WorldWideScience

Sample records for archival precursor lesions

  1. Application of a global proteomic approach to archival precursor lesions: deleted in malignant brain tumors 1 and tissue transglutaminase 2 are upregulated in pancreatic cancer precursors

    DEFF Research Database (Denmark)

    Cheung, Wang; Darfler, Marlene M; Alvarez, Hector;

    2008-01-01

    of invasive cancer. Biomarker discovery in precursor lesions has been hampered by the ready availability of fresh specimens, and limited yields of proteins suitable for large scale screening. METHODS: We utilized Liquid Tissue, a novel technique for protein extraction from archival formalin-fixed material...... their overexpression in IPMNs. CONCLUSION: Global proteomics analysis using the Liquid Tissue workflow is a feasible approach for unbiased biomarker discovery in limited archival material, particularly applicable to precursor lesions of cancer....

  2. PROLIFERATIVE INFLAMMATORY ATROPHY: POTENTIAL PRECURSOR LESION FOR PROSTATIC ADENOCARCINOMA

    Directory of Open Access Journals (Sweden)

    Benedetti-Padrón Inés

    2014-01-01

    Full Text Available Introduction: Prostatic Intraepithelial neoplasia (PIN is currently considered as the only precursor lesion of prostate cancer (PCa; nevertheless, some years ago, it has been suspected that the atrophic lesions also might be involved in its carcinogenesis. In 1999, De Marzo prospered, the expression Proliferative Inflammatory Atrophy (PIA to denominate a lesion located in the peripheral area of the gland, with epithelial cells with high proliferative potential, frequently accompanied of inflammation that has been postulated as possible precursor lesion of PIN and PCa. Objective: To review the concepts about Proliferative Inflammatory Atrophy (PIA, its morphological, genetics and molecular characteristics and to explain the precursor capacity of PIN and PCa. Methods: Databases Pubmed, Sciencedirect, EBSCOhost and OvidSP were reviewed in search of studies, systematic reviews, consensus and meta-analyses with keywords: Proliferative Inflammatory Atrophy, Prostatic Atrophy, Prostatic Carcinoma, using as due date December of 2012. Results: Molecular disorders described in PIA support the beginning of these lesions in a context of oxidative stress, possibly caused by the surrounding inflammatory cells, which induce the expression of defense gene against the oxidative damage of the genome in some epithelial cells, while those that fail in the expression of these gene become vulnerable to oxidants and electrophiles, which do them prone to develop genetic disorders that will benefit their transformation in cells of PIN and PCa. The morphological association PIA-PIN/PCa points to a progressive relationship between these lesions.Conclusion: Topographic association and morphological transition of PIA with PIN and PCa have been observed. Besides, genetic, somatic and molecular disorders have been reported in PIA, similar to those observed in PIN and PCa due to it has been postulated as possible precursor lesion of both. Nevertheless, this approach is

  3. Clinical and biological significance of precursor lesions of intrahepatic cholangiocarcinoma.

    Science.gov (United States)

    Ettel, Mark; Eze, Ogechukwu; Xu, Ruliang

    2015-11-01

    Cholangiocarcinoma (CC) is primarily a malignant tumor of older adults most prevalent in Southeast Asia, where liver fluke infestation is high. However the etiology in western countries is unknown. Although the incidence of extrahepatic cholangiocarcinoma has remained constant, incidence of intrahepatic CC (ICC) which differs in morphology, pathogenesis, risk factors, treatment and prognosis is increasing. While this increase is associated with hepatitis C virus infection, chronic nonalcoholic liver disease, obesity, and smoking, the pathogenesis of ICC and molecular alterations underlying the carcinogenesis are not completely elucidated. Benign biliary lesions such as biliary intraepithelial neoplasia, intraductal papillary neoplasm of the bile duct, von Meyenburg complex or bile duct hamartoma, and bile duct adenoma have been associated with ICC. For each of these entities, evidence suggests or supports a role as premalignant lesions. This article summarized the important biological significance of the precursor lesions of ICC and the molecular mechanisms that may be involved in intrahepatic cholangiocarcinogenesis. PMID:26557948

