 48 0.43 4 ( EF158072 ) Plasmodium falciparum erythrocyte membra...ry ... 46 2.1 1 ( FE818683 ) CCAG34291.b1 CCAG Petrolisthes cinctipes heart, g... 46 2.1 1 ( FE...800468 ) CCAG23241.g1 CCAG Petrolisthes cinctipes heart, g... 46 2.1 1 ( FE800467 ) CCAG23241.b1 CCAG Petrol...Y329335 ) CAWY2264.fwd CAWY Helobdella robusta Subtracted E... 46 0.099 2 ( AC179628 ) Strongylocentrotus purpura... EY389431 ) CAXA7847.rev CAXA Helobdella robusta Subtracted L... 34 4.9 2 ( EH074316 ) PMDB174TO Pe

  19. Sequence and submolecular localization of the 115-kD accessory subunit of the heterotrimeric kinesin-II (KRP85/95) complex

    OpenAIRE

    1996-01-01

    The heterotrimeric kinesin-II holoenzyme purified from sea urchin (Strongylocentrotus purpuratus) eggs is assembled from two heterodimerized kinesin-related motor subunits of known sequence, together with a third, previously uncharacterized 115-kD subunit, SpKAP115. Using monospecific anti-SpKAP115 antibodies we have accomplished the molecular cloning and sequencing of the SpKAP115 subunit. The deduced sequence predicts a globular 95-kD non-motor "accessory" polypeptide rich in alpha-helical ...

  20. Identification of a repeated sequence in the genome of the sea urchin which is transcribed by RNA polymerase III and contains the features of a retroposon.

    OpenAIRE

    Nisson, P E; Hickey, R. J.; Boshar, M F; Crain, W R

    1988-01-01

    A repeated sequence element which is located about 200 nucleotides upstream from the protein-coding portion of the muscle actin gene (probably within a large 5' intron) in the genome of the sea urchin, Strongylocentrotus purpuratus has been characterized, and shown to contain the sequence features which indicate that it has been transposed by means of an RNA intermediate. This retroposon-like sequence, SURF1-1, is a member of a family which is dispersed and repeated about 800 times in the gen...

  1. Dicty_cDB: Contig-U01967-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available =Neural Wiskott-Aldrich syndrome protein; ... 38 0.96 ( O80517 ) RecName: Full=Uclacyanin-2; AltName: Full...=Uclacyanin-II... 38 0.96 CP000249_642( CP000249 |pid:none) Fran...agen cyanog... 34 1.4 AF211852_1( AF211852 |pid:none) Danio rerio GAP-associated phos...cus tauri strain OTTH059... 42 0.051 K03206_1( K03206 |pid:none) Human PRB1 locus salivary prolin...0.008 M92040_1( M92040 |pid:none) Strongylocentrotus purpuratus alpha 1 ... 39 0.

  2. Dicty_cDB: Contig-U03592-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available plete sequ... 34 0.015 15 ( AE014842 ) Plasmodium falciparum 3D7 chromosome 11 section 7... 42 0.015 11...modium falci... 32 0.10 3 ( AE014823 ) Plasmodium falciparum 3D7 chromosome 14 sectio...s purpuratus clone R3-3040G7, WO... 40 0.26 5 ( AE014820 ) Plasmodium falciparum 3D7 chromosome 14 section 5... 12, section ... 36 0.38 10 ( AC117076 ) Dictyostelium discoideum chromosome... 4 clone B316M24 map 4q25,... 44 0.62 7 ( AE014821 ) Plasmodium falciparum 3D7 chromosome 14 sectio

  3. Dicty_cDB: Contig-U15959-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available g t... 46 2.8 1 ( DL073161 ) Expression method of recombinant protein having t... 46 2.8 1 ( CS498545 ) Sequence 3 from...ssion method. 46 2.8 1 ( DL073179 ) Expression method of recombinant protein havin...( DW021003 ) PMAD-aac06g03.g1 Lamprey_WGS_pCMV-sport6 Petromyz... 48 0.72 1 ( AM522569 ) Paracentrot...0990 ) Plasmodium knowlesi strain H chromosome 8, comple... 46 2.8 1 ( AC165428 ) Strongylocentrot...ngylocentrotus purpuratus clone R3-14J20, WOR... 34 0.40 2 ( AC158254 ) Ornithorhynchus anatin

  4. Dicty_cDB: Contig-U12484-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s purpuratus clone R3-3083B11, W... 36 0.76 8 ( AE014841 ) Plasmodium falciparum 3D7 chromosome 11 section 6...LOW-PASS SEQUENCE ... 46 3.7 1 ( DX414313 ) SOYBF93TH LargeInsertSoybeanGenLibBuild4 Glycine ... 46 3.7 1 ( ...nus DNA, clone:MSMg01-142N08.... 34 8.9 2 ( AE014817 ) Plasmodium falciparum 3D7 chromosome 14 section 2... ...ngth = 1426 Score = 1279 bits (645), Expect = 0.0 Identities = 645/645 (100%) Strand = Plus / Plus Query: 1 gatttgctcagtttct...|||||||||||||||||||||||||||||||| Sbjct: 601 attactctttgaatatgccagagagttacataaattcacatcact 645 Score = 1094 bits (552), Expect

  5. Dicty_cDB: Contig-U12479-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available um 3D7 chromo... 35 5.6 DQ008305_1( DQ008305 |pid:none) Staphylococcus simulans biofi...74,871 total letters Score E Sequences producing significant alignments: (bits) Value Contig-U12479-1 (Conti.........................................done Score E Sequences producing significant alignments: (bits) Value N ( BJ440937 ) Dic...purpuratus clone R3-3108A8, WO... 46 3.2 1 ( BH479067 ) BOGXM92TR BOGX Brassica oleracea genomic clone BO......ata genom... 46 3.2 1 ( ED536535 ) KBrB129H08F KBrB, Brassica rapa BamHI BAC libr

  6. Aislamiento de enterobacterias en algunos moluscos del mar peruano

    Directory of Open Access Journals (Sweden)

    Dora A. Taboada P.

    2014-06-01

    Full Text Available En este trabajo se da a conocer el resultado de un estudio bacteriológico en 5 especies de moluscos que se utilizan en la alimentación humana, ellos fueron: Aulacomya ater, Gari sp., Mesodesma donacium, Aequipecten purpuratus y Thais chocolata, obtenidos de diversos centros de expendio del Callao y Lima. Se aisló Salmonella enteritidis serotipo Derby y Edwardsiella de Gari sp. Otras bacterias como Proteus, Citrobacter, Enterobacter y Serratia estuvieron presentes en los diversos moluscos. El 100% de ellos presentó contaminación por E. coli.

  7. Dicty_cDB: Contig-U01585-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available us purpuratus clone R3-61N10, WOR... 42 0.13 3 ( AY392443 ) Dictyostelium discoideum possible endotoxin... AX4 chromosome 2 ... 38 0.004 8 ( EX849445 ) CBNC7929.rev CBNC Phycomyces blakesleeanus NRRL15... 38... DNA, STS on chromosome 8, D8S0163i, ... 50 0.15 1 ( S59342 ) nuclear pore complex glycoprotein...d (901 letters) Database: CSM 8361 sequences; 7,895,291 total letters Score E Sequences producing significan...quences; 101,790,757,118 total letters Searching..................................................done Score E Sequences producin

  8. Dicty_cDB: Contig-U13778-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available se: 95,242,211,685 Length adjustment: 23 Effective length of query: 585 Effective length of databa...gth adjustment: 122 Effective length of query: 80 Effective length of databa... Motch B protein - mouse (fragment) ... 36 0.74 BC044262_1( BC044262 |pid:none) Xenopus laevis similar to de...X-Delta-2 ... 36 0.74 M17421_1( M17421 |pid:none) Strongylocentrotus purpuratus putati...se: CSM 6905 sequences; 5,674,871 total letters Score E Sequences producing significant alignment

  9. Dicty_cDB: Contig-U15575-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nnnnnnnnnnnnnnnnnnnnkndeyyfqnlnkhnniynnnnknsl yeylyfynepikmghipyqtkilifldefnfpinvgdip...dary hyperparathyroid... 34 3.5 2 ( AC178577 ) Strongylocentrotus purpuratus clon...... 32 0.050 21 ( AE014837 ) Plasmodium falciparum 3D7 chromosome 11 section 2... 36 0.065 16 ( AC127602 ) Rattus norvegicus clon...00123 ) Mycoplasma capricolum subsp. capricolum ATCC 2734... 34 0.15 22 ( AE014822 ) Plasmodium falciparum 3D7 chromosome 14 section...mosome 2 map 5018074... 38 0.17 18 ( CR382399 ) Plasmodium falciparum chromosome 6, complete sequ... 34 0.17 21 ( AF538053 ) Mon

  10. Dicty_cDB: Contig-U11962-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available . ATCC 19397, complete... 38 0.16 2 ( CP000727 ) Clostridium botulinum A str. Hall, complet...otus purpuratus clone R3-3091C13, W... 48 1.3 1 ( CW414019 ) fsbb001f113h10f0 Sorghum methyla...e diphosphate... 63 4e-08 AJ005836_1( AJ005836 |pid:none) Cicer arietinum...AX344835 ) Sequence 260 from Patent WO0200927. 40 0.006 5 ( CP001078 ) Clostridium botulinum E3 str. Ala..... 36 0.16 15 ( AM412317 ) Clostridium botulinum A str. ATCC 3502 complete g... 38 0.16 2 ( CP000726 ) Clostridium botulinum A str

  11. Innate Immune Complexity in the Purple Sea Urchin: Diversity of the Sp185/333 System

    OpenAIRE

    Smith, L. Courtney

    2012-01-01

    The California purple sea urchin, Strongylocentrotus purpuratus, is a long-lived echinoderm with a complex and sophisticated innate immune system. There are several large gene families that function in immunity in this species including the Sp185/333 gene family that has ∼50 (±10) members. The family shows intriguing sequence diversity and encodes a broad array of diverse yet similar proteins. The genes have two exons of which the second encodes the mature protein and has repeats and blocks o...

  12. Dicty_cDB: Contig-U06541-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available cyclase... 44 7.5 1 ( EF152287 ) Strongylocentrotus purpuratus BRCA1 (brca1) mRNA,... 44 7.5 1 ( AC131169 ) ...1 ( CW927554 ) EDCBM45TF A. castellanii, 6-8 kb library from tot... 44 7.5 1 ( CL534328 ) trib011xa13.g1 T. reesei HindIII BAC libr...us lewisii genomic, ge... 44 7.5 1 ( CW927722 ) EDCBN39TR A. castellanii, 6-8 kb library from tot... 44 7.5 ...ce (All Frames) Frame A: t*idtnkkmkllfilliltitiknclsinindnnnqiinlkindtsysmvpyqdeaca...E Sequences producing significant alignments: (bits) Value Contig-U06541-1 (Conti

  13. Dicty_cDB: Contig-U13049-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 20, WOR... 48 0.32 1 ( AC179852 ) Strongylocentrotus purpuratus clone R3-1007J5, WO... 48 0.32 1 ( AU061377 ) Dictyostelium discoi...elium discoideum chromosom... 33 3.5 CP000107_458( CP000107 |pid:none) Ehrlichia canis str..............................done Score E Sequences producing significant alignments: (bits) Value N ( BJ382164 ) Dictyostelium discoi..._150( AL844504 |pid:none) Plasmodium falciparum 3D7 chromo... 38 0.19 CP000246_1573( CP000246 |pid:none) Clostr...90 |pid:none) Plasmodium knowlesi strain H chr... 37 0.24 AL034557_42( AL034557 |

  14. Dicty_cDB: CHS334 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available fkslkisllklkrennlns*kiinqfhl*lqlvmyq vqlqlq*llqfnqllmnlqvviiimitviqqllqqlqllqq*mieikqprqfkrhgkiiv vsnnlkkklklknylkilvncylim...50 0.012 6 AZ188093 |AZ188093.1 SP_1011_B1_A04_T7A Strongylocentrotus purpuratus, purple sea urchin , sperm genomi...keihlkiikh*ilksmmmkiminhktitimnqtnk lnqmkilkikmkmlkikmkmlkikmkmkkikskikyiknfk*k*k*rnnkk Frame... AE006471_96( AE006471 |pid:none) Salmonella typhimurium LT2 strain... 35 7.6 CR940352_701( CR940352 |pid:no... 3.4 AE017340_616( AE017340 |pid:none) Idiomarina loihiensis L2TR, comp... 35 5.8

  15. Immunofluorescence localization of dissociation supernatant and extracellular matrix components in Lytechinus pictus sectioned embryos. M.S. Thesis

    Science.gov (United States)

    Garciaflack, Ana Leticia

    1988-01-01

    Indirect immunofluorescence was used to localize specific extracellular components in embryos of the sea urchin Lytechinus pictus. Hyalin and S2 (a group of components found in the disaggregation supernatant from Strongylocentrotus purpuratus blastulae) were uniformly present at all stages (unfertilized up to 32 hr) except hyalin could not be detected at the 12 hour early blastula stage. Laminin was found in 16 cell, 32 cell, 6 hour, 18 hour, 24 hour, and 32 hour stages, with especially bright fluorescence at 18 hours. Collagen I was present at all stages (freshly fertilized up to 32 hour) except little was detected at 12 hours. Fibronectin was uniformly present in blastocoelar fibers stained with anto-collagen I and anti-fibronectin. These results were compared with those for S. purpuratus to produce an overview of the localization of specific extracellular matrix components during development of two species of sea urchins. The results set the stage for future studies that will examine the function of these components at the various developmental stages.

  16. Sea urchin akt activity is Runx-dependent and required for post-cleavage stage cell division

    KAUST Repository

    Robertson, Anthony J.

    2013-03-25

    In animal development following the initial cleavage stage of embryogenesis, the cell cycle becomes dependent on intercellular signaling and controlled by the genomically encoded ontogenetic program. Runx transcription factors are critical regulators of metazoan developmental signaling, and we have shown that the sea urchin Runx gene runt-1, which is globally expressed during early embryogenesis, functions in support of blastula stage cell proliferation and expression of the mitogenic genes pkc1, cyclinD, and several wnts. To obtain a more comprehensive list of early runt-1 regulatory targets, we screened a Strongylocentrotus purpuratus microarray to identify genes mis-expressed in mid-blastula stage runt-1 morphants. This analysis showed that loss of Runx function perturbs the expression of multiple genes involved in cell division, including the pro-growth and survival kinase Akt (PKB), which is significantly underexpressed in runt-1 morphants. Further genomic analysis revealed that Akt is encoded by two genes in the S. purpuratus genome, akt-1 and akt-2, both of which contain numerous canonical Runx target sequences. The transcripts of both genes accumulate several fold during blastula stage, contingent on runt-1 expression. Inhibiting Akt expression or activity causes blastula stage cell cycle arrest, whereas overexpression of akt-1 mRNA rescues cell proliferation in runt-1 morphants. These results indicate that post-cleavage stage cell division requires Runx-dependent expression of akt.

  17. Is evolution Darwinian or/and Lamarckian?

    Directory of Open Access Journals (Sweden)

    Wolf Yuri I

    2009-11-01

    Full Text Available Abstract Background The year 2009 is the 200th anniversary of the publication of Jean-Bapteste Lamarck's Philosophie Zoologique and the 150th anniversary of Charles Darwin's On the Origin of Species. Lamarck believed that evolution is driven primarily by non-randomly acquired, beneficial phenotypic changes, in particular, those directly affected by the use of organs, which Lamarck believed to be inheritable. In contrast, Darwin assigned a greater importance to random, undirected change that provided material for natural selection. The concept The classic Lamarckian scheme appears untenable owing to the non-existence of mechanisms for direct reverse engineering of adaptive phenotypic characters acquired by an individual during its life span into the genome. However, various evolutionary phenomena that came to fore in the last few years, seem to fit a more broadly interpreted (quasiLamarckian paradigm. The prokaryotic CRISPR-Cas system of defense against mobile elements seems to function via a bona fide Lamarckian mechanism, namely, by integrating small segments of viral or plasmid DNA into specific loci in the host prokaryote genome and then utilizing the respective transcripts to destroy the cognate mobile element DNA (or RNA. A similar principle seems to be employed in the piRNA branch of RNA interference which is involved in defense against transposable elements in the animal germ line. Horizontal gene transfer (HGT, a dominant evolutionary process, at least, in prokaryotes, appears to be a form of (quasiLamarckian inheritance. The rate of HGT and the nature of acquired genes depend on the environment of the recipient organism and, in some cases, the transferred genes confer a selective advantage for growth in that environment, meeting the Lamarckian criteria. Various forms of stress-induced mutagenesis are tightly regulated and comprise a universal adaptive response to environmental stress in cellular life forms. Stress-induced mutagenesis

  18. Van degeneratie tot individuele gezondheidsopties. Het maatschappelijk gebruik van erfelijkheidsconcepten in de twintigste eeuw

    Directory of Open Access Journals (Sweden)

    Stephen Snelders

    2003-10-01

    Full Text Available

    On the basis of a review of the historiography on thought about hereditary transmission and human genetics in the 20th century in Britain, the United States, Germany, Russia, Sweden, and the Netherlands, a new research perspective is formulated. Concepts of heredity and their use in society have been various and diverse. Definitions of heredity and of the influence of 'nature' and 'nurture' in shaping genetic material have significantly changed. In the new research perspective the focus is directed to the role of a broad range of concepts of heredity in framing debates and practices around health, disease, and behaviour, including but not exclusively the concepts of Mendelian genetics, neo- Lamarckism', and concepts prevalent in eugenic movements. A research programme is outlined that is directed at specific problem fields in health care (e.g. alcoholism, and uses various sources to examine the historical dynamics in medical and public spheres.

  19. Los orígenes de la Biología como ciencia. El impacto de las teorías de evolución y las problemáticas asociadas a su enseñanza y aprendizaje

    OpenAIRE

    Bermúdez, Gonzalo M.A.

    2014-01-01

    Este artículo se propone analizar los acontecimientos más relevantes de la historia de la Biología que le dieron corpus teórico y sustento científico, enfatizando el papel que cumplió la teoría de evolución de Lamarck y de Darwin en este proceso; y recopilar algunas de las problemáticas actuales asociadas con la enseñanza y el aprendizaje de la teoría de la evolución por selección natural. Inicialmente, los estudios sobre la vida recibieron fuertes críticas por una corriente de pe...

  20. Evaluation of butachlor for control of some submerged macrophytes along with its impact on biotic components of freshwater system

    Directory of Open Access Journals (Sweden)

    A. Chattopadhyay, S. Adhikari, S. P. Adhikary, S. Ayyappan

    2006-04-01

    Full Text Available In this investigation, the efficacy of the herbicide butachlor, (N-butoxymethyl-2 chloro-21, 61 diethyl acetanilide was tested against few common submerged macrophytes namely Hydrilla (Hydrilla verticillata (L. Royale, Najas (Najas minor All., Nechamandra (Nechamandra alternifolia (Roxb. Thwaites and Ottelia (Ottelia alismoides (L. Pers. of freshwater fish ponds. Almost complete decay of Hydrilla, Nechamandra and Ottelia was achieved at 7.5 L of active ingredient/ha/m butachlor within 15 days while the herbicide showed no negative effect on Najas. However at the same concentration of butachlor, total mortality of zooplankton and water fern Azolla (Azolla caroliniana Lamarck occurred within seven days. In case of few freshwater fish species like Rohu (Labeo rohita, Channa (Channa punctatus, Anabas (Anabas testitudineus and Heteropneustes (Heteropneustes fossilis, total mortality occurred upto 90 days after application of the same dose of butachlor but fish survived beyond 120 days of herbicide application indicating degradation of the herbicides.

  1. Fator Cronológico na Credibilidade do Evolucionismo entre os Discentes da Universidade Severino Sombra

    Directory of Open Access Journals (Sweden)

    Maria das Graças Avila Guimarães

    2015-07-01

    Full Text Available Os conceitos evolucionistas começaram a se fundamentar a partir de Descartes, Buffon, Lamarck e Darwin e ao mesmo tempo despertaram as contradições das doutrinas criacionistas. A credibilidade do evolucionismo por faixa etária dos alunos de graduação da Universidade Severino Sombra (USS, nas diferentes áreas do saber foi o objeto deste trabalho. A população discente se concentrou na faixa etária entre 20 a 24 anos em que predomina o acreditar em ideias evolucionistas, não se podendo avaliar se estes posicionamentos independem da divulgação ou do ensino do criacionismo introduzido há algum tempo nas escolas públicas de alguns estados brasileiros. Pode-se inferir, a partir deste estudo, um grande desconhecimento sobre a teoria científica evolucionista entre os discentes dos cursos superiores pesquisados na USS.

  2. Editoral: Molecular epigenetics: dawn of a new era of biomedical research

    Institute of Scientific and Technical Information of China (English)

    XU RuiMing

    2009-01-01

    @@ At about the same time in 1940s when Erwin Schrǒdinger published his famous little book What Is Life, which sparked the birth of molecular biology, the term epigenetics was coined by the English biologist Conrad Waddington.The concept of epi-inheritance can be traced back to French naturalist Jean-Baptiste Lamarck's idea of "inheritance of acquired traits". Nevertheless, epigenetics as an experimental science owes much credit to Barbara McCiintock's pio-neering work on transposable elements in maize. In early 1950s, she put forward a theory that alteration in chromatin structure is responsible for the peculiar non-Mendelian rules of inheritance - a concept nowadays widely accepted as the comer stone of modem epigenetics.

  3. Consequences of physical disturbance by tadpoles and snails on chironomid larvae.

    Science.gov (United States)

    Pal, Gargi; Aditya, Gautam; Hazra, Niladri

    2014-01-01

    Indirect interactions among community members impact on organisms. The effects of two snails, banded pond snail, Bellamya bengalensis (Lamarck), and Red-rimmed melania, Melanoides tuberculata (Müller), and tadpoles of Asian common toad, Duttaphrynus melanostictus (Schneider), on nonbiting midge larvae, Chironomus striatipennis Kieffer, were observed in experimental microcosm. Decrease in tube number and tube length of midge larvae was observed compared to control condition due to introduction of selected above mentioned organisms. The direct effects of non-predator organisms on the midge larvae are due to physical disturbance that destroys their tubes. This may result in vulnerability of midge larvae to predators in the wild. So the community structure may be altered by indirect effects, where one or more species, through their direct disturbance, indirectly change the abundance of other species. PMID:24672384

  4. Consequences of Physical Disturbance by Tadpoles and Snails on Chironomid Larvae

    Directory of Open Access Journals (Sweden)

    Gargi Pal

    2014-01-01

    Full Text Available Indirect interactions among community members impact on organisms. The effects of two snails, banded pond snail, Bellamya bengalensis (Lamarck, and Red-rimmed melania, Melanoides tuberculata (Müller, and tadpoles of Asian common toad, Duttaphrynus melanostictus (Schneider, on nonbiting midge larvae, Chironomus striatipennis Kieffer, were observed in experimental microcosm. Decrease in tube number and tube length of midge larvae was observed compared to control condition due to introduction of selected above mentioned organisms. The direct effects of non-predator organisms on the midge larvae are due to physical disturbance that destroys their tubes. This may result in vulnerability of midge larvae to predators in the wild. So the community structure may be altered by indirect effects, where one or more species, through their direct disturbance, indirectly change the abundance of other species.

  5. Coptoborus ochromactonus, n. sp. (Coleoptera: Curculionidae: Scolytinae), an emerging pest of cultivated balsa (Malvales: Malvaceae) in Ecuador.

    Science.gov (United States)

    Stilwell, Abby R; Smith, Sarah M; Cognato, Anthony I; Martinez, Malena; Flowers, R Wills

    2014-04-01

    A new species of xyleborine ambrosia beetle has been found to attack balsa, Ochroma pyramidale (Cavanilles ex Lamarck) Urban, in Ecuador. Coptoborus ochromactonus Smith & Cognato is described and its biology is reported. Large-scale surveys were conducted between 2006 and 2009, and observational studies were carried out between 2010 and 2013 in Ecuadorian commercial plantations to determine life history and host preference characteristics. C. ochromactonus attacked balsa between 1.5 and 3 yr in age. Successful attacks were more prevalent in smaller diameter trees and unhealthy trees. In general, attacks and beetle-caused mortality were more prevalent during the dry summer months when trees were under more moisture and light stress. Fungal mycelia were consistently observed coating beetle galleries and are likely the true damaging agent to balsa trees. PMID:24772549

  6. Contaminação por mercúrio em sedimento e em moluscos do Pantanal, Mato Grosso, Brasil Mercury contamination in sediment and in molluscs of Pantanal, Mato Grosso, Brazil

    Directory of Open Access Journals (Sweden)

    Luiz M. Vieira

    1995-09-01

    Full Text Available The total level of mercury detected in the sediment and in the tissues of molluscs from the Bento Gomes basin, although low, have shown that the mercury used in the gold mining activities in the Poconé wetlands has contaminated those aquatic habitats in Pantanal. From 69 sediment samples analyzed, 26 % (N = 18 have shown levels ranging from 0.01 to 0.25µg.g-1 of mercury (moist weight. Mercury levels analyzed in 54 samples of mollusc tissues (Ampullaria scalaris Orbigny, 1835; A. canaliculata Lamarck, 1819 and Marisa planogyra Pilsbry, 1933 have shown that 30% (N = 16 were contaminated with levels ranging from 0.02 to 1.16µg.g-1 moist weight. This study shows that the mercury used in digs for gold mining and released into the environment has reached the habitats of Pantanal spread from the sediment into the molluscs living in the region.

  7. Microbiome, holobiont and the net of life.

    Science.gov (United States)

    Salvucci, Emiliano

    2016-05-01

    Holistic emerging approaches allow us to understand that every organism is the result of integration mechanisms observed at every level of nature: integration of DNA from virus and bacteria in metazoans, endosymbiotic relationships and holobionts. Horizontal gene transfer events in Bacteria, Archaea and Eukaryotes have resulted in the chimeric nature of genomes. As a continuity of this genomic landscape, the human body contains more bacterial than human cells. Human microbiome has co-evolved with the human being as a unity called holobiont. The loss of part of our microbiome along evolution can explain the continuous increasing incidence of immune and inflammatory-related diseases. Life is a continuous process in which the organism experiences its environment and this interaction impacts in the epigenetic system and the genomic structure. The emerging perspectives restitute the great importance of Lamarck's theoretical contributions (the milieu) and Darwin's pangenesis theory. PMID:25430522

  8. [From the mechanical complexity in biology].

    Science.gov (United States)

    Uribe, Libia Herrero

    2008-03-01

    From the mechanical complexity in biology. Through history, each century has brought new discoveries and beliefs that have resulted in different perspectives to study life organisms. In this essay, 1 define three periods: in the first, organisms were studied in the context of their environment, in the second, on the basis of physical and chemical laws, and on the third, systemically. My analysis starts with primitive humans, continues to Aristoteles and Newton, Lamarck and Darwin, the DNA doble helix discovery, and the beginnings of reduccionism in science. I propose that life is paradigmatical, that it obeys physical and chemical laws but cannot be explained by them I review the systemic theory, autopoiesis, discipative structures and non- linear dynamics. 1 propose that the deterministic, lineal and quantitative paradigm of nature are not the only way to study nature and invite the reader to explore the complexity paradigm. PMID:18624253

  9. Avicularia rickwesti sp. nov., a remarkable new species of Avicularia (Theraphosidae: Aviculariinae from Dominican Republic

    Directory of Open Access Journals (Sweden)

    Rogério Bertani

    2013-06-01

    Full Text Available A remarkable new species of Avicularia Lamarck, 1818, Avicularia rickwesti sp. nov., is described from Dominican Republic. Female specimens of the new species are unusual by having two very short and broad spermathecae with distal half strongly sclerotized, a feature not found in any other aviculariine. Additionally, it has the leg coxae with spiniform setae, smaller on leg I and prolateral leg II, larger, black on retrolateral leg II, prolateral and retrolateral leg III and prolateral leg IV. Males are unknown. The new species is known only from two localities, in southwestern Dominican Republic. This is the first record for the subfamily on Hispañola which is close to the northern boundary for the Aviculariinae distribution.

  10. Cancer as a metabolic disease: implications for novel therapeutics.

    Science.gov (United States)

    Seyfried, Thomas N; Flores, Roberto E; Poff, Angela M; D'Agostino, Dominic P

    2014-03-01

    Emerging evidence indicates that cancer is primarily a metabolic disease involving disturbances in energy production through respiration and fermentation. The genomic instability observed in tumor cells and all other recognized hallmarks of cancer are considered downstream epiphenomena of the initial disturbance of cellular energy metabolism. The disturbances in tumor cell energy metabolism can be linked to abnormalities in the structure and function of the mitochondria. When viewed as a mitochondrial metabolic disease, the evolutionary theory of Lamarck can better explain cancer progression than can the evolutionary theory of Darwin. Cancer growth and progression can be managed following a whole body transition from fermentable metabolites, primarily glucose and glutamine, to respiratory metabolites, primarily ketone bodies. As each individual is a unique metabolic entity, personalization of metabolic therapy as a broad-based cancer treatment strategy will require fine-tuning to match the therapy to an individual's unique physiology. PMID:24343361

  11. La familia Acmaeidae (Gastropoda, Archaeogastropoda en el Perú

    Directory of Open Access Journals (Sweden)

    Carlos Paredes

    2014-06-01

    Full Text Available Se reportan siete especies de la familia Acmaeidae de la zona litoral rocosa del Departamento de Lima: Scurria viridula (Lamarck, S. parasitica (Orbigny, S. variabilis (Sowerby, S. zebrina (Lesson, Collisella orbignyi (Dall, C. ceciliana (Orbigny y C. araucana (Orbigny. Se amplía el límite norte de la distribución geográfica de las dos últimas especies y asimismo para S. zebrina y S. parasitica. Se informa sobre la zonación vertical de las especies, su dominancia relativa y otras observaciones ecológicas. De la revisión de la literatura y los resultados del presente estudio se concluye que, conjuntamente con Scurria scurra (Lesson, 1830, son ocho las especies de Acmaeidae presentes en la Provincia Peruana.

  12. Authorship of some polychaete (Annelida) names derived from the works of Renier and Savigny.

    Science.gov (United States)

    Muir, Alexander I; Petersen, Mary E

    2013-01-01

    Full citations of animal specific or generic names ultimately derived from unpublished manuscripts should commemorate the work of the person who described the new species as well as the person who eventually validly published the name. We suggest that biologists should use the following authorships when citing these names: Terebella infundibulum Renier in Meneghini, 1847 (now used in the genus Myxicola); Nereis coccinea Renier in Meneghini, 1847 (now used in the genus Lumbrineris); Thalassema scutatum Renier in Ranzani, 1817 (now known as Sternaspis scutata); Polynoe Savigny in Lamarck, 1818. The case of Myxicola infundibulum is further complicated by a possible homonymy, and to avoid confusion we suggest that the name is used for the Myxicola species found in the Adriatic. PMID:26176114

  13. William Keith Brooks and the naturalist's defense of Darwinism in the late-nineteenth century.

    Science.gov (United States)

    Nash, Richard

    2015-06-01

    William Keith Brooks was an American zoologist at Johns Hopkins University from 1876 until his death in 1908. Over the course of his career, Brooks staunchly defended Darwinism, arguing for the centrality of natural selection in evolutionary theory at a time when alternative theories, such as neo-Lamarckism, grew prominent in American biology. In his book The Law of Heredity (1883), Brooks addressed problems raised by Darwin's theory of pangenesis. In modifying and developing Darwin's pangenesis, Brooks proposed a new theory of heredity that sought to avoid the pitfalls of Darwin's hypothesis. In so doing he strengthened Darwin's theory of natural selection by undermining arguments for the inheritance of acquired characteristics. In later attacks on neo-Lamarckism, Brooks consistently defended Darwin's theory of natural selection on logical grounds, continued to challenge the idea of the inheritance of acquired characteristics, and argued that natural selection best explained a wide range of adaptations. Finally, he critiqued Galton's statistical view of heredity and argued that Galton had resurrected an outmoded typological concept of species, one which Darwin and other naturalists had shown to be incorrect. Brooks's ideas resemble the "biological species concept" of the twentieth century, as developed by evolutionary biologist Ernst Mayr and others. The late-nineteenth century was not a period of total "eclipse" of Darwinism, as biologists and historians have hitherto seen it. Although the "Modern Synthesis" refers to the reconciliation of post-Mendelian genetics with evolution by natural selection, we might adjust our understanding of how the synthesis developed by seeing it as the culmination of a longer discussion that extends back to the late-nineteenth century. PMID:26013644

  14. Sensorial, physical and chemical evaluation of bio-fortified Ipomoea batatas

    Directory of Open Access Journals (Sweden)

    Mara N.G. Santos

    2014-08-01

    Full Text Available Context: Bio-fortified sweet potato, Ipomoea batatas (L. Lamarck beta-carotene rich, has been included in the most vulnerable population’s diet with the purpose of reducing health disturbances associated with hipovitaminosis. Aims:To evaluate a physical and chemical analysis of total carotenes and beta-carotene and to determine the antioxidant potential as well as to carry out a sensorial analysis of the bio-fortified Ipomoea batatas (L. Lamarck (BDB in nature and processed. Methods: BDB was processed as sweet (in natura, paste and syrup and physicochemical characteristics were compared, total carotenoids, beta-carotene, antioxidant activity (DPPH and microbiological and sensory analyses were performed. Results:The analysis of total carotenoids, beta-carotene and anti-oxidant potential showed the following results: BDB in nature – 11.81 mg/100 g/440.5 mg/100 g/26.30%; sweet paste – 0.61 mg/100 g/53.5 mg/100 g/53.40% and savored syrup – 0.85 mg/100 g/46.0 mg/100 g/14.30%. The methods of conservation avoided the coliforms growth at 35 and 45°C, Staphylococcus coagulasa positivo, Bacillus cereus and Salmonella in all elaborated candies. The sensorial analysis didn’t detect significant differences among the syrup or paste. Conclusions: The conservation methods have an important function keeping the physical, chemical characteristics and sensorial of BDB, although they can influence in their chemical and nutritional composition, mainly in relation to the quantity of total carotenoids and beta-carotene.

  15. Genetic diversity and molecular characterization of several Heliconia species in Colombia.

    Science.gov (United States)

    Isaza, L; Marulanda, M L; López, A M

    2012-01-01

    Researchers have classified the Heliconia genus as a group of highly variable and diverse plants. Species and cultivars are visually differentiated primarily on the basis of the color and size of inflorescence bracts. At taxonomic level, flower type (parabolic, sigmoid, or erect) and size are taken into account. The vast morphological diversity of heliconias at intra-specific, intra-population, and varietal levels in central-west Colombia prompted the present study. We characterized the genetic variability of 67 genotypes of cultivated heliconias belonging to Heliconia caribaea Lamarck, H. bihai (L.) L., H. orthotricha L. Andersson, H. stricta Huber, H. wagneriana Petersen, and H. psittacorum L. f., as well as that of several interspecific hybrids such as H. psittacorum L. f. x H. spathocircinata Aristeguieta and H. caribaea Lamarck x H. bihai (L.) L. We also created an approximation to their phylogenetic analysis. Molecular analysis using amplified fragment length polymorphism (AFLP) markers revealed a total of 170 bands. Two large, well-defined groups resulted: the first grouped cultivars of the very closely related H. caribaea and H. bihai species with those of H. orthotricha and H. psittacorum, and the second grouped H. stricta and H. wagneriana cultivars. The lowest percentage of polymorphism was found in H. psittacorum (17.65%) and the highest was in H. stricta (55.88%). Using AFLP, phylogenetic analysis of the species studied revealed the monophyletic origin of the Heliconiaceae family, and identified the Heliconia subgenus as monophyletic while providing evidence of the polyphyletic origin of several representatives of the Stenochlamys subgenus. PMID:23212400

  16. The infauna of three widely distributed sponge species (Hexactinellida and Demospongiae) from the deep Ekström Shelf in the Weddell Sea, Antarctica

    Science.gov (United States)

    Kersken, Daniel; Göcke, Christian; Brandt, Angelika; Lejzerowicz, Franck; Schwabe, Enrico; Anna Seefeldt, Meike; Veit-Köhler, Gritta; Janussen, Dorte

    2014-10-01

    Due to their high abundance and large body size sponges have a central position in Antarctic zoobenthos, where they form the most extensive sponge grounds of the world. Though research on Antarctic benthos communities is quite established, research on sponge-associated infauna communities is scarce. We analyzed associated infauna of fifteen individuals of the sponge species Mycale (Oxymycale) acerata Kirkpatrick, 1907 (Demospongiae: Mycalina), Rossella antarctica Carter, 1872 and R. racovitzae Topsent, 1901 (both Hexactinellida: Lyssacinosida). Samples were collected from the deep Ekström Shelf at 602 m in the South-Eastern Weddell Sea, Antarctica, during the ANT XXIV-2 (SYSTCO I) expedition of RV Polarstern. The number of species, α- and β-diversity and the significantly different species composition of infauna communities related to sponge species were calculated, the latter via cluster analysis. The sponge-associated infauna consisted of five phyla: Foraminifera, Nematoda, Polychaeta, Mollusca and Arthropoda. In total 11,463 infaunal specimens were extracted and we found at least 76 associated species. Highest values of α-diversity were calculated for a sample of R. antarctica with a Shannon-Index of 1.84 and Simpson-Index of 0.72 respectively. Our results of the cluster-analysis show significant differences between infauna communities and a unique species composition for single sponge species. Polychaetes of the genus Syllis Lamarck, 1818 were numerous in M. acerata and genera like Pionosyllis Malmgren, 1867 and Cirratulus Lamarck, 1801 were numerous in R. antarctica. Individuals of the amphipod species Seba cf. dubia Schellenberg, 1926 were often found in R. antarctica and R. racovitzae while Colomastix fissilingua Schellenberg, 1926 was frequent in samples of M. acerata. Molluscs were present in M. acerata and R. antarctica but absent in R. racovitzae.