  4. Imaging of precursor lesions of the female breast; Bildgebung und Vorgehen bei praeinvasiven Laesionen der Mamma

    Energy Technology Data Exchange (ETDEWEB)

    Weigel, Stefanie [Universitaetsklinikum Muenster (Germany). Inst. fuer Klinische Radiologie; Universitaetsklinikum Muenster (Germany). Referenzzentrum Mammografie; Decker, Thomas [Dietrich-Bonhoeffer-Klinikum Neubrandenburg, Neubrandenburg (Germany). Inst. fuer Pathologie; Heindel, Walter [Universitaetsklinikum Muenster (Germany). Referenzzentrum Mammografie; Muenster Univ. (Germany). Medizinische Fakultaet

    2012-06-15

    Precursor lesions of the breast are biologically and clinically heterogeneous neoplastic lesions with a varying risk for progression to an invasive breast cancer. This review presents definitions, diagnostic criteria and concepts for the clinical management of the following lesions: ductal carcinoma in situ (DCIS), atypical ductal hyperplasia (ADH), flat epithelial atypia (FEA), lobular neoplasia (LN). (orig.)

  5. What Are the Precursor and Early Lesions of Peripheral Intrahepatic Cholangiocarcinoma?

    Science.gov (United States)

    Nakanuma, Yasuni; Tsutsui, Akemi; Sasaki, Motoko

    2014-01-01

    Cholangiocarcinoma (CC) is divided into distal, perihilar, and intrahepatic CCs (ICCS), and are further subdivided into large bile duct ICC and peripheral ICC. In distal and perihilar CC and large duct ICC, biliary intraepithelial neoplasm (BilIN) and intraductal papillary neoplasm (IPN) have been proposed as precursor lesions. Peripheral ICC, bile duct adenoma (BDA), biliary adenofibroma (BAF), and von Meyenburg complexes (VMCs) are reportedly followed by development of ICCs. Herein, we surveyed these candidate precursor lesions in the background liver of 37 cases of peripheral ICC and controls (perihilar CC, 34 cases; hepatocellular carcinoma, 34 cases and combined hepatocellular cholangiocarcinoma, 25 cases). In the background liver of peripheral ICC, BDA and BAF were not found, but there were not infrequently foci of BDA-like lesions and atypical bile duct lesions involving small bile ducts (32.4% and 10.8%, resp.). VMCs were equally found in peripheral CCs and also control CCs. In conclusion, BDA, BAF, and VMCs are a possible precursor lesion of a minority of peripheral CCs, and BDA-like lesions and atypical bile duct lesions involving small bile ducts may also be related to the development of peripheral ICC. Further pathologic studies on these lesions are warranted for analysis of development of peripheral ICCs. PMID:24860673

  6. Prevalence of gastric cancer precursor lesions in patients with dyspepsia

    Directory of Open Access Journals (Sweden)

    Cem Aygün

    2010-03-01

    Full Text Available Objectives: In Southeastern cities of Turkey, high prevalencesof Helicobacter pylori infection and gastric cancerare seen. The aim of this study was to evaluate the frequencyof the precancerous gastric lesions in patientswith dyspeptic symptoms who underwent upper gastrointestinalendoscopy in Adıyaman State Hospital.Materials and methods: We analyzed gastric biopsiestaken from corpus and antrum of 234 consecutive patientswho underwent upper gastrointestinal endoscopybetween January 2009 and May 2009. According to Sydneysystem, chronic gastritis, gastric atrophy, intestinalmetaplasia and dysplasia were diagnosed by histologicalexamination.Results: The mean age of patients was 46±15 (16- 82years. Helicobacter pylori infection was seen in 66.7% ofpatients. Normal mucosa, chronic gastritis, gastric atrophy,intestinal metaplasia and dysplasia were diagnosedin 2.7%, 78.6%, 3.4%, 11.5% and 3.8% of gastric biopsyspecimens, respectively. Helicobacter pylori infected patientsshowed a significantly higher prevalence of intestinalmetaplasia compared with that of the non infectedsubjects (9.8% vs 1.7% p=0.021. Although prevalenceof gastric atrophy and dysplasia were higher among Helicobacterpylori infected patients, the difference did notreached to a statistically significant level (3.0% vs 0.4%p=0.19 and 3.0% vs 0.8% p=0.37 respectively.Conclusion: Our findings suggested that the prevalenceof gastric precancerous lesions such as gastric atrophy,intestinal metaplasia, dysplasia and Helicobacter pyloriinfection were high in dyspeptic patients. This may be relatedto actual high incidence of gastric cancer in southeasternregion of Turkey.

  7. REPRODUCTIVE ASPECTS ASSOCIATED WITH PRECURSOR LESIONS FOR CERVICAL CANCER

    Directory of Open Access Journals (Sweden)

    Rogério Ferrari

    2013-05-01

    Full Text Available To investigate the relationship between reproductive variables and theprecursor lesions for cervical cancer in women attended the clinic of the lower genitaltract pathology and colposcopy (PTGIC, packed in the complex regional healthCaceres city, southwest of Mato Grosso, in the year 2009.Methods:We conducted across sectional study with data collection from medical records of 142 women withabnormal cytology, colposcopy and positive underwent directed biopsy, taking intoaccount the reproductive variables.Results:indicate that the minimum age at menarchewas 9 years and maximum age was 17 years, mean 12.6 years; on the average paritywas 3.4 children, the use of hormonal contraceptive method corresponds to 34 5% and38.1% female sterilization research, 46.5% are or have use of contraception for a periodgreater than five years, with a mean of 4.7 years and 67.2% of women surveyed do notuse condoms. The variables were not significantly associated to cervical cancer.Conclusion:the characteristics of the women studied may serve as a basis for workdirected to this population in order to seek to minimize this problem.Although the dataobtained were satisfactory, it was possible to trace the profile of the reproductiveaspects of women in the Clinic ofPTGIC, there is a lack of association betweenreproductive aspects and findings of the cervical biopsy, it may be associated with somelimiting factors of the study that need to be balanced

  8. Functional remineralization of dentin lesions using polymer-induced liquid-precursor process.

    Directory of Open Access Journals (Sweden)

    Anora K Burwell

    Full Text Available It was hypothesized that applying the polymer-induced liquid-precursor (PILP system to artificial lesions would result in time-dependent functional remineralization of carious dentin lesions that restores the mechanical properties of demineralized dentin matrix. 140 µm deep artificial caries lesions were remineralized via the PILP process for 7-28 days at 37°C to determine temporal remineralization characteristics. Poly-L-aspartic acid (27 KDa was used as the polymeric process-directing agent and was added to the remineralization solution at a calcium-to-phosphate ratio of 2.14 (mol/mol. Nanomechanical properties of hydrated artificial lesions had a low reduced elastic modulus (E(R = 0.2 GPa region extending about 70 μm into the lesion, with a sloped region to about 140 μm where values reached normal dentin (18-20 GPa. After 7 days specimens recovered mechanical properties in the sloped region by 51% compared to the artificial lesion. Between 7-14 days, recovery of the outer portion of the lesion continued to a level of about 10 GPa with 74% improvement. 28 days of PILP mineralization resulted in 91% improvement of E(R compared to the artificial lesion. These differences were statistically significant as determined from change-point diagrams. Mineral profiles determined by micro x-ray computed tomography were shallower than those determined by nanoindentation, and showed similar changes over time, but full mineral recovery occurred after 14 days in both the outer and sloped portions of the lesion. Scanning electron microscopy and energy dispersive x-ray analysis showed similar morphologies that were distinct from normal dentin with a clear line of demarcation between the outer and sloped portions of the lesion. Transmission electron microscopy and selected area electron diffraction showed that the starting lesions contained some residual mineral in the outer portions, which exhibited poor crystallinity. During remineralization