  17. EL ORIGEN DE LAS ESPECIES Y SU RELACIÓNCON EL INICIO DE LA ACTUAL TEORÍA DE LA HERENCIA The Origin of Species and its Relation with the Birth of Present Genetic Theory

    Directory of Open Access Journals (Sweden)

    WILLIAM USAQUÉN MARTÍNEZ

    Full Text Available En la primera parte se mostrarán algunos elementos históricos relacionados con la "Philosophie Zoologique" de Jean-Baptiste Lamarck, obra fundamental de la biología moderna merecedora de una mención especial en su aniversario número 200. Esta obra contiene algunos conceptos impor-tantes para "The Origin of species by means of natural selection, or the preservation of favoured races in the struggle for life" el trabajo fundamental de Charles Darwin. Posteriormente se revisará la idea general de la pangénesis y sus diferentes contradicciones en la explicación de la variabilidad necesaria para la acción de la selección natural que culminarían con el nacimiento de la genética. Es importante mostrar la posición particular de los experimentos mendelianos en relación con el paradigma evo-lutivo causado por el origen de las especies.In the first part I present some historical elements related to the "Philosophie Zoologique" by Jean-Baptiste Lamarck, a fundamental work of modern biology. This work deserves a special mention in its 200th anniversary, since it contains some important concepts for "The Origin of Species by Means of Natural Selection, or the Preservation of favored races in the struggle for life" the principal work of Charles Darwin. Subsequently we review the pangenesis and various contradictions in the explanation of the variability required for the action of natural selection that culminate with the birth of genetics. In this paper is important show the particular position of Mendelian experiments in relation with the evolutionary paradigm caused by the origin of species.

  18. Integrated bioremediation techniques in a shrimp farming environment under controlled conditions

    Institute of Scientific and Technical Information of China (English)

    SONG Xianli; YANG Qian; REN J. Shengmin; SUN Yao; WANG Xiulin; SUN Fuxin

    2016-01-01

    This study investigated the integrated bioremediation techniques for a shrimp culture system to reduce unconsumed feed and the contents of suspended solids (SS), nutrients and organic pollutants using barracuda, clamworm, scallop, large algae and a biofilter. A multi-pool internal circulation system was designed to test the effectiveness of the techniques in the laboratory. The experimental result has shown thatArgopecten irradians, Gracilaria lemaneiformis and the biofilter efficiently reduced the contents of SS, dissolved inorganic carbon (DIC) and dissolved organic carbon (DOC) in the breeding wastewater. The amount of unconsumed feed was significantly reduced by barracuda and clamworm, but there was an increase in the contents of SS, DIC and DOC in the water due to disturbance by the barracuda and clamworm. The capacity of macroalgae to extract inorganic nitrogen was insufficient. However, the balance of the nitrogen fixation rate of macroalgae and the biological exhaust nitrogen rate within the system should be fully considered. The use of the biofilter alone was not optimal for the remediation of organic matter in shrimp effluent so that auxiliary foam separation technology is needed to improve the ability of the system to remove macromolecules. This study provides a basis for the further development of remediation techniques to reduce the environmental impact of shrimp aquaculture.

  19. Cloning of a big defensin gene and its response to Vibrio parahaemolyticus challenge in the noble scallop Chlamys nobilis (Bivalve: Pectinidae).

    Science.gov (United States)

    Yang, Jianqing; Luo, Jiafu; Zheng, Huaiping; Lu, Yeqing; Zhang, Hongkuan

    2016-09-01

    The noble scallop Chlamys nobilis has been an important marine cultured bivalve in the Southern Sea of China for decades. However, large-scale mortality events often occurred during the scallop' cultivation. As one of AMPs (antimicrobial peptides), big defensin is an important component of the innate immunity against pathogenic microorganisms in invertebrates. In order to investigate whether the big defensin can play a role in the immune defense against pathogenic microorganisms in noble scallop, a big defensin gene from the hemocytes of Chlamys nobilis (CnBD) was cloned, and the mRNA level was measured after an acute Vibrio parahaemolyticus challenge of 36 h. The CnBD cDNA contains an open reading frame (ORF) of 381 bp encoding a peptide of 126 amino acids residues. The deduce amino acid sequence of CnBD shows a high similarity with that from Argopecten irradians and displays common features of big defensin, indicating that CnBD is a new member of the big defensin family. Compared with the control group, the relative mRNA level of CnBD was significantly up-regulated at 3, 24 and 36 h. The present result indicated that CnBD played an immune role against bacterial infection in noble scallop. PMID:27474446

  20. Molecular identification of scallop planktonic larvae using species-specific microsatellites

    Institute of Scientific and Technical Information of China (English)

    ZHAN Aibin; HU Xiaoli; BAO Lisui; LU Wei; PENG Wei; WANG Mingling; HU Jingjie

    2008-01-01

    The identification of scallop larvae is essential to understand the population structure and community dynamics and to assess the potential environmental impacts caused by scallop larvae released or escaped. However, the larvae identification by morphological characteristics is notoriously difficult, mainly due to the small size (usually being less than 150 μm) and vague morphological characteristics among different scallop species. A simple and accurate molecular method was developed to identify four economically farmed scallop species, the Zhikong scallop Chlamys farreri, the noble scallop C. nobilis, the bay scallop Argopecten irradians and the Yesso scallop Mizuhopecten yessoensis. The tests used the high degree of species-specific micresatellite markers, which was specified by transferability analyses, assessed by reference individuals and evaluated by BLAST searches. The sensitivity test indicated that the species-specific micresatellites were sensitive enough for the detection of 1%~2% larvae in mixed plankton samples, larvae collected from scallop hatcheries and their effluents and from the artificially controlled crosses were well identified to the species/hybrid level. The results demonstrated that the one-step PCR-based assay was technically simple, inexpensive and robust in identification analyses, and also less sensitive to initial quality of template DNA extracted from the ethanol-preserved samples for several years.

  1. Phylogenetic analysis of Pectinidae (Bivalvia) based on the ribosomal DNA internal transcribed spacer region

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    The ribosomal DNA internal transcribed spacer (ITS) region is a useful genomic region for understanding evolutionary and genetic relationships. In the current study, the molecular phylogenetic analysis of Pectinidae (Mollusca: Bivalvia) was performed using the nucleotide sequences of the nuclear ITS region in nine species of this family. The sequences were obtained from the scallop species Argopecten irradians, Mizuhopecten yessoensis, Amusium pleuronectes and Mimachlamys nobilis, and compared with the published sequences of Aequipecten opercularis, Chlamys farreri, C. distorta, M. varia, Pecten maximus, and an outgroup species Perna viridis. The molecular phylogenetic tree was constructed by the neighbor-joining and maximum parsimony methods. Phylogenetic analysis based on ITS1, ITS2, or their combination always yielded trees of similar topology. The results support the morphological classifications of bivalve and are nearly consistent with classification of two subfamilies (Chlamydinae and Pectininae) formulated by Waller. However, A. irradians, together with A. opercularis made up of genera Amusium, evidences that they may belong to the subfamily Pectinidae. The data are incompatible with the conclusion of Waller who placed them in Chlamydinae by morphological characteristics. These results provide new insights into the evolutionary relationships among scallop species and contribute to the improvement of existing classification systems.

  2. AUTOCHTHONOUS BIOFACIES IN THE PLIOCENE LORETO BASIN, BAJA CALIFORNIA SUR, MEXICO

    Directory of Open Access Journals (Sweden)

    MICHELE PIAZZA

    1998-07-01

    Full Text Available The present paper examines the molluscan and/or echinoid assemblages recovered from two lithostratigraphic units (Piedras Rodadas Sandstone and Arroyo de Arce Norte Sandstone outcropping in the Pliocene Loreto Basin, Baja California Sur, Mexico. Ten biofacies have been identified, i.e. Trachycardium procerum-Trachycardium senticosum Biofacies, Chione compta-Transennella modesta Biofacies, Laevicardium elenense-Chione kelletii Biofacies, Xenophora sp. 1-Strombus subgracilior Biofacies, Crassostrea californica osunai Biofacies, Myrakeena angelica Biofacies, Vermetid-Nodipecten Biofacies, Argopecten abietis abietis Biofacies, Aequipecten dallasi Biofacies and Encope Biofacies. The first four biofacies have been defined on the basis of statistical analyses (cluster analysis, MDS. The other six, which are monospecific or definitely low-diversity, were already identified during field work. The deduced paleoecological bearing of biofacies, largely relying upon the comparison to their closest modern counterparts, provides the basis for the paleoenvironmental reconstruction. The latter also considers sedimentological evidence and is framed within the tectonic and sedimentary context recently proposed by American workers. Biofacies point toward environments differing in terms of substrate texture, presence/absence of vegetal cover, energy level, variously distributed within the low tide mark-40 m bathymetric range. 

  3. Composition, abundance, biomass, and production of macrofauna in a New England estuary: comparisons among eelgrass meadows and other nursery habitats

    Science.gov (United States)

    Heck, K.L., Jr.; Able, K.W.; Roman, C.T.; Fahay, M.P.

    1995-01-01

    Quantitative suction sampling was used to characterize and compare the species composition, abundance, biomass, and secondary production of macrofauna inhabiting intertidal mudflat and sandflat, eelgrass meadow, and saltmarshpool habitats in the Nauset Marsh complex, Cape Cod, Massachusetts (USA). Species richness and abundance were often greatest in eelgrass habitat, as was macroinvertebrate biomass and production. Most striking was the five to fifteen times greater rate of annual macrofaunal production in eelgrass habitat than elsewhere, with values ranging from approximately 23139 g AFDW m super(2) yr super(1). The marsh pool containing widgeon grass (Ruppia maritima) supported surprisingly low numbers of macroinvertebrates, probably due to stressfully low dissolved oxygen levels at night during the summer. Two species of macroinvertebrates, blue mussels (Mytilus edulis) and to a lesser extent bay scallops (Argopecten irradians), used eelgrass as 'nursery habitat.' Calculations showed that macroinvertebrate production is proportionally much greater than the amount of primary production attributable to eelgrass in the Nauset Marsh system, and that dramatic changes at all trophic levels could be expected if large changes in seagrass abundance should occur. This work further underscores the extraordinarily large impact that seagrass can have on both the structure and function of estuarine ecosystems.

  4. Dicty_cDB: Contig-U02008-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .9 1 ( FE778676 ) CCAG10325.b3 CCAG Petrolisthes cinctipes heart, g... 46 1.9 1 (...5C24 in l... 38 1.4 4 ( BV469818 ) G591P608585RB1.T0 Clint Pan troglodytes verus STS... 34 1.4 3 ( BX601643 ) Zebra...665 ) tigr-gss-dog-17000329822776 Dog Library Canis lup... 46 1.9 1 ( CU068638 ) AGENAE Rainbow trout multi-tissues libra...J255870 ) Mus musculus adult male brain cDNA, RIKEN full-le... 38 7.8 2 ( AC193012 ) Pan troglodytes BAC clone CH251-424B9 from chro...mosome 2 map 3323568... 34 8.3 6 ( AC184611 ) Strongylocentrotus purpuratus clone R3-3085G2, WO...

  5. Dicty_cDB: Contig-U10609-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available :none) Boltenia villosa transmembrane rec... 86 7e-16 AE014188_55( AE014188 |pid:none) Plasmodium falci...1803 ) CV01005A2B04.f1 CV01-normalized library Manihot e... 46 1.4 1 ( BW801716 ) Branchiostoma floridae...nchiostoma floridae un... 56 0.001 1 ( AC180603 ) Strongylocentrotus purpuratus clone R3-3092N08,...er of clones 1 Number of EST 1 Link to clone list U10609 List of clone(s) est1= VFI267F ,1,564 Translated Amino Acid... 38 0.25 2 ( CD323116 ) StrPu537.001478 Sea urchin embryo 20hr blastula s... 38 0.26 2 ( CX678736 ) ydc31g02

  6. Dicty_cDB: Contig-U13932-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 08K3, WO... 38 4.0 3 ( AC178133 ) Strongylocentrotus purpuratus clone R3-3078F18, W... 34 4.0 6 ( AC189628 ) Brassica rapa subsp. pe...ngth = 679 Score = 1304 bits (658), Expect = 0.0 Identities = 672/679 (98%) Stran...h = 1740 Score = 38.2 bits (19), Expect = 0.012 Identities = 19/19 (100%) Strand = Plus / Plus Query: 223 ag...dv17h06, 3' end, single read. Length = 679 Score = 1158 bits (584), Expect(2) = 0.0 Identities = 584/584 (100%) Stra...c... 83 9e-15 CP000703_88( CP000703 |pid:none) Staphylococcus aureus subsp. aure... 83 9e-15 CP000316_3878(

  7. Dicty_cDB: Contig-U03858-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 0.003 (Q9FVX0) RecName: Full=Cyclin-A1-2; AltName: Full=G2/mitotic-spe... 45 0.004 CR940348_224( CR940348 |pid:none) Theileri....5 3 ( EU004203 ) Saccharomyces cerevisiae YJM789 mitochondrion, co... 34 1.6 7 ( AC201298 ) Strongylocentrotus purpuratus clone... Leishmania major strain Friedlin... 72 2e-11 AP007171_790( AP007171 |pid:none) Aspergillus oryzae RIB40 gen...... 45 0.005 EU692911_1( EU692911 |pid:none) Caenorhabditis brenneri clone 2A12.....44 FM992690_258( FM992690 |pid:none) Candida dubliniensis CD36 chromo... 42 0.044 ( P36630 ) RecName: Full=G2/mitotic-spe

  8. Dicty_cDB: Contig-U01577-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available num E3 str. Alaska E43, complet... 36 0.27 18 ( CT573329 ) Zebrafish DNA sequence **...2 4.8 2 ( AC116924 ) Dictyostelium discoideum chromosome 2 map 6357117... 32 4.9 9 ( BX088595 ) Zebrafish DN.... 36 6.9 2 ( EJ270540 ) 1095353009890 Global-Ocean-Sampling_GS-27-01-01-1... 40 7.0 2 ( AL929239 ) Zebrafish...77376. 34 7.5 5 ( AC178390 ) Strongylocentrotus purpuratus clone R3-3107O18, W... 40 7.5 5 ( CP001247 ) Borrelia afzelii ACA-1 plas...num A3 str. Loch Maree, complet... 36 9.6 17 ( CR753902 ) Zebrafish DNA sequence from clone CH2

  9. Dicty_cDB: Contig-U15734-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available equence, co... 40 1.7 6 ( AL731764 ) Mouse DNA sequence from clone RP23-75F12 on chrom... 42 1.7 10 ( EU746611 ) Nasonia girault...e) Schistosoma japonicum SJCHGC04034 ... 37 1.6 AY084712_1( AY084712 |pid:none) Arabidopsis thaliana clon...e) Zea mays clone 446343 prenyltransf... 33 2.2 BT053405_1( BT053405 |pid:none) Medicago truncatula clon...34 0.005 14 ( AC007891 ) Drosophila melanogaster, chromosome 3R, region 91... 44 0.005 5 ( BA000021 ) Wigglesworthia glossinid...... 38 0.66 11 ( AC175911 ) Strongylocentrotus purpuratus clone R3-12O6, WORK... 36 0.67 10 ( CP000685 ) Flavobacterium johnsoni

  10. Dicty_cDB: Contig-U11959-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available U11959-1Q.Seq.d (1360 letters) Database: CSM 6905 sequences; 5,674,871 total letters Score E Sequences producing significant al...ig-U11959-1Q) /CSM_Contig/Contig-U11959-1Q.Seq.d (1360 letters) Database: ddbj_A 92,845,959 sequences; 95,242,211,685 total letter...000638_4( CP000638 |pid:none) Agrobacterium vitis S4 plasmid pAt... 49 6e-04 AX771881_1( AX771881 |pid:none) Sequence 93 from Patent...lone R3-4011I10, W... 52 0.056 1 ( AC176333 ) Strongylocentrotus purpuratus clone R3-3053K7, WO... 52 0.056 1 ( AC116984 ) Dictyoste...2.2 4 ( ER399326 ) 1095349040644 Global-Ocean-Sampling_GS-34-01-01-1... 36 2.4 2 ( AC184243 ) Strongylocentr

  11. Dicty_cDB: Contig-U15851-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available DNA ... 36 4.5 2 ( EG686832 ) RCRB692TO Castor bean cDNA library from roots, 1.... 36 4.5 2 ( EG670343 ) RCRCH76TO Castor be...an cDNA library from roots, 1.... 36 4.5 2 ( EE256738 ) RFAAD56TH Castor bean cDNA library fro... Vitis v... 48 1.8 1 ( CU759384 ) A BAC library has been constructed from PN40024 g... 48 1.8 1 ( CG915134 )...5 1 ( FC850896 ) CBHN6554.rev CBHN Metridium senile tentacle Metri... 50 0.45 1 ( AC116977 ) Dictyostelium discoideum chro...se DhkG (d... 36 7.2 5 ( AC177109 ) Strongylocentrotus purpuratus clone R3-4014B6

  12. Animal mitochondrial DNA polymorphism:a valuable tool for evolutionary studies

    Institute of Scientific and Technical Information of China (English)

    ZHANGYAPING; HONGLAN; 等

    1993-01-01

    Since the mitochondrial DNA(mtDNA) was discovered[1],a great amount of information have been accumulated about its sturcutres and functions[2],The complete nucleotide sequence of the mitochondrial genome has been determined for one individual in each of the following species:mouse(Mus musculus)[3],human(HOmo sapiens)[4],cow(Bos taurus)[5],Xenopus laevis[6],fruit fly(Drosophila yacuba)[7],sea urchin (Strongylocentrotus purpuratus)[8].rat(rattus novegicus)[9],fin whale(Balaenoptera physalus)[10],and harbor seal(Phoca vitulina)[11],More than 300 species of animals have been studied on mtDNA3.In the past 10 years.mtDNA has been a useful and powerful tool in the field of evolutionary biology and taxonomy.

  13. Dicty_cDB: Contig-U01659-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 5 5 ( AC178341 ) Strongylocentrotus purpuratus clone R3-3105C09, W... 34 0.58 6 ( CT573185 ) Zebrafish DNA seq....70 9 ( CU856289 ) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 42 0.71 5 ( AC116330 ) Dictyostelium dis...whol... 38 0.76 2 ( AL845419 ) Zebrafish DNA sequence from clone CH211-198O19 in...... 36 0.77 6 ( DE907714 ) Macropus eugenii DNA, BAC clone: MEB1-090A16_F, 5... 44 0.82 2 ( BX510307 ) Zebrafish DNA seq...s aculeatus c... 46 1.6 1 ( EU746612 ) Nasonia longicornis strain IV7 NADH dehydrogenase... 32 1.8 4 ( CU466265 ) Zebrafish DNA seq

  14. Dicty_cDB: Contig-U04682-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 35423 ) BE1093_H18_R IASMA L1 HindIII BAC library Vitis v... 44 5.2 1 ( AJ553508 ) Arabidopsis thaliana T-DNA flanking seq...centrotus purpuratus clone R3-3080O09, W... 34 2.6 7 ( BX323995 ) Zebrafish DNA sequence from clone RP71-86K...19 in l... 32 2.6 2 ( CR936835 ) Zebrafish DNA sequence *** SEQUENCING IN PROGRES...S... 32 2.6 2 ( CR382398 ) Plasmodium falciparum chromosome 6, complete sequ... 32 3.1 8 ( AL928870 ) Zebrafish DNA seq...1105A22, W... 34 4.0 5 ( CU074418 ) Zebrafish DNA sequence from clone CH73-20D8 i

  15. Dicty_cDB: Contig-U13647-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 986361 ) 206046 Tomato MboI BAC Library Solanum lycopersic... 44 6.6 1 ( CZ516602 ) GMW2-36N21a.b2 GMW2 Glycine...7,... 47 5e-04 CU466930_1697( CU466930 |pid:none) Candidatus Cloacamonas acidamin... 45 0.002 CP001037_287( CP001037 |pid:none...s hypothetica... 42 0.016 CP001322_1830( CP001322 |pid:none) Desulfatibacillum alkenivorans...) Pseudoalteromonas atlantica T6c... 39 0.18 CP000473_7482( CP000473 |pid:none) Solibacter usitatu...) Strongylocentrotus purpuratus alph... 33 7.5 CP000503_2692( CP000503 |pid:none) Shewanella sp. W3-18-1, compl

  16. Dicty_cDB: Contig-U11282-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ongylocentrotus purpuratus clone R3-3090I4, WO... 56 0.004 1 ( EL737564 ) Osmo01699 F. cylindrus osmotic str... contig VV78X003108.... 246 3e-69 AC166146_12( AC166146 |pid:none) Medicago trunc...0( CR954207 |pid:none) Ostreococcus tauri strain OTTH05... 194 7e-48 AC137986_3( AC137986 |pid:none) Medicago trun...617_5( AC144617 |pid:none) Medicago truncatula clone mth2-7m9... 46 2e-06 AM270400_14( AM270400 |pid:none) A...NA,... 55 8e-06 AY093112_1( AY093112 |pid:none) Arabidopsis thaliana unknown prot

  17. Dicty_cDB: Contig-U05345-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .073 (Q4V8I7) RecName: Full=Leucine-rich repeat-containing protein 8A... 41 0.073 CP001574_677( CP001574 |pid:none) Micromon...ngylocentrotus purpuratus clone R3-44M22, WOR... 50 0.17 1 ( CP000552 ) Prochlorococcus marinus str... ) rf50d06.y2 Meloidogyne hapla J2 pAMP1 v1 Meloidog... 42 5.3 2 ( AM177607 ) Lycopersicon esculentum mRNA for putr...e) Magnetococcus sp. MC-1, complete... 36 0.066 CP001325_782( CP001325 |pid:none) Micromonas sp. RCC299 chro...=Leucine-rich repeat-containing protein 1;... 36 2.4 AJ276703_1( AJ276703 |pid:none) Aspergillus fumi

  18. Dicty_cDB: SHK255 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available PQDDNNNESNEQIES NEDIENKDEDVENKDEDVENKDEDEEDQIEN*iykkf*ikikikk**kkyyffnfk Translated Amino Acid sequence (All Frames) Frame...e RPCI-23-89E14, genomic survey sequence. 36 0.004 3 CN775673 |CN775673.1 tae84a06.y1 Hydra EST Darmstadt I ...us purpuratus genomic clone Plate=1011 Col=7 Row=B, DNA sequence. 42 0.013 3 CN776161 |CN776161.1 tae78a10.y1 Hydra EST Darm.... 40 0.020 8 CN624142 |CN624142.1 tae59h05.y1 Hydra EST Darmstadt I Hydra magnipapillata cDNA 5', mRNA seq...uence. 40 0.023 2 CN628860 |CN628860.1 tae96h10.y1 Hydra EST Darmstadt I Hydra magnipapillata cDNA 5', mRNA

  19. SEM and x-ray microanalysis of cellular differentiation in Sea Urchin Embryos: a frozen hydrated study

    International Nuclear Information System (INIS)

    Quantitative studies of major chemical element distribution among individual differentiating cells were attempted using scanning electron microscopy. Frozen hydrated embryos of the sea urchin Strongelocentrotus purpuratus were examined at three stages: blastula, mesenchyme blastula, and early gastrula. The blastocoel matrix contained large beads of approximately 1 μm diameter. The cells of the archenteron lacked well defined cell boundaries. Characteristic levels of beam damage and charging provided structural information. The primary mesenchyme cells within the blastocoel were particularly susceptible to both effects. Damaging effects were noted in material stored in liquid nitrogen longer than three months. Ice crystal growth, shrinkage, elemental shift, density changes and charge accumulation may take place in these stored specimens. 151 refs., 50 figs., 3 tabs

  20. Dicty_cDB: Contig-U06578-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ( AC180017 ) Strongylocentrotus purpuratus clone R3-23H22, WOR... 46 0.21 1 ( EK579666 ) 1095521409324 Global-Ocean... clone R3-14K15, WOR... 36 0.90 3 ( EU643477 ) Adineta vaga clone Av_TEL_K_A retrotransposons Ju...guiculata geno... 42 3.3 1 ( EI881265 ) CAH1-65F19TR CAA1Ba Cicer arietinum genomic clone... 42 3.3 1 ( EI602591 ) Wang-VSVGgfp-Jur...th 106 Chromosome number (1..6, M) 2 Chromosome length 8467578 Start point 5390881 End point 5390775 Strand ...(PLUS/MINUS) MINUS Number of clones 1 Number of EST 1 Link to clone list U06578 List of clone(s) est1= VSD639F ,1,107 Tran

  1. Dicty_cDB: Contig-U15188-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Name: Full=Protein-L-isoaspartate O-methyltransferas... 57 3e-15 CP001322_810( CP001322 |pid:none) Desulfatibacillum al...9 4e-12 CP001600_3131( CP001600 |pid:none) Edwardsiella ictaluri 93-146, c... 50 4e-12 (A9N1H6) RecName: Full=Protein-L-isoasparta...6899 ) Strongylocentrotus purpuratus clone R3-1104P9, WO... 34 3.3 5 ( U31288 ) Arabidopsis thaliana L-isoaspart... 98 5e-38 AY496702_1( AY496702 |pid:none) Arabidopsis thaliana L-isoaspartyl... 93 2e-37 AY496702_2( AY49670...2 |pid:none) Arabidopsis thaliana L-isoaspartyl... 93 2e-37 AY496702_3( AY496702

  2. Dicty_cDB: Contig-U16221-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available abase: 8402 Lambda K H 1.37 0.711 1.31 Gapped Lambda K H 1.37 0.711 1.31 Matrix: blastn matri... ) AGENCOURT_56977043 D. grimshawi EST Drosophila gr... 32 7.3 3 ( EC384843 ) PMAH-aab09g10.g1 Lamprey_EST_Olfactory Petr... AGENCOURT_57320741 D. grimshawi EST Drosophila gr... 32 9.9 3 ( AC181324 ) Strongylocentrotus purpuratus cl...tccag 474 Lambda K H 1.37 0.711 1.31 Matrix: blastn matrix:1 -3 Number of Sequences: 98226423 Number o... ++ + G Sbjct: 969 RKAGKTG 975 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLO

  3. Dicty_cDB: Contig-U05215-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available -05 AM884748_1( AM884748 |pid:none) Homo sapiens SRY gene for sex dete... 49 8e-05 AY235423_1( AY235423 |pid:none) Trachemy...17180 |pid:none) Strongylocentrotus purpuratus hapl... 49 8e-05 AY172026_1( AY172026 |pid:none) Branchiostoma belche...ing tran... 49 8e-05 AY578709_1( AY578709 |pid:none) Branchiostoma belcheri tsing...parum 3D7 asexua... 46 1.4 1 ( CJ186583 ) Mus musculus 14.5 days embryo Rathke's pouches cD... 38 4.7 2 ( AL...hus sex-determin... 52 7e-06 EF062529_1( EF062529 |pid:none) Odocoileus hemionus

  4. Meisetz and the birth of the KRAB motif.

    Science.gov (United States)

    Birtle, Zoë; Ponting, Chris P

    2006-12-01

    The largest family of transcription factors in mammals is of Cys(2)His(2) zinc finger-proteins, each with an NH(2)-terminal KRAB motif. Extensive expansions of this family have occurred in separate mammalian lineages, with approximately 400 such genes known in the human genome. Despite their widespread occurrence, the evolutionary provenance of the KRAB motif is unclear since previously it has not been found outside of the tetrapod vertebrates. Here, we show that homologues of the histone methyltransferase Meisetz are present within the sea urchin (Strongylocentrotus purpuratus) genome. Sea urchin and mammalian Meisetz sequences each contain an N-terminal KRAB motif, which thereby establishes an early origin of the KRAB motif prior to the divergence of echinoderm and chordate lineages. Finally, we present evidence that KRAB motifs derive from a novel family of KRI (KRAB Interior) motifs that were present in the last common ancestor of animals, plants and fungi. PMID:17032681

  5. Dicty_cDB: Contig-U13707-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available brachys jingzhao cystine knot toxin (JZTX-49... 32 0.97 2 ( AC214212 ) Populus trichocarpa clon...ING DRAFT SEQU... 32 2.6 2 ( AC207216 ) Pongo abelii BAC clone CH276-180A1 from chromosom... 32 2.6 2 ( AE014841 ) Plasmodium fal..... 44 5.4 1 ( AC005623 ) Arabidopsis thaliana chromosome 2 clone T20P8 map... 44 5.4 1 ( AE014296 ) Drosophi...m... 42 0.015 CP000323_2122( CP000323 |pid:none) Psychrobacter cryohalolentis K5... 41 0.020 B86613( B86613 ) zinc metallo...tig VV78X101109.2, whole genome... 32 0.25 4 ( AC181049 ) Strongylocentrotus purpuratus clone R3-3050K15, W.

  6. AcEST: BP919022 [AcEST

    Lifescience Database Archive (English)

    Full Text Available amydia pneum... 33 1.3 sp|P11761|SAPR_STRPU Sperm-activating peptides OS=Strongylocentr... 32 2.2 sp|Q255A6|...DEFGIAITLNADREGLGYQE 70 >sp|P11761|SAPR_STRPU Sperm-activating peptides OS=Strongylocentrotus purpuratus PE=...amily OS... 34 6.4 tr|Q25121|Q25121_HEMPU Sperm-activating peptide I OS=Hemicentrot... 34 6.4 tr|B3KZU2|B3KZ...GGALVLAGGTGLGKTALLDTARR 61 Query: 252 DGIGFQQRGF 223 D GF RGF Sbjct: 62 DVAGFDVRGF 71 >tr|Q25121|Q25121_HEMPU Sperm-activating pe...e: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipma

  7. Dicty_cDB: Contig-U12755-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ... 48 0.63 1 ( AC181857 ) Strongylocentrotus purpuratus clone R3-1020G24, W... 48 0.63 1 ( AU074405 ) Dictyostelium discoi...CR382135 |pid:none) Debaryomyces hansenii strain CBS... 57 1e-06 CP000496_423( CP000496 |pid:none) Pichia stipitis CBS 6054 chro...e-06 CU928166_118( CU928166 |pid:none) Kluyveromyces thermotolerans str... 56 2e-06 CR382126_555( CR382126 |pid:none) Kluyveromyces...130_396( CR382130 |pid:none) Yarrowia lipolytica strain CLIB1... 52 2e-05 CR382122_550( CR382122 |pid:none) Kluyveromyces lactis str...|pid:none) S.cerevisiae GTP-binding protein (VPS1... 51 7e-05 CU928174_56( CU928174 |pid:none) Zygosaccharomyces rouxii str

  8. Proteome-wide dataset supporting the study of ancient metazoan macromolecular complexes

    Directory of Open Access Journals (Sweden)

    Sadhna Phanse

    2016-03-01

    Full Text Available Our analysis examines the conservation of multiprotein complexes among metazoa through use of high resolution biochemical fractionation and precision mass spectrometry applied to soluble cell extracts from 5 representative model organisms Caenorhabditis elegans, Drosophila melanogaster, Mus musculus, Strongylocentrotus purpuratus, and Homo sapiens. The interaction network obtained from the data was validated globally in 4 distant species (Xenopus laevis, Nematostella vectensis, Dictyostelium discoideum, Saccharomyces cerevisiae and locally by targeted affinity-purification experiments. Here we provide details of our massive set of supporting biochemical fractionation data available via ProteomeXchange (PXD002319-PXD002328, PPIs via BioGRID (185267; and interaction network projections via (http://metazoa.med.utoronto.ca made fully accessible to allow further exploration. The datasets here are related to the research article on metazoan macromolecular complexes in Nature [1].

  9. Proteome-wide dataset supporting the study of ancient metazoan macromolecular complexes.

    Science.gov (United States)

    Phanse, Sadhna; Wan, Cuihong; Borgeson, Blake; Tu, Fan; Drew, Kevin; Clark, Greg; Xiong, Xuejian; Kagan, Olga; Kwan, Julian; Bezginov, Alexandr; Chessman, Kyle; Pal, Swati; Cromar, Graham; Papoulas, Ophelia; Ni, Zuyao; Boutz, Daniel R; Stoilova, Snejana; Havugimana, Pierre C; Guo, Xinghua; Malty, Ramy H; Sarov, Mihail; Greenblatt, Jack; Babu, Mohan; Derry, W Brent; Tillier, Elisabeth R; Wallingford, John B; Parkinson, John; Marcotte, Edward M; Emili, Andrew

    2016-03-01

    Our analysis examines the conservation of multiprotein complexes among metazoa through use of high resolution biochemical fractionation and precision mass spectrometry applied to soluble cell extracts from 5 representative model organisms Caenorhabditis elegans, Drosophila melanogaster, Mus musculus, Strongylocentrotus purpuratus, and Homo sapiens. The interaction network obtained from the data was validated globally in 4 distant species (Xenopus laevis, Nematostella vectensis, Dictyostelium discoideum, Saccharomyces cerevisiae) and locally by targeted affinity-purification experiments. Here we provide details of our massive set of supporting biochemical fractionation data available via ProteomeXchange (PXD002319-PXD002328), PPIs via BioGRID (185267); and interaction network projections via (http://metazoa.med.utoronto.ca) made fully accessible to allow further exploration. The datasets here are related to the research article on metazoan macromolecular complexes in Nature [1]. PMID:26870755

  10. Dicty_cDB: Contig-U10060-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available DRAFT SEQU... 38 1.8 8 ( EC241466 ) 72899 CK01 Drosophila melanogaster cDNA clone CK0... 38 1.8 2 ( CO286841 ) EK0640...2 ( CQ807072 ) Sequence 522 from Patent WO2004035803. 42 0.23 2 ( AX826010 ) Sequence 262 from Patent WO03072821....TJ CHORI103 Schistosoma mansoni gen... 34 0.69 3 ( AC168359 ) Strongylocentrotus purpuratus clone R3-4013O21...3 EF214995_1( EF214995 |pid:none) Callithrix jacchus clone G19-50.1_... 46 0.003 AL645941_14...main-containing protein 9; &BC049... 45 0.006 EF210363_7( EF210363 |pid:none) Salmo salar clone CH214-714P22 MHC... 45 0.00

  11. Dicty_cDB: Contig-U04535-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Group genomic DNA, chromoso... 36 6.5 5 ( AC220300 ) Bos taurus clone CH240-369A22, WORKING DRAFT SEQU... 36 7.1 2 ( CO217017 ) WS00...lone BACR06H06, complete... 40 5.5 4 ( DX924979 ) Bst5kb000721 bstricta5kb Boechera stricta genomic... 30 5....822 ) Plasmodium falciparum 3D7 chromosome 14 section 7... 34 0.058 7 ( AC177200 ) Strongylocentrotus purpuratus clone R3-40...NG IN PROGRESS *** f... 44 1.5 2 ( CU424463 ) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 34 1.5 4 ( CR382400...telium discoideum cDNA clone:dda53i02, 3' ... 38 2.4 2 ( AC218614 ) Bos taurus clone CH240-299E4, WORKING DR

  12. Dicty_cDB: Contig-U03323-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 333882848 Dog Library Canis lup... 38 6.5 2 ( CO216067 ) WS0043.B21_N04 SS-R-A-5 Picea sitchensis cDNA clo... 40...2 Contig-U11407-1 (Contig-U11407-1Q) /CSM_Contig/Conti... 40 0.002 Contig-U11391-1 (Conti...595 ) Bos taurus clone CH240-391C9, WORKING DRAFT SEQUE... 46 1.4 1 ( AC221214 ) Bos taurus clone CH240...ylocentrotus purpuratus clone R3-3003C12, W... 40 2.6 5 ( AC114099 ) Rattus norvegicus clone CH230-66A14..., clone: LjT12M13, TM0... 40 3.4 2 ( BU910062 ) AGENCOURT_10487025 NICHD_XGC_Emb1 Xenopus laevis ... 32 3.5 2 ( DE948014

  13. Dicty_cDB: Contig-U04881-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF345905_1( AF345905 |pid:none) Homo sapiens LIM mineralization pr... 47 3e-04 AB005140_1( AB005140 |pid:none) Mus musculus li...ent WO0171042. 36 2.8 2 ( AC184568 ) Strongylocentrotus purpuratus clone R3-3106J12, W... 38 3.0 3 ( ER424660 ) 1092963741121 Globa...680059 ) ENTIA95TF Entamoeba histolytica Sheared DNA Entam... 32 3.3 2 ( EJ379203 ) 1092963755348 Global-Ocean-Sampli.... 40 1.8 5 ( EK125743 ) 1092978801507 Global-Ocean-Sampling_GS-31-01-01-1... 32 1...ana tabacum ge... 40 1.9 2 ( EK158830 ) 1095458016335 Global-Ocean-Sampling_GS-31-01-01-

  14. Dicty_cDB: Contig-U12053-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e) 43 0.030 AF345905_1( AF345905 |pid:none) Homo sapiens LIM mineralization pr... 43 0.030 AB209531_1( AB209531 |pid:non... 48 0.88 1 ( AC177181 ) Strongylocentrotus purpuratus clone R3-4018C22, W... 48 0.88 1 ( ER286475 ) 1092343573088 Global...e CH251-682B11, ... 38 0.79 6 ( ER415983 ) 1092452150498 Global-Ocean-Sampling_GS-35-01-01-1... 3...us Phytoplasma mali strain AT complete ch... 36 0.72 17 ( AC192970 ) Pan troglodytes chromosome X clon...vegicus protein tyrosine... 91 1e-16 AB183035_1( AB183035 |pid:none) Ciona intestinalis Ci-VSP mRNA for... 8

  15. Dicty_cDB: Contig-U15684-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s for pharmacological ... 46 4.0 1 ( BD299093 ) Cloning, expression and characterization.... 38 4.5 3 ( AC177271 ) Strongylocentrotus purpuratus clone R3-43O10, WOR... 38 4.5 4 ( EJ509602 ) 1095407058338 Global-Ocean-Sampli... 44 1.4 2 ( BJ367367 ) Dictyostelium discoideum cDNA clone:ddc42o07, 5' ... 32 1.4 3 ( ER589928 ) 1093016193049 Global-Ocean-Sampli...472065 ) AYARK48TF pooled cDNA populations Arabidopsis tha... 34 10.0 2 >( BJ403383 ) Dictyostelium discoideum cDNA clon...avy chain kinas... 38 9.9 3 ( EK406030 ) 1095505002857 Global-Ocean-Sampling_GS-31-01-01-1... 34 10.0 2 ( EG

  16. SEM and x-ray microanalysis of cellular differentiation in Sea Urchin Embryos: a frozen hydrated study

    Energy Technology Data Exchange (ETDEWEB)

    Klein, S.B.