  9. Early Breast Cancer Precursor Lesions: Lessons Learned from Molecular and Clinical Studies

    OpenAIRE

    Sinn, Hans-Peter; Elsawaf, Zeinab; Helmchen, Birgit; Aulmann, Sebastian

    2010-01-01

    Atypical ductal hyperplasia (ADH), flat epithelial atypia (FEA), and lobular neoplasia (LN) form a group of early precursor lesions that are part of the low-grade pathway in breast cancer development. This concept implies that the neoplastic disease process begins at a stage much earlier than in situ carcinoma. We have performed a review of the published literature for the upgrade risk to ductal carcinoma in situ or invasive carcinoma in open biopsy after a diagnosis of ADH, FEA, or LN in cor...

  10. Early Breast Cancer Precursor Lesions: Lessons Learned from Molecular and Clinical Studies.

    Science.gov (United States)

    Sinn, Hans-Peter; Elsawaf, Zeinab; Helmchen, Birgit; Aulmann, Sebastian

    2010-08-01

    Atypical ductal hyperplasia (ADH), flat epithelial atypia (FEA), and lobular neoplasia (LN) form a group of early precursor lesions that are part of the low-grade pathway in breast cancer development. This concept implies that the neoplastic disease process begins at a stage much earlier than in situ carcinoma. We have performed a review of the published literature for the upgrade risk to ductal carcinoma in situ or invasive carcinoma in open biopsy after a diagnosis of ADH, FEA, or LN in core needle biopsy. This has revealed the highest upgrade risk for ADH (28.2% after open biopsy), followed by LN (14.9%), and FEA (10.2%). With LN, the pleomorphic subtype is believed to confer a higher risk than classical LN. With all types of precursor lesions, careful attention must be paid to the clinicopathological correlation for the guidance of the clinical management. Follow-up biopsies are generally indicated in ADH, and if there is any radiological-pathological discrepancy, also in LN or FEA. PMID:22590441

  11. Measuring telomere length for the early detection of precursor lesions of esophageal squamous cell carcinoma

    International Nuclear Information System (INIS)

    Esophageal cancer is the sixth leading cause of cancer death worldwide; current early detection screening tests are inadequate. Esophageal balloon cytology successfully retrieves exfoliated and scraped superficial esophageal epithelial cells, but cytologic reading of these cells has poor sensitivity and specificity for detecting esophageal squamous dysplasia (ESD), the precursor lesion of esophageal squamous cell carcinoma (ESCC). Measuring telomere length, a marker for chromosomal instability, may improve the utility of balloon cytology for detecting ESD and early ESCC. We examined balloon cytology specimens from 89 asymptomatic cases of ESD (37 low-grade and 52 high-grade) and 92 age- and sex-matched normal controls from an esophageal cancer early detection screening study. All subjects also underwent endoscopy and biopsy, and ESD was diagnosed histopathologically. DNA was extracted from the balloon cytology cells, and telomere length was measured by quantitative PCR. A receiver operating characteristic (ROC) curve was plotted for telomere length as a diagnostic marker for high-grade dysplasia. Telomere lengths were comparable among the low- and high-grade dysplasia cases and controls, with means of 0.96, 0.96, and 0.92, respectively. The area under the ROC curve was 0.55 for telomere length as a diagnostic marker for high-grade dysplasia. Further adjustment for subject characteristics, including sex, age, smoking, drinking, hypertension, and body mass index did not improve the use of telomere length as a marker for ESD. Telomere length of esophageal balloon cytology cells was not associated with ESCC precursor lesions. Therefore, telomere length shows little promise as an early detection marker for ESCC in esophageal balloon samples

  12. Expression of HER2 and bradykinin B1 receptors in precursor lesions of gallbladder carcinoma

    Institute of Scientific and Technical Information of China (English)

    Cesar Toledo; Carola E Matus; Ximena Barraza; Pamela Arroyo; Pamela Ehrenfeld; Carlos D Figueroa; Kanti D Bhoola; Maeva del Pozo; Maria T Poblete

    2012-01-01

    AIM:TO determine the expression of HER2 and bradykinin B1 receptors (B1R) in the two pathogenic models of gallbladder cancer:the metaplasia-dysplasia-carcinoma and the adenoma-carcinoma pathways.METHODS:Receptor proteins were visualized by immunohistochemistry on 5-μm sections of paraffin-embedded tissue.Expression of both receptors was studied in biopsy samples from 92 patients (6 males and 86 females; age ranging from 28 to 86 years,mean 56 years).High HER2 expression in specimens was additionally investigated by fluorescence in situ hybridization.Cell proliferation in each sample was assessed by using the Ki-67 proliferation marker.RESULTS:HER2 receptor protein was absent in adenomas and in normal gallbladder epithelium.On the contrary,there was intense staining for HER2 on the basolateral membrane of epithelial cells of intestinal metaplasia (22/24; 91.7%) and carcinoma in situ (9/10;90%),the lesions that displayed a significantly high proliferation index.Protein up-regulation of HER2 in the epithelium with metaplasia or carcinoma in situ was not accompanied by HER2 gene amplification.A similar result was observed in invasive carcinomas (0/12).The B1R distribution pattern mirrored that of HER2 except that B1R was additionally observed in the adenomas.The B1R appeared either as cytoplasmic dots or labelingon the apical cell membrane of the cells composing the epithelia with intestinal metaplasia (24/24; 100%) and carcinoma in situ (10/10; 100%) and in the epithelial cells of adenomas.In contrast,both HER2 (4/12; 33%)and B1R (1/12; 8.3%) showed a low expression in invasive gallbladder carcinomas.CONCLUSION:The up-regulation of HER2 and B1R in precursor lesions of gallbladder carcinoma suggests cross-talk between these two receptors that may be of importance in the modulation of cell proliferation in gallbladder carcinogenesis.

  13. The value of high-resolution anoscopy in the diagnosis of anal cancer precursor lesions in hiv-positive patients

    OpenAIRE

    Felicidad Gimenez; Ivan Tramujas da Costa-e-Silva; Adriana Daumas; José Araújo; Sara Grigna Medeiros; Luiz Ferreira

    2011-01-01

    CONTEXT: Anal cancer, although a still rare disease, is being observed in ascending rates among some population segments known to be at risk for the development of the disease. Human papillomavirus (HPV) infection, immunodepression and anal intercourse are some factors associated with the development of the malignancy. Its similarities to cervical cancer have led to many studies aiming to establish guidelines for detecting and treating precursor lesions of anal cancer, with the goal of preven...

  14. The value of high-resolution anoscopy in the diagnosis of anal cancer precursor lesions in hiv-positive patients

    Directory of Open Access Journals (Sweden)