    1985-12-01

    Quantitative studies of major chemical element distribution among individual differentiating cells were attempted using scanning electron microscopy. Frozen hydrated embryos of the sea urchin Strongelocentrotus purpuratus were examined at three stages: blastula, mesenchyme blastula, and early gastrula. The blastocoel matrix contained large beads of approximately 1 ..mu..m diameter. The cells of the archenteron lacked well defined cell boundaries. Characteristic levels of beam damage and charging provided structural information. The primary mesenchyme cells within the blastocoel were particularly susceptible to both effects. Damaging effects were noted in material stored in liquid nitrogen longer than three months. Ice crystal growth, shrinkage, elemental shift, density changes and charge accumulation may take place in these stored specimens. 151 refs., 50 figs., 3 tabs.

  17. Dicty_cDB: Contig-U06368-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available omi... 50 7e-05 AE2149( AE2149 ) hypothetical protein all2748 [imported] - Nostoc ... 50 7e-05 ( P16157 ) RecNam...RIKEN full-length enric... 40 0.003 2 ( EJ378046 ) 1092963750492 Global-Ocean-Sampling_GS-28-01-01-1... 40 0...( EJ834521 ) 1093017609386 Global-Ocean-Sampling_GS-30-02-01-1... 36 1.1 2 ( EJ870952 ) 1093018347150 Global-Ocean-Samp...ling_GS-30-02-01-1... 36 1.1 2 ( EK149681 ) 1095456042258 Global-Ocean-Sampling_GS-31-01-01-1... ...RE... 34 3.0 6 ( AC177682 ) Strongylocentrotus purpuratus clone R3-1017C9, WO... 34 3.0 2 ( EJ581400 ) 10929

  18. Dicty_cDB: Contig-U00294-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available trongylocentrotus purpuratus clone R3-18G21, WOR... 46 3.5 1 ( ET096753 ) QM0AAA24CF02FM1 CCL1 Citrus clemen...eductase [NADH]; Short=... 139 1e-55 L11563_1( L11563 |pid:none) Petunia hybrida nitrate reductase apoe... 1...str. 7 DNA,... 55 4e-06 AL111168_5( AL111168 |pid:none) Campylobacter jejuni subsp. jejuni... 55 4e-06 CP000474_1511... Vitis vinifera contig VV78X087113.5, whole genome... 32 8.1 2 ( AC217677 ) Populus trichocarpa clone Pop1-97L1...00875_2850( CP000875 |pid:none) Herpetosiphon aurantiacus ATCC ... 119 4e-46 ( P2

  19. Dicty_cDB: Contig-U03670-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ) Strongylocentrotus purpuratus clone R3-3059I07, W... 50 0.049 1 ( ET089327 ) QM0AAA13DD03FM1 CCL1 Citrus c...99 ) Mus musculus BAC RP23-145M15 (Roswell Park Cance... 50 0.049 1 ( AC147260 ) Mus musculus BAC clone RP24-186L11...24-251O18 from chromosom... 48 0.19 1 ( AC141474 ) Mus musculus BAC clone RP24-192L11... 0.19 1 ( AC139062 ) Mus musculus chromosome 17, clone RP23-69L11, com... 48 0.19 1 ( AC138718 ) Mus musculu...6523 ) Mus musculus chromosome 9, clone RP24-349L11, com... 48 0.19 1 ( AC116482 ) Mus musculus chromoso

  20. Dicty_cDB: Contig-U15975-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available iywiyv*ymytvyyilyilyiq ylci*iymnikynvyslilfillllllvisiykggrveivvfllfffflffif--- ---in**ticsif*rfqngl*ftnfkdfktr.... 46 2.9 1 ( AC177336 ) Strongylocentrotus purpuratus clone R3-46L23, WOR... 36 3.4 5 ( AC229836 ) Monodelphis domestica clon...tein ligase Itchy homolog... 91 1e-16 AP005590_16( AP005590 |pid:none) Oryza sativa Japonica Group ge...e) Aspergillus oryzae RIB40 genomic... 74 9e-12 AP004187_7( AP004187 |pid:none) Oryza sativa Japonica Gro...Y810307_1( AY810307 |pid:none) Schistosoma japonicum SJCHGC03644 ... 67 2e-09 BC172391_1( BC172391 |pid:none) Synthetic constr

  1. Dicty_cDB: Contig-U12694-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 6 CP000777_2353( CP000777 |pid:none) Leptospira biflexa serovar Pato... 176 1e-42 AP009493_6570( AP009493 |pid:none) Str...e) Oryza sativa Japonica Group cDNA c... 200 6e-50 EU200974_1( EU200974 |pid:none) Triticum aestivum neutr...00804_3748( CP000804 |pid:none) Roseiflexus castenholzii DSM 13... 34 6.9 CP000141_1555( CP000141 |pid:none) Carboxydothermus hydro...283 Number of successful extensions: 1811 Number of sequences better than 10.0: 562 length of query: 843 len...e CH240-195P7, WORKING DRAFT SEQUE... 44 8.4 1 ( AC168419 ) Strongylocentrotus purpuratus clone R3-

  2. Dicty_cDB: Contig-U16390-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 38 1.8 CP001034_767( CP001034 |pid:none) Natranaerobius thermophilus JW/N... 38 2.3 CP000686_2932( CP000686 |pid:none) Roseiflex... 0.00 m3a: 0.00 m3b: 0.00 m_ : 1.00 40.0 %: extracellular, including cell wall 16.0 %: cytoplasmic 12.0 %: mitochon...te s... 46 7.1 1 ( AP008207 ) Oryza sativa (japonica cultivar-group) genomic DN... 46 7.1 1 ( AP0...s: 59344 Number of successful extensions: 6416 Number of sequences better than 10.0: 198 length of query: 2794 le...e:ddv43d20, 3' ... 198 8e-46 1 ( AC176379 ) Strongylocentrotus purpuratus clon

  3. Reconstructing SALMFamide neuropeptide precursor evolution in the phylum Echinodermata: ophiuroid and crinoid sequence data provide new insights

    Directory of Open Access Journals (Sweden)

    Maurice R Elphick

    2015-02-01

    Full Text Available The SALMFamides are a family of neuropeptides that act as muscle relaxants in echinoderms. Analysis of genome/transcriptome sequence data from the sea urchin Strongylocentrotus purpuratus (Echinoidea, the sea cucumber Apostichopus japonicus (Holothuroidea and the starfish Patiria miniata (Asteroidea reveals that in each species there are two types of SALMFamide precursor: an L-type precursor comprising peptides with a C-terminal LxFamide-type motif and an F-type precursor solely or largely comprising peptides with a C-terminal FxFamide-type motif. Here we have identified transcripts encoding SALMFamide precursors in the brittle star Ophionotus victoriae (Ophiuroidea and the feather star Antedon mediterranea (Crinoidea. We have also identified SALMFamide precursors in other species belonging to each of the five echinoderm classes. As in S. purpuratus, A. japonicus and P. miniata, in O. victoriae there is one L-type precursor and one F-type precursor. However, in A. mediterranea only a single SALMFamide precursor was found, comprising two peptides with a LxFamide-type motif, one with a FxFamide-type motif, five with a FxLamide-type motif and four with a LxLamide-type motif. As crinoids are basal to the Echinozoa (Holothuroidea + Echinoidea and Asterozoa (Asteroidea + Ophiuroidea in echinoderm phylogeny, one model of SALMFamide precursor evolution would be that ancestrally there was a single SALMFamide gene encoding a variety of SALMFamides (as in crinoids, which duplicated in a common ancestor of the Echinozoa and Asterozoa and then specialised to encode L-type SALMFamides or F-type SALMFamides. Alternatively, a second SALMFamide precursor may remain to be discovered or may have been lost in crinoids. Further insights will be obtained if SALMFamide receptors are identified, which would provide a molecular basis for experimental analysis of the functional significance of the cocktails of SALMFamides that exist in echinoderms.

  4. Reconstructing SALMFamide Neuropeptide Precursor Evolution in the Phylum Echinodermata: Ophiuroid and Crinoid Sequence Data Provide New Insights.

    Science.gov (United States)

    Elphick, Maurice R; Semmens, Dean C; Blowes, Liisa M; Levine, Judith; Lowe, Christopher J; Arnone, Maria I; Clark, Melody S

    2015-01-01

    The SALMFamides are a family of neuropeptides that act as muscle relaxants in echinoderms. Analysis of genome/transcriptome sequence data from the sea urchin Strongylocentrotus purpuratus (Echinoidea), the sea cucumber Apostichopus japonicus (Holothuroidea), and the starfish Patiria miniata (Asteroidea) reveals that in each species there are two types of SALMFamide precursor: an L-type precursor comprising peptides with a C-terminal LxFamide-type motif and an F-type precursor solely or largely comprising peptides with a C-terminal FxFamide-type motif. Here, we have identified transcripts encoding SALMFamide precursors in the brittle star Ophionotus victoriae (Ophiuroidea) and the feather star Antedon mediterranea (Crinoidea). We have also identified SALMFamide precursors in other species belonging to each of the five echinoderm classes. As in S. purpuratus, A. japonicus, and P. miniata, in O. victoriae there is one L-type precursor and one F-type precursor. However, in A. mediterranea only a single SALMFamide precursor was found, comprising two peptides with a LxFamide-type motif, one with a FxFamide-type motif, five with a FxLamide-type motif, and four with a LxLamide-type motif. As crinoids are basal to the Echinozoa (Holothuroidea + Echinoidea) and Asterozoa (Asteroidea + Ophiuroidea) in echinoderm phylogeny, one model of SALMFamide precursor evolution would be that ancestrally there was a single SALMFamide gene encoding a variety of SALMFamides (as in crinoids), which duplicated in a common ancestor of the Echinozoa and Asterozoa and then specialized to encode L-type SALMFamides or F-type SALMFamides. Alternatively, a second SALMFamide precursor may remain to be discovered or may have been lost in crinoids. Further insights will be obtained if SALMFamide receptors are identified, which would provide a molecular basis for experimental analysis of the functional significance of the "cocktails" of SALMFamides that exist in echinoderms. PMID:25699014

  5. Cell-surface proteoglycan in sea urchin primary mesenchyme cell migration

    Energy Technology Data Exchange (ETDEWEB)

    Lane, M.C.

    1989-01-01

    Early in the development of the sea urchin embryo, the primary mesenchyme cells (PMC) migrate along the basal lamina of the blastocoel. Migration is inhibited in L. pictus embryos cultured in sulfate-free seawater and in S. purpuratus embryos exposed to exogenous {beta}-D-xylosides. An in vitro assay was developed to test the migratory capacity of normal PMC on normal and treated blastocoelic matrix. Sulfate deprivation and exposure to exogenous xyloside render PMC nonmotile on either matrix. Materials removed from the surface of normal PMC by treatment with 1 M urea restored migratory ability to defective cells, whereas a similar preparation isolated from the surface of epithelial cells at the same stage did not. Migration also resumed when cells were removed from the xyloside or returned to normal seawater. The urea extract was partially purified and characterized by radiolabeling, gel electrophoresis, fluorography, ion exchange chromatography, and western blotting. The PMC synthesize a large chondroitin sulfate/dermatan sulfate proteoglycan that is present in an active fraction isolated by chromatography. Chondroitinase ABC digestion of live cells blocked migration reversibly, further supporting the identification of the chondroitin sulfate/dermatan sulfate proteoglycan as the active component in the urea extract. Much of the incorporated sulfate was distributed along the filopodia in {sup 35}SO{sub 4}-labelled PMC by autoradiography. The morphology of normal and treated S. purpuratus PMC was examined by scanning electron microscopy, and differences in spreading, particularly of the extensive filopodia present on the cells, was observed. A model for the role of the chondroitin sulfate/dermatan sulfate proteoglycan in cell detachment during migration is proposed.

  6. Dynamic evolution of toll-like receptor multigene families in echinoderms.

    Science.gov (United States)

    Buckley, Katherine M; Rast, Jonathan P

    2012-01-01

    The genome sequence of the purple sea urchin, Strongylocentrotus purpuratus, a large and long-lived invertebrate, provides a new perspective on animal immunity. Analysis of this genome uncovered a highly complex immune system in which the gene families that encode homologs of the pattern recognition receptors that form the core of vertebrate innate immunity are encoded in large multigene families. The sea urchin genome contains 253 Toll-like receptor (TLR) sequences, more than 200 Nod-like receptors and 1095 scavenger receptor cysteine-rich domains, a 10-fold expansion relative to vertebrates. Given their stereotypic protein structure and simple intron-exon architecture, the TLRs are the most tractable of these families for more detailed analysis. A role for these receptors in immune defense is suggested by their similarity to TLRs in other organisms, sequence diversity, and expression in immunologically active tissues, including phagocytes. The complexity of the sea urchin TLR multigene families is largely derived from expansions independent of those in vertebrates and protostomes, although a small family of TLRs with structure similar to that of Drosophila Toll can be traced to an ancient eumetazoan ancestor. Several other echinoderm sequences are now available, including Lytechinus variegatus, as well as partial sequences from two other sea urchin species. Here, we present an analysis of the invertebrate deuterostome TLRs with emphasis on the echinoderms. Representatives of most of the S. purpuratus TLR subfamilies and homologs of the mccTLR sequences are found in L. variegatus, although the L. variegatus TLR gene family is notably smaller (68 TLR sequences). The phylogeny of these genes within sea urchins highlights lineage-specific expansions at higher resolution than is evident at the phylum level. These analyses identify quickly evolving TLR subfamilies that are likely to have novel immune recognition functions and other, more stable, subfamilies that may

  7. Dynamic evolution of toll-like receptor multigene families in echinoderms

    Directory of Open Access Journals (Sweden)

    Katherine M Buckley

    2012-06-01

    Full Text Available The genome of the purple sea urchin, Strongylocentrotus purpuratus, was the first to be sequenced from a long-lived large invertebrate. Analysis of this genome uncovered a surprisingly complex immune system in which the moderately sized sets of pattern recognition receptors that form the core of vertebrate innate immunity are encoded in large multigene families. The sea urchin genome contains 253 Toll-like receptor (TLR genes, more than 200 Nod-like receptors and 1095 scavenger receptor cysteine-rich domains, a ten-fold expansion relative to vertebrates. Given their stereotypic structure and simple intron-exon architecture, the TLRs are the most tractable of these families for more detailed analysis. An immune defense role for these receptors is suggested by their sequence diversity and expression in immunologically active tissues, including phagocytes. This complexity of the sea urchin TLR multigene families largely derives from expansions that are independent of those in vertebrates and protostomes, although a small family of TLRs with structure similar to that of Drosophila Toll likely originated in an ancient eumetazoan ancestor. Several other invertebrate deuterostome genomes have been sequenced, including the cephalochordate, Branchiostoma floridae and the sea urchin Lytechinus variegatus, as well as partial sequences from two other sea urchin species. Here, we present an analysis of the invertebrate deuterostome TLRs with emphasis on the echinoderms. Representatives of most of the S. purpuratus TLR subfamilies and homologs of the protostome-like sequences are found in L. variegatus. The phylogeny of these genes within sea urchins highlights lineage-specific expansions at higher resolution than is evident at the phylum level. These analyses identify quickly evolving TLR subfamilies that are likely to have novel functions and other, more stable, subfamilies that may function similarly to those of vertebrates.

  8. Substituting mouse transcription factor Pou4f2 with a sea urchin orthologue restores retinal ganglion cell development

    Science.gov (United States)

    Mocko-Strand, Julie A.; Wang, Jing; Ullrich-Lüter, Esther; Pan, Ping; Wang, Steven W.; Arnone, Maria Ina; Frishman, Laura J.; Klein, William H.

    2016-01-01

    Pou domain transcription factor Pou4f2 is essential for the development of retinal ganglion cells (RGCs) in the vertebrate retina. A distant orthologue of Pou4f2 exists in the genome of the sea urchin (class Echinoidea) Strongylocentrotus purpuratus (SpPou4f1/2), yet the photosensory structure of sea urchins is strikingly different from that of the mammalian retina. Sea urchins have no obvious eyes, but have photoreceptors clustered around their tube feet disc. The mechanisms that are associated with the development and function of photoreception in sea urchins are largely unexplored. As an initial approach to better understand the sea urchin photosensory structure and relate it to the mammalian retina, we asked whether SpPou4f1/2 could support RGC development in the absence of Pou4f2. To answer this question, we replaced genomic Pou4f2 with an SpPou4f1/2 cDNA. In Pou4f2-null mice, retinas expressing SpPou4f1/2 were outwardly identical to those of wild-type mice. SpPou4f1/2 retinas exhibited dark-adapted electroretinogram scotopic threshold responses, indicating functionally active RGCs. During retinal development, SpPou4f1/2 activated RGC-specific genes and in S. purpuratus, SpPou4f2 was expressed in photoreceptor cells of tube feet in a pattern distinct from Opsin4 and Pax6. Our results suggest that SpPou4f1/2 and Pou4f2 share conserved components of a gene network for photosensory development and they maintain their conserved intrinsic functions despite vast morphological differences in mouse and sea urchin photosensory structures. PMID:26962139

  9. Molecular cloning of hsf1 and hsbp1 cDNAs, and the expression of hsf1, hsbp1 and hsp70 under heat stress in the sea cucumber Apostichopus japonicus.

    Science.gov (United States)

    Xu, Dongxue; Sun, Lina; Liu, Shilin; Zhang, Libin; Yang, Hongsheng

    2016-08-01

    The heat shock response (HSR) is known for the elevated synthesis of heat shock proteins (HSPs) under heat stress, which is mediated primarily by heat shock factor 1 (HSF1). Heat shock factor binding protein 1 (HSBP1) and feedback control of heat shock protein 70 (HSP70) are major regulators of the activity of HSF1. We obtained full-length cDNA of genes hsf1 and hsbp1 in the sea cucumber Apostichopus japonicus, which are the second available for echinoderm (after Strongylocentrotus purpuratus), and the first available for holothurian. The full-length cDNA of hsf1 was 2208bp, containing a 1326bp open reading frame encoding 441 amino acids. The full-length cDNA of hsbp1 was 2850bp, containing a 225bp open reading frame encoding 74 amino acids. The similarities of A. japonicus HSF1 with other species are low, and much higher similarity identities of A. japonicus HSBP1 were shared. Phylogenetic trees showed that A. japonicus HSF1 and HSBP1 were clustered with sequences from S. purpuratus, and fell into distinct clades with sequences from mollusca, arthropoda and vertebrata. Analysis by real-time PCR showed hsf1 and hsbp1 mRNA was expressed constitutively in all tissues examined. The expression of hsf1, hsbp1 and hsp70 in the intestine at 26°C was time-dependent. The results of this study might provide new insights into the regulation of heat shock response in this species. PMID:26952354

  10. Reconstructing SALMFamide Neuropeptide Precursor Evolution in the Phylum Echinodermata: Ophiuroid and Crinoid Sequence Data Provide New Insights

    Science.gov (United States)

    Elphick, Maurice R.; Semmens, Dean C.; Blowes, Liisa M.; Levine, Judith; Lowe, Christopher J.; Arnone, Maria I.; Clark, Melody S.

    2015-01-01

    The SALMFamides are a family of neuropeptides that act as muscle relaxants in echinoderms. Analysis of genome/transcriptome sequence data from the sea urchin Strongylocentrotus purpuratus (Echinoidea), the sea cucumber Apostichopus japonicus (Holothuroidea), and the starfish Patiria miniata (Asteroidea) reveals that in each species there are two types of SALMFamide precursor: an L-type precursor comprising peptides with a C-terminal LxFamide-type motif and an F-type precursor solely or largely comprising peptides with a C-terminal FxFamide-type motif. Here, we have identified transcripts encoding SALMFamide precursors in the brittle star Ophionotus victoriae (Ophiuroidea) and the feather star Antedon mediterranea (Crinoidea). We have also identified SALMFamide precursors in other species belonging to each of the five echinoderm classes. As in S. purpuratus, A. japonicus, and P. miniata, in O. victoriae there is one L-type precursor and one F-type precursor. However, in A. mediterranea only a single SALMFamide precursor was found, comprising two peptides with a LxFamide-type motif, one with a FxFamide-type motif, five with a FxLamide-type motif, and four with a LxLamide-type motif. As crinoids are basal to the Echinozoa (Holothuroidea + Echinoidea) and Asterozoa (Asteroidea + Ophiuroidea) in echinoderm phylogeny, one model of SALMFamide precursor evolution would be that ancestrally there was a single SALMFamide gene encoding a variety of SALMFamides (as in crinoids), which duplicated in a common ancestor of the Echinozoa and Asterozoa and then specialized to encode L-type SALMFamides or F-type SALMFamides. Alternatively, a second SALMFamide precursor may remain to be discovered or may have been lost in crinoids. Further insights will be obtained if SALMFamide receptors are identified, which would provide a molecular basis for experimental analysis of the functional significance of the “cocktails” of SALMFamides that exist in echinoderms. PMID:25699014

  11. Cell-surface proteoglycan in sea urchin primary mesenchyme cell migration

    International Nuclear Information System (INIS)

    Early in the development of the sea urchin embryo, the primary mesenchyme cells (PMC) migrate along the basal lamina of the blastocoel. Migration is inhibited in L. pictus embryos cultured in sulfate-free seawater and in S. purpuratus embryos exposed to exogenous β-D-xylosides. An in vitro assay was developed to test the migratory capacity of normal PMC on normal and treated blastocoelic matrix. Sulfate deprivation and exposure to exogenous xyloside render PMC nonmotile on either matrix. Materials removed from the surface of normal PMC by treatment with 1 M urea restored migratory ability to defective cells, whereas a similar preparation isolated from the surface of epithelial cells at the same stage did not. Migration also resumed when cells were removed from the xyloside or returned to normal seawater. The urea extract was partially purified and characterized by radiolabeling, gel electrophoresis, fluorography, ion exchange chromatography, and western blotting. The PMC synthesize a large chondroitin sulfate/dermatan sulfate proteoglycan that is present in an active fraction isolated by chromatography. Chondroitinase ABC digestion of live cells blocked migration reversibly, further supporting the identification of the chondroitin sulfate/dermatan sulfate proteoglycan as the active component in the urea extract. Much of the incorporated sulfate was distributed along the filopodia in 35SO4-labelled PMC by autoradiography. The morphology of normal and treated S. purpuratus PMC was examined by scanning electron microscopy, and differences in spreading, particularly of the extensive filopodia present on the cells, was observed. A model for the role of the chondroitin sulfate/dermatan sulfate proteoglycan in cell detachment during migration is proposed

  12. Esponjas (Porifera, Demospongiae da plataforma continental ao largo do Estado do Amapá, Brasil Sponges (Porifera, Demospongiae of the continental shelf off the coast of Amapá State, Brazil

    Directory of Open Access Journals (Sweden)

    Beatriz Mothes

    2006-09-01

    Full Text Available As amostras foram coletadas com draga retangular ao largo da costa (04º13'00" -02º34'02" N, 47º54'05" -50º50'07" W, pela Comissão Pesca Norte I, em 1968, através da Diretoria de Hidrografia e Navegação da Marinha do Brasil com o N./Oc. " Almirante Saldanha" em profundidades que variaram de 56 a 95 m. Oito espécies são aqui registradas, entre as quais Niphates alba Van Soest, 1980, Placospongia melobesioides Gray, 1867 e Terpios belindae Rützler & Smith, 1993 são identificadas pela primeira vez para a costa brasileira. As demais espécies, Aplysina fulva (Pallas, 1766, Ircinia strobilina (Lamarck, 1816, Niphates erecta (Duchassaing & Michelotti, 1864, Neopetrosia proxima (Duchassaing & Michelotti, 1864 e Plakinastrella onkodes Uliczka, 1929 são conhecidas pela primeira vez para a área estudada. Todas as espécies identificadas são também registradas para o Caribe. Os espécimes encontram-se depositados na Coleção de Porifera do Museu de Ciências Naturais, Fundação Zoobotânica do Rio Grande do Sul, Brasil.The collections were dredged off the coast (04º13'00" -02º34'02" N, 47º54'05" -50º50'07" W. They were collected between 56 to 95 depths, during an oceanographic expedition, Diretoria de Hidrografia e Navegação da Marinha do Brasil, by R/V " Almirante Saldanha" in 1968. Eight species are here registered, among which Niphates alba Van Soest, 1980, Placospongia melobesioides Gray, 1867 and Terpios belindae Rützler & Smith, 1993 represent new registers for Brazil. The other species: Aplysina fulva (Pallas, 1766, Ircinia strobilina (Lamarck, 1816, Niphates erecta Duchassaing & Michelotti, 1864, Neopetrosia proxima (Duchassaing & Michelotti, 1864 and Plakinastrella onkodes Uliczka, 1929 represent new records to the studied area. All registered species are also known from Caribbean. Specimens are deposited in the Porifera Collection of the Museu de Ciências Naturais, Fundação Zoobotânica do Rio Grande do Sul, Brazil.

  13. O darwinismo e seu outro, a teoria transformacional da evolução Darwinism and its other, the transformational theory of evolution

    Directory of Open Access Journals (Sweden)

    Gustavo Caponi

    2005-06-01

    Full Text Available O programa darwiniano sempre teve que enfrentar o desafio de uma plêiade de teorias alternativas que, por compartilhar um conjunto de pressupostos fundamentais, podem ser consideradas como formulações distintas de um único programa de pesquisa dirigido para o objetivo de articular aquilo que, seguindo a Richard Lewontin e a Elliot Sober, podemos caracterizar como uma explicação transformacional da evolução, alternativa à explicação de tipo variacional ou selecional proposta por Darwin. Antes de 1859, a teoria transformacional já tinha sido entrevista, de diferentes ângulos, por Lamarck, Geoffroy Saint-Hilaire e Chambers. Paradoxalmente, é somente depois da publicação de A origem das espécies que ela parece adquirir maior plausibilidade. O próprio Owen se atreve inclusive a sugeri-la; e, a partir daí, desde Spencer e Häeckel, passando pelos defensores da ortogênese, pelos neo-lamarkianos americanos, e chegando até Brian Goodwin, essa obstinada hidra epistemológica nunca cessou de se insinuar como sendo ou uma genuína alternativa ou um necessário complemento da teoria da seleção natural.The darwinian program has always had to face the challenge of a constellation of alternative theories that, for having a common set of fundamental presuppositions, they can considered, all of them, as modifications of only one research program directed to the objective of articulate what, following Richard Lewontin and Eliot Sober, we can characterize as a transformational explanation of evolution alternative to the variational or selectional explanation proposed by Darwin. Before 1859, that transformational theory had been suggested, from a diferent point of view, by Lamarck, Geoffroy Saint-Hilaire and Chambers; but, paradoxically, it is only after the publication of On the origin of the species that this theory won greater plausibility. Owen himself suggested it; and from Spencer and Häeckel, passing through the defenders of the

  14. 对企业知识创造类生物现象及知识基因论的再思考%Rethinking on Biological Phenomenon and Knowledge Gene of Knowledge Creation in Enterprises

    Institute of Scientific and Technical Information of China (English)

    赵健宇; 李柏洲

    2014-01-01

    为揭示知识创造的本质和规律,采用二分法将新达尔文主义和拉马克主义两种观点予以融合。在此基础上,根据生物进化原理,围绕知识的类基因特性对知识基因、知识进化的选择、重组和变异以及知识进化与环境的关系进行解释。研究结果表明:纯粹的知识创造主要是新达尔文式的演化,体现知识创造的不确定性、随机性和不可控性。相对应地,知识的复制、流动等过程则具有更多的拉马克现象,带有明确的指向且结果可以被预测。知识基因的选择、重组和变异是知识得以被创造的根本原因。知识创造的方向受到环境的影响,知识创造的动力源于知识主体对环境的学习,新知识能够对环境进行改变。%In order to reveal the nature and patterns of knowledge creation, this thesis combines Neo-Darwinism with Lamarckism using Dichotomy. Based on biological evolution theories, we interpret knowledge gene, knowledge evolution's selection, restructuring and variation, as well as the relationship between knowledge evolution and the environment, with the acknowledgement that knowledge has characteristics in common with gene. Research results show that, knowledge creation in itself is evolution of Neo-Darwinism, reflecting that knowledge creation is uncer-tain, random and unpredictable. Correspondingly, Lamarckism could be reflected in knowledge's replication and flows, with certain direction and predictable results. The selection, restructuring and variation of knowledge are the basic reason why knowledge could be created. The direction of knowledge creation is affected by the environ-ment. The driving force of knowledge creation has its origin in the learning process of knowledge workers in the environment, and new knowledge can change the environment accordingly.

  15. De novo assembly and characterization of two transcriptomes reveal multiple light-mediated functions in the scallop eye (Bivalvia: Pectinidae.

    Directory of Open Access Journals (Sweden)

    Autum N Pairett

    Full Text Available BACKGROUND: The eye has evolved across 13 separate lineages of molluscs. Yet, there have been very few studies examining the molecular machinary underlying eye function of this group, which is due, in part, to a lack of genomic resources. The scallop (Bivalvia: Pectinidae represents a compeling molluscan model to study photoreception due to its morphologically novel and separately evolved mirror-type eye. We sequenced the adult eye transcriptome of two scallop species to: 1 identify the phototransduction pathway components; 2 identify any additional light detection functions; and 3 test the hypothesis that molluscs possess genes not found in other animal lineages. RESULTS: A total of 3,039 contigs from the bay scallop, Argopecten irradians and 26,395 contigs from the sea scallop, Placopecten magellanicus were produced by 454 sequencing. Targeted BLAST searches and functional annotation using Gene Ontology (GO terms and KEGG pathways identified transcripts from three light detection systems: two phototransduction pathways and the circadian clock, a previously unrecognized function of the scallop eye. By comparing the scallop transcriptomes to molluscan and non-molluscan genomes, we discovered that a large proportion of the transcripts (7,776 sequences may be specific to the scallop lineage. Nearly one-third of these contain transmembrane protein domains, suggesting these unannotated transcripts may be sensory receptors. CONCLUSIONS: Our data provide the most comprehensive transcriptomic resource currently available from a single molluscan eye type. Candidate genes potentially involved in sensory reception were identified, and are worthy of further investigation. This resource, combined with recent phylogenetic and genomic data, provides a strong foundation for future investigations of the function and evolution of molluscan photosensory systems in this morphologically and taxonomically diverse phylum.

  16. Short- and long-term consequences of larval stage exposure to constantly and ephemerally elevated carbon dioxide for marine bivalve populations

    Directory of Open Access Journals (Sweden)

    C. J. Gobler

    2013-04-01

    Full Text Available While larval bivalves are highly sensitive to ocean acidification, the basis for this sensitivity and the longer-term implications of this sensitivity are unclear. Experiments were performed to assess the short-term (days and long-term (months consequences of larval stage exposure to varying CO2 concentrations for calcifying bivalves. Higher CO2 concentrations depressed both calcification rates assessed using 45Ca uptake and RNA : DNA ratios in Mercenaria mercenaria and Argopecten irradians larvae with RNA : DNA ratios being highly correlated with larval growth rates (r2>0.9. These findings suggested that high CO2 has a cascading negative physiological impact on bivalve larvae stemming in part from lower calcification rates. Exposure to elevated CO2 during the first four days of larval development significantly depressed A. irradians larval survival rates, while a 10-day exposure later in larval development did not, demonstrating the extreme CO2 sensitivity of bivalve larvae during first days of development. Short- (weeks and long-term (10 month experiments revealed that individuals surviving exposure to high CO2 during larval development grew faster when exposed to normal CO2 as juveniles compared to individuals reared under ambient CO2 as larvae. These increased growth rates could not, however, overcome size differences established during larval development, as size deficits of individuals exposed to even moderate levels of CO2 as larvae were evident even after 10 months of growth under normal CO2 concentrations. This "legacy effect" emphasizes the central role larval stage CO2 exposure can play in shaping the success of modern-day bivalve populations.

  17. Short and long term consequences of larval stage exposure to constantly and ephemerally elevated carbon dioxide for marine bivalve populations

    Directory of Open Access Journals (Sweden)

    C. J. Gobler

    2012-11-01

    Full Text Available While larval bivalves are highly sensitive to ocean acidification, the basis for this sensitivity and the longer term implications of this sensitivity are unclear. Experiments were performed to assess the short term (days and long term (months consequences of larval stage exposure to varying CO2 concentrations for calcifying bivalves. Higher CO2 concentrations depressed both calcification rates assessed using 45Ca uptake and RNA:DNA ratios in Mercenaria mercenaria and Argopecten irradians larvae with RNA:DNA ratios being highly correlated with larval growth rates r2 > 0.9. These findings suggested that high CO2 has a cascading negative physiological impact on bivalve larvae stemming in part from lower calcification rates. Exposure to elevated CO2 during the first four days of larval development significantly depressed A. irradians larval survival rates, while a 10 day exposure later in larval development did not, demonstrating the extreme CO2-sensitivity of bivalve larvae during first days of development. Short- (weeks and long-term (10 month experiments revealed that individuals surviving exposure to high CO2 during larval development grew faster when exposed to normal CO2 as juveniles compared to individuals reared under ambient CO2 as larvae. These increased growth rates could not, however, overcome size differences established during larval development, as size deficits of individuals exposed to even moderate levels of CO2 as larvae were evident even after 10 months of growth under normal CO2 concentrations. This `legacy effect' emphasizes the central role larval stage CO2 exposure can play in shaping the success of modern day bivalve populations.

  18. The search for minimum-energy atomic configurations on a lattice: Lamarckian twist on Darwinian Evolution

    Science.gov (United States)

    D'Avezac, Mayeul; Zunger, Alex

    2008-03-01

    We examine how two different mechanisms proposed historically for biological evolution compare for the determination of crystal structures from random initial lattice-configurations. The Darwinian theory of evolution contends that the genetic makeup inherited at birth is the one passed on to offsprings. Lamarck surmised additionally that offspring can inherit acquired traits. In the case of lattice-configurations, such improvements consist in AB transmutations of atomic sites as guided by ``Virtual Atom'' energy-gradients(M. d'Avezac and Alex Zunger, J. Phys.: Cond. Matt. 19, 402201 (2007)). This hybrid evolution is shown to provide an efficient solution to a generalized Ising Hamiltonian, illustrated by finding the ground-states of face-centered cubic Au1-xPdx using a cluster-expansion functional fitted to first-principles total-energies. For example, finding all minimum-energy structures of a 32-atom supercell with 95,% confidence requires evaluating 750, 000 configurations using local improvements only, 150, 000 using a reciprocal-space genetic algorithm only, and 14,000 using the hybrid approach. We consider applying the lamarckian search to further functionals.

  19. The instinctual nation-state: non-Darwinian theories, state science and ultra-nationalism in Oka Asajirō's Evolution and Human Life.

    Science.gov (United States)

    Sullivan, Gregory

    2011-01-01

    In his anthology of socio-political essays, Evolution and Human Life, Oka Asajirō (1868-1944), early twentieth century Japan's foremost advocate of evolutionism, developed a biological vision of the nation-state as super-organism that reflected the concerns and aims of German-inspired Meiji statism and anticipated aspects of radical ultra-nationalism. Drawing on non-Darwinian doctrines, Oka attempted to realize such a fused or organic state by enhancing social instincts that would bind the minzoku (ethnic nation) and state into a single living entity. Though mobilization during the Russo-Japanese War seemed to evince this super-organism, the increasingly contentious and complex society that emerged in the war's aftermath caused Oka to turn first to Lamarckism and eventually to orthogenesis in the hopes of preserving the instincts needed for a viable nation-state. It is especially in the state interventionist measures that Oka finally came to endorse in order to forestall orthogenetically-driven degeneration that the technocratic proclivities of his statist orientation become most apparent. The article concludes by suggesting that Oka's emphasis on degeneration, autarkic expansion, and, most especially, totalitarian submersion of individuals into the statist collectivity indicates a complex relationship between his evolutionism and fascist ideology, what recent scholarship has dubbed radical Shinto ultra-nationalism. PMID:21080039

  20. Freshwater snails and schistosomiasis mansoni in the State of Rio de Janeiro, Brazil: I - metropolitan mesoregion

    Directory of Open Access Journals (Sweden)

    Thiengo Silvana C

    2001-01-01

    Full Text Available In order to elaborate a planorbid chart of the State of Rio de Janeiro a survey of freshwater gastropods in the Metropolitan Mesoregion of this State was performed and revealed the occurrence of 20 species: Antillorbis nordestensis (Lucena, 1954; Biomphalaria glabrata (Say, 1818; Biomphalaria schrammi (Crosse, 1864; Biomphalaria straminea (Dunker, 1848; Biomphalaria tenagophila (Orbigny, 1835; Burnupia sp.; Drepanotrema anatinum (Orbigny, 1835; Drepanotrema cimex (Moricand, 1839; Drepanotrema lucidum (Pfeiffer, 1839; Ferrissia sp.; Gundlachia ticaga (Marcus & Marcus, 1962; Heleobia davisi Silva & Thomé, 1985; Lymnaea columella Say, 1817; Melanoides tuberculatus (Müller, 1774; Physa cubensis Pfeiffer, 1839; Physa marmorata Guilding, 1828; Pomacea sp.; Pomacea canaliculata (Lamarck, 1822; Pomacea lineata (Spix, 1827 and Pomacea sordida (Swainson, 1823. Among the planorbid species B. tenagophila was the most frequent, occurring in all municipalities surveyed. The present study extends the distribution of B. straminea in the State of Rio de Janeiro and reports new records for A. nordestensis, B. schrammi, G. ticaga, H. davisi and the genera Burnupia and Ferrissia. An account about the current transmission areas of schistosomiasis mansoni in this Mesoregion is presented as well.

  1. Between two worlds: Yamanouchi Shigeo and eugenics in early twentieth-century Japan.

    Science.gov (United States)

    Otsubo, Sumiko

    2005-04-01

    This paper explores the eugenic through of Yamanouchi Shigeo (1876-1973), who was trained in plant cytology under the tutelage of botanist and eugenicist John Coulter (1851-1928) in the USA, and later become one of the early and important popularizers of eugenic ideas in Japan. His career demonstrates a direct link between Japanese and US eugenics. Despite his academic training and research at various internationally renowned institutions, numerous publications, and longevity, his life has received little scholarly attention. By the early twentieth century, most biologists in Japan, as in the USA, began accepting Mendelian evolutionary theory and rejecting the Lamarckian notion of inheritance of acquire characteristics. However, Yamanouchi Shigeo's eugenic view represents a paradox: he was a mendelian cytologist sympathetic to Lamarckism. Was his 'nurture'-oriented eugenic view unscientific? is that why he was largely ignored in the history of botany in Japan? This study attempts to answer these questions and to analyse the origins and distinct features of Yamanouchi's eugenic ideas by situating Yamanouchi's eugenic through historically and culturally. After examining his scientific papers, popular writings, and documents of various organizations to which he belonged, I argue that Yamanouchi's 'softer' (or less biologically deterministic) perspective may have reflected the Japanese desire to catch up with the dominant 'race' by using eugenics without accepting permanent inferior status. PMID:15789487

  2. Phylogenetic systematics of the Indo-Pacific heart urchin Metalia Gray, 1885

    Science.gov (United States)

    Guevara-Plunkett, S.; Mooi, R.

    2014-12-01

    Irregular sea urchins of the clade Spatangoida, informally known as heart urchins, form a major and important component of tropical marine ecosystems. The spatangoid sea urchin genus, Metalia Gray 1885, a member of the spatangoid family Brissidae, is known primarily from the Indo-pacific region, although one species is known from the west coast of North America. Examination of new material is adding significantly to our knowledge of the morphology and taxonomy of Metalia. There are nine known species: Metalia spatagus (Linnaeus, 1758); Metalia sternalis (Lamarck, 1816); Metalia townsendi (Bell, 1904); Metalia nobilis Verrill, 1867-71; Metalia robillardi (de Loriol, 1876); Metalia dicrana H.L. Clark, 1917; Metalia latissima H.L. Clark, 1925; Metalia persica (Mortensen, 1940); Metalia angustus de Ridder, 1984; and Metalia kermadecensis Baker & Rowe, 1990. In addition, we have discovered two Philippines species new to science. Our work is presently removing ambiguities among characters used to typify all known Metalia, allowing for the establishment of more reliable species identification. A morphology-based phylogenetic analysis of Metalia using outgroup comparisons among brissid taxa such as Anametalia, Granobrissoides, Rhynobrissus, Brissopsis, Eupatatus, Meoma, and Brissus suggests that Metalia is monophyletic. An intriguing possibility is that the very distinctive and beautiful form from North America, Plagiobrissus, is very closely related to and possibly evolved from within Metalia. We are also studing various aspects of the biogeography and growth of Metalia.

  3. The shallow-water chitons (Mollusca, Polyplacophora of Caldera, Region of Atacama, northern Chile

    Directory of Open Access Journals (Sweden)

    Juan Francisco Araya

    2015-03-01

    Full Text Available The Molluscan species of the northern littoral of Chile have been sparsely studied. This work reviews for the first time the diversity of polyplacophoran molluscs around the port of Caldera, in the Region of Atacama (26°45’49”S; 70°45’17”W to 27°20’23”S; 70°56’46”W, northern Chile. Eleven species were found in this study: Acanthopleura echinata (Barnes, 1824; Callistochiton pulchellus (Gray, 1828; Calloplax vivipara (Plate, 1899, Chaetopleura peruviana (Lamarck, 1819; Chiton cumingsii Frembly, 1827; Chiton granosus Frembly, 1827; Chiton magnificus Deshayes, 1827; Enoplochiton niger (Barnes, 1824, Radsia barnesii (Gray, 1828, Tonicia atrata (G. B. Sowerby II, 1840 and Tonicia chilensis (Frembly, 1827. All of the species occurring in the area have distributions in the southeastern Pacific Ocean, from Ecuador to central Chile, and three of them are species endemic to the Chilean coasts (Calloplax vivipara, Radsia barnesii, and Tonicia atrata. This diversity of species is comparable to that of better surveyed faunas of central and southern Chile or Patagonia. Of the eleven species recorded, the geographic distribution records for Callistochiton pulchellus, Radsia barnesii and Tonicia atrata are extended, and Calloplax vivipara is found alive again after 40 years, filling a gap in its known distribution. Illustrations of living specimens in their habitat, distribution records and a taxonomic key for all the studied taxa are also provided.

  4. The search for purpose in a post-Darwinian universe: George Bernard Shaw, 'creative evolution', and Shavian eugenics: 'The dark side of the force'.

    Science.gov (United States)

    Hale, Piers J

    2006-01-01

    The Irish playwright and socialist George Bernard Shaw has been of marginal concern for historians of biology because his vitalist Lamarckism has been viewed as out of step with contemporary science. However, Julian Huxley and J.B.S. Haldane were certainly of the opinion that Shaw was a man of influence in this regard and took pains to counter his views in their own attempts to engage the public in science. Previously, Shaw's colleague and friend H.G. Wells had also agued with Shaw from his own mechanistic neo-Darwinian perspective. The very public debate between Shaw and Wells, which continued to concern Huxley and Haldane, shows that public concern over the moral implications of Darwinism has a long history. Taking into account the opinions of John Maynard Smith on this matter, I suggest that a consideration of Shaw in this context can give us an understanding of the historical popularity of vitalist teleology as well as of the persistent ambivalence to the non-normative character of Darwinism. PMID:17702503

  5. Monod before Monod: enzymatic adaptation, Lwoff, and the legacy of general biology.

    Science.gov (United States)

    Loison, Laurent

    2013-01-01

    For most of his scientific career, Jacques Monod appeared to be a man of a single problem: the formation of enzymes and the regulation of their properties. His ability to produce theoretical models led him to play a major role in both the discovery of the operon regulation and the model of allosteric transitions. The successes of Monod, from the 1950s to the Noble Prize (1965), are already well documented. In this paper, I will focus on the Monod before Monod, that is, the Monod who, during the 1940s, tried to explain the fundamental phenomenon of enzymatic adaptation. To begin with, however, I will survey how this phenomenon was discovered and explained by French Pasteurians at the very beginning of the twentieth century. This first explanation took place amidst an entrenched Lamarckian atmosphere in French thought, which was still alive during the 1920s and the 1930s, when Monod commenced the study of biology at the Sorbonne. Because of his will to construct a scientific biology free from teleology, Monod always tried to break from the legacy of this traditional background of Lamarckism, and he consequently developed ways of thinking that, in the main, were not part of the French biological tradition. Nevertheless, one point did link Monod to French history: his fruitful interactions with André Lwoff. As we shall see, these interactions were necessary for the development of Monod's science, both technically and intellectually speaking. PMID:24466631

  6. Adaptation or malignant transformation: the two faces of epigenetically mediated response to stress.

    Science.gov (United States)

    Vojta, Aleksandar; Zoldoš, Vlatka

    2013-01-01

    Adaptive response to stress is a fundamental property of living systems. At the cellular level, many different types of stress elicit an essentially limited repertoire of adaptive responses. Epigenetic changes are the main mechanism for medium- to long-term adaptation to accumulated (intense, long-term, or repeated) stress. We propose the adaptive deregulation of the epigenome in response to stress (ADERS) hypothesis which assumes that the unspecific adaptive stress response grows stronger with the increasing stress level, epigenetically activating response gene clusters while progressively deregulating other cellular processes. The balance between the unspecific adaptive response and the general epigenetic deregulation is critical because a strong response can lead to pathology, particularly to malignant transformation. The main idea of our hypothesis is the continuum traversed by a cell subjected to accumulated stress, which lies between an unspecific adaptive response and pathological deregulation--the two extremes sharing the same underlying cause, which is a manifestation of a unified epigenetically mediated adaptive response to stress. The evolutionary potential of epigenetic regulation in multigenerational adaptation is speculatively discussed in the light of neo-Lamarckism. Finally, an approach to testing the proposed hypothesis is presented, relying on either the publicly available datasets or on conducting new experiments. PMID:24187667

  7. "Synergistic selection": a Darwinian frame for the evolution of complexity.

    Science.gov (United States)

    Corning, Peter A; Szathmáry, Eörs

    2015-04-21

    Non-Darwinian theories about the emergence and evolution of complexity date back at least to Lamarck, and include those of Herbert Spencer and the "emergent evolution" theorists of the later nineteenth and early twentieth centuries. In recent decades, this approach has mostly been espoused by various practitioners in biophysics and complexity theory. However, there is a Darwinian alternative - in essence, an economic theory of complexity - proposing that synergistic effects of various kinds have played an important causal role in the evolution of complexity, especially in the "major transitions". This theory is called the "synergism hypothesis". We posit that otherwise unattainable functional advantages arising from various cooperative phenomena have been favored over time in a dynamic that the late John Maynard Smith characterized and modeled as "synergistic selection". The term highlights the fact that synergistic "wholes" may become interdependent "units" of selection. We provide some historical perspective on this issue, as well as a brief explication of the underlying theory and the concept of synergistic selection, and we describe two relevant models. PMID:25681798

  8. Partial Life History of Chrysodeixis includens (Lepidoptera: Noctuidae) on Summer Hosts.

    Science.gov (United States)

    Moonga, M N; Davis, J A

    2016-08-01

    The soybean looper, Chrysodeixis includens (Walker) (Lepidoptera: Noctuidae), is a major defoliating pest of soybeans, Glycine max (L.) Merrill, in Louisiana. However, other alternate host crops in the agroecosystem have the potential to impact C. includens populations. Life table statistics of C. includens on four host plants were evaluated. C. includens larvae were fed leaves of three cotton Gossypium hirsutum L. cultivars 'DP 143 B2RF,' 'DP 174 RF,' and 'PHY 485 WRF'; cowpea Vigna unguiculata (L.) Walpers 'California Blackeye'; three soybean cultivars 'Lyon,' 'PI 227687,' and 'RC 4955'; and sweetpotato Ipomoea batatas (L.) Lamarck 'Evangeline.' All C. includens larvae reared on cotton cultivars DP 143 B2RF and PHY 485 WRF experienced 100% mortality during the first instar. Total developmental period of preadult C. includens was significantly shorter on cotton DP 174 RF and cowpea California Blackeye but longer on sweetpotato Evangeline. Sweetpotato Evangeline had the highest amount of leaf tissue consumed and soybean Lyon had the least. Pupal weight was highest when insects fed on cotton DP 174 RF and lowest on soybean PI 227687. Life table statistics showed that the highest intrinsic rate of increase and net reproductive rate were attained when insects were reared on cotton DP 174 RF and cowpea California Blackeye whilst the lowest were recorded on soybean PI 227687. This study provides valuable information on the role of alternative host crops on the partial life history of C. includens in Louisiana agroecosystems. PMID:27375294

  9. Simultaneous Determination of Crypto-Chlorogenic Acid, Isoquercetin, and Astragalin Contents in Moringa oleifera Leaf Extracts by TLC-Densitometric Method.

    Science.gov (United States)

    Vongsak, Boonyadist; Sithisarn, Pongtip; Gritsanapan, Wandee

    2013-01-01

    Moringa oleifera Lamarck (Moringaceae) is used as a multipurpose medicinal plant for the treatment of various diseases. Isoquercetin, astragalin, and crypto-chlorogenic acid have been previously found to be major active components in the leaves of this plant. In this study, a thin-layer-chromatography (TLC-)densitometric method was developed and validated for simultaneous quantification of these major components in the 70% ethanolic extracts of M. oleifera leaves collected from 12 locations. The average amounts of crypto-chlorogenic acid, isoquercetin, and astragalin were found to be 0.0473, 0.0427, and 0.0534% dry weight, respectively. The method was validated for linearity, precision, accuracy, limit of detection, limit of quantitation, and robustness. The linearity was obtained in the range of 100-500 ng/spot with a correlation coefficient (r) over 0.9961. Intraday and interday precisions demonstrated relative standard deviations of less than 5%. The accuracy of the method was confirmed by determining the recovery. The average recoveries of each component from the extracts were in the range of 98.28 to 99.65%. Additionally, the leaves from Chiang Mai province contained the highest amounts of all active components. The proposed TLC-densitometric method was simple, accurate, precise, and cost-effective for routine quality controlling of M. oleifera leaf extracts. PMID:23533530

  10. COUPLING AMPULLINID GASTROPODS: SEXUAL BEHAVIOUR FROZEN IN PALAEOGENE DEPOSITS OF NORTHERN ITALY

    Directory of Open Access Journals (Sweden)

    IGINIO DIENI

    2008-11-01

    Full Text Available Couples of the ampullinid gastropods Globularia (Eocernina vulcani (Brogniart, 1823, Amaurellina (Crommium angustata (Grateloup, 1827 and Amaurellina (Pachycrommium cf. suessoniensis (d'Orbigny, 1850, composed of dimorphed shells tightly conjoined at the apertures, from the Palaeogene (Eocene and Oligocene marine successions of northern Italy, are interpreted as buried while mating, specimens being "frozen" while suddenly covered by a mass of sediment. Violent depositional events were responsible for their rapid burial, primarily by volcanoclastics, the formation of which had also involved acidification. The consequent poisoning of sea water and/or overwarming beyond the range in which the gastropods could survive, induced mass mortality. A similar set of conditional circumstances is also discussed for differently sized coupled specimens of Ampullinopsis crassatina (Lamarck, 1804, preserved with their shells slightly apart but with their apertures almost in contact. With reference to the catastrophic eruption of Vesuvius in A.D. 79, when Pompei was buried under tephra, it is thought that volcanic activity caused the death and burial of all these pairing gastropods in a "Pompeian" way. 

  11. The Anthropological Study of “Insect Society” in Evolutionism

    Institute of Scientific and Technical Information of China (English)

    Bian Quanqin; Zhang Yuan

    2015-01-01

    Evolutionism is the first discipline paradigm in the history of anthropology.As early as 1801, Jean-Baptiste Lamarck, a French naturalist clearly put forward the notion of evolution.Howev-er,it was not until C.R.Darwin published his book The Origin of Species in 1859,that the theory of evo-lution became widely regarded by the world.In ad-dition to the field of biology, evolutionism also broadly and deeply influenced the fields of anthro-pology,philosophy and psychology,etc.In the study of evolutionism,a comparative investigation between insect society and human society has attracted the special interest of many scholars.In addition to Charles Robert Darwin,Aldous Leonard Huxley,Jo-ham Jakob Bochofen and Henri Bergson published special works on this aspect.These scholars not only lived during the era of evolutionism, their thinking and research were more or less connected with evo-lutionism and insect society.Their research spawned a series of new theoretical thinking on the division of labor,ethics and morality,matrilineal society,and the creation of evolution,etc.Clarifying the research on“insect society” in evolutionism is necessary and important for us to understand the construction of social theories during that time.Hence, this article seeks to review“insect society”in the eyes of these scholars and make comparisons among them.

  12. Evolution of evolution theory since Charles Darwin%达尔文学说问世以来生物进化论的发展概况及其展望

    Institute of Scientific and Technical Information of China (English)

    舒德干

    2014-01-01

    The development of evolutionary theory, from the original Darwinism through Neo-Lamarckism, Mendelism, Neo-Darwinism to the modern synthetic theory, is herein reviewed. The synthetic theory is again challenged by the new information from molecular investigations and new significant fossil discoveries. As a result, the neutral mutation-random hypothesis and the Three-episode Cambrian Explosion hypothesis were proposed.%综述了自达尔文学说诞生以来,生物进化论经历了孟德尔颗粒遗传理论、新拉马克主义、新达尔文主义直到现代综合进化论建立的发展历程。然而,综合论更面临着来自分子生物学新信息和古生物学重大新发现的挑战和发展机遇,由此产生了分子中性遗传漂变假说和三幕式寒武大爆发假说。

  13. Biological control of golden apple snail, Pomacea canaliculata by Chinese soft-shelled turtle, Pelodiscus sinensis in the wild rice, Zizania latifolia field

    Directory of Open Access Journals (Sweden)

    Shengzhang Dong

    2012-04-01

    Full Text Available The wild rice, Zizania latifolia Turcz, used to be one of the important aquatic vegetables cultivated in China. Recently, the golden apple snail - GAS (Pomacea canaliculata (Lamarck was found to be a major invasive pest attacking Z. latifolia. To control efficiently GAS, predation by the Chinese soft-shelled turtles (Pelodiscus sinensis on GAS was evaluated in laboratory and field trials. P. sinensis had a strong predatory capacity and selectivity for GAS both in laboratory and field conditions. All the sizes of P. sinensis prefer to capture smaller snails. The optimum number of P. sinensis released in Z. latifolia field was dependent on the density of over-wintered GAS, and varied between 30 and 50 turtles per 666.7 m². The number of GAS declined in the fields with turtles as compared to turtle-free field. A pattern of releasing P. sinensis in Z. latifolia fields was developed and widely adopted by farmers because of much more benefit besides biologically controlling GAS.

  14. [THE PROFESSORS OF THE NATIONAL MUSEUM OF NATURAL HISTORY AND THE SOCIETY OF THE FRIENDS OF THE SCIENCES OF WARSAW (1800-1832)].

    Science.gov (United States)

    Daszkiewicz, Piotr

    2015-01-01

    The National Museum of Natural History played a crucial role in the formation of Polish scientific elites in the 19th century. Many Polish students were attending in Paris natural history, botany, zoology, chemistry and mineralogy courses. The Warsaw Society of Friends of Learning was the largest scientific society and one of the most important scientific institutions in Poland. It had also an impact on the political and cultural life of the country, occupied and deprived of freedom at that time. Amongst its founders and members, could be found listeners to the lectures of Lamarck, Haüy, Vauquelin, Desfontaines, Jussieu. Moreover, seven professors of the National Museum of Natural History were elected foreign members of the Warsaw Society of Friends of Learning: Cuvier, Desfontaines, Haüy, Jussieu, Latreille, Mirbel, Vauquelin. The article analyses this choice and underlines the relationship between these scientists and Warsaw's scientists. The results of this research allow to confirm that the National Museum of Natural History was the most important foreign institution in the 19th century for Polish science, and more specifically natural sciences. PMID:27071294

  15. Erasmus Darwin, Herbert Spencer, and the origins of the evolutionary worldview in British provincial scientific culture, 1770-1850.

    Science.gov (United States)

    Elliott, Paul

    2003-03-01

    The significance of Herbert Spencer's evolutionary philosophy has been generally recognized for over a century, as the familiarity of his phrase "survival of the fittest" indicates, yet accounts of the origins of his system still tend to follow too closely his own description, written many decades later. This essay argues that Spencer's own interpretation of his intellectual development gives an inadequate impression of the debt he owed to provincial scientific culture and its institutions. Most important, it shows that his evolutionism was originally stimulated by his association with the Derby philosophical community, for it was through this group--of which his father, who also appears to have espoused a deistic evolutionary theory, was a member--that he was first exposed to progressive Englightenment social and educational philosophies and to the evolutionary worldview of Erasmus Darwin, the first president of the Derby Philosophical Society. Darwin's scheme was the first to incorporate biological evolution, associationist psychology, evolutionary geology, and cosmological developmentalism. Spencer's own implicit denials of the link with Darwin are shown to be implausible in the face of Darwin's continuing influence on the Derby savants, the product of insecurity in his later years when he feared for his reputation as Lamarckism became increasingly untenable. PMID:12725102

  16. Identification and comparative analysis of complement C3-associated microRNAs in immune response of Apostichopus japonicus by high-throughput sequencing.

    Science.gov (United States)

    Zhong, Lei; Zhang, Feng; Zhai, Yu; Cao, Yanhui; Zhang, Si; Chang, Yaqing

    2015-01-01

    MicroRNAs (miRNAs) are important effectors in mediating host-pathogen interaction. In this report, coelomocytes miRNA libraries of three Japanese sea cucumbers Apostichopus japonicus were built by Illumina(®) Hiseq2000 from different time points after lipopolysaccharide challenge (at time 0 h, 6 h and 12 h). The clean data received from high throughput sequencing were used to sequences analysis. Referenced to the Strongylocentrotus purpuratus genome, 38 conserved miRNAs were found, and three miRNA candidates were predicted by software. According to the evidence resulting from the expression of AjC3, expressing levels of spu-miR-133, spu-miR-137 and spu-miR-2004 altered along with the expression of AjC3 changing at different time points after LPS injection. Thus, we speculated that the three miRNAs may have influence on A. japonicus complement C3. The spu-miR-137 and miR-137 gene family in miRBase were analyzed by bioinformatics. There is an obvious discrepancy between invertebrates and vertebrates. The first and ninth nucleotides in invertebrate miR-137 are offset compared vertebrate miR-137. Importantly, this is the first attempt to map the stage of immune response regulome in echinoderms, which might be considered as information for elucidating the intrinsic mechanism underlying the immune system in this species. PMID:26634300

  17. Comparison of the disposition of several nitrogen-containing compounds in the sea urchin and other marine invertebrates

    Energy Technology Data Exchange (ETDEWEB)

    Landrum, P.F.; Crosby, D.G.

    1981-01-01

    1. The disposition of an aromatic amine and three aromatic nitro compounds was investigated in the sea urchin, Strongylocentrotus purpuratus. 2. The sea urchin rapidly eliminated injected compounds. The elimination rate constants decreased in the order p-toluidine greater than p-nitroanisole . p-nitrophenol greater than p-nitrotoluene. The fraction of total injected compound eliminated in 8 h was lowest for p-nitrophenol less than p-toluidine less than p-nitrotoluene less than p-nitroanisole. 3. Biotransformation for the sea urchin was primarily reduction of the nitro group followed by acetylation of the amine. 4. Other animals, starfish (Pisaster ochraceus), sea cucumber (Cucumaria miniata), gum boot chiton (Cryptochiton stelleri) and mussels (Mytilus californianus), injected with p-nitroanisole exhibited a trend toward oxidative biotransformation. 5. Elimination of parent compound was the major pathway for reducing body burden of xenobiotics for the invertebrates studied. 6. p-Toluidine oxidizes during analysis and was thus not suitable for studying biotransformation.

  18. Identification and comparative analysis of complement C3-associated microRNAs in immune response of Apostichopus japonicus by high-throughput sequencing

    Science.gov (United States)

    Zhong, Lei; Zhang, Feng; Zhai, Yu; Cao, Yanhui; Zhang, Si; Chang, Yaqing

    2015-01-01

    MicroRNAs (miRNAs) are important effectors in mediating host–pathogen interaction. In this report, coelomocytes miRNA libraries of three Japanese sea cucumbers Apostichopus japonicus were built by Illumina® Hiseq2000 from different time points after lipopolysaccharide challenge (at time 0 h, 6 h and 12 h). The clean data received from high throughput sequencing were used to sequences analysis. Referenced to the Strongylocentrotus purpuratus genome, 38 conserved miRNAs were found, and three miRNA candidates were predicted by software. According to the evidence resulting from the expression of AjC3, expressing levels of spu-miR-133, spu-miR-137 and spu-miR-2004 altered along with the expression of AjC3 changing at different time points after LPS injection. Thus, we speculated that the three miRNAs may have influence on A. japonicus complement C3. The spu-miR-137 and miR-137 gene family in miRBase were analyzed by bioinformatics. There is an obvious discrepancy between invertebrates and vertebrates. The first and ninth nucleotides in invertebrate miR-137 are offset compared vertebrate miR-137. Importantly, this is the first attempt to map the stage of immune response regulome in echinoderms, which might be considered as information for elucidating the intrinsic mechanism underlying the immune system in this species. PMID:26634300

  19. Developmental expression of a cell surface protein involved in sea urchin skeleton formation

    International Nuclear Information System (INIS)

    The authors have previously used a monoclonal antibody (1223) to identify a 130 Kd cell surface protein involved in skeleton formation is sea urchin embryos. In the current study the authors have examined the expression of the 1223 antigen over the course of development of embryos of two species, Strongylocentrotus purpuratus and Lytechinus pictus. The 130 Kd protein is detected in S. purp eggs on immunoblots. Labeling with [3H] leucine and immunoaffinity chromatography show that it also is synthesized shortly after fertilization. Immunofluroescence reveals that at this early stage the 1223 antigen is uniformly distributed on all of the cells. Synthesis decreases to a minimum by the time of hatching (18 h), as does the total amount of antigen present in the embryo. A second period of synthesis commences at the mesenchyme blastula stage, when the spicule-forming primary mesenchyme cells (PMCs) have appeared. During this later stage, synthesis and cell surface expression are restricted to the PMCs. In contrast to S. purp., in L. pictus the 130 Kd protein does not appear until the PMCs are formed. Hybrid embryos demonstrate a pattern of expression of the maternal species. These results suggest that early expression of 1223 antigen in S. purp. is due to utilization of maternal transcripts present in the egg. In both species later expression in PMCs appears to be the result of cell-type specific synthesis, perhaps encoded by embryonic transcripts

  20. Mechanism of Calcite Co-Orientation in the Sea Urchin Tooth

    Energy Technology Data Exchange (ETDEWEB)

    Killian, Christopher; Metzler, Rebecca; Gong, Y. U. T.; Olson, Ian; Aizenberg, Joanna; Politi, Yael; Wilt, Fred; Scholl, Andreas; Young, Anthony; Doran, Andrew; Kunz, Martin; Tamura, Nobumichi; Coppersmith, Susan; Gilbert, P. U. P. A.

    2009-12-01

    Sea urchin teeth are remarkable and complex calcite structures, continuously growing at the forming end and self-sharpening at the mature grinding tip. The calcite (CaCO{sub 3}) crystals of tooth components, plates, fibers, and a high-Mg polycrystalline matrix, have highly co-oriented crystallographic axes. This ability to co-orient calcite in a mineralized structure is shared by all echinoderms. However, the physico-chemical mechanism by which calcite crystals become co-oriented in echinoderms remains enigmatic. Here, we show differences in calcite c-axis orientations in the tooth of the purple sea urchin (Strongylocentrotus purpuratus), using high-resolution X-ray photoelectron emission spectromicroscopy (X-PEEM) and microbeam X-ray diffraction ({mu}XRD). All plates share one crystal orientation, propagated through pillar bridges, while fibers and polycrystalline matrix share another orientation. Furthermore, in the forming end of the tooth, we observe that CaCO{sub 3} is present as amorphous calcium carbonate (ACC). We demonstrate that co-orientation of the nanoparticles in the polycrystalline matrix occurs via solid-state secondary nucleation, propagating out from the previously formed fibers and plates, into the amorphous precursor nanoparticles. Because amorphous precursors were observed in diverse biominerals, solid-state secondary nucleation is likely to be a general mechanism for the co-orientation of biomineral components in organisms from different phyla.

  1. The PHD domain of the sea urchin RAG2 homolog, SpRAG2L, recognizes dimethylated lysine 4 in histone H3 tails.

    Science.gov (United States)

    Wilson, David R; Norton, Darrell D; Fugmann, Sebastian D

    2008-01-01

    V(D)J recombination is a somatic gene rearrangement process that assembles antigen receptor genes from individual segments during lymphocyte development. The access of the RAG1/RAG2 recombinase to these gene segments is regulated at the level of chromatin modifications, in particular histone tail modifications. Trimethylation of lysine 4 in histone H3 (H3K4me3) correlates with actively recombining gene elements, and this mark is recognized and interpreted by the plant homeodomain (PHD) of RAG2. Here we report that the PHD domain of the only known invertebrate homolog of RAG2, the SpRAG2L protein of the purple sea urchin (Strongylocentrotus purpuratus) also binds to methylated histones, but with a unique preference for H3K4me2. While the cognate substrate for the sea urchin RAG1L/RAG2L complex remains elusive, the affinity for histone tails and the nuclear localization of ectopically expressed SpRAG2L strongly support the model that this enzyme complex exerts its activity on DNA in the context of chromatin. PMID:18499250

  2. Habitat structure is more important than nutrient supply in modifying mussel bed assemblage in an upwelling area of the Peruvian coast

    Science.gov (United States)

    Firstater, Fausto N.; Hidalgo, Fernando J.; Lomovasky, Betina J.; Ramos, Elmer; Gamero, Patricia; Iribarne, Oscar O.

    2011-06-01

    Upwelling intensity modifies coastal primary production and influences individual traits of habitat-forming species. Along the Peruvian coast, beds of the mytilid Perumytilus purpuratus provide structurally complex habitats that harbour many organisms. We predict that in the nutrient-rich system of Central Peru, the modification of structural complexity would have stronger effects on the Perumytilus community than nutrient addition. We experimentally examined the effects of nutrient addition on the Perumytilus-dominated assemblage and we evaluated the potential effect of varying shell size on the Perumytilus-dominated assemblage. Nutrient addition to the mussel bed with slow-release fertilizers caused no changes in the total macro- and microalgal biomass and did not affect abundances or composition of the assemblage. To explore the effect of structural complexity on the Perumytilus assemblage, we manipulated mussel size with experimental bags containing small and large individuals. Predators, grazers and mobile organisms were more abundant among smaller mussels, with smaller gap volume, whereas the barnacle Jehlius cirratus was more abundant on larger mussels. In conclusion, point-source nutrient addition to the mussel bed did not enhance primary production. However, the modification of structural characteristics related to mussel size induced changes in the faunal assemblage. Thus, it seems that in this nutrient-rich system, nutrient enhancement would not significantly affect Perumytilus and its assemblage, whereas structural habitat seems to play an important role in shaping this community.

  3. Early development and neurogenesis of Temnopleurus reevesii.

    Science.gov (United States)

    Yaguchi, Shunsuke; Yamazaki, Atsuko; Wada, Wakana; Tsuchiya, Yasutaka; Sato, Toshihiko; Shinagawa, Hideo; Yamada, Yutaro; Yaguchi, Junko

    2015-04-01

    Sea urchins are model non-chordate deuterostomes, and studying the nervous system of their embryos can aid in the understanding of the universal mechanisms of neurogenesis. However, despite the long history of sea urchin embryology research, the molecular mechanisms of their neurogenesis have not been well investigated, in part because neurons appear relatively late during embryogenesis. In this study, we used the species Temnopleurus reevesii as a new sea urchin model and investigated the detail of its development and neurogenesis during early embryogenesis. We found that the embryos of T. reevesii were tolerant of high temperatures and could be cultured successfully at 15-30°C during early embryogenesis. At 30°C, the embryos developed rapidly enough that the neurons appeared at just after 24 h. This is faster than the development of other model urchins, such as Hemicentrotus pulcherrimus or Strongylocentrotus purpuratus. In addition, the body of the embryo was highly transparent, allowing the details of the neural network to be easily captured by ordinary epifluorescent and confocal microscopy without any additional treatments. Because of its rapid development and high transparency during embryogenesis, T. reevesii may be a suitable sea urchin model for studying neurogenesis. Moreover, the males and females are easily distinguishable, and the style of early cleavages is intriguingly unusual, suggesting that this sea urchin might be a good candidate for addressing not only neurology but also cell and developmental biology. PMID:25754419

  4. Unusual Gene Order and Organization of the Sea Urchin Hox Cluster

    Energy Technology Data Exchange (ETDEWEB)

    Cameron, R A; Rowen, L; Nesbitt, R; Bloom, S; Rast, J P; Berney, K; Arenas-Mena, C; Martinez, P; Lucas, S; Richardson, P M; Davidson, E H; Peterson, K J; Hood, L

    2005-10-11

    The highly consistent gene order and axial colinear expression patterns found in vertebrate hox gene clusters are less well conserved across the rest of bilaterians. We report the first deuterostome instance of an intact hox cluster with a unique gene order where the paralog groups are not expressed in a sequential manner. The finished sequence from BAC clones from the genome of the sea urchin, Strongylocentrotus purpuratus, reveals a gene order wherein the anterior genes (Hox1, Hox2 and Hox3) lie nearest the posterior genes in the cluster such that the most 3 gene is Hox5. (The gene order is : 5-Hox1, 2, 3, 11/13c, 11/13b, 11/13a, 9/10, 8, 7, 6, 5 - 3). The finished sequence result is corroborated by restriction mapping evidence and BAC-end scaffold analyses. Comparisons with a putative ancestral deuterostome Hox gene cluster suggest that the rearrangements leading to the sea urchin gene order were many and complex.

  5. Unusual Gene Order and Organization of the Sea Urchin HoxCluster

    Energy Technology Data Exchange (ETDEWEB)

    Richardson, Paul M.; Lucas, Susan; Cameron, R. Andrew; Rowen,Lee; Nesbitt, Ryan; Bloom, Scott; Rast, Jonathan P.; Berney, Kevin; Arenas-Mena, Cesar; Martinez, Pedro; Davidson, Eric H.; Peterson, KevinJ.; Hood, Leroy

    2005-05-10

    The highly consistent gene order and axial colinear expression patterns found in vertebrate hox gene clusters are less well conserved across the rest of bilaterians. We report the first deuterostome instance of an intact hox cluster with a unique gene order where the paralog groups are not expressed in a sequential manner. The finished sequence from BAC clones from the genome of the sea urchin, Strongylocentrotus purpuratus, reveals a gene order wherein the anterior genes (Hox1, Hox2 and Hox3) lie nearest the posterior genes in the cluster such that the most 3' gene is Hox5. (The gene order is : 5'-Hox1,2, 3, 11/13c, 11/13b, '11/13a, 9/10, 8, 7, 6, 5 - 3)'. The finished sequence result is corroborated by restriction mapping evidence and BAC-end scaffold analyses. Comparisons with a putative ancestral deuterostome Hox gene cluster suggest that the rearrangements leading to the sea urchin gene order were many and complex.

  6. Lesions of Copper Toxicosis in Captive Marine Invertebrates With Comparisons to Normal Histology.

    Science.gov (United States)

    LaDouceur, E E B; Wynne, J; Garner, M M; Nyaoke, A; Keel, M K

    2016-05-01

    Despite increasing concern for coral reef ecosystem health within the last decade, there is scant literature concerning the histopathology of diseases affecting the major constituents of coral reef ecosystems, particularly marine invertebrates. This study describes histologic findings in 6 species of marine invertebrates (California sea hare [Aplysia californica], purple sea urchin [Strongylocentrotus purpuratus], sunburst anemone [Anthopleura sola], knobby star [Pisaster giganteus], bat star [Asterina miniata], and brittle star [Ophiopteris papillosa]) with spontaneous copper toxicosis, 4 purple sea urchins with experimentally induced copper toxicosis, and 1 unexposed control of each species listed. The primary lesions in the California sea hare with copper toxicosis were branchial and nephridial necrosis. Affected echinoderms shared several histologic lesions, including epidermal necrosis and ulceration and increased numbers of coelomocytes within the water-vascular system. The sunburst anemone with copper toxicosis had necrosis of both epidermis and gastrodermis, as well as expulsion of zooxanthellae from the gastrodermis. In addition to the lesions attributed to copper toxicosis, our results describe normal microscopic features of these animals that may be useful for histopathologic assessment of marine invertebrates. PMID:26459519

  7. Cell mediated immune response of the Mediterranean sea urchin Paracentrotus lividus after PAMPs stimulation.

    Science.gov (United States)

    Romero, A; Novoa, B; Figueras, A

    2016-09-01

    The Mediterranean sea urchin (Paracentrotus lividus) is of great ecological and economic importance for the European aquaculture. Yet, most of the studies regarding echinoderm's immunological defense mechanisms reported so far have used the sea urchin Strongylocentrotus purpuratus as a model, and information on the immunological defense mechanisms of Paracentrotus lividus and other sea urchins, is scarce. To remedy this gap in information, in this study, flow cytometry was used to evaluate several cellular immune mechanisms, such as phagocytosis, cell cooperation, and ROS production in P. lividus coelomocytes after PAMP stimulation. Two cell populations were described. Of the two, the amoeboid-phagocytes were responsible for the phagocytosis and ROS production. Cooperation between amoeboid-phagocytes and non-adherent cells resulted in an increased phagocytic response. Stimulation with several PAMPs modified the phagocytic activity and the production of ROS. The premise that the coelomocytes were activated by the bacterial components was confirmed by the expression levels of two cell mediated immune genes: LPS-Induced TNF-alpha Factor (LITAF) and macrophage migration inhibitory factor (MIF). These results have helped us understand the cellular immune mechanisms in P. lividus and their modulation after PAMP stimulation. PMID:27113124

  8. Maintenance of somatic tissue regeneration with age in short- and long-lived species of sea urchins.

    Science.gov (United States)

    Bodnar, Andrea G; Coffman, James A

    2016-08-01

    Aging in many animals is characterized by a failure to maintain tissue homeostasis and the loss of regenerative capacity. In this study, the ability to maintain tissue homeostasis and regenerative potential was investigated in sea urchins, a novel model to study longevity and negligible senescence. Sea urchins grow indeterminately, regenerate damaged appendages and reproduce throughout their lifespan and yet different species are reported to have very different life expectancies (ranging from 4 to more than 100 years). Quantitative analyses of cell proliferation and apoptosis indicated a low level of cell turnover in tissues of young and old sea urchins of species with different lifespans (Lytechinus variegatus, Strongylocentrotus purpuratus and Mesocentrotus franciscanus). The ability to regenerate damaged tissue was maintained with age as assessed by the regrowth of amputated spines and tube feet (motor and sensory appendages). Expression of genes involved in cell proliferation (pcna), telomere maintenance (tert) and multipotency (seawi and vasa) was maintained with age in somatic tissues. Immunolocalization of the Vasa protein to areas of the tube feet, spines, radial nerve, esophagus and a sub-population of circulating coelomocytes suggests the presence of multipotent cells that may play a role in normal tissue homeostasis and the regenerative potential of external appendages. The results indicate that regenerative potential was maintained with age regardless of lifespan, contrary to the expectation that shorter lived species would invest less in maintenance and repair. PMID:27095483

  9. Dicty_cDB: Contig-U15437-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 0 1 ( DR553880 ) WS03227.C21_F14 WS-MC-N-A-20 Picea glauca cDNA cl... 50 0.030 1 ( CO240636 ) WS00715.B21_I1...7 WS-PS-N-A-8 Picea glauca cDNA clo... 50 0.030 1 ( CO221954 ) WS01014.B21_H24 SS-R-N-A-11 Picea sitchensis cDNA... 50 0.030 1 ( CO21...Contig-U15437-1 no gap 1000 6 891404 891199 MINUS 2 3 U15437 0 0 0 0 0 2 0 0 0 0 0 ...ngylocentrotus purpuratus clone R3-14B9, WORK... 40 0.002 4 ( AL627212 ) Mouse DNA sequence from clone RP23-14...one CH230-423G17, WORKING DRA... 36 0.005 2 ( BJ354964 ) Dictyostelium discoideum cDNA clone:dda55f07, 3' ... 42 0.005 2 ( CT737140

  10. Biological testing of sediment for the Olympia Harbor Navigation Improvement Project, 1988: Geoduck, amphipod, and echinoderm bioassays

    Energy Technology Data Exchange (ETDEWEB)

    Ward, J.A.; Word, J.Q.; Antrim, L.D.

    1989-05-01

    The Olympia Harbor Navigation Improvement Project requires the dredging of approximately 330,000 cubic yards (cy) of sediment from the harbor entrance channel and 205,185 cy from the turning basin. Puget Sound Dredged Disposal Analysis (PSDDA) partial characterization studies were used to plan a full sediment characterization in which chemical analyses and biological testing of sediments evaluated the suitability of the dredged material for unconfined, open-water disposal. The US Army Corps of Engineers (COE), Seattle District, contracted with NOAA/NMFS, Environmental Conservation Division, to perform the chemical analysis and Microtox bioassay tests, and with the Battelle/Marine Sciences Laboratory (MSL) in Sequim to perform flow-through solid-phase bioassays utilizing juvenile (8 to 10 mm) geoduck clams, Panopea generosa, and static solid phase bioassays using the phoxocephalid amphipod, Rhepoxynius abronius, developing embryos and gametes of the purple sea urchin, Strongylocentrotus purpuratus, and the larvae of the Pacific oyster Crassostrea gigas. When the results of the biological tests were evaluated under PSDDA guidelines, it was found that all the tested sediment treatments from Olympia Harbor are suitable for unconfined open-water disposal. 14 refs., 12 figs., 3 tabs.

  11. cis-Regulatory control of the initial neurogenic pattern of onecut gene expression in the sea urchin embryo.

    Science.gov (United States)

    Barsi, Julius C; Davidson, Eric H

    2016-01-01

    Specification of the ciliated band (CB) of echinoid embryos executes three spatial functions essential for postgastrular organization. These are establishment of a band about 5 cells wide which delimits and bounds other embryonic territories; definition of a neurogenic domain within this band; and generation within it of arrays of ciliary cells that bear the special long cilia from which the structure derives its name. In Strongylocentrotus purpuratus the spatial coordinates of the future ciliated band are initially and exactly determined by the disposition of a ring of cells that transcriptionally activate the onecut homeodomain regulatory gene, beginning in blastula stage, long before the appearance of the CB per se. Thus the cis-regulatory apparatus that governs onecut expression in the blastula directly reveals the genomic sequence code by which these aspects of the spatial organization of the embryo are initially determined. We screened the entire onecut locus and its flanking region for transcriptionally active cis-regulatory elements, and by means of BAC recombineered deletions identified three separated and required cis-regulatory modules that execute different functions. The operating logic of the crucial spatial control module accounting for the spectacularly precise and beautiful early onecut expression domain depends on spatial repression. Previously predicted oral ectoderm and aboral ectoderm repressors were identified by cis-regulatory mutation as the products of goosecoid and irxa genes respectively, while the pan-ectodermal activator SoxB1 supplies a transcriptional driver function. PMID:26522848

  12. Phylogeny and biogeography of the fruit doves (Aves: Columbidae).

    Science.gov (United States)

    Cibois, Alice; Thibault, Jean-Claude; Bonillo, Céline; Filardi, Christopher E; Watling, Dick; Pasquet, Eric

    2014-01-01

    We reconstruct the phylogeny of fruit doves (genus Ptilinopus) and allies with a dense sampling that includes almost all species, based on mitochondrial and nuclear sequence data. We evaluate the most likely biogeographic scenario for the evolution of this group that colonized many islands of the Pacific Ocean. We also investigate the evolution of one of the main plumage character of fruit doves (the color of the crown), and we propose several revisions of the group's systematics. All Ptilinopus taxa formed a monophyletic group that includes two morphologically distinct genera, Alectroenas and Drepanoptila, confirming a previous result found with less species and genes. The divergence time analysis suggests that the basal divergences within Ptilinopus dated to the Early Oligocene, and the biogeographic analysis indicates that fruit doves originated most probably from the proto New Guinea region. The earliest dispersals from the New Guinea region to Oceania occurred with the colonization of New Caledonia and Fiji. A large group of Polynesian species (Central and Eastern), as well as the three taxa found in Micronesia and four species from the Guinean-Moluccan region, form the "purpuratus" clade, the largest diversification of fruit doves within Oceania, which also has a New Guinean origin. However, the eastbound colonization of fruit doves was not associated with a significant increase of their diversification rate. Overall, the Melanesian region did not act as a cradle for fruit doves, in contrast to the New Guinea region which is found as the ancestral area for several nodes within the phylogeny. PMID:24012584

  13. Fossils and Theories of Evolution in Gustave Flaubert’s Bouvard et Pécuchet

    Directory of Open Access Journals (Sweden)

    Anthony Zielonka

    2011-07-01

    Full Text Available Cette étude se propose d’analyser de près le chapitre III de ce chef d’œuvre comique et satirique qu’est le dernier roman de Flaubert, Bouvard et Pécuchet (1881. Après avoir exploré la médecine, la cosmologie, l’astronomie et la zoologie, les « deux bonshommes » de Flaubert se tournent vers la géologie, la paléontologie, et même les théories rivales de l’évolution. Ce chapitre est d’un intérêt considérable comme tour de force comique, surtout quand on le replace dans le contexte des découvertes, théories, controverses et querelles scientifiques (incluant les conflits entre les positions antagonistes de la religion et de la science qui faisaient rage à l’époque de Flaubert. Alors que le romancier avait réalisé des recherches exhaustives sur l’histoire des sciences, il est particulièrement intéressant de relever que ce sont les théories et les découvertes les plus récentes qui sont présentées sur le mode comique et sceptique. Après avoir passé en revue les idées de Buffon, Cuvier, Lamarck et Geoffroy Saint-Hilaire, ainsi que celle des savants fidèles à l’inspiration biblique, Bouvard et Pécuchet ne manquent pas de conclure à l’incompatibilité, et finalement à l’inanité, de toutes ces théories. Ils tirent leurs informations d’ouvrages savants mais aussi populaires, puisant dans les journaux et les magazines. Flaubert montre, de manière tout à fait significative, comment les simplifications et les erreurs des textes de vulgarisation ne servent qu’à renforcer le trouble et le doute des deux personnages et les amènent finalement à abandonner leurs recherches scientifiques.This paper proposes a close textual analysis of Chapter III of the masterpiece of comic and satirical fiction that is Gustave Flaubert’s last novel, Bouvard et Pécuchet (1881. After exploring the sciences of medicine, cosmology, astronomy, and zoology, Flaubert’s “deux bonshommes” turn their attention

  14. The Oxford Companion to the Earth

    Science.gov (United States)

    Hancock, Paul L.

    2001-06-01

    Here is a wealth of information on planet Earth, ranging from the heights of the ionsphere down to the red-hot molten core. Written by some 200 expert contributors, and illustrated with over 600 pictures, including 16 pages of color plates, The Oxford Companion to the Earth offers 900 alphabetically arranged entries that cover everything from deserts and wetlands to mountains, caves, glaciers, and coral reefs. There are articles on natural phenomena such as tornadoes and tsunamis, volcanoes and earthquakes, jet streams and weather fronts; on the history of Earth, including the origin of life, Burgess Shale fauna, dinosaurs, and the Ice Ages; on key figures, such as Agassiz, Cuvier, Darwin, and Lamarck; and on such important ecological concerns as acid rain, the ozone layer, industrial waste disposal, and the greenhouse effect. The Companion also examines the great sources of wealth to be found in the Earth, from coal and oil to gold, silver, and diamonds, and many curious land formations, from sinkholes and fiords to yardangs and quicksand. There are brief entries on rock types, from amber to travertine, and extensive essays on cutting-edge aspects of the earth sciences, such as seismology and marine geology. The Companion includes extensive cross-references, suggested further reading, an index, and many useful appendices, with a geological timescale, facts and figures about the Earth, and a table of chemical elements. The Oxford Companion to the Earth is a unique reference work, offering unrivaled coverage of our home planet. Generously illustrated and vividly written, it is a treasure house of information for all lovers of natural history, geology, and ecology, whether professional or amateur.

  15. Tritrophic effects on survival and development in a Coccidophagous coccinellid.

    Science.gov (United States)

    Boothe, R A; Ponsonby, D J; Preziosi, R F; Copland, M J W

    2008-01-01

    Chilocorus nigritus is currently considered one of the most successful biological control agents of armoured scale insects. However, establishment of this beetle in crop pest situations has not always been successful and there are still gaps in our knowledge of its ecology and behaviour. The research involved an examination of tritrophic effects on the survival and development of this common diaspid predator. The effect of a forced change in host plant on the developmental time of the juvenile stages was also examined. The prey and host plants used were the armoured scales Aspidiotus nerii Bouché Homoptera: Diaspididae and Abgrallaspis cyanophylli (Signoret) Homoptera: Diaspididae, on potatoes (Solanum tuberosum L.) and Butternut squashes (Cucurbita moschata Duchesne ex Lamarck). C. nigritus eggs were incubated on four treatments of scales on potatoes or squashes for ten days, half the second instar larvae were then switched to the same scales on the other host plant. Daily observations were made during development to adult emergence. C. nigritus larvae survived and completed development on two species of diaspid scales and the two host plants examined with varying levels of success. Larvae were able to switch from feeding on A. nerii on potatoes to A. nerii on squashes or A. cyanophylli on potatoes to A. cyanophylli on squashes and vice versa with little or no deleterious effects when compared to those beetles reared on one prey and host plant throughout. There were significant differences in survival of larvae reared to the adult stage on both A. nerii and A. cyanophylli on potatoes when compared to larvae reared on these scales on squashes. Squash appears to be a less desirable and potato a more favourable host plant for survival and development. The results have implications for rearing programmes, and the release and establishment of C. nigritus, in fields and glasshouses where scale pests may be present on a variety of host plants, or may be on host plants

  16. Genetic variation amongst biotypes of Dactylopius tomentosus.

    Science.gov (United States)

    Mathenge, Catherine W; Riegler, Markus; Beattie, G Andrew C; Spooner-Hart, Robert N; Holford, Paul

    2015-03-01

    The tomentose cochineal scale insect, Dactylopius tomentosus (Lamarck) (Hemiptera: Dactylopiidae), is an important biological control agent against invasive species of Cylindropuntia (Caryophyllales: Cactaceae). Recent studies have demonstrated that this scale is composed of host-affiliated biotypes with differential host specificity and fitness on particular host species. We investigated genetic variation and phylogenetic relationships among D. tomentosus biotypes and provenances to examine the possibility that genetic diversity may be related to their host-use pattern, and whether their phylogenetic relationships would give insights into taxonomic relatedness of their host plants. Nucleotide sequence comparison was accomplished using sequences of the mitochondrial cytochrome c oxidase I (COI) gene. Sequences of individuals from the same host plant within a region were identical and characterized by a unique haplotype. Individuals belonging to the same biotype but from different regions had similar haplotypes. However, haplotypes were not shared between different biotypes. Phylogenetic analysis grouped the monophyletic D. tomentosus into 3 well-resolved clades of biotypes. The phylogenetic relationships and clustering of biotypes corresponded with known taxonomic relatedness of their hosts. Two biotypes, Fulgida and Mamillata, tested positive for Wolbachia (α-Proteobacteria), a common endosymbiont of insects. The Wolbachia sequences were serendipitously detected by using insect-specific COI DNA barcoding primers and are most similar to Wolbachia Supergroup F strains. This study is the first molecular characterization of cochineal biotypes that, together with Wolbachia sequences, contribute to the better identification of the biotypes of cochineal insects and to the biological control of cacti using host-specific biotypes of the scale. PMID:24619863

  17. Toward an evolutionary-predictive foundation for creativity : Commentary on "Human creativity, evolutionary algorithms, and predictive representations: The mechanics of thought trials" by Arne Dietrich and Hilde Haider, 2014 (Accepted pending minor revisions for publication in Psychonomic Bulletin & Review).

    Science.gov (United States)

    Gabora, Liane; Kauffman, Stuart

    2016-04-01

    Dietrich and Haider (Psychonomic Bulletin & Review, 21 (5), 897-915, 2014) justify their integrative framework for creativity founded on evolutionary theory and prediction research on the grounds that "theories and approaches guiding empirical research on creativity have not been supported by the neuroimaging evidence." Although this justification is controversial, the general direction holds promise. This commentary clarifies points of disagreement and unresolved issues, and addresses mis-applications of evolutionary theory that lead the authors to adopt a Darwinian (versus Lamarckian) approach. To say that creativity is Darwinian is not to say that it consists of variation plus selection - in the everyday sense of the term - as the authors imply; it is to say that evolution is occurring because selection is affecting the distribution of randomly generated heritable variation across generations. In creative thought the distribution of variants is not key, i.e., one is not inclined toward idea A because 60 % of one's candidate ideas are variants of A while only 40 % are variants of B; one is inclined toward whichever seems best. The authors concede that creative variation is partly directed; however, the greater the extent to which variants are generated non-randomly, the greater the extent to which the distribution of variants can reflect not selection but the initial generation bias. Since each thought in a creative process can alter the selective criteria against which the next is evaluated, there is no demarcation into generations as assumed in a Darwinian model. We address the authors' claim that reduced variability and individuality are more characteristic of Lamarckism than Darwinian evolution, and note that a Lamarckian approach to creativity has addressed the challenge of modeling the emergent features associated with insight. PMID:26527351

  18. [Historic and functional biology: the inadequacy of a system theory of evolution].

    Science.gov (United States)

    Regelmann, J P

    1982-01-01

    In the first half of the 20th century neo-Kantianism in a broad sense proved itself the main conceptual and methodological background of the central European biology. As such it contributed much to the victory on the typological, idealistic-morphological and psycho-vitalistic interpretations of life. On the other hand it could not give tools to the biologists for working out a strictly darwinian evolution theory. Kant's theory of organism was conceived without evolution as a theory of the internal functionality of the organism. There was only some 'play' with the evolutionary differentiation of the species. Since then the disputes around the work of August Weismann, a synthetical evolution theory which is now behind time, arose. This theory developed from coinciding claims, elaborated by geneticists, mathematicians, and by biologists studying development, natural history and systematics. This was done under a strong influence of marxist ideas. Through the interweaving of such different approaches it was possible for this evolutionary synthesis to influence successfully the development of evolution research during more than 40 years. Philosophically speaking modern evolution theory means therefore an aversion, even a positive abolition of Kantian positions. A number of biologists however--as L. von Bertalanffy--refused to adhere to a misinterpreted Kantian methodology and oriented themselves to an approach via system theory, which obtained a place in evolution research. In fact this is a Kantian approach as well. They only repeated the Kantian dilemma of the evolution which can also be found in Lamarck and Hegel. The system theory of the functionality of the organism never reaches to the level of the evolving species, but remains always on the level of epigenetic thinking, because of its philosophical origin. This paper points out the consequences of this still current dilemma. At the same time an all-enclosing reflection on the methodological, epistemological and

  19. The mitochondrial genomes of sponges provide evidence for multiple invasions by Repetitive Hairpin-forming Elements (RHE

    Directory of Open Access Journals (Sweden)

    Lavrov Dennis V

    2009-12-01

    Full Text Available Abstract Background The mitochondrial (mt genomes of sponges possess a variety of features, which appear to be intermediate between those of Eumetazoa and non-metazoan opisthokonts. Among these features is the presence of long intergenic regions, which are common in other eukaryotes, but generally absent in Eumetazoa. Here we analyse poriferan mitochondrial intergenic regions, paying particular attention to repetitive sequences within them. In this context we introduce the mitochondrial genome of Ircinia strobilina (Lamarck, 1816; Demospongiae: Dictyoceratida and compare it with mtDNA of other sponges. Results Mt genomes of dictyoceratid sponges are identical in gene order and content but display major differences in size and organization of intergenic regions. An even higher degree of diversity in the structure of intergenic regions was found among different orders of demosponges. One interesting observation made from such comparisons was of what appears to be recurrent invasions of sponge mitochondrial genomes by repetitive hairpin-forming elements, which cause large genome size differences even among closely related taxa. These repetitive hairpin-forming elements are structurally and compositionally divergent and display a scattered distribution throughout various groups of demosponges. Conclusion Large intergenic regions of poriferan mt genomes are targets for insertions of repetitive hairpin- forming elements, similar to the ones found in non-metazoan opisthokonts. Such elements were likely present in some lineages early in animal mitochondrial genome evolution but were subsequently lost during the reduction of intergenic regions, which occurred in the Eumetazoa lineage after the split of Porifera. Porifera acquired their elements in several independent events. Patterns of their intra-genomic dispersal can be seen in the mt genome of Vaceletia sp.

  20. Toxic effects of crotocaudin extracted from the medicinal plant Croton tiglium.

    Science.gov (United States)

    Yadav, Ram P; Singh, Ajay

    2010-01-01

    The compound crotocaudin extracted from the stem bark of the medicinal plant Croton tiglium Linn. was administered for 24 h or 96 h to the freshwater vector snail Lymnaea (Radix) acuminata Lamarck in order to test its toxicity. L. acuminata is the intermediate host of Fasciola hepatica and Fasciola gigantica which cause immense harm to man and his domestic animals. It was observed that the molluscicidal activity of crotocaudin against L. acuminata is time- as well as dose-dependent. There was a significant negative correlation among LC50 values and exposure periods, i.e. increasing the exposure time, the LC50 value of crotocaudin decreased from 5.37 microM (24 h) > 2.08 microM (48 h) > 1.36 microM (72 h) to 1.01 microM (96 h), respectively, against L. acuminata. The toxicological experiments to proof for environmental toxicity, if any, have also been carried out on the non-target freshwater fish Channa punctatus (Bloch) [Channidae (Ophicephalidae)], which shares the habitat with L. acuminata. The sublethal doses of crotocaudin (40% and 80% of LC50) administered over 24 h caused significant changes in the carbohydrate and nitrogenous metabolisms in nervous, hepatopancreas, and ovotestis tissues of Lymnaea acuminata. Channa punctatus was also exposed to sublethal doses of crotocaudin (40% and 80% of 24-h LC50 of L. acuminata) for 96 h which showed significant alterations in the metabolism in muscle, liver, and gonad tissues. After withdrawal of crotocaudin the snail tissues recovered in part after 7 days and the fish tissues completely. PMID:20653234

  1. Generalized training effects induced by athletic preparation. A review.

    Science.gov (United States)

    Issurin, V B

    2009-12-01

    The present review deals with training effects produced by training pieces of different duration. Athletes' responses to training workloads can be considered hierarchically, where the most intimate level encompasses changes produced at the cellular and molecular levels, while the generalized level summarizes the most integrative training outcomes, which characterize athletes' adaptability, preparedness and readiness for forthcoming workloads. These training outcomes, called generalized training effects (GTE) are considered to be closely linked with duration and mode of training workloads. Summarizing earlier and more recent publications, GTEs are categorized as acute, immediate, cumulative, delayed and residual training effects, which encompass changes induced by 1) a single exercise; 2) a single workout or training day; 3) a series of workouts; or 4) obtained over a given time interval after a program completion ; or (5) changes retained after cessation of training beyond a give time period. Each one these GTEs has a three-fold characterization:1) variables of executed workloads; 2) athletes' responses to workloads and training-induced changes in their state; 3) changes in athletic performance as described by sport specific indicators. Although the concept of GTE is far from complete in terms of an understanding of the physiological mechanisms underlying the short-, medium-, and long-term changes caused by athletic training, a number of fundamental theories and statements contribute to its scientific background. They are Cannon's theory of homeostasis; Salye's theory of stress adaptation; Weigert's law of supercompensation; and Lamarck's classic theory of evolution regarding the "use" and "disuse" of any organ or function. PMID:20087292

  2. Marine Mollusca of isotope stages of the last 2 million years in New Zealand. Part 3, Gastropoda (Vetigastropoda - Littorinimorpha)

    International Nuclear Information System (INIS)

    Three new species: Grandicrepidula hemispherica (Nukumaruan, S Hawke's Bay), Pelicaria Granttaylori (Mangapanian-early Nukumaruan, Wanganui-Hawke's Bay), Pelicaria arahura (Waipipian-early Mangapanian, Westland and Hawke's Bay). Drawings of marine species in Smith's (1874) three plates of New Zealand molluscan types are republished. Further Australian molluscs in Wanganui Basin: Sabia australis (Lamarck), Clanculus plebejus (Philippi), both early Nukumaruan. Further northern New Zealand molluscs in Wanganui Basin: Stephopoma roseum (Quoy and Gaimard), OIS 13, 9. Distinctive gastropods extinct at end Nukumaruan: Struthiolaria frazeri (Hutton), Taxonia suteri (Marwick). Taniella planisuturalis (Marwick) (Opoitian-Nukumaruan, southern NZ) and Trivia (Ellatrivia) zealandica (Kirk) (Nukumaruan, Hawke's Bay-Wanganui; Castlecliffian, North Canterbury) occur in Castlecliffian (OIS 15?) rocks at Whakatane. Cantharidella tessellate (A. Adams) and Risellopsis varia (Hutton), formerly Haweran, are recorded from Nukumaruan and Castlecliffian rocks, respectively. New fossil late Nukumaruan-early Castlecliffian records listed from Mikonui-1 offshore well, Westland, include Malluvium calcareum (Suter) and 10 other species. Other biostratigraphically useful gastropods: Calliostoma (Maurea) nukumaruense (Laws) (Mangapanian-OIS 17); Argobuccinum pustulosum (Lightfoot), Semicassis labiate (Perry) (both earliest in OIS 7). New synonymy: Zeacumantus perplexus (Marshall and Murdoch) =Z. lutulentus (Kiener); Pelicaria vermis (Martyn) =all named Nukumaruan-Recent forms (other than P. rugosa (Marwick) and P. granttaylori n. sp.); Trivia flora Marwick =T.zealandica Kirk. Taxonomy revised: Zelippistes benhami (Suter) (OIS 13 and 9 at Wanganui), distinguished from Lippistes and Separatista; Stiracolpus species, informally; Maoricrypta profunda (Hutton), Waipipian-early Castlecliffian (- OIS 19); M. radiata (Hutton) (=incurva Zittel,=hochetteriana Woods, =wilckensi Finlay), (Middle Miocene

  3. Consumption rates and prey preference of the invasive gastropod Rapana venosa in the Northern Adriatic Sea

    Science.gov (United States)

    Savini, Dario; Occhipinti-Ambrogi, Anna

    2006-05-01

    The alien Asian gastropod Rapana venosa (Valenciennes 1846) was first recorded in 1973 along the Italian coast of the Northern Adriatic Sea. Recently, this predator of bivalves has been spreading all around the world oceans, probably helped by ship traffic and aquaculture trade. A caging experiment in natural environment was performed during the summer of 2002 in Cesenatico (Emilia-Romagna, Italy) in order to estimate consumption rates and prey preference of R. venosa. The prey items chosen were the Mediterranean mussel Mytilus galloprovincialis (Lamarck 1819), the introduced carpet clam Tapes philippinarum (Adams and Reeve 1850), both supporting the local fisheries, and the Indo-Pacific invasive clam Anadara (Scapharca) inaequivalvis (Bruguière 1789). Results showed an average consumption of about 1 bivalve prey per day (or 1.2 g wet weight per day). Predation was species and size selective towards small specimens of A. inaequivalvis; consumption of the two commercial species was lower. These results might reduce the concern about the economical impact on the local bivalve fishery due to the presence of the predatory gastropod. On the other hand, selective predation might probably alter local community structure, influencing competition amongst filter feeder/suspension feeder bivalve species and causing long-term ecological impact. The large availability of food resource and the habitat characteristics of the Emilia-Romagna littoral makes this area an important breeding ground for R. venosa in the Mediterranean Sea, thus worthy of consideration in order to understand the bioinvasion ecology of this species and to control its likely further dispersal.

  4. First report of Temnocephala haswelli (Platyhelminthes: Temnocephalida in Pomacea canaliculata (Mollusca: Ampullariidae from Brazil: description update based on specimens from the state of Rio Grande do Sul, Brazil

    Directory of Open Access Journals (Sweden)

    Samantha A. Seixas

    2010-06-01

    Full Text Available The impact of the discovery of Temnocephala haswelli Ponce de Léon, 1989, described as ectosymbionts of ampullariid apple snails outside of Uruguay, motivated us to collect a large number of specimens of Pomacea canaliculata (Lamarck, 1822 from several localities in the southern portion of the state of Rio Grande do Sul. This species was recorded three times after its description: in a study of chromosomes, in a study about the ultrastructure of the collar receptor cells, and in a study of the Haswell glands, all conducted in Uruguay. A total of 301 specimens of P. canaliculata were collected from 1999 to 2007. Temnocephalans found in the pallial cavity were identified as T. haswelli, which occurred in single infestations or concurrently with Temnocephala iheringi Haswell, 1893. Helminths usually showed a light-orange body pigmentation and conspicuous, intense red-eye pigment. Many taxonomic characters evidenced by several techniques were documented photographically for the first time. The typical curved cirrus, approximately 90°, typical of the species, showed some variation in the width of the shaft base, whereas the first longitudinal row of spines of the introvert appeared with shorter spines. The vagina was found to be thick-walled, but not very muscular, and to have a single, large and slightly asymmetrical sphincter, with the posterior portion of slightly larger diameter. Eggs were observed in the umbilicus and along the suture, but predominantly in the body whorl of the shell. Egg peduncles were found to be very short or, most of the time, the eggs were sessile, always with a long apical filament. The rounded shape of the dorsolateral 'excretory' syncytial epidermal plates had external margins reaching the ventrolateral region of the body and eccentric nephridiopores. This is the first record of the species outside Uruguay and in Brazil.

  5. Amphimixis and the individual in evolving populations: does Weismann's Doctrine apply to all, most or a few organisms?

    Science.gov (United States)

    Niklas, Karl J.; Kutschera, Ulrich

    2014-05-01

    The German biologist August Weismann (1834-1914) proposed that amphimixis (sexual reproduction) creates variability for natural selection to act upon, and hence he became one of the founders of the Neo-Darwinian theory of biological evolution. He is perhaps best known for what is called "Weismann's Doctrine" or "Weismann's Barrier" (i.e. the irreversible separation of somatic and germ cell functionalities early during ontogeny in multicellular organisms). This concept provided an unassailable argument against "soft inheritance" sensu Lamarck and informed subsequent theorists that the only "individual" in the context of evolution is the mature, reproductive organism. Herein, we review representative model organisms whose embryology conforms to Weismann's Doctrine (e.g. flies and mammals) and those that do not (e.g. freshwater hydroids and plants) based on this survey and the Five Kingdoms of Life scheme; we point out that most species (notably bacteria, fungi, protists and plants) are "non-Weismannian" in ways that make a canonical definition of the "individual" problematic if not impossible. We also review critical life history functional traits that allow us to create a matrix of all theoretically conceivable life cycles (for eukaryotic algae, embryophytes, fungi and animals), which permits us to establish where this scheme Weismann's Doctrine holds true and where it does not. In addition, we argue that bacteria, the dominant organisms of the biosphere, exist in super-cellular biofilms but rarely as single (planktonic) microbes. Our analysis attempts to show that competition among genomic variants in cell lineages played a critical part in the evolution of multicellularity and life cycle diversity. This feature was largely ignored during the formulation of the synthetic theory of biological evolution and its subsequent elaborations.

  6. An annotated catalogue and bibliography of the taxonomy, synonymy and distribution of the Recent Vetigastropoda of South Africa (Mollusca).

    Science.gov (United States)

    Herbert, David G

    2015-01-01

    A complete inventory of the known Recent vetigastropod fauna of South Africa is provided. Bibliographic citations to works discussing the taxonomy, synonymy and distribution of the species in a southern African or south-western Indian Ocean context are provided. Additional explanatory notes are given where pertinent. New genus records for South Africa: Acremodontina B.A. Marshall, 1995; Choristella Bush, 1879; Cocculinella Thiele, 1909; Conjectura Finlay, 1926; Crosseola Iredale, 1924; Falsimargarita Powell, 1951; Lepetella Verrill, 1880; Profundisepta McLean & Geiger, 1998; Stomatella Lamarck, 1816; Stomatia Helbling, 1779; Stomatolina Iredale, 1937; Synaptocochlea Pilsbry, 1890; Tibatrochus Nomura, 1940; Visayaseguenzia Poppe, Tagaro & Dekker, 2006; Zetela Finlay, 1926. New species records for South Africa: Acremodontina aff. carinata Powell, 1940; Anatoma finlayi (Powell, 1937); Anatoma munieri (P. Fischer, 1862); Calliotropis acherontis B.A. Marshall, 1979; Calliotropis bucina Vilvens, 2006; Cocculinella minutissima (E.A. Smith, 1904); Diodora ruppellii (G.B. Sowerby (I), 1835); Emarginula costulata Deshayes, 1863; Emarginula decorata Deshayes, 1863; Jujubinus hubrechti Poppe, Tagaro & Dekker, 2006; Lepetella sp.; Seguenzia orientalis Thiele, 1925; Stomatella auricula Lamarck, 1816; Stomatia phymotis Helbling, 1779; Stomatolina angulata (A. Adams, 1850); Stomatolina cf. calliostoma (A. Adams, 1850); Stomatolina aff. danblumi Singer & Mienis, 1999; Stomatolina cf. rubra (Lamarck, 1822); Stomatolina sp.; Synaptocochlea concinna (Gould, 1845); Tectus mauritianus (Gmelin, 1791); Tibatrochus cf. incertus (Schepman, 1908); Turbo imperialis Gmelin, 1791; Turbo tursicus Reeve, 1848; Visayaseguenzia compsa (Melvill, 1904).New species: Spectamen martensi, replacement name for Spectamen semisculptum sensu Herbert (1987) (non Martens, 1904). New name: Oxystele antoni is proposed as a new name for Trochus (Turbo) variegatus (non Gmelin, 1791 =Heliacus) Anton, 1838. Revised

  7. Mercury contents in shellfish sold in Qingdao City and their health risk:Distribution and health risk assessment%青岛市售贝类中总汞含量分布及人群健康风险

    Institute of Scientific and Technical Information of China (English)

    张磊; 张磊

    2014-01-01

    In order to understand the status of mercury pollution in the shellfish of Qingdao City, and mercury health risk for the population via consumption of shellfish production, a total of 181 samples for 8 types of shellfish including Ruditapes philippinarum, Argopectens irradias, Meretrix meretrix L, Sinonovacula, Haliotis asinine, Busycon canaliculatu, Ostrea riuularis Gould, Neptunea arthritica cumingii Crosse, were collected from the markets of 8 administrative regions in Qingdao from October in 2012 to April in 2013. The mercury contents in the shellfish samples were determined by the cold vapor atomic absorption spectrophotometry. The range of mercury contents in all the kinds of shellfish was from 0.001 mg·kg-1 to 0.098 mg·kg-1 . The average mercury content in Ruditapes philippinarum, Argopectens irradias, Meretrix meretrix L, Sinonovacula, Haliotis asinina Busycon canaliculatu, Ostrea riuularis Gould, Neptunea arthritica cumingii Crosse was 0.02, 0.039, 0.012, 0�013, 0.031, 0.030, 0.021, 0.020 mg·kg-1 , respectively. Among the production areas of shellfish in Qingdao, the samples from Hong Island had the highest average mercury content of 0.046 mg·kg-1 , followed by that from Longkou of 0. 027 mg·kg-1 . Shellfish samples from Rushan and Rizhao had the lowest mercury contents, which were 0. 002 mg·kg-1 and 0. 003 mg·kg-1 , respectively. The mercury concentrations were under the limit of national permitted levels in foods ( GB 2762-2012, 0.5 mg·kg-1 ) . The results of the assessments of mercury intake indicated that the amount of mercury intake through consumption of shellfish was far below the acceptable daily intake recommended by FAO/WHO. However, the calculation results of the target hazard quotient ( THQ) based on the new reference dose set by US Environmental Protection Agency showed that there was high mercury health risk for children living in the target areas through the exposure path of the consumption of shellfish products.%为了解青岛

  8. Consumption and digestion of animal food by rocky intertidal herbivores: an evaluation of digestive flexibility and omnivory in three grazing species Consumo y digestión de alimento animal por herbívoros del intermareal rocoso: evaluación de flexibilidad digestiva y omnivoría en tres especies de pastoreadores

    Directory of Open Access Journals (Sweden)

    Patricio A Camus

    2009-01-01

    Full Text Available The ingestion of invertebrates by herbivores on rocky intertidal shores is traditionally considered a casual phenomenon. However, a recent study of 29 species in northern Chile shows that animal consumption is widespread, consistent, and important, suggesting that some of these herbivores may actually be omnivores. Therefore, we examined the capability of three common Chilean herbivores (the key-hole limpets Fissurella limbata and Fissurella pida and the polyplacophoran Chiton granosus to digest animal food. For each species, we conducted no-choice feeding experiments using artificial foods based on either algal or animal tissue from one of their frequent prey (Ulva rigida, Perumytilus purpuratus. After the feeding trials, we evaluated the total proteolytic activity (availability of free amino acids in the digestive contents of the species studied and, as a reference, we evaluated this activity in animals obtained directly from the field. We found that all three species were able to eat animal food, and this consumption was not significantly different from that of algal food, suggesting that both foods were not only edible but at least similarly palatable. In addition, we detected comparable levels of proteolytic activity under the three feeding conditions for the three species. No statistical differences were found for C. granosus, but activity was significantly higher with animal food in F. limbata and with algal food in F. pida. Our data show the high digestive flexibility of these species, suggesting their ability for adaptive modulation and the possibility that they are true omnivorous consumers. We discuss the implications of these results for our current view of the structure of rocky intertidal food webs.La ingestión de invertebrados por herbívoros de costas intermareales rocosas se considera tradi-cionalmente un fenómeno casual. Sin embargo, un estudio reciente en 29 especies del norte de Chile muestra que el consumo animal es

  9. Cathepsin L of the sea cucumber Apostichopus japonicus-molecular characterization and transcriptional response to Vibrio splendidus infection.

    Science.gov (United States)

    Yang, Jingwen; Liu, Huihui; Zheng, Gang; Xiang, Xiaowei; Lv, Zhenming; Wang, Tianming

    2016-02-01

    Cathepsin L, a lysosomal endopeptidase, has been noted for its involvement in the innate immune response in invertebrates. Here, the cathepsin L cDNA of the sea cucumber Apostichopus japonicus (AjCatL) is identified from an EST library and then cloned by the rapid amplification of the cDNA ends (RACE) PCR. The full-length cDNA is 1678 bp long containing an open reading frame (ORF) of 1002 bp, an 80 bp 5' UTR and a 599 bp 3' UTR. The cDNA encodes 333 amino acid residues with a predicted molecular mass of 37.07 kDa and a theoretical isoelectric point (pI) of 5.01. The full-length AjCatL contains three active sites of eukaryotic thiol (cysteine) protease at positions 133-144, 278-288 and 295-314. Analysis of the predicted tertiary structure of prepro-CatL (17-333 aa) and mature-CatL (116-333 aa) reveals that the propeptide region (17-115 aa) blocks access to the substrate-binding cleft. Phylogenetic analysis shows that the AjCatL is clustered together with two other CatLs from Strongylocentrotus purpuratus. The enzymatic activity of AjCatL was verified using a substrate hydrolyzing assay with recombinant mAjCatL. Further analysis of real time-PCR demonstrates that the expression of AjCatL mRNA is significantly up-regulated in the coelomocytes in cases of infection with the common bacterial pathogen, Vibrio splendidus. This suggests that the AjCatL is likely to be involved in the immune response. PMID:26777896

  10. Transcriptome sequencing and characterization for the sea cucumber Apostichopus japonicus (Selenka, 1867.

    Directory of Open Access Journals (Sweden)

    Huixia Du

    Full Text Available BACKGROUND: Sea cucumbers are a special group of marine invertebrates. They occupy a taxonomic position that is believed to be important for understanding the origin and evolution of deuterostomes. Some of them such as Apostichopus japonicus represent commercially important aquaculture species in Asian countries. Many efforts have been devoted to increasing the number of expressed sequence tags (ESTs for A. japonicus, but a comprehensive characterization of its transcriptome remains lacking. Here, we performed the large-scale transcriptome profiling and characterization by pyrosequencing diverse cDNA libraries from A. japonicus. RESULTS: In total, 1,061,078 reads were obtained by 454 sequencing of eight cDNA libraries representing different developmental stages and adult tissues in A. japonicus. These reads were assembled into 29,666 isotigs, which were further clustered into 21,071 isogroups. Nearly 40% of the isogroups showed significant matches to known proteins based on sequence similarity. Gene ontology (GO and KEGG pathway analyses recovered diverse biological functions and processes. Candidate genes that were potentially involved in aestivation were identified. Transcriptome comparison with the sea urchin Strongylocentrotus purpuratus revealed similar patterns of GO term representation. In addition, 4,882 putative orthologous genes were identified, of which 202 were not present in the non-echinoderm organisms. More than 700 simple sequence repeats (SSRs and 54,000 single nucleotide polymorphisms (SNPs were detected in the A. japonicus transcriptome. CONCLUSION: Pyrosequencing was proven to be efficient in rapidly identifying a large set of genes for the sea cucumber A. japonicus. Through the large-scale transcriptome sequencing as well as public EST data integration, we performed a comprehensive characterization of the A. japonicus transcriptome and identified candidate aestivation-related genes. A large number of potential genetic

  11. Molecular cloning of heat shock protein 10 (Hsp10) and 60 (Hsp60) cDNAs and their expression analysis under thermal stress in the sea cucumber Apostichopus japonicus.

    Science.gov (United States)

    Xu, Dongxue; Sun, Lina; Liu, Shilin; Zhang, Libin; Ru, Xiaoshang; Zhao, Ye; Yang, Hongsheng

    2014-05-01

    Hsp10 and Hsp60 are important heat shock proteins (HSPs), which might be indispensable in the heat shock response and many other physiological processes. We obtained full-length cDNAs of genes hsp10 and hsp60 and classified their mRNA expression levels under thermal stress in the sea cucumber Apostichopus japonicus. Full-length hsp10 cDNA was 1528 bp containing a 5' untranslated region (UTR) of 83 bp, a 3' UTR of 1133 bp and an open reading frame (ORF) of 312 bp encoding 103 amino acid residues. Full-length hsp60 cDNA was 2560 bp containing a 118-bp 5' UTR, a 678-bp 3' UTR and a 1764-bp ORF encoding 586 amino acid residues. The deduced amino acid sequences of Hsp10 and Hsp60 shared the highest identity with sequences of the sea urchin Strongylocentrotus purpuratus, and phylogenetic trees showed that the evolution of Hsp10 and Hsp60 was almost in accord with the evolution of species. Further analysis by real-time PCR showed that the expression of hsp10 and hsp60 mRNA was highly up-regulated at 26 °C compared with other three groups (20, 22, 24 °C), and their expression in the intestine was in a time-dependent manner at 26 °C. The results suggested that hsp10 and hsp60 were involved in the heat-shock response in the sea cucumber A. japonicus. PMID:24721556

  12. The protein precursors of peptides that affect the mechanics of connective tissue and/or muscle in the echinoderm Apostichopus japonicus.

    Directory of Open Access Journals (Sweden)

    Maurice R Elphick

    Full Text Available Peptides that cause muscle relaxation or contraction or that modulate electrically-induced muscle contraction have been discovered in the sea cucumber Apostichopus japonicus (Phylum Echinodermata; Class Holothuroidea. By analysing transcriptome sequence data, here the protein precursors of six of these myoactive peptides (the SALMFamides Sticho-MFamide-1 and -2, NGIWYamide, stichopin, GN-19 and GLRFA have been identified, providing novel insights on neuropeptide and endocrine-type signalling systems in echinoderms. The A. japonicus SALMFamide precursor comprises eight putative neuropeptides including both L-type and F-type SALMFamides, which contrasts with previous findings from the sea urchin Strongylocentrotus purpuratus where L-type and F-type SALMFamides are encoded by different genes. The NGIWYamide precursor contains five copies of NGIWYamide but, unlike other NG peptide-type neuropeptide precursors in deuterostomian invertebrates, the NGIWYamide precursor does not have a C-terminal neurophysin domain, indicating loss of this character in holothurians. NGIWYamide was originally discovered as a muscle contractant, but it also causes stiffening of mutable connective tissue in the body wall of A. japonicus, whilst holokinins (PLGYMFR and derivative peptides cause softening of the body wall. However, the mechanisms by which these peptides affect the stiffness of body wall connective tissue are unknown. Interestingly, analysis of the A. japonicus transcriptome reveals that the only protein containing the holokinin sequence PLGYMFR is an alpha-5 type collagen. This suggests that proteolysis of collagen may generate peptides (holokinins that affect body wall stiffness in sea cucumbers, providing a novel perspective on mechanisms of mutable connective tissue in echinoderms.

  13. The evolution and diversity of SALMFamide neuropeptides.

    Directory of Open Access Journals (Sweden)

    Maurice R Elphick

    Full Text Available The SALMFamides are a family of neuropeptides that act as muscle relaxants in echinoderms. Two types of SALMFamides have been identified: L-type (e.g. the starfish neuropeptides S1 and S2 with the C-terminal motif LxFamide (x is variable and F-type with the C-terminal motif FxFamide. In the sea urchin Strongylocentrotus purpuratus (class Echinoidea there are two SALMFamide genes, one encoding L-type SALMFamides and a second encoding F-type SALMFamides, but hitherto it was not known if this applies to other echinoderms. Here we report the identification of SALMFamide genes in the sea cucumber Apostichopus japonicus (class Holothuroidea and the starfish Patiria miniata (class Asteroidea. In both species there are two SALMFamide genes: one gene encoding L-type SALMFamides (e.g. S1 in P. miniata and a second gene encoding F-type SALMFamides plus one or more L-type SALMFamides (e.g. S2-like peptide in P. miniata. Thus, the ancestry of the two SALMFamide gene types traces back to the common ancestor of echinoids, holothurians and asteroids, although it is not clear if the occurrence of L-type peptides in F-type SALMFamide precursors is an ancestral or derived character. The gene sequences also reveal a remarkable diversity of SALMFamide neuropeptides. Originally just two peptides (S1 and S2 were isolated from starfish but now we find that in P. miniata, for example, there are sixteen putative SALMFamide neuropeptides. Thus, the SALMFamides would be a good model system for experimental analysis of the physiological significance of neuropeptide "cocktails" derived from the same precursor protein.

  14. Search for eukaryotic motility proteins in spirochetes: immunological detection of a tektin-like protein in Spirochaeta halophila.

    Science.gov (United States)

    Barth, A L; Stricker, J A; Margulis, L

    1991-01-01

    The serial endosymbiotic theory (SET) for the spirochete origin of undulipodia (cilia and eukaryotic flagella) predicts that a greater number of axonemal proteins will show homology to spirochete than to other bacterial proteins. To continue testing, the SET proteins associated with eukaryotic motility (tektin, centrin and calmodulin) were sought in Spirochaeta halophila. Western blot immunological detection techniques (for tektin and centrin) and two-dimensional gel analysis (for calmodulin) were used. Tektins are filamentous proteins extending the length of the axoneme in sperm tails and other undulipodia. Whole cell extracts of S. halophila were probed with antibodies made against three sea urchin (Lytechinus pictus) sperm axonemal tektins (tektins A, B, and C). In the spirochetes, one tektin-like protein was detected as a band on Western blots (a C tektin.) An antibody made against Lytechinus pictus sperm tail axonemes, affinity-purified against the C tektin of another sea urchin, Stronglyocentrotus purpuratus, bound to a 30 kDa protein from Spirochaeta halophila. The C tektin epitope was not detected in Escherichia coli. Both the poly- and monoclonal anti-centrin antibodies cross-reacted with multiple proteins in the control alga (Tetraselmis striata) and in the putatively negative control bacterium E. coli. No cross reaction was seen between any anti-centrin antibody and S. halophila. Neither did a two-dimensional gel analysis reveal the presence of calmodulin in these spirochetes or in the two other prokaryotes tested (Spiroplasma citri, Acholeplasma laidlawii). Although neither centrin nor calmodulin were detected, a 30 kDa tektin-like protein apparently is present in these spirochetes. PMID:1863720

  15. De novo assembly and analysis of tissue-specific transcriptomes revealed the tissue-specific genes and profile of immunity from Strongylocentrotus intermedius.

    Science.gov (United States)

    Chen, Yadong; Chang, Yaqing; Wang, Xiuli; Qiu, Xuemei; Liu, Yang

    2015-10-01

    Strongylocentrotus intermedius is an important marine species in north China and Japan. Recent years, diseases are threating the sea urchin aquaculture industry seriously. To provide a genetic resource for S. intermedius as well as overview the immune-related genes of S. intermedius, we performed transcriptome sequencing of three cDNA libraries representing three tissues, coelomocytes, gut and peristomial membrane respectively. In total 138,421 contigs were assembled from all sequencing data. 96,764 contigs were annotated according to bioinformatics databases, including NT, nr, Swiss-Prot, KEGG, COG. 49,336 Contigs were annotated as CDS. In this study, we obtained 24,778 gene families from S. intermedius transcriptome. The gene expression analysis revealed that more genes were expressed in gut, more high expression level genes in coelomocytes when compared with other tissues. Specific expressed contigs in coelomocytes, gut, and peristomial membrane were 546, 1136, and 1012 respectively. Pathway analysis suggested 25, 17 and 36 potential specifically pathways may specific progressed in peristomial membrane, gut and coelomocytes respectively. Similarities and differences between S. intermedius and other echinoderms were analyzed. S. intermedius was more homology to Strongylocentrotus purpuratus than others sea urchin. Of 24,778 genes, 1074 genes are immune-related, immune genes were expressed with a higher level in coelomocytes than other tissues. Complement system may be the most important immune system in sea urchin. We also identified 2438 SSRs and 16,236 SNPs for S. intermedius. These results provide a transcriptome resource and foundation to study molecular mechanisms of sea urchin immune system. PMID:26253994

  16. Species sensitivity distribution evaluation for chronic nickel toxicity to marine organisms.

    Science.gov (United States)

    DeForest, David K; Schlekat, Christian E

    2013-10-01

    In Europe, the European Union's Existing Substances Regulation (EEC 793/93), the REACH Regulation, and Water Framework Directive all share common guidance for conducting environmental effects assessments, which can be further used to derive predicted no effect concentrations (PNECs) and environmental quality standards (EQS) for chemical substances. To meet the criteria for using a species sensitivity distribution (SSD) in the effects assessment of Ni for marine organisms, chronic toxicity data from the published scientific literature were augmented with toxicity testing of several additional marine species including: a unicellular alga (Dunalliela tertiolecta), a diatom (Skeletonema costatum), 2 macroalgae (Champia parvula, Macrocystis pyrifera), 2 mollusks (Crassostrea gigas, Mytilus galloprovincialis), 2 echinoderms (Dendraster excentricus, Strongylocentrotus purpuratus), a polychaete (Neanthes arenaceodentata), and a fish (Cyprinodon variegatus). Based on this updated database, which includes chronic Ni toxicity data for a total of 17 marine species, HC5 values (hazardous concentrations to 5% of the species) were derived using an SSD. The most sensitive species is a tropical sea urchin from the Caribbean region, Diadema antillarum, which has an EC10 that is approximately 6-fold less than the EC10 for the second most sensitive species tested. There is some uncertainty in the representativeness of D. antillarum to temperate European marine waters because 1) a European sea urchin species (Paracentrotus lividus) is approximately 48-fold less sensitive to Ni, and (2) ambient marine Ni concentrations in at least some European waters closely approach the D. antillarum EC10. The HC5 values with and without D. antillarum included in the SSD are 3.9 and 20.9 μg/L, respectively. Site-specific toxicity testing with local species may be warranted for locations where Ni concentrations fall between the range in HC5s of 3.9 to 20.9 μg/L. PMID:23553986

  17. Characterization of the deleted in autism 1 protein family: implications for studying cognitive disorders.

    Directory of Open Access Journals (Sweden)

    Azhari Aziz

    Full Text Available Autism spectrum disorders (ASDs are a group of commonly occurring, highly-heritable developmental disabilities. Human genes c3orf58 or Deleted In Autism-1 (DIA1 and cXorf36 or Deleted in Autism-1 Related (DIA1R are implicated in ASD and mental retardation. Both gene products encode signal peptides for targeting to the secretory pathway. As evolutionary medicine has emerged as a key tool for understanding increasing numbers of human diseases, we have used an evolutionary approach to study DIA1 and DIA1R. We found DIA1 conserved from cnidarians to humans, indicating DIA1 evolution coincided with the development of the first primitive synapses. Nematodes lack a DIA1 homologue, indicating Caenorhabditis elegans is not suitable for studying all aspects of ASD etiology, while zebrafish encode two DIA1 paralogues. By contrast to DIA1, DIA1R was found exclusively in vertebrates, with an origin coinciding with the whole-genome duplication events occurring early in the vertebrate lineage, and the evolution of the more complex vertebrate nervous system. Strikingly, DIA1R was present in schooling fish but absent in fish that have adopted a more solitary lifestyle. An additional DIA1-related gene we named DIA1-Like (DIA1L, lacks a signal peptide and is restricted to the genomes of the echinoderm Strongylocentrotus purpuratus and cephalochordate Branchiostoma floridae. Evidence for remarkable DIA1L gene expansion was found in B. floridae. Amino acid alignments of DIA1 family gene products revealed a potential Golgi-retention motif and a number of conserved motifs with unknown function. Furthermore, a glycine and three cysteine residues were absolutely conserved in all DIA1-family proteins, indicating a critical role in protein structure and/or function. We have therefore identified a new metazoan protein family, the DIA1-family, and understanding the biological roles of DIA1-family members will have implications for our understanding of autism and mental

  18. Innate immune complexity in the purple sea urchin: diversity of the Sp185/333 system

    Directory of Open Access Journals (Sweden)

    L. Courtney Smith

    2012-04-01

    Full Text Available The California purple sea urchin, Strongylocentrotus purpuratus, is a long-lived echinoderm with a complex and sophisticated innate immune system. Several large gene families that function in immunity in this species includes the Sp185/333 gene family with ~50 (±10 members. The family shows intriguing sequence diversity and encodes a broad array of diverse yet similar proteins. The genes have two exons of which the second encodes the mature protein and has repeats and blocks of sequence called elements. Mosaics of element patterns plus SNPs within the elements result in significant sequence diversity among the genes yet maintains similar structure among the members of the family. An Sp185/333-positive BAC insert has a cluster of six, tightly linked Sp185/333 genes that are flanked by GA microsatellites. The sequences between the GA microsatellites are much more similar to each other than are the sequences outside the microsatellites suggesting processes such as gene conversion, recombination, or duplication. However, close linkage does not correspond with greater sequence similarity compared to randomly cloned and sequenced genes that are unlikely to be linked. There are three segmental duplications that are bounded by GAT microsatellites and include three almost identical genes. RNA editing is detectible throughout the messages and putative post-translational modifications to the proteins result in broad arrays of Sp185/333 proteins that differ among individuals. The mature proteins have an N-terminal glycine-rich region, a central RGD motif, and a C-terminal histidine-rich region. The Sp185/333 proteins are localized to the cell surface and are found within vesicles in subsets of polygonal and small phagocytes. The coelomocyte proteome shows full-length and truncated proteins, including some with missense sequence. Current results suggest that both native and a recombinant Sp185/333 protein bind bacteria and are likely important in sea urchin

  19. An ancient evolutionary origin of the Rag1/2 gene locus.

    Science.gov (United States)

    Fugmann, Sebastian D; Messier, Cynthia; Novack, Laura A; Cameron, R Andrew; Rast, Jonathan P

    2006-03-01

    The diversity of antigen receptors in the adaptive immune system of jawed vertebrates is generated by a unique process of somatic gene rearrangement known as V(D)J recombination. The Rag1 and Rag2 proteins are the key mediators of this process. They are encoded by a compact gene cluster that has exclusively been identified in animal species displaying V(D)J-mediated immunity, and no homologous gene pair has been identified in other organisms. This distinctly restricted phylogenetic distribution has led to the hypothesis that one or both of the Rag genes were coopted after horizontal gene transfer and assembled into a Rag1/2 gene cluster in a common jawed vertebrate ancestor. Here, we identify and characterize a closely linked pair of genes, SpRag1L and SpRag2L, from an invertebrate, the purple sea urchin (Strongylocentrotus purpuratus) with similarity in both sequence and genomic organization to the vertebrate Rag1 and Rag2 genes. They are coexpressed during development and in adult tissues, and recombinant versions of the proteins form a stable complex with each other as well as with Rag1 and Rag2 proteins from several vertebrate species. We thus conclude that SpRag1L and SpRag2L represent homologs of vertebrate Rag1 and Rag2. In combination with the apparent absence of V(D)J recombination in echinoderms, this finding strongly suggests that linked Rag1- and Rag2-like genes were already present and functioning in a different capacity in the common ancestor of living deuterostomes, and that their specific role in the adaptive immune system was acquired much later in an early jawed vertebrate. PMID:16505374

  20. Regulation of membrane fusion and secretory events in the sea urchin embryo

    International Nuclear Information System (INIS)

    Membrane fusion and secretory events play a key role in fertilization and early development in the sea urchin embryo. To investigate the mechanism of membrane fusion, the effect of inhibitors of metalloendoprotease activity was studied on two model systems of cell fusion; fertilization and spiculogenesis by primary mesenchyme cells in the embryo. Both the zinc chelator, 1,10-phenanthroline, and peptide metalloprotease substrates were found to inhibit both fertilization and gamete fusion, while peptides that are not substrates of metalloproteases did not affect either process. Primary mesenchyme cells form the larval skeleton in the embryo by deposition of mineral and an organic matrix into a syncytial cavity formed by fusion of filopodia of these cells. Metalloprotease inhibitors were found to inhibit spiculogenesis both in vivo and in cultures of isolated primary mesenchyme cells, and the activity of a metalloprotease of the appropriate specificity was found in the primary mesenchyme cells. These two studies implicate the activity of a metalloprotease in a necessary step in membrane fusion. Following fertilization, exocytosis of the cortical granules results in the formation of the fertilization envelope and the hyaline layer, that surround the developing embryo. The hatching enzyme is secreted by the blastula stage sea urchin embryo, which proteolyzes the fertilization envelope surrounding the embryo, allowing the embryo to hatch. Using an assay that measures 125I-fertilization envelope degradation, the hatching enzyme was identified as a 33 kDa metalloprotease, and was purified by ion-exchange and affinity chromatography from the hatching media of Strongylocentrotus purpuratus embryos. The hatching enzyme showed a substrate preference for only a minor subset of fertilization envelope proteins

  1. Aggregation of sea urchin phagocytes is augmented in vitro by lipopolysaccharide.

    Science.gov (United States)

    Majeske, Audrey J; Bayne, Christopher J; Smith, L Courtney

    2013-01-01

    Development of protocols and media for culturing immune cells from marine invertebrates has not kept pace with advancements in mammalian immune cell culture, the latter having been driven by the need to understand the causes of and develop therapies for human and animal diseases. However, expansion of the aquaculture industry and the diseases that threaten these systems creates the need to develop cell and tissue culture methods for marine invertebrates. Such methods will enable us to better understand the causes of disease outbreaks and to develop means to avoid and remedy epidemics. We report a method for the short-term culture of phagocytes from the purple sea urchin, Strongylocentrotus purpuratus, by modifying an approach previously used to culture cells from another sea urchin species. The viability of cultured phagocytes from the purple sea urchin decreases from 91.6% to 57% over six days and phagocyte morphology changes from single cells to aggregates leading to the formation of syncytia-like structures. This process is accelerated in the presence of lipopolysaccharide suggesting that phagocytes are capable of detecting this molecular pattern in culture conditions. Sea urchin immune response proteins, called Sp185/333, are expressed on the surface of a subset of phagocytes and have been associated with syncytia-like structures. We evaluated their expression in cultured phagocytes to determine their possible role in cell aggregation and in the formation of syncytia-like structures. Between 0 and 3 hr, syncytia-like structures were observed in cultures when only ~10% of the cells were positive for Sp185/333 proteins. At 24 hr, ~90% of the nuclei were Sp185/333-positive when all of the phagocytes had aggregated into syncytia-like structures. Consequently, we conclude that the Sp185/333 proteins do not have a major role in initiating the aggregation of cultured phagocytes, however the Sp185/333 proteins are associated with the clustered nuclei within the

  2. Phylogeny of Echinoderm Hemoglobins.

    Directory of Open Access Journals (Sweden)

    Ana B Christensen

    Full Text Available Recent genomic information has revealed that neuroglobin and cytoglobin are the two principal lineages of vertebrate hemoglobins, with the latter encompassing the familiar myoglobin and α-globin/β-globin tetramer hemoglobin, and several minor groups. In contrast, very little is known about hemoglobins in echinoderms, a phylum of exclusively marine organisms closely related to vertebrates, beyond the presence of coelomic hemoglobins in sea cucumbers and brittle stars. We identified about 50 hemoglobins in sea urchin, starfish and sea cucumber genomes and transcriptomes, and used Bayesian inference to carry out a molecular phylogenetic analysis of their relationship to vertebrate sequences, specifically, to assess the hypothesis that the neuroglobin and cytoglobin lineages are also present in echinoderms.The genome of the sea urchin Strongylocentrotus purpuratus encodes several hemoglobins, including a unique chimeric 14-domain globin, 2 androglobin isoforms and a unique single androglobin domain protein. Other strongylocentrotid genomes appear to have similar repertoires of globin genes. We carried out molecular phylogenetic analyses of 52 hemoglobins identified in sea urchin, brittle star and sea cucumber genomes and transcriptomes, using different multiple sequence alignment methods coupled with Bayesian and maximum likelihood approaches. The results demonstrate that there are two major globin lineages in echinoderms, which are related to the vertebrate neuroglobin and cytoglobin lineages. Furthermore, the brittle star and sea cucumber coelomic hemoglobins appear to have evolved independently from the cytoglobin lineage, similar to the evolution of erythroid oxygen binding globins in cyclostomes and vertebrates.The presence of echinoderm globins related to the vertebrate neuroglobin and cytoglobin lineages suggests that the split between neuroglobins and cytoglobins occurred in the deuterostome ancestor shared by echinoderms and vertebrates.

  3. Unique system of photoreceptors in sea urchin tube feet

    Science.gov (United States)

    Ullrich-Lüter, Esther M; Dupont, Sam; Arboleda, Enrique; Hausen, Harald; Arnone, Maria Ina

    2011-01-01

    Different sea urchin species show a vast variety of responses to variations in light intensity; however, despite this behavioral evidence for photosensitivity, light sensing in these animals has remained an enigma. Genome information of the recently sequenced purple sea urchin (Strongylocentrotus purpuratus) allowed us to address this question from a previously unexplored molecular perspective by localizing expression of the rhabdomeric opsin Sp-opsin4 and Sp-pax6, two genes essential for photoreceptor function and development, respectively. Using a specifically designed antibody against Sp-Opsin4 and in situ hybridization for both genes, we detected expression in two distinct groups of photoreceptor cells (PRCs) located in the animal's numerous tube feet. Specific reactivity of the Sp-Opsin4 antibody with sea star optic cushions, which regulate phototaxis, suggests a similar visual function in sea urchins. Ultrastructural characterization of the sea urchin PRCs revealed them to be of a microvillar receptor type. Our data suggest that echinoderms, in contrast to chordates, deploy a microvillar, r-opsin–expressing PRC type for vision, a feature that has been so far documented only in protostome animals. Surprisingly, sea urchin PRCs lack any associated screening pigment. Indeed, one of the tube foot PRC clusters may account for directional vision by being shaded through the opaque calcite skeleton. The PRC axons connect to the animal internal nervous system, suggesting an integrative function beyond local short circuits. Because juveniles display no phototaxis until skeleton completion, we suggest a model in which the entire sea urchin, deploying its skeleton as PRC screening device, functions as a huge compound eye. PMID:21536888

  4. Distribution and evolution of the serine/aspartate racemase family in invertebrates.

    Science.gov (United States)

    Uda, Kouji; Abe, Keita; Dehara, Yoko; Mizobata, Kiriko; Sogawa, Natsumi; Akagi, Yuki; Saigan, Mai; Radkov, Atanas D; Moe, Luke A

    2016-02-01

    Free D-amino acids have been found in various invertebrate phyla, while amino acid racemase genes have been identified in few species. The purpose of this study is to elucidate the distribution, function, and evolution of amino acid racemases in invertebrate animals. We searched the GenBank databases, and found 11 homologous serine racemase genes from eight species in eight different invertebrate phyla. The cloned genes were identified based on their maximum activity as Acropora millepora (Cnidaria) serine racemase (SerR) and aspartate racemase (AspR), Caenorhabditis elegans (Nematoda) SerR, Capitella teleta (Annelida) SerR, Crassostrea gigas (Mollusca) SerR and AspR, Dugesia japonica (Platyhelminthes) SerR, Milnesium tardigradum (Tardigrada) SerR, Penaeus monodon (Arthropoda) SerR and AspR and Strongylocentrotus purpuratus (Echinodermata) AspR. We found that Acropora, Aplysia, Capitella, Crassostrea and Penaeus had two amino acid racemase paralogous genes and these paralogous genes have evolved independently by gene duplication at their recent ancestral species. The transcriptome analyses using available SRA data and enzyme kinetic data suggested that these paralogous genes are expressed in different tissues and have different functions in vivo. Phylogenetic analyses clearly indicated that animal SerR and AspR are not separated by their particular racemase functions and form a serine/aspartate racemase family cluster. Our results revealed that SerR and AspR are more widely distributed among invertebrates than previously known. Moreover, we propose that the triple serine loop motif at amino acid positions 150-152 may be responsible for the large aspartate racemase activity and the AspR evolution from SerR. PMID:26352274

  5. Cis-regulatory control of the nuclear receptor Coup-TF gene in the sea urchin Paracentrotus lividus embryo.

    Directory of Open Access Journals (Sweden)

    Lamprini G Kalampoki

    Full Text Available Coup-TF, an orphan member of the nuclear receptor super family, has a fundamental role in the development of metazoan embryos. The study of the gene's regulatory circuit in the sea urchin embryo will facilitate the placement of this transcription factor in the well-studied embryonic Gene Regulatory Network (GRN. The Paracentrotus lividus Coup-TF gene (PlCoup-TF is expressed throughout embryonic development preferentially in the oral ectoderm of the gastrula and the ciliary band of the pluteus stage. Two overlapping λ genomic clones, containing three exons and upstream sequences of PlCoup-TF, were isolated from a genomic library. The transcription initiation site was determined and 5' deletions and individual segments of a 1930 bp upstream region were placed ahead of a GFP reporter cassette and injected into fertilized P.lividus eggs. Module a (-532 to -232, was necessary and sufficient to confer ciliary band expression to the reporter. Comparison of P.lividus and Strongylocentrotus purpuratus upstream Coup-TF sequences, revealed considerable conservation, but none within module a. 5' and internal deletions into module a, defined a smaller region that confers ciliary band specific expression. Putative regulatory cis-acting elements (RE1, RE2 and RE3 within module a, were specifically bound by proteins in sea urchin embryonic nuclear extracts. Site-specific mutagenesis of these elements resulted in loss of reporter activity (RE1 or ectopic expression (RE2, RE3. It is proposed that sea urchin transcription factors, which bind these three regulatory sites, are necessary for spatial and quantitative regulation of the PlCoup-TF gene at pluteus stage sea urchin embryos. These findings lead to the future identification of these factors and to the hierarchical positioning of PlCoup-TF within the embryonic GRN.

  6. In-depth, high-accuracy proteomics of sea urchin tooth organic matrix

    Directory of Open Access Journals (Sweden)

    Mann Matthias

    2008-12-01

    Full Text Available Abstract Background The organic matrix contained in biominerals plays an important role in regulating mineralization and in determining biomineral properties. However, most components of biomineral matrices remain unknown at present. In sea urchin tooth, which is an important model for developmental biology and biomineralization, only few matrix components have been identified. The recent publication of the Strongylocentrotus purpuratus genome sequence rendered possible not only the identification of genes potentially coding for matrix proteins, but also the direct identification of proteins contained in matrices of skeletal elements by in-depth, high-accuracy proteomic analysis. Results We identified 138 proteins in the matrix of tooth powder. Only 56 of these proteins were previously identified in the matrices of test (shell and spine. Among the novel components was an interesting group of five proteins containing alanine- and proline-rich neutral or basic motifs separated by acidic glycine-rich motifs. In addition, four of the five proteins contained either one or two predicted Kazal protease inhibitor domains. The major components of tooth matrix were however largely identical to the set of spicule matrix proteins and MSP130-related proteins identified in test (shell and spine matrix. Comparison of the matrices of crushed teeth to intact teeth revealed a marked dilution of known intracrystalline matrix proteins and a concomitant increase in some intracellular proteins. Conclusion This report presents the most comprehensive list of sea urchin tooth matrix proteins available at present. The complex mixture of proteins identified may reflect many different aspects of the mineralization process. A comparison between intact tooth matrix, presumably containing odontoblast remnants, and crushed tooth matrix served to differentiate between matrix components and possible contributions of cellular remnants. Because LC-MS/MS-based methods directly

  7. Beyond BLASTing: tertiary and quaternary structure analysis helps identify major vault proteins.

    Science.gov (United States)

    Daly, Toni K; Sutherland-Smith, Andrew J; Penny, David

    2013-01-01

    We examine the advantages of going beyond sequence similarity and use both protein three-dimensional (3D) structure prediction and then quaternary structure (docking) of inferred 3D structures to help evaluate whether comparable sequences can fold into homologous structures with sufficient lateral associations for quaternary structure formation. Our test case is the major vault protein (MVP) that oligomerizes in multiple copies to form barrel-like vault particles and is relatively widespread among eukaryotes. We used the iterative threading assembly refinement server (I-TASSER) to predict whether putative MVP sequences identified by BLASTp and PSI Basic Local Alignment Search Tool are structurally similar to the experimentally determined rodent MVP tertiary structures. Then two identical predicted quaternary structures from I-TASSER are analyzed by RosettaDock to test whether a pair-wise association occurs, and hence whether the oligomeric vault complex is likely to form for a given MVP sequence. Positive controls for the method are the experimentally determined rat (Rattus norvegicus) vault X-ray crystal structure and the purple sea urchin (Strongylocentrotus purpuratus) MVP sequence that forms experimentally observed vaults. These and two kinetoplast MVP structural homologs were predicted with high confidence value, and RosettaDock predicted that these MVP sequences would dock laterally and therefore could form oligomeric vaults. As the negative control, I-TASSER did not predict an MVP-like structure from a randomized rat MVP sequence, even when constrained to the rat MVP crystal structure (PDB:2ZUO), thus further validating the method. The protocol identified six putative homologous MVP sequences in the heterobolosean Naegleria gruberi within the excavate kingdom. Two of these sequences are predicted to be structurally similar to rat MVP, despite being in excess of 300 residues shorter. The method can be used generally to help test predictions of homology via

  8. Sea urchin vault structure, composition, and differential localization during development

    Directory of Open Access Journals (Sweden)

    Dickey-Sims Carrie

    2005-02-01

    Full Text Available Abstract Background Vaults are intriguing ribonucleoprotein assemblies with an unknown function that are conserved among higher eukaryotes. The Pacific coast sea urchin, Strongylocentrotus purpuratus, is an invertebrate model organism that is evolutionarily closer to humans than Drosophila and C. elegans, neither of which possesses vaults. Here we compare the structures of sea urchin and mammalian vaults and analyze the subcellular distribution of vaults during sea urchin embryogenesis. Results The sequence of the sea urchin major vault protein (MVP was assembled from expressed sequence tags and genome traces, and the predicted protein was found to have 64% identity and 81% similarity to rat MVP. Sea urchin MVP includes seven ~50 residue repeats in the N-terminal half of the protein and a predicted coiled coil domain in the C-terminus, as does rat MVP. A cryoelectron microscopy (cryoEM reconstruction of isolated sea urchin vaults reveals the assembly to have a barrel-shaped external structure that is nearly identical to the rat vault structure. Analysis of the molecular composition of the sea urchin vault indicates that it contains components that may be homologs of the mammalian vault RNA component (vRNA and protein components (VPARP and TEP1. The sea urchin vault appears to have additional protein components in the molecular weight range of 14–55 kDa that might correspond to molecular contents. Confocal experiments indicate a dramatic relocalization of MVP from the cytoplasm to the nucleus during sea urchin embryogenesis. Conclusions These results are suggestive of a role for the vault in delivering macromolecules to the nucleus during development.

  9. Identifying the minimum-energy atomic configuration on a lattice: Lamarckian twist on Darwinian evolution

    Science.gov (United States)

    D'Avezac, Mayeul; Zunger, Alex

    2008-08-01

    We examine how the two different mechanisms proposed historically for biological evolution compare for the determination of crystal structures from random initial lattice configurations. The Darwinian theory of evolution contends that the genetic makeup inherited at birth is the one passed on during mating to new offspring, in which case evolution is a product of environmental pressure and chance. In addition to this mechanism, Lamarck surmised that individuals can also pass on traits acquired during their lifetime. Here we show that the minimum-energy configurations of a binary A1-xBx alloy in the full 0≤x≤1 concentration range can be found much faster if the conventional Darwinian genetic progression—mating configurations and letting the lowest-energy (fittest) offspring survive—is allowed to experience Lamarckian-style fitness improvements during its lifetime. Such improvements consist of A↔B transmutations of some atomic sites (not just atomic relaxations) guided by “virtual-atom” energy gradients. This hybrid evolution is shown to provide an efficient solution to a generalized Ising Hamiltonian, illustrated here by finding the ground states of face-centered-cubic Au1-xPdx using a cluster-expansion functional fitted to first-principles total energies. The statistical rate of success of the search strategies and their practical applicability are rigorously documented in terms of average number of evaluations required to find the solution out of 400 independent evolutionary runs with different random seeds. We show that all exact ground states of a 12-atom supercell ( 212 configurations) can be found within 330 total-energy evaluations, whereas a 36-atom supercell ( 236 configurations) requires on average 39000 evaluations. Thus, this problem cannot be currently addressed with confidence using costly energy functionals [e.g., density-functional theory (DFT) based] unless it is limited to ≤20 atoms. The computational cost can be reduced at the

  10. Atmospheric tides and other relationships: ``Interpreting the Phenomena'' at the time of the Seeberg conference

    Science.gov (United States)

    Kokott, Wolfgang

    Lalande's account of his experiences at Gotha and on his journey back to France [AGE 2 (1798), 381-382] contains an interesting attempt to explain the extremely rainy September weather (``at a time of the year when it is raining more rarely in our countries'') by means of the Moon's southern declination. Actually, there are several other documents on the same subject; Lagrange was trying to prove his version of lunar influence against Lamarck who claimed exactly the opposite correlation to be true. In the light of Lalande's own work on oceanic tides, his interest in this meteorological problem is readily understood. While stringent limits for tidal variations of air pressure had already been established by d'Alembert (1747) and Toaldo (1779), no consistent theory of tidal mechanics was yet available. Theoretical and empirical investigations of alleged lunar influences on our weather did remain on the agenda well into the 19th century - the names of Olbers and Arago stand for many contemporaries. Moreover, the Earth's atmosphere was an object of fundamental interest to astronomers not only because of its influence on observational results, but also because it was the only accessible planetary atmosphere. Not only were sizeable gaseous envelopes of planetary bodies (with the apparent exception of only the Moon) considered as commonplace (Herschel, Schröter, etc.); the quest for understanding them was also an importent issue. As early as 1780, J.E. Bode tried (following Euler) to explain the blue colour of the sky by means of blue (scattering?) particles in the upper atmosphere; consequently, he raised the question of whether the red colour of Mars was due to this planet's surface materials or rather to a different atmospheric composition. In our time and age, a new and very successful branch of science called Comparative Planetology did emerge from apparently very modern roots; two centuries ago, its basic objectives were an undisputed part of everyday astronomical

  11. Trees and networks before and after Darwin

    Directory of Open Access Journals (Sweden)

    Ragan Mark A

    2009-11-01

    Full Text Available Abstract It is well-known that Charles Darwin sketched abstract trees of relationship in his 1837 notebook, and depicted a tree in the Origin of Species (1859. Here I attempt to place Darwin's trees in historical context. By the mid-Eighteenth century the Great Chain of Being was increasingly seen to be an inadequate description of order in nature, and by about 1780 it had been largely abandoned without a satisfactory alternative having been agreed upon. In 1750 Donati described aquatic and terrestrial organisms as forming a network, and a few years later Buffon depicted a network of genealogical relationships among breeds of dogs. In 1764 Bonnet asked whether the Chain might actually branch at certain points, and in 1766 Pallas proposed that the gradations among organisms resemble a tree with a compound trunk, perhaps not unlike the tree of animal life later depicted by Eichwald. Other trees were presented by Augier in 1801 and by Lamarck in 1809 and 1815, the latter two assuming a transmutation of species over time. Elaborate networks of affinities among plants and among animals were depicted in the late Eighteenth and very early Nineteenth centuries. In the two decades immediately prior to 1837, so-called affinities and/or analogies among organisms were represented by diverse geometric figures. Series of plant and animal fossils in successive geological strata were represented as trees in a popular textbook from 1840, while in 1858 Bronn presented a system of animals, as evidenced by the fossil record, in a form of a tree. Darwin's 1859 tree and its subsequent elaborations by Haeckel came to be accepted in many but not all areas of biological sciences, while network diagrams were used in others. Beginning in the early 1960s trees were inferred from protein and nucleic acid sequences, but networks were re-introduced in the mid-1990s to represent lateral genetic transfer, increasingly regarded as a fundamental mode of evolution at least for

  12. Lower Oligocene bivalves of Ramanian Stage from Kachchh, Gujarat, India

    Science.gov (United States)

    Kachhara, R. P.; Jodhawat, R. L.; Devi, K. Bigyapati

    2012-04-01

    Marine Oligocene sequences in India outcrop only in western part of Kachchh. Earlier researchers have recognized the Oligocene strata under the Nari Series (Nagappa 1959; Chatterji and Mathur 1966). The Nari Series has a type area in Pakistan. It has two subdivisions - the Lower Nari (Lower Oligocene) and the Upper Nari (Upper Oligocene). It seems that there is no valid proof about the age of the Lower Nari due to lack of proper fauna (Eames 1975), and according to Pascoe (1962), the Upper Nari slightly transgress into Aquitanian (Lower Miocene), therefore, one has to be very cautious. Biswas and Raju (1971) reclassified the Oligocene strata of Kachchh and lithostratigraphically clubbed them as the Maniyara Fort Formation with type section along the Bermoti stream. This Formation has four members. The lower three members correspond to the Ramanian Stage (Lower Oligocene, Biswas 1971, 1973) while the uppermost to the Waiorian Stage (Upper Oligocene, Biswas 1965, 1971, 1973). The Ramanian Stage is characterized by large forams especially Nummulites fichteli, Nummulites fichteli intermedius, Lepidocyclina ( Eulepidina) dialata and Operculina sp. Several ostracods are also known to occur. Megafauna include bivalves, gastropods, echinoids, corals, mammals and reptiles. Concerning bivalves earlier researchers have recorded a few taxa namely Trisidos semitorta (Lamarck), Cubitostrea angulata (J de C Sowerby), Pecten ( Amussiopecten) labadyei d'Archiac and Haime, Periglypta puerpera (Linne') var. aglaurae Brongniart, Ostrea fraasi Mayer Eymer and listed Pecten laevicostatus J de C Sowerby, Callista pseudoumbonella Vredenburg and Clementia papyracea (Gray) from Kachchh as against overall 42 forms from the Nari Series as a whole (Vredenburg 1928). This tempted us to make an attempt to collect bivalve fauna systematically which are occurring prolifically in the Ramanian Stage. In the present work, for this purpose, sections are worked out around Lakhpat (23°50'N; 68°47'E

  13. Is metal pollution a threat to the continued survival of the starfish in False Bay, South Africa?

    Directory of Open Access Journals (Sweden)

    Adriaan J. Reinecke

    2013-02-01

    Full Text Available Urbanisation and industrial development in the catchment area of False Bay in South Africa are increasing and concern was raised about the effect of environmental pollutants on intertidal fauna such as starfish. The aim of the present study was to obtain initial descriptive baseline data over several seasons during 2000–2001 of metal concentrations in water, sediment and body samples of the chosen cushion starfish Parvulastra exigua (Lamarck, 1816 that occurs widely in the intertidal zone of False Bay. Concentrations of cadmium, copper, lead, nickel and zinc were measured in samples of the cushion starfish, water and sediment at five localities along the coast of False Bay. The samples were chemically analysed for metals by atomic spectrophotometry. The highest individually measured concentrations of cadmium (Cd in starfish and sediment were found in the northern coastal region between Strand and Muizenberg where most industrial activity and human settlement occur. Large variation in concentrations of all metals occurred between localities and seasons. The mean concentrations of Cd and Pb in water and sediment were in a few instances slightly higher than the recommended levels or target values of the South African marine water and sediment quality norms but still lower than those in various developed countries. Indications are that the bay was at the time of this study still less contaminated by metals in comparison with the coastal waters of various other countries. The accumulation of nonessential metals such as cadmium and lead in both sediment and bodies of starfish was nevertheless such that it can be assumed that environmental concentrations in some parts of the bay could over time build up to levels that are detrimental to the species as well as their predators. This study provided evidence that the cushion starfish in False Bay is exposed to several metals of which some are potentially hazardous since they tend to gradually accumulate

  14. Radiactividad natural en la zona costera del departamento de Rocha, Uruguay

    Directory of Open Access Journals (Sweden)

    Ana Lía Noguera Rocha

    2014-03-01

    Full Text Available La costa este uruguaya posee una riqueza enorme de ecosistemas como ser dunas, mar, ríos, arroyos y aguas subterráneas, así como una inmensa variedad de fauna y flora. En dicha área están presentes además recursos minerales, los cuales incluyen yacimientos de arenas negras, con 7 millones de toneladas de metales pesados evaluados en el área de Aguas Dulces – Valizas. Estos yacimientos están compuestos entre otros minerales por 0.6 % of monacita. Como resultado están presentes todos los radionucleidos pertenecientes a la serie del 238U y del 232Th series.A los efectos de evaluar la transferencia de la contaminación radiactiva natural desde arena a otros compartimentos la actividad total alfa y beta fue determinada utilizando Analyzing miniscaler Ratemeter modelo PRS-5/STB-3, para arena, aguas subterráneas y vegetación (Hydrocotile bonariensis Lamarck del Balneario Valizas (34º 20´ 31.42” S y 53º 47´ 19.47” O. Todas las muestras fueron previamente tratadas, las muestras de arena fueron secadas, las aguas tratadas con HNO3, mantenidas a 4 º para su conservación y llevadas a sequedad, finalmente los vegetales fueron calcinados y las cenizas medidas. Fueron utilizados patrones de 238U y 232Th (IAEA RGU-1, RGTh-1. De las actividades específicas y de los coeficientes de transferencia obtenidospodemos concluir que los contaminantes radiactivos naturales migran de arena a otroscompartimentos. El coeficiente de transferencia de arena a H.bonariensis es el máselevado y está de acuerdo a los resultados previamente reportados en literatura. Losvalores obtenidos para aguas subterráneas están por debajo del límite de intervencióndeterminado para agua potable (0.55 Bq.l-1.

  15. Eastern Mediterranean sea levels through the last interglacial from a coastal-marine sequence in northern Israel

    Science.gov (United States)

    Sivan, D.; Sisma-Ventura, G.; Greenbaum, N.; Bialik, O. M.; Williams, F. H.; Tamisiea, M. E.; Rohling, E. J.; Frumkin, A.; Avnaim-Katav, S.; Shtienberg, G.; Stein, M.

    2016-08-01

    A last interglacial (Marine Isotope Stage, MIS5e) marine-coastal sequence has been identified along the Galilee coast of Israel, with the type section located at Rosh Hanikra (RH). The microtidal regime and tectonic stability, along with the detailed stratigraphy of the RH shore, make the study region ideally suited for determining relative sea level (RSL) through the MIS5e interval in the eastern Mediterranean. The sequence contains fossilized microtidal subunits at a few meters above the current sea level. Unfortunately, all fossils were found to be altered, so that U-Th datings cannot be considered to represent initial deposition. We contend that U-Th dating of Strombus bubonius shells (recrystallized to calcite) suffices to indicate a lower limit of ∼110 ± 8 ka for the time sea level dropped below the RH sedimentary sequence. The RH-section comprises three main subunits of a previously determined member (the Yasaf Member): (a) a gravelly unit containing the diagnostic gastropod Strombus bubonius Lamarck (Persististrombus latus), which was deposited in the intertidal to super-tidal stormy zone; (b) Vermetidae reef domes indicating a shallow-water depositional environment; and (c) coarse to medium-sized, bioclastic sandstone, probably deposited in the shallow sub-tidal zone. The sequence overlies three abrasion platforms that are cut by tidal channels at elevations of +0.8 m, +2.6 m and +3.4 m, and which are filled with MIS5e sediments. We present a detailed study of the sequence, with emphasis on stratigraphic, sedimentological, and palaeontological characteristics that indicate sea-level changes. Although without precise absolute dating, the stratigraphic sequence of RH through MIS5e allows us to identify a time-series of RSL positions, using the elevations of three stratigraphic subunits. Reconstructed RSL values range from +1.0 m to +7 m (with uncertainly < 1 m), and most fall within a narrow range of +1.0 to +3.3 m. Toward the end of MIS5e, RSL exceeded

  16. Reef sponges of the genus Agelas (Porifera: Demospongiae) from the Greater Caribbean.

    Science.gov (United States)

    Parra-Velandia, Fernando J; Zea, Sven; Van Soest, Rob W M

    2014-01-01

    The genus Agelas comprises a group of tropical and subtropical reef sponges that contains large, long-lived, often brightly colored and conspicuous species, distributed throughout the tropica l western Atlantic, temperate northern Atlantic (Mediterranean Sea), and western and central Indo-Pacific Realms. Among tropical sponge genera, Agelas is one with similar species richness in the Greater Caribbean in comparison to the Indo Pacific. The presence of verticillated acanthostyle spicules and a fibroreticulate skeleton of spongin fibres cored and/or echinated by spicules characterize this group. Taxonomic identification relies on a combination of characters, where external morphology and color play a key role, owing to the paucity of microscopical characters. Thus, there is still a great deal of taxonomic confusion, even for the more common species. We carried out a detailed revision of Agelas species throughout the Greater Caribbean area using classic taxonomic tools. Samples and observations covered Colombia, Belize, Jamaica, the Bahamas, Barbados, Curaçao and Venezuela, and included type material from major museum collections. According to our results, the genus Agelas in the Caribbean has at least thirteen valid species, viz. Agelas sceptrum (Lamarck, 1815); A. dispar Duchassaing & Michelotti, 1864;  A. dilatata Duchassaing & Michelotti, 1864; A. clathrodes (Schmidt, 1870);  A. cervicornis (Schmidt, 1870); A. conifera (Schmidt, 1870); A. schmidti Wilson, 1902;   A. tubulata Lehnert & van Soest, 1996; A. wiedenmayeri Alcolado, 1984;  A. citrina Gotera & Alcolado, 1987; A. sventres Lehnert & van Soest, 1996; A. repens Lehnert & van Soest, 1998; and A. cerebrum Assmann et al., 2001. We found that variation of microscopic characteristics like skeleton arrangement, number of verticills and their spines, and spicule length and width, can be used as taxonomic tools, but only in a thorough comparison with other species in the same sub-regional context. Thus, a

  17. The co-occurrence of the demosponge Hymeniacidon perlevis and the edible mussel Mytilus galloprovincialis as a new tool for bacterial load mitigation in aquaculture.

    Science.gov (United States)

    Longo, Caterina; Cardone, Frine; Corriero, Giuseppe; Licciano, Margherita; Pierri, Cataldo; Stabili, Loredana

    2016-02-01

    Pollutants in marine coastal areas are mainly a consequence of anthropogenic inputs, and microorganisms often play a major role in determining the extent of this pollution. Thus, practical and eco-friendly techniques are urgently required in order to control or minimise the pathogenic bacterial problem. The bacterial accumulation of Mytilus galloprovincialis (Lamarck 1919) in the presence or absence of another filter feeder, the demosponge Hymeniacidon perlevis (Montagu 1818) on sewage flowing into the Northern Ionian Sea has been estimated in a laboratory study. On account of the interesting results obtained, we also evaluated the bioremediation capability of the sponges when reared in co-culture with mussels. Specimens of M. galloprovincialis and H. perlevis were collected from the Mar Grande and from the Second Inlet of the Mar Piccolo of Taranto (Northern Ionian Sea, Italy), respectively. In the laboratory, we detected the bacterial abundances in the sewage, in sponge homogenates (both sponges alone and sponges that have been added to sewage with mussels) and in mussel homogenates (both mussels alone and mussels that have been added to sewage with sponges). In the field, we estimated the bacterial concentration in both the seawater within the mussels culture and the seawater collected where mussels were reared in co-culture with sponges. The bacteriological analyses were performed analysing the following parameters: the density of culturable heterotrophic bacteria by spread plate on marine agar, total culturable bacteria at 37 °C on plate count agar and vibrios on thiosulphate-citrate-bile-sucrose-salt (TCBS) agar. Total coliforms, Escherichia coli and intestinal streptococci concentrations were detected by the MPN method. The study demonstrates a higher efficiency of the sponges in removing all the considered bacterial groups compared to the mussels. Due to the conspicuous bacterial accumulation by the sponge, we can conclude that the co-occurrence of the

  18. Complexity, Compassion and Self-Organisation: Human Evolution and the Vulnerable Ape Hypothesis

    Directory of Open Access Journals (Sweden)

    Nick P. Winder

    2015-06-01

    Full Text Available Humans are agents capable of helping others, learning new behaviours and forgetting old ones. The evolutionary approach to archaeological systems has therefore been hampered by the 'modern synthesis' - a gene-centred model of evolution as a process that eliminates those that cannot handle stress. The result has been a form of environmental determinism that explains human evolution in terms of heroic struggles and selective winnowing. Biologists committed to the modern synthesis have either dismissed agency as a delusion wrought in our bodies by natural selection, or imposed a sharp, Cartesian split between 'natural' and 'artificial' ecologies. We revisit the seminal literature of evolutionary biology and show that the paradigmatic fault lines of 21st century anthropology can be traced back to the 19th century and beyond. Lamarck had developed a two-factor evolutionary theory - one factor an endogenous tendency to become more advanced and complex, the other an exogenous constraint that drove organisms into conformity with environment. Darwin tried to eliminate the progressive tendency and imposed linearity constraints on evolution that Thomas Henry Huxley rejected. When experimental evidence falsified Darwin's linear hypothesis, the race began to develop a new, gene-centred model of evolution. This became the modern synthesis. The modern synthesis is now under pressure from the evidence of anthropology, sociology, palaeontology, ecology and genetics. An 'extended synthesis' is emerging. If evolution is adequately summarised by the aphorism survival of the fittest, then 'fitness' cannot always be defined in the heroic sense of 'better able to compete and reproduce'. The fittest organisms are often those that evade selective winnowing, even when their ability to compete and reproduce has been compromised by their genes. Characteristically human traits like language, abstraction, compassion and altruism may have arisen as coping strategies that

  19. Lower Oligocene bivalves of Ramanian Stage from Kachchh, Gujarat, India

    Indian Academy of Sciences (India)

    R P Kachhara; R L Jodhawat; K Bigyapati Devi

    2012-04-01

    Marine Oligocene sequences in India outcrop only in western part of Kachchh. Earlier researchers have recognized the Oligocene strata under the Nari Series (Nagappa 1959; Chatterji and Mathur 1966). The Nari Series has a type area in Pakistan. It has two subdivisions – the Lower Nari (Lower Oligocene) and the Upper Nari (Upper Oligocene). It seems that there is no valid proof about the age of the Lower Nari due to lack of proper fauna (Eames 1975), and according to Pascoe (1962), the Upper Nari slightly transgress into Aquitanian (Lower Miocene), therefore, one has to be very cautious. Biswas and Raju (1971) reclassified the Oligocene strata of Kachchh and lithostratigraphically clubbed them as the Maniyara Fort Formation with type section along the Bermoti stream. This Formation has four members. The lower three members correspond to the Ramanian Stage (Lower Oligocene, Biswas 1971, 1973) while the uppermost to the Waiorian Stage (Upper Oligocene, Biswas 1965, 1971, 1973). The Ramanian Stage is characterized by large forams especially Nummulites fichteli, Nummulites fichteli intermedius, Lepidocyclina (Eulepidina) dialata and Operculina sp. Several ostracods are also known to occur. Megafauna include bivalves, gastropods, echinoids, corals, mammals and reptiles. Concerning bivalves earlier researchers have recorded a few taxa namely Trisidos semitorta (Lamarck), Cubitostrea angulata (J de C Sowerby), Pecten (Amussiopecten) labadyei d’Archiac and Haime, Periglypta puerpera (Linne’) var. aglaurae Brongniart, Ostrea fraasi Mayer Eymer and listed Pecten laevicostatus J de C Sowerby, Callista pseudoumbonella Vredenburg and Clementia papyracea (Gray) from Kachchh as against overall 42 forms from the Nari Series as a whole (Vredenburg 1928). This tempted us to make an attempt to collect bivalve fauna systematically which are occurring prolifically in the Ramanian Stage. In the present work, for this purpose, sections are worked out around Lakhpat (23° 50′N; 68

  20. From the scala naturae to the symbiogenetic and dynamic tree of life

    Directory of Open Access Journals (Sweden)

    Kutschera Ulrich

    2011-06-01

    Full Text Available Abstract All living beings on Earth, from bacteria to humans, are connected through descent from common ancestors and represent the summation of their corresponding, ca. 3500 million year long evolutionary history. However, the evolution of phenotypic features is not predictable, and biologists no longer use terms such as "primitive" or "perfect organisms". Despite these insights, the Bible-based concept of the so-called "ladder of life" or Scala Naturae, i.e., the idea that all living beings can be viewed as representing various degrees of "perfection", with humans at the very top of this biological hierarchy, was popular among naturalists until ca. 1850 (Charles Bonnet, Jean Lamarck and others. Charles Darwin is usually credited with the establishment of a branched evolutionary "Tree of Life". This insight of 1859 was based on his now firmly corroborated proposals of common ancestry and natural selection. In this article I argue that Darwin was still influenced by "ladder thinking", a theological view that prevailed throughout the 19th century and is also part of Ernst Haeckel's famous Oak tree (of Life of 1866, which is, like Darwin's scheme, static. In 1910, Constantin Mereschkowsky proposed an alternative, "anti-selectionist" concept of biological evolution, which became known as the symbiogenesis-theory. According to the symbiogenesis-scenario, eukaryotic cells evolved on a static Earth from archaic prokaryotes via the fusion and subsequent cooperation of certain microbes. In 1929, Alfred Wegener published his theory of continental drift, which was later corroborated, modified and extended. The resulting theory of plate tectonics is now the principal organizing concept of geology. Over millions of years, plate tectonics and hence the "dynamic Earth" has caused destructive volcanic eruptions and earthquakes. At the same time, it created mountain ranges, deep oceans, novel freshwater habitats, and deserts. As a result, these geologic

  1. Thermal stress in Larvae of the sand dollar (Dendraster excentricus) induces changes in hsp70 gen expression

    Science.gov (United States)

    Olivares-Bañuelos, T.; Garcia-Echauri, L.; Figueroa-Flores, S.; Carpizo-Ituarte, E.

    2010-03-01

    temperature where larvae development occurs. It seems that competent and metamorphic larvae are more sensitive to changes in sea water temperature, than 8 arms pluteus larval stage of Dendraster excentricus. References 1. Boidron-Metairon IF (1988) Morphological plasticity in laboratory-reared echinoplutei of Dendraster excentricus (Eschscholtz) and Lytechinus variegatus (Lamarck) in response to food conditions Journal of Experimental Marine Biology and Ecology. 119(1):31-41 2. Kregel KC (2002) Heat shock proteins: modifying factors in physiological stress responses and acquired thermotolerance. J Appl Physiol. 92(5):2177-2186

  2. Zonação de comunidade bêntica do entremarés em molhes sob diferente hidrodinamismo na costa norte do estado do Rio de Janeiro, Brasil Zonation of intertidal benthic communities on breakwaters of different hydrodynamics in the north coast of the state of Rio de Janeiro, Brazil

    Directory of Open Access Journals (Sweden)

    Bruno P. Masi

    2008-12-01

    Full Text Available O presente estudo pretende comparar a distribuição vertical da comunidade bêntica na zona entremarés em dois locais compostos por matacões graníticos caracterizados por hidrodinâmica distinta, reflexo da diferença na orientação dos molhes nas praias do Farol de São Tomé (Píer e na Barra do Furado (Barra, norte do Estado do Rio de Janeiro. Quadrados de 400 cm² foram sobrepostos ao longo de três perfis verticais de ambos os sítios e amostrados através do método de fotoquadrats, desde o nível 0,2 m da maré até o limite superior de Littorina spp. O limite superior dos organismos marinhos foi ampliado na Barra (3,8 m em relação ao Píer (2,2 m. Quanto à composição taxonômica, nove espécies foram comuns. Chaetomorpha sp., Chondracanthus teedii (Mertens ex Roth Fredericq e Grateloupia sp. foram exclusivas na Barra, enquanto Tetraclita stalactifera (Lamarck, 1818, Fissurella clench, Gracilaria domingensis (Kützing Sonder ex Dickie e Hypnea musciformis (Wulfen in Jacqu. Lamouroux ocorreram somente no Píer. Em ambos os locais, a riqueza e a diversidade de espécies foram superiores nos quadrados intermediários. Os maiores valores foram registrados na Barra. As maiores diferenças nos agrupamentos entre faixas equivalentes de locais distintos ocorreram na faixa eulitorânea superior, seguida pela faixa eulitorânea inferior e franja sublitorânea. Apenas a orla litorânea não revelou diferença significativa entre os locais, mas uma maior extensão desta franja e da faixa eulitorânea superior era bastante evidente. As demais faixas na Barra do Furado foram caracterizadas em grande parte por espécies típicas de ambientes mais expostos como Chaetomorpha sp. na faixa eulitorânea superior e Perna perna (Linnaeus, 1758 na eulitorânea inferior, além de C. teedii e Ulva fasciata Delile, 1813 na franja sublitorânea. No Píer, as diferentes faixas apresentavam distribuição eqüitativa, refletindo um ambiente menos

  3. Ciclo gametogênico e comportamento reprodutivo de Iphigenia brasiliana (Mollusca, Bivalvia, Donacidae no estuário do rio Subaé, Baía de Todos os Santos, Bahia, Brasil Gametogenic cycle and reproductive behavior of Iphigenia brasiliana (Mollusca, Bivalvia, Donacidae in the Subaé river estuary, Todos os Santos Bay, Bahia, Brazil

    Directory of Open Access Journals (Sweden)

    Patrícia P. Silva

    2012-12-01

    Full Text Available Este estudo teve como objetivos descrever o ciclo gametogênico e o comportamento reprodutivo da população de Iphigenia brasiliana (Lamarck,1818 no estuário do rio Subaé, Baía de Todos os Santos, Bahia. Os bivalves foram coletados de novembro de 2001 a novembro de 2002. Um total de 244 espécimes foi medido (eixo anteroposterior, eviscerado, fixado, desidratado e incluído em parafina. O estudo histológico das gônadas foi realizado através de cortes seriados do tecido gonadal, de 5 mm de espessura, e corados pela HE. O tamanho médio mínimo da primeira maturação sexual (Lpm foi estimado a partir da distribuição das frequências relativas de jovens e adultos, por classe de comprimento dos indivíduos. As frequências relativas dos sexos em cada estádio de desenvolvimento foram consideradas conjuntamente para a análise do comportamento reprodutivo da população, e, em separado, para avaliar a sincronia do ciclo sexual entre machos e fêmeas. Foi observada uma variação de tamanhos entre 9,1 e 66,6 mm, com comprimento médio de 50,2 mm. O estudo não demonstrou diferença significativa entre os tamanhos de machos e fêmeas. Não foi possível observar a diferenciação de sexos em 2,1% dos indivíduos analisados. 51,6% dos indivíduos foram identificados como machos (M e 46,3% como fêmeas (F, não sendo constatadas diferenças significativas entre o número médio de machos e fêmeas, resultando numa proporção de M:F de 1,1:1. O Lpm foi estimado em 11,4 mm, mas apenas ao alcançarem comprimento médio de 34,4 mm, todos os indivíduos foram considerados adultos. Foram caracterizados quatro estádios de evolução do desenvolvimento gonadal em fêmeas e machos. A análise dos diferentes estádios permitiu a observação dos fenômenos de atresia e inversão sexual em fêmeas. O ciclo reprodutivo apresentou eliminação contínua de gametas, com maiores intensidades reprodutivas nos meses de novembro de 2001 a abril de 2002 e, tamb

  4. Ciclo gametogênico e comportamento reprodutivo de Iphigenia brasiliana (Mollusca, Bivalvia, Donacidae no estuário do rio Subaé, Baía de Todos os Santos, Bahia, Brasil Gametogenic cycle and reproductive behavior of Iphigenia brasiliana (Mollusca, Bivalvia, Donacidae in the Subaé river estuary, Todos os Santos Bay, Bahia, Brazil

    Directory of Open Access Journals (Sweden)

    Patrícia P. Silva

    2012-01-01

    Full Text Available Este estudo teve como objetivos descrever o ciclo gametogênico e o comportamento reprodutivo da população de Iphigenia brasiliana (Lamarck,1818 no estuário do rio Subaé, Baía de Todos os Santos, Bahia. Os bivalves foram coletados de novembro de 2001 a novembro de 2002. Um total de 244 espécimes foi medido (eixo anteroposterior, eviscerado, fixado, desidratado e incluído em parafina. O estudo histológico das gônadas foi realizado através de cortes seriados do tecido gonadal, de 5 mm de espessura, e corados pela HE. O tamanho médio mínimo da primeira maturação sexual (Lpm foi estimado a partir da distribuição das frequências relativas de jovens e adultos, por classe de comprimento dos indivíduos. As frequências relativas dos sexos em cada estádio de desenvolvimento foram consideradas conjuntamente para a análise do comportamento reprodutivo da população, e, em separado, para avaliar a sincronia do ciclo sexual entre machos e fêmeas. Foi observada uma variação de tamanhos entre 9,1 e 66,6 mm, com comprimento médio de 50,2 mm. O estudo não demonstrou diferença significativa entre os tamanhos de machos e fêmeas. Não foi possível observar a diferenciação de sexos em 2,1% dos indivíduos analisados. 51,6% dos indivíduos foram identificados como machos (M e 46,3% como fêmeas (F, não sendo constatadas diferenças significativas entre o número médio de machos e fêmeas, resultando numa proporção de M:F de 1,1:1. O Lpm foi estimado em 11,4 mm, mas apenas ao alcançarem comprimento médio de 34,4 mm, todos os indivíduos foram considerados adultos. Foram caracterizados quatro estádios de evolução do desenvolvimento gonadal em fêmeas e machos. A análise dos diferentes estádios permitiu a observação dos fenômenos de atresia e inversão sexual em fêmeas. O ciclo reprodutivo apresentou eliminação contínua de gametas, com maiores intensidades reprodutivas nos meses de novembro de 2001 a abril de 2002 e, tamb

  5. Promoter binding factors regulating cyclin B transcription in the sea urchin embryo.

    Science.gov (United States)

    Thatcher, J D; McBride, B; Katula, K S

    1995-10-01

    Cyclin B is a key regulatory protein of the cell cycle, central to the control of the G2/M transition. In the developing sea urchin embryo, the cyclin B gene is transcriptionally regulated in concert with changing patterns of cell division. In an effort to understand the mechanism controlling cyclin B expression during development, we have conducted an analysis of the Strongylocentrotus purpuratus cyclin B gene promoter. DNase I foot-printing of the cyclin B upstream region revealed eight binding regions within 435 bp of the start of transcription; seven of these sites were within 215 bp. Found within these regions were consensus sequences for two CCAAT boxes, TATA, and E-boxes and sequences with some similarity to E2F and octamer binding motifs. Upstream sequences were functionally defined by generating cyclin B-CAT fusion genes, containing deletions and base specific mutations, and testing for relative levels of expression by gene transfer. Both CCAAT boxes were found to be essential for maximal levels of expression. A third binding site (PR7) with no recognizable consensus sequence was also found to act as a positive element. Our results suggest that protein binding to the E2F-like sequences may act to reduce expression. Protein binding was further characterized by gel mobility-shift and methylation interference. The CCAAT boxes were found to bind similar, if not identical, proteins. Sequence comparisons and methylation interference data indicate that the likely protein binding these CCAAT sequences is the characterized CCAAT-binding protein CP1. A probe containing site PR7 formed multiple gel shift complexes that, by methylation interference, appeared to be interrelated. One major complex was formed with an oligonucleotide containing the two E2F-like sequences. Protein binding to this probe was specific and required bases within the E2F-like sequences. Our results indicate that cyclin B is subject to positive and negative regulation, involving multiple factors

  6. Innate immune complexity in the purple sea urchin: diversity of the sp185/333 system.

    Science.gov (United States)

    Smith, L Courtney

    2012-01-01

    The California purple sea urchin, Strongylocentrotus purpuratus, is a long-lived echinoderm with a complex and sophisticated innate immune system. There are several large gene families that function in immunity in this species including the Sp185/333 gene family that has ∼50 (±10) members. The family shows intriguing sequence diversity and encodes a broad array of diverse yet similar proteins. The genes have two exons of which the second encodes the mature protein and has repeats and blocks of sequence called elements. Mosaics of element patterns plus single nucleotide polymorphisms-based variants of the elements result in significant sequence diversity among the genes yet maintains similar structure among the members of the family. Sequence of a bacterial artificial chromosome insert shows a cluster of six, tightly linked Sp185/333 genes that are flanked by GA microsatellites. The sequences between the GA microsatellites in which the Sp185/333 genes and flanking regions are located, are much more similar to each other than are the sequences outside the microsatellites suggesting processes such as gene conversion, recombination, or duplication. However, close linkage does not correspond with greater sequence similarity compared to randomly cloned and sequenced genes that are unlikely to be linked. There are three segmental duplications that are bounded by GAT microsatellites and include three almost identical genes plus flanking regions. RNA editing is detectible throughout the mRNAs based on comparisons to the genes, which, in combination with putative post-translational modifications to the proteins, results in broad arrays of Sp185/333 proteins that differ among individuals. The mature proteins have an N-terminal glycine-rich region, a central RGD motif, and a C-terminal histidine-rich region. The Sp185/333 proteins are localized to the cell surface and are found within vesicles in subsets of polygonal and small phagocytes. The coelomocyte proteome shows full

  7. The chronic toxicity of molybdate to marine organisms. I. Generating reliable effects data

    International Nuclear Information System (INIS)

    A scientific research program was initiated by the International Molybdenum Association (IMOA) which addressed identified gaps in the environmental toxicity data for the molybdate ion (MoO42−). These gaps were previously identified during the preparation of EU-REACH-dossiers for different molybdenum compounds (European Union regulation on Registration, Evaluation, Authorization and Restriction of Chemical substances; EC, 2006). Evaluation of the open literature identified few reliable marine ecotoxicological data that could be used for deriving a Predicted No-Effect Concentration (PNEC) for the marine environment. Rather than calculating a PNECmarine using the assessment factor methodology on a combined freshwater/marine dataset, IMOA decided to generate sufficient reliable marine chronic data to permit derivation of a PNEC by means of the more scientifically robust species sensitivity distribution (SSD) approach (also called the statistical extrapolation approach). Nine test species were chronically exposed to molybdate (added as sodium molybdate dihydrate, Na2MoO4·2H2O) according to published standard testing guidelines that are acceptable for a broad range of regulatory purposes. The selected test organisms were representative for typical marine trophic levels: micro-algae/diatom (Phaeodactylum tricornutum, Dunaliella tertiolecta), macro-alga (Ceramium tenuicorne), mysids (Americamysis bahia), copepod (Acartia tonsa), fish (Cyprinodon variegatus), echinoderms (Dendraster exentricus, Strongylocentrotus purpuratus) and molluscs (Mytilus edulis, Crassostrea gigas). Available NOEC/EC10 levels ranged between 4.4 mg Mo/L (blue mussel M. edulis) and 1174 mg Mo/L (oyster C. gigas). Using all available reliable marine chronic effects data that are currently available, a HC5,50% (median hazardous concentration affecting 5% of the species) of 5.74 (mg Mo)/L was derived with the statistical extrapolation approach, a value that can be used for national and international

  8. Aggregation of sea urchin phagocytes is augmented in vitro by lipopolysaccharide.

    Directory of Open Access Journals (Sweden)

    Audrey J Majeske

    Full Text Available Development of protocols and media for culturing immune cells from marine invertebrates has not kept pace with advancements in mammalian immune cell culture, the latter having been driven by the need to understand the causes of and develop therapies for human and animal diseases. However, expansion of the aquaculture industry and the diseases that threaten these systems creates the need to develop cell and tissue culture methods for marine invertebrates. Such methods will enable us to better understand the causes of disease outbreaks and to develop means to avoid and remedy epidemics. We report a method for the short-term culture of phagocytes from the purple sea urchin, Strongylocentrotus purpuratus, by modifying an approach previously used to culture cells from another sea urchin species. The viability of cultured phagocytes from the purple sea urchin decreases from 91.6% to 57% over six days and phagocyte morphology changes from single cells to aggregates leading to the formation of syncytia-like structures. This process is accelerated in the presence of lipopolysaccharide suggesting that phagocytes are capable of detecting this molecular pattern in culture conditions. Sea urchin immune response proteins, called Sp185/333, are expressed on the surface of a subset of phagocytes and have been associated with syncytia-like structures. We evaluated their expression in cultured phagocytes to determine their possible role in cell aggregation and in the formation of syncytia-like structures. Between 0 and 3 hr, syncytia-like structures were observed in cultures when only ~10% of the cells were positive for Sp185/333 proteins. At 24 hr, ~90% of the nuclei were Sp185/333-positive when all of the phagocytes had aggregated into syncytia-like structures. Consequently, we conclude that the Sp185/333 proteins do not have a major role in initiating the aggregation of cultured phagocytes, however the Sp185/333 proteins are associated with the clustered

  9. Molecular evolution of the reactive oxygen-generating NADPH oxidase (Nox/Duox family of enzymes

    Directory of Open Access Journals (Sweden)

    Lambeth J David

    2007-07-01

    Full Text Available Abstract Background NADPH-oxidases (Nox and the related Dual oxidases (Duox play varied biological and pathological roles via regulated generation of reactive oxygen species (ROS. Members of the Nox/Duox family have been identified in a wide variety of organisms, including mammals, nematodes, fruit fly, green plants, fungi, and slime molds; however, little is known about the molecular evolutionary history of these enzymes. Results We assembled and analyzed the deduced amino acid sequences of 101 Nox/Duox orthologs from 25 species, including vertebrates, urochordates, echinoderms, insects, nematodes, fungi, slime mold amoeba, alga and plants. In contrast to ROS defense enzymes, such as superoxide dismutase and catalase that are present in prokaryotes, ROS-generating Nox/Duox orthologs only appeared later in evolution. Molecular taxonomy revealed seven distinct subfamilies of Noxes and Duoxes. The calcium-regulated orthologs representing 4 subfamilies diverged early and are the most widely distributed in biology. Subunit-regulated Noxes represent a second major subdivision, and appeared first in fungi and amoeba. Nox5 was lost in rodents, and Nox3, which functions in the inner ear in gravity perception, emerged the most recently, corresponding to full-time adaptation of vertebrates to land. The sea urchin Strongylocentrotus purpuratus possesses the earliest Nox2 co-ortholog of vertebrate Nox1, 2, and 3, while Nox4 first appeared somewhat later in urochordates. Comparison of evolutionary substitution rates demonstrates that Nox2, the regulatory subunits p47phox and p67phox, and Duox are more stringently conserved in vertebrates than other Noxes and Nox regulatory subunits. Amino acid sequence comparisons identified key catalytic or regulatory regions, as 68 residues were highly conserved among all Nox/Duox orthologs, and 14 of these were identical with those mutated in Nox2 in variants of X-linked chronic granulomatous disease. In addition to

  10. The 10 sea urchin receptor for egg jelly proteins (SpREJ are members of the polycystic kidney disease-1 (PKD1 family

    Directory of Open Access Journals (Sweden)

    Miyata Shinji

    2007-07-01

    Full Text Available Abstract Background Mutations in the human polycystic kidney disease-1 (hPKD1 gene result in ~85% of cases of autosomal dominant polycystic kidney disease, the most frequent human monogenic disease. PKD1 proteins are large multidomain proteins involved in a variety of signal transduction mechanisms. Obtaining more information about members of the PKD1 family will help to clarify their functions. Humans have five hPKD1 proteins, whereas sea urchins have 10. The PKD1 proteins of the sea urchin, Strongylocentrotus purpuratus, are referred to as the Receptor for Egg Jelly, or SpREJ proteins. The SpREJ proteins form a subfamily within the PKD1 family. They frequently contain C-type lectin domains, PKD repeats, a REJ domain, a GPS domain, a PLAT/LH2 domain, 1–11 transmembrane segments and a C-terminal coiled-coil domain. Results The 10 full-length SpREJ cDNA sequences were determined. The secondary structures of their deduced proteins were predicted and compared to the five human hPKD1 proteins. The genomic structures of the 10 SpREJs show low similarity to each other. All 10 SpREJs are transcribed in either embryos or adult tissues. SpREJs show distinct patterns of expression during embryogenesis. Adult tissues show tissue-specific patterns of SpREJ expression. Conclusion Possession of a REJ domain of about 600 residues defines this family. Except for SpREJ1 and 3, that are thought to be associated with the sperm acrosome reaction, the functions of the other SpREJ proteins remain unknown. The sea urchin genome is one-fourth the size of the human genome, but sea urchins have 10 SpREJ proteins, whereas humans have five. Determination of the tissue specific function of each of these proteins will be of interest to those studying echinoderm development. Sea urchins are basal deuterostomes, the line of evolution leading to the vertebrates. The study of individual PKD1 proteins will increase our knowledge of the importance of this gene family.

  11. The chronic toxicity of molybdate to marine organisms. I. Generating reliable effects data

    Energy Technology Data Exchange (ETDEWEB)

    Heijerick, D.G., E-mail: Dagobert.heijerick@arche-consulting.be [ARCHE - Assessing Risks of Chemicals, Stapelplein 70 Bus 104, Gent (Belgium); Regoli, L. [International Molybdenum Association, 4 Heathfield Terrace, London, W4 4JE (United Kingdom); Stubblefield, W. [Oregon State University, Department of Environmental and Molecular Toxicology, 421 Weniger Hall, Corvallis, OR 97331 (United States)

    2012-07-15

    A scientific research program was initiated by the International Molybdenum Association (IMOA) which addressed identified gaps in the environmental toxicity data for the molybdate ion (MoO{sub 4}{sup 2-}). These gaps were previously identified during the preparation of EU-REACH-dossiers for different molybdenum compounds (European Union regulation on Registration, Evaluation, Authorization and Restriction of Chemical substances; EC, 2006). Evaluation of the open literature identified few reliable marine ecotoxicological data that could be used for deriving a Predicted No-Effect Concentration (PNEC) for the marine environment. Rather than calculating a PNEC{sub marine} using the assessment factor methodology on a combined freshwater/marine dataset, IMOA decided to generate sufficient reliable marine chronic data to permit derivation of a PNEC by means of the more scientifically robust species sensitivity distribution (SSD) approach (also called the statistical extrapolation approach). Nine test species were chronically exposed to molybdate (added as sodium molybdate dihydrate, Na{sub 2}MoO{sub 4}{center_dot}2H{sub 2}O) according to published standard testing guidelines that are acceptable for a broad range of regulatory purposes. The selected test organisms were representative for typical marine trophic levels: micro-algae/diatom (Phaeodactylum tricornutum, Dunaliella tertiolecta), macro-alga (Ceramium tenuicorne), mysids (Americamysis bahia), copepod (Acartia tonsa), fish (Cyprinodon variegatus), echinoderms (Dendraster exentricus, Strongylocentrotus purpuratus) and molluscs (Mytilus edulis, Crassostrea gigas). Available NOEC/EC{sub 10} levels ranged between 4.4 mg Mo/L (blue mussel M. edulis) and 1174 mg Mo/L (oyster C. gigas). Using all available reliable marine chronic effects data that are currently available, a HC{sub 5,50%} (median hazardous concentration affecting 5% of the species) of 5.74 (mg Mo)/L was derived with the statistical extrapolation approach, a

  12. Juvenile skeletogenesis in anciently diverged sea urchin clades.

    Science.gov (United States)

    Gao, Feng; Thompson, Jeffrey R; Petsios, Elizabeth; Erkenbrack, Eric; Moats, Rex A; Bottjer, David J; Davidson, Eric H

    2015-04-01

    Mechanistic understanding of evolutionary divergence in animal body plans devolves from analysis of those developmental processes that, in forms descendant from a common ancestor, are responsible for their morphological differences. The last common ancestor of the two extant subclasses of sea urchins, i.e., euechinoids and cidaroids, existed well before the Permian/Triassic extinction (252 mya). Subsequent evolutionary divergence of these clades offers in principle a rare opportunity to solve the developmental regulatory events underlying a defined evolutionary divergence process. Thus (i) there is an excellent and fairly dense (if yet incompletely analyzed) fossil record; (ii) cladistically confined features of the skeletal structures of modern euechinoid and cidaroid sea urchins are preserved in fossils of ancestral forms; (iii) euechinoids and cidaroids are among current laboratory model systems in molecular developmental biology (here Strongylocentrotus purpuratus [Sp] and Eucidaris tribuloides [Et]); (iv) skeletogenic specification in sea urchins is uncommonly well understood at the causal level of interactions of regulatory genes with one another, and with known skeletogenic effector genes, providing a ready arsenal of available molecular tools. Here we focus on differences in test and perignathic girdle skeletal morphology that distinguish all modern euechinoid from all modern cidaroid sea urchins. We demonstrate distinct canonical test and girdle morphologies in juveniles of both species by use of SEM and X-ray microtomography. Among the sharply distinct morphological features of these clades are the internal skeletal structures of the perignathic girdle to which attach homologous muscles utilized for retraction and protraction of Aristotles׳ lantern and its teeth. We demonstrate that these structures develop de novo between one and four weeks after metamorphosis. In order to study the underlying developmental processes, a method of section whole mount in

  13. A provisional regulatory gene network for specification of endomesoderm in the sea urchin embryo

    Science.gov (United States)

    Davidson, Eric H.; Rast, Jonathan P.; Oliveri, Paola; Ransick, Andrew; Calestani, Cristina; Yuh, Chiou-Hwa; Minokawa, Takuya; Amore, Gabriele; Hinman, Veronica; Arenas-Mena, Cesar; Otim, Ochan; Brown, C. Titus; Livi, Carolina B.; Lee, Pei Yun; Revilla, Roger; Schilstra, Maria J.; Clarke, Peter J C.; Rust, Alistair G.; Pan, Zhengjun; Arnone, Maria I.; Rowen, Lee; Cameron, R. Andrew; McClay, David R.; Hood, Leroy; Bolouri, Hamid

    2002-01-01

    We present the current form of a provisional DNA sequence-based regulatory gene network that explains in outline how endomesodermal specification in the sea urchin embryo is controlled. The model of the network is in a continuous process of revision and growth as new genes are added and new experimental results become available; see http://www.its.caltech.edu/mirsky/endomeso.htm (End-mes Gene Network Update) for the latest version. The network contains over 40 genes at present, many newly uncovered in the course of this work, and most encoding DNA-binding transcriptional regulatory factors. The architecture of the network was approached initially by construction of a logic model that integrated the extensive experimental evidence now available on endomesoderm specification. The internal linkages between genes in the network have been determined functionally, by measurement of the effects of regulatory perturbations on the expression of all relevant genes in the network. Five kinds of perturbation have been applied: (1) use of morpholino antisense oligonucleotides targeted to many of the key regulatory genes in the network; (2) transformation of other regulatory factors into dominant repressors by construction of Engrailed repressor domain fusions; (3) ectopic expression of given regulatory factors, from genetic expression constructs and from injected mRNAs; (4) blockade of the beta-catenin/Tcf pathway by introduction of mRNA encoding the intracellular domain of cadherin; and (5) blockade of the Notch signaling pathway by introduction of mRNA encoding the extracellular domain of the Notch receptor. The network model predicts the cis-regulatory inputs that link each gene into the network. Therefore, its architecture is testable by cis-regulatory analysis. Strongylocentrotus purpuratus and Lytechinus variegatus genomic BAC recombinants that include a large number of the genes in the network have been sequenced and annotated. Tests of the cis-regulatory predictions of

  14. El progreso biológico

    Directory of Open Access Journals (Sweden)

    Barahona, Ana

    1997-12-01

    Full Text Available Not available.La idea de progreso en Biología está ligada al concepto de scala naturae o la gran cadena del ser que se puede trazar hasta Aristóteles. Esta noción de que los organismos vivientes pueden clasificarse en una jerarquía de inferior a superior tomó formas nuevas en los siglos XVII y XVIII. En el siglo XVIII, naturalistas como Buffon, Bonnet y Robinet se habían preguntado si podíamos hablar de un patrón definido de desarrollo. En el siglo XIX, Lamarck postula la idea de que existe una progresión de los organismos menos avanzados a los organismos más avanzados. Posteriormente, la teoría de la evolución añade la dimensión temporal y de continuidad genética o histórica a la clasificación jerárquica de los seres vivos. Darwin pensaba que la selección natural traía como resultado el perfeccionamiento y que éste inevitablemente conduciría al progreso gradual de la organización. Herbert Spencer se convirtió en uno de los darwinistas más radicales del siglo XIX y principios del XX. Para Spencer la idea de progreso se aplicaba no solo al mundo biológico sino que era parte de una ley general, que dirigía lo simple hacia lo complejo, lo homogéneo a lo heterogéneo. Posteriormente, Julian Huxley, Theodosius Dobzhansky, Ernst Mayr, George Gaylord Simpson y Ledyard Stebbins —conocidos como los arquitectos de la Sintesis Moderna— comparten una visión progresionista de la evolución biológica. La noción de progreso evolutivo, en la actualidad, es sumamente controvertida, y se pueden distinguir básicamente tres diferentes perspectivas. La primera, defendida por Michael Ruse y David Hull entre otros, sostiene que no existe evidencia científica que nos lleve a aceptar cierta «direccionalidad» en la evolución biológica. Una segunda visión, defendida por Stephen J. Gould, sostiene que, en la medida en que reemplacemos el término de progreso (ya que éste es antropocéntrico por el de «noción operacional de

  15. Sorption potential of Moringa oleifera pods for the removal of organic pollutants from aqueous solutions

    International Nuclear Information System (INIS)

    Moringa oleifera pods Lamarck (Drumstick or Horseradish) is a multipurpose medium or small size tree from sub-Himalayan regions of north-west India and indigenous to many parts of Asia, Africa, South America, and in the Pacific and Caribbean Islands. Its pods (MOP) have been employed as an inexpensive and effective sorbent for the removal of organics, i.e., benzene, toluene, ethylbenzene and cumene (BTEC) from aqueous solutions using HPLC method. Effect of different parameters, i.e., sorbent dose 0.05-0.8 g, 25 cm-3 agitation time 5-120 min, pH 1-10, temperature 283-308 K and concentration of sorbate (1.3-13) x 10-3, (1.1-11) x 10-3, (0.9-9) x 10-3, (0.8-8) x 10-3 mol dm-3, on the sorption potential of MOP for BTEC have been investigated. The pore area and average pore diameter of the MOP by BET method using nitrogen as a standard are calculated to be 28.06 ± 0.8 m2 g-1 and 86.2 ± 1.3 nm respectively. Freundlich, Langumir and Dubinin-Radushkevich (D-R) sorption isotherms were employed to evaluate the sorption capacity of MOP. Sorption capacities of BTEC onto MOP have been found to be 46 ± 10, 84 ± 9, 101 ± 4, 106 ± 32 mmol g-1 by Freundlich, 8 ± 0.1, 9 ± 0.1, 10 ± 0.3, 9 ± 0.1 mmol g-1 by Langumir and 15 ± 1, 21 ± 1, 23 ± 2, 22 ± 3 mmol g-1 by D-R isotherms respectively, from BTEC solutions at 303 K. While the mean energy of sorption process 9.6 ± 0.3, 9.2 ± 0.2, 9.3 ± 0.3, 9.5 ± 0.4 kJ mol-1 for BTEC is calculated by D-R isotherm only. Rate constant of BTEC onto MOP 0.033 ± 0.003, 0.030 ± 0.002, 0.029 ± 0.002, 0.027 ± 0.002 min-1 at solution concentration of 1.3 x 10-3, 1.1 x 10-3, 0.9 x 10-3 and 0.8 x 10-3 mol dm-3 and at 303 K have been calculated by employing Lagergren equation. Thermodynamic parameters ΔH -8 ± 0.4, -10 ± 0.6, -11 ± 0.7, -11 ± 0.7 kJ mol-1, ΔS -22 ± 2, -26 ± 2, -27 ± 2, -29 ± 3 J mol-1 K-1 and ΔG 303K -0.9 ± 0.2, -1.9 ± 0.2, -2.3 ± 0.1 and -2.6 ± 0.2 kJ mol-1 were also estimated for BTEC respectively at

  16. Sorption potential of Moringa oleifera pods for the removal of organic pollutants from aqueous solutions

    Energy Technology Data Exchange (ETDEWEB)

    Akhtar, Mubeena [National Center of Excellence in Analytical Chemistry, University of Sindh, Jamshoro-76080 (Pakistan)]. E-mail: profmarao@yahoo.com; Moosa Hasany, S. [Pakistan Institute of Engineering and Applied Sciences, PO Nilore, Islamabad (Pakistan); Bhanger, M.I. [National Center of Excellence in Analytical Chemistry, University of Sindh, Jamshoro-76080 (Pakistan); Iqbal, Shahid [Department of Chemistry, University of Sargodha, Sargodha-40100 (Pakistan)]. E-mail: ranashahid313@gmail.com

    2007-03-22

    Moringa oleifera pods Lamarck (Drumstick or Horseradish) is a multipurpose medium or small size tree from sub-Himalayan regions of north-west India and indigenous to many parts of Asia, Africa, South America, and in the Pacific and Caribbean Islands. Its pods (MOP) have been employed as an inexpensive and effective sorbent for the removal of organics, i.e., benzene, toluene, ethylbenzene and cumene (BTEC) from aqueous solutions using HPLC method. Effect of different parameters, i.e., sorbent dose 0.05-0.8 g, 25 cm{sup -3} agitation time 5-120 min, pH 1-10, temperature 283-308 K and concentration of sorbate (1.3-13) x 10{sup -3}, (1.1-11) x 10{sup -3}, (0.9-9) x 10{sup -3}, (0.8-8) x 10{sup -3} mol dm{sup -3}, on the sorption potential of MOP for BTEC have been investigated. The pore area and average pore diameter of the MOP by BET method using nitrogen as a standard are calculated to be 28.06 {+-} 0.8 m{sup 2} g{sup -1} and 86.2 {+-} 1.3 nm respectively. Freundlich, Langumir and Dubinin-Radushkevich (D-R) sorption isotherms were employed to evaluate the sorption capacity of MOP. Sorption capacities of BTEC onto MOP have been found to be 46 {+-} 10, 84 {+-} 9, 101 {+-} 4, 106 {+-} 32 mmol g{sup -1} by Freundlich, 8 {+-} 0.1, 9 {+-} 0.1, 10 {+-} 0.3, 9 {+-} 0.1 mmol g{sup -1} by Langumir and 15 {+-} 1, 21 {+-} 1, 23 {+-} 2, 22 {+-} 3 mmol g{sup -1} by D-R isotherms respectively, from BTEC solutions at 303 K. While the mean energy of sorption process 9.6 {+-} 0.3, 9.2 {+-} 0.2, 9.3 {+-} 0.3, 9.5 {+-} 0.4 kJ mol{sup -1} for BTEC is calculated by D-R isotherm only. Rate constant of BTEC onto MOP 0.033 {+-} 0.003, 0.030 {+-} 0.002, 0.029 {+-} 0.002, 0.027 {+-} 0.002 min{sup -1} at solution concentration of 1.3 x 10{sup -3}, 1.1 x 10{sup -3}, 0.9 x 10{sup -3} and 0.8 x 10{sup -3} mol dm{sup -3} and at 303 K have been calculated by employing Lagergren equation. Thermodynamic parameters {delta}H -8 {+-} 0.4, -10 {+-} 0.6, -11 {+-} 0.7, -11 {+-} 0.7 kJ mol{sup -1}, {delta

  17. Ciclo gametogênico e comportamento reprodutivo de Iphigenia brasiliana (Mollusca, Bivalvia, Donacidae no estuário do rio Subaé, Baía de Todos os Santos, Bahia, Brasil

    Directory of Open Access Journals (Sweden)

    Patrícia P. Silva

    2012-12-01

    Full Text Available Este estudo teve como objetivos descrever o ciclo gametogênico e o comportamento reprodutivo da população de Iphigenia brasiliana (Lamarck,1818 no estuário do rio Subaé, Baía de Todos os Santos, Bahia. Os bivalves foram coletados de novembro de 2001 a novembro de 2002. Um total de 244 espécimes foi medido (eixo anteroposterior, eviscerado, fixado, desidratado e incluído em parafina. O estudo histológico das gônadas foi realizado através de cortes seriados do tecido gonadal, de 5 mm de espessura, e corados pela HE. O tamanho médio mínimo da primeira maturação sexual (Lpm foi estimado a partir da distribuição das frequências relativas de jovens e adultos, por classe de comprimento dos indivíduos. As frequências relativas dos sexos em cada estádio de desenvolvimento foram consideradas conjuntamente para a análise do comportamento reprodutivo da população, e, em separado, para avaliar a sincronia do ciclo sexual entre machos e fêmeas. Foi observada uma variação de tamanhos entre 9,1 e 66,6 mm, com comprimento médio de 50,2 mm. O estudo não demonstrou diferença significativa entre os tamanhos de machos e fêmeas. Não foi possível observar a diferenciação de sexos em 2,1% dos indivíduos analisados. 51,6% dos indivíduos foram identificados como machos (M e 46,3% como fêmeas (F, não sendo constatadas diferenças significativas entre o número médio de machos e fêmeas, resultando numa proporção de M:F de 1,1:1. O Lpm foi estimado em 11,4 mm, mas apenas ao alcançarem comprimento médio de 34,4 mm, todos os indivíduos foram considerados adultos. Foram caracterizados quatro estádios de evolução do desenvolvimento gonadal em fêmeas e machos. A análise dos diferentes estádios permitiu a observação dos fenômenos de atresia e inversão sexual em fêmeas. O ciclo reprodutivo apresentou eliminação contínua de gametas, com maiores intensidades reprodutivas nos meses de novembro de 2001 a abril de 2002 e, tamb

  18. [Not Available].

    Science.gov (United States)

    Spivak, M

    1987-01-01

    Some ideas, whether right or wrong, seem never to die, whatever might be the general evolution of knowledge, of science, or simply of good common sense. This is exactly the case with physical education or sports. For centuries, and especially since the middle of the nineteenth century, its advocates have fought for recognition of its all-round virtues, taken as a concept. But to attain a high level of recognition, not only in society but in official government circles, certain conditions were necessary. Education as a whole, around the middle of the nineteenth century, had to be strict and similar to military drill to be considered efficient, although the French middle classes and bourgeoisie had very little taste for the military. Although they admired physical prowess they had a horror of regimentation. But later on, when the Prussians so easily defeated Austria, feelings of doubt in French superiority began to spread, and a handful of theoreticians of physical exercise tried to show that to combat the so-called degeneration of the race, it was essential to impose a system of education in which physical exercise, coupled with military drill, still had an important place. As scientific arguments they referred to the theories of evolution and its then accepted principle, according to Lamarck, or the transmission of acquired properties and character. Darwin was still unknown in France at that time. These zealous advocates succeeded in convincing the Minister of Public Education, Victor Duruy, to include gymnastics in the normal course of studies in all schools, and by 1869 one can say that a craze for all types of physical exercise and sport had spread into many levels of society. That was the start of a never-ending movement which has passed through various stages of evolution corresponding to the changes in society itself. It has therefore changed its methods, its ways, its forms, but the overall principle remains the same, in spite of the improved understanding

  19. 双壳类线粒体基因组结构分析%Analysis of Mitochondrial Genomic Structures in Bivalves

    Institute of Scientific and Technical Information of China (English)

    孟学平; 申欣; 赵娜娜; 田美; 郑立波; 程汉良; 阎斌伦; 董志国

    2013-01-01

    chain ,and mitochondrial genes from Unionoida in the 2 chains. A few species (12 species from Unionoida ,2 species from Veneroida ,1 species from Mytiloida ,and 1 species from Myoida , species from oyster Crassostrea) mitochondrial genomes contain 13 protein-coding genes (PCGs) ,and the remainings are comprised of 12 PCGs ,w hich are lack of AT P8 gene. The gene arrangements of PCGs and rRNAs are identical within same genus or family ,including 4 species from Meretrix ,4 species from Crassostrea ,11 species from Unionidae and Margaritiferidae , two species (Mytilus edulis and M. galloprovincialis) from mussel Mytilus. The gene arrangements of 10 mitochondrial genomes from Ostreidae can be divided into 7 types. There were no shared gene blocks in mitochondrial genomes from Pectinidae except similar gene structures were detected in bay scallop Argopecten irradians irradians f arreri(NC_012977)and A. irradians(NC_009687). The mussels Mytilus edulis and M. trossulus from Mytilidae have very similar genomic structures ,and the genomic structure of Musculista senhousia is very special with a duplicated cox2 genes. The gene arrangement of Hiatella arctica from Myoida is very different from other species. The proportions of non-coding regions in mitogenomes are ranged from 7.6%to 40.3% ,the major non-coding region ranging from 374nt to 4341nt in size in bivalves. The minimum divergence is found to be 0.2-1.0/0-1.0 in Meretrix ,0.4-2.0/0-3.2 in Mytilus and 1.9-13.9/0-6.4 in oyster Crassostrea based on nucleotides of PCGs genes/amino acids of proteins.

  20. Molecular evolution of Phox-related regulatory subunits for NADPH oxidase enzymes

    Directory of Open Access Journals (Sweden)

    Lambeth J David

    2007-09-01

    Full Text Available Abstract Background The reactive oxygen-generating NADPH oxidases (Noxes function in a variety of biological roles, and can be broadly classified into those that are regulated by subunit interactions and those that are regulated by calcium. The prototypical subunit-regulated Nox, Nox2, is the membrane-associated catalytic subunit of the phagocyte NADPH-oxidase. Nox2 forms a heterodimer with the integral membrane protein, p22phox, and this heterodimer binds to the regulatory subunits p47phox, p67phox, p40phox and the small GTPase Rac, triggering superoxide generation. Nox-organizer protein 1 (NOXO1 and Nox-activator 1 (NOXA1, respective homologs of p47phox and p67phox, together with p22phox and Rac, activate Nox1, a non-phagocytic homolog of Nox2. NOXO1 and p22phox also regulate Nox3, whereas Nox4 requires only p22phox. In this study, we have assembled and analyzed amino acid sequences of Nox regulatory subunit orthologs from vertebrates, a urochordate, an echinoderm, a mollusc, a cnidarian, a choanoflagellate, fungi and a slime mold amoeba to investigate the evolutionary history of these subunits. Results Ancestral p47phox, p67phox, and p22phox genes are broadly seen in the metazoa, except for the ecdysozoans. The choanoflagellate Monosiga brevicollis, the unicellular organism that is the closest relatives of multicellular animals, encodes early prototypes of p22phox, p47phox as well as the earliest known Nox2-like ancestor of the Nox1-3 subfamily. p67phox- and p47phox-like genes are seen in the sea urchin Strongylocentrotus purpuratus and the limpet Lottia gigantea that also possess Nox2-like co-orthologs of vertebrate Nox1-3. Duplication of primordial p47phox and p67phox genes occurred in vertebrates, with the duplicated branches evolving into NOXO1 and NOXA1. Analysis of characteristic domains of regulatory subunits suggests a novel view of the evolution of Nox: in fish, p40phox participated in regulating both Nox1 and Nox2, but after the

  1. Estradiol and endocrine disrupting compounds adversely affect development of sea urchin embryos at environmentally relevant concentrations

    Energy Technology Data Exchange (ETDEWEB)

    Roepke, Troy A. [Bodega Marine Laboratory, University of California, Davis, POB 247, Bodega Bay, CA 94923 (United States); Snyder, Mark J. [Bodega Marine Laboratory, University of California, Davis, POB 247, Bodega Bay, CA 94923 (United States); Cherr, Gary N. [Bodega Marine Laboratory, University of California, Davis, POB 247, Bodega Bay, CA 94923 (United States) and Departments of Environmental Toxicology and Nutrition, One Shields Avenue, University of California, Davis, CA 95616 (United States)]. E-mail: gncherr@ucdavis.edu

    2005-01-26

    Environmental endocrine disrupting compounds (EDCs) are a wide variety of chemicals that typically exert effects, either directly or indirectly, through receptor-mediated processes, thus mimicking endogenous hormones and/or inhibiting normal hormone activities and metabolism. Little is known about the effects of EDCs on echinoderm physiology, reproduction and development. We exposed developing sea urchin embryos (Strongylocentrotus purpuratus and Lytechinus anamesus) to two known EDCs (4-octylphenol (OCT), bisphenol A (BisA)) and to natural and synthetic reproductive hormones (17{beta}-estradiol (E{sub 2}), estrone (E{sub 1}), estriol (E{sub 3}), progesterone (P{sub 4}) and 17{alpha}-ethynylestradiol (EE{sub 2})). In addition, we studied two non-estrogenic EDCs, tributyltin (TBT) and o,p-DDD. Successful development to the pluteus larval stage (96 h post-fertilization) was used to define EDC concentration-response relationships. The order of compound potency based on EC{sub 50} values for a reduction in normal development was as follows: TBT {sub L.anamesus} > OCT > TBT {sub S.{sub p}}{sub urpuratus} >> E{sub 2} > EE{sub 2} > DDD >> BisA > P{sub 4} > E{sub 1} >> E{sub 3}. The effect of TBT was pronounced even at concentrations substantially lower than those commonly reported in heavily contaminated areas, but the response was significantly different in the two model species. Sea urchin embryos were generally more sensitive to estrogenic EDCs and TBT than most other invertebrate larvae. Stage-specific exposure experiments were conducted to determine the most sensitive developmental periods using blastula, gastrula and post-gastrula (pluteus) stages. The stage most sensitive to E{sub 2}, OCT and TBT was the blastula stage with less overall sensitivity in the gastrula stage, regardless of concentration. Selective estrogen receptor modulators (SERMs) were added to the experiments individually and in combination with estrogenic EDCs to interfere with potential receptor

  2. Colonização de Pomacea haustrum (Reeve, 1856 em localidade com esquistossomose mansoni: Baldim, MG (Brasil. (Prosobranchia, Pilidae Colonization of Pomacea haustrum (Reeve, 1856 at localility with Schistosomiasis mansoni: Baldim, MG (Brazil

    Directory of Open Access Journals (Sweden)

    Roberto Milward-de-Andrade

    1979-06-01

    introduced into 5 brooks and 2 ditches where Biomphalaria glabrata (primarily and B. straminea (secondarily predominated. From 1968 to 1971, the infection rate of B. glabrata by S. mansoni ranged from 2.1% to 11.9%. None of the B. straminea specimens collected, however, were seen to be liberating cercariae of this trematode. After the introduction of Pilidae, only once were two positive B. glabrata specimens (1.8% detected. A decrease in the planorbide population was observed, as well as an increase in the pomacea density to 20.0 and 121.6 specimens per square meter in the brooks and ditches, respectively. P. haustrum density was estimated by the "quadrat" method. Of the planorbides in the experiment, 65.2% (1,526 were collected from July/68 to July/72 and the rest were obtained after the introduction of the predator-competitor species, as follows: 15.0% (352 in 1976; 16.1% (377 in 1977; and 3.7% (87 in 1978. Although transferred from a lenitic medium (Sete Lagoas, MG, the pomaceae became perfectly adapted to the lotic collections of Baldim, and proved to be capable of replacing the original B. glabrata populations of several biotopes or, at least, of becoming predominant, with no damage to the new ecosystems. Based on the data presented above and the knowledge previously acquired in the study of the biology and ecology of the species, it is believed that, under similar conditions, Pomacea haustrum (Reeve, 1856 - and, by extension, P. lineata (Spix, 1827 and P. canaliculata (Lamarck, 1822, as well as other species from the same genus - may be successfully used in the biological control of the intermediate hosts of S. mansoni.

  3. La science comme pratique d’intégration dans la société des princes. Les Grimaldi de Monaco et la curiosité savante (xviie–xviiie siècle

    Directory of Open Access Journals (Sweden)

    Thomas Fouilleron

    2011-09-01

    le géologue Faujas de Saint-Fond un filon charbonneux qui, un temps, fait croire à une possible industrialisation de la Principauté. Homme de son temps et des usages de son ordre, le dernier prince d’Ancien Régime sacrifie à la frénésie mesmérienne et à la mode parisienne des expériences publiques. Même si l’histoire continue à être un goût dominant, les « sciences et arts » sont bien représentés dans les bibliothèques des Grimaldi au siècle des Lumières. Quelques ouvrages savants et techniques leur sont dédiés. Les jeunes princes reçoivent les rudiments d’une éducation scientifique, en particulier dans le domaine des mathématiques. Georges Cuvier est même, pendant la Révolution, le précepteur fortuit du futur prince Honoré V (1778-1841. L’exemple des souverains entraîne quelques sujets, gens de cour ou ecclésiastiques de la Principauté, à s’investir dans les sciences. Le milieu naturel local les amène souvent à s’intéresser à la botanique. Lamarck, en garnison à Monaco, y aurait d’ailleurs fait ses premières observations.Si, dans le domaine du connoissorship scientifique, les Grimaldi suivent les usages de leur temps, peut-être plus qu’ils ne les précèdent, ils instrumentalisent les sciences et les savants à des fins de reconnaissance culturelle et de légitimation politique. Laboratoire des grandes cours européennes, le palais de Monaco peut ainsi être vu comme un observatoire privilégié des rapports qu’entretiennent, aux xviie et xviiie siècles, les princes et les savants, et un marqueur de la propagation de la culture scientifique jusque dans les petites cours.

  4. Foundations, fallacies, and assumptions of science for livestock development

    International Nuclear Information System (INIS)

    editorial arguing we must go back to the beginning of molecular genetics. The ENCODE Project which examined 1% of the human genome in fine detail concluded the same. Dr. David Schubert in Salk Institute considers that GM foods have been launched too early with unknown risks. Stress proteins are emerging as a highly important factor in modifying gene expression. Perhaps of greatest importance to the question of using molecular genetics in the developing world for livestock improvement is the growing evidence for Epigenesis. The mammalian genome is a complex of DNA, RNA of many types and proteins, which seem to be engaged routinely in passing information around that modifies gene expression. Since this raises the question of information being fed into the genome and the genes from the environment, the whole issue of adaptation of livestock to differing environments is open to review. There is even a case for rethinking the total rejection of Lamarckism. We face risks from genetic engineering that are asymmetric: Black Swan risks with Low Probability and High Impact. Conventional risk assessments using mathematical probabilities not good enough. Once is too many. Clearly we should not be against research. In fact more is needed. The main issue is the need for great caution in applying molecular genetic techniques and projects based upon them until we gain better understanding of the inner world of the mammalian genome. (author)

  5. Annotated type catalogue of the Bulimulidae (Mollusca, Gastropoda, Orthalicoidea in the Natural History Museum, London

    Directory of Open Access Journals (Sweden)

    Abraham Breure

    2014-03-01

    edwardsi (Morelet, 1863; Kuschelenia (K. gayi (Pfeiffer, 1857; Kuschelenia (K. tupacii (d’Orbigny, 1835; Kuschelenia (Vermiculatus anthisanensis (Pfeiffer, 1853; Kuschelenia (Vermiculatus aquilus (Reeve, 1848; Kuschelenia (Vermiculatus bicolor (Sowerby I, 1835; Kuschelenia (Vermiculatus caliginosus (Reeve, 1849; Kuschelenia (Vermiculatus cotopaxiensis (Pfeiffer, 1853; Kuschelenia (Vermiculatus filaris (Pfeiffer, 1853; Kuschelenia (Vermiculatus ochracea (Morelet, 1863; Kuschelenia (Vermiculatus petiti (Pfeiffer, 1846; Kuschelenia (Vermiculatus purpuratus (Reeve, 1849; Kuschelenia (Vermiculatus quechuarum (Crawford, 1939; Naesiotus cinereus (Reeve, 1849; Naesiotus dentritis (Morelet, 1863; Naesiotus fontainii (d’Orbigny, 1838; Naesiotus orbignyi (Pfeiffer, 1846; Protoglyptus pilosus (Guppy, 1871; Protoglyptus sanctaeluciae (E.A. Smith, 1889.Type material of the following taxa is figured herein for the first time: Bulimus cinereus Reeve, 1849; Bulimus coriaceus Pfeiffer, 1857; Bulimulus laxostylus Rolle, 1904; Bulimus pliculatus Pfeiffer, 1857; Bulimus simpliculus Pfeiffer, 1855.