    Felicidad Gimenez

    2011-06-01

    Full Text Available CONTEXT: Anal cancer, although a still rare disease, is being observed in ascending rates among some population segments known to be at risk for the development of the disease. Human papillomavirus (HPV infection, immunodepression and anal intercourse are some factors associated with the development of the malignancy. Its similarities to cervical cancer have led to many studies aiming to establish guidelines for detecting and treating precursor lesions of anal cancer, with the goal of prevention. High-resolution anoscopy is routinely used for the diagnosis of anal cancer precursor lesions in many centers but the medical literature is still deficient concerning the role of this diagnostic modality. OBJECTIVES: To evaluate diagnostic validation and precision measures of high-resolution anoscopy in comparison to histopathological results of anal biopsies performed in HIV-positive patients treated at the Tropical Medicine Foundation of Amazonas, AM, Brazil. To observe any possible association between some risk factors for the development of anal cancer and the presence of anal squamous intraepithelial lesions. METHODS: A hundred and twenty-eight HIV-positive patients were submitted to anal canal cytological sampling for the detection of HPV infection by a PCR based method. High-resolution anoscopy was then performed after topical application of acetic acid 3% in the anal canal for 2 minutes. Eventual acetowhite lesions that were detected were recorded in respect to location, and classified by their tinctorial pattern, distribution aspect, relief, surface and vascular pattern. Biopsies of acetowhite lesions were performed under local anesthesia and the specimens sent to histopathological analysis. The patients were interviewed for the presence of anal cancer risk factors. RESULTS: The prevalences of anal HPV infection and of anal squamous intraepithelial lesions in the studied population were, respectively, 79% and 39.1%. High-resolution anoscopy

  15. Precursors and preinvasive lesions of the breast: the role of molecular prognostic markers in the diagnostic and therapeutic dilemma

    Directory of Open Access Journals (Sweden)

    Zografos George C

    2007-05-01

    Full Text Available Abstract Precursors and preinvasive lesions of the breast include atypical ductal hyperplasia (ADH, ductal carcinoma in situ (DCIS, and lobular neoplasia (LN. There is a significant debate regarding the classification, diagnosis, prognosis and management of these lesions. This review article describes the current theories regarding the pathogenesis and molecular evolution of these lesions. It reviews the implication of a variety of molecules in the continuum of breast lesions: estrogen receptors (ER-alpha and ER-beta, c-erb-B2 (Her2/neu, p53, Ki-67, bcl-2, E-cadherin, transforming growth factor-beta (TGF-beta, p27 (Kip1, p16 (INK4a, p21 (Waf1, vascular endothelial growth factor (VEGF. With respect to the aforementioned molecules, this article reviews their pathophysiological importance, and puts the stress on whether they confer additional risk for invasive breast cancer or not. This knowledge has the potential to be of importance in the therapeutic decisions presenting in the common clinical practice.

  16. Expression of p53 protein in precursor lesions and adenocarcinoma of human pancreas.

    OpenAIRE

    Boschman, C. R.; Stryker, S.; Reddy, J K; M.S. Rao

    1994-01-01

    To evaluate the incidence and stage at which p53 alterations occur in human pancreatic carcinogenesis, we examined primary and metastatic carcinomas, carcinoma in situ, and hyperplastic lesions with and without atypia for p53 protein overexpression by immunohistochemical procedure. Overexpression of p53 was observed in 40% (10/25) of primary tumors, 29% (2/7) of metastatic tumors, 36% (5/14) of carcinoma in situ, and 35% (6/17) of hyperplastic lesions. These results suggest that p53 protein o...

  17. Expression of C4.4A in precursor lesions of pulmonary adenocarcinoma and squamous cell carcinoma

    DEFF Research Database (Denmark)

    Jacobsen, Benedikte; Santoni-Rugiu, Eric; Illemann, Martin;

    2012-01-01

    in precursor lesions of lung squamous cell carcinoma and adenocarcinoma was investigated by stainings with a specific anti-C4.4A antibody. In the transformation from normal bronchial epithelium to squamous cell carcinoma, C4.4A was weakly expressed in basal cell hyperplasia but dramatically increased...... in squamous metaplasia. This was confined to the cell membrane and sustained in dysplasia, carcinoma in situ, and the invasive carcinoma. The induction of C4.4A already at the stage of hyperplasia could indicate that it is a marker of very early squamous differentiation, which aligns well with our...... earlier finding that C4.4A expression levels do not provide prognostic information on the survival of squamous cell carcinoma patients. In the progression from normal alveolar epithelium to peripheral adenocarcinoma, we observed an unexpected, distinct cytoplasmic staining for C4.4A in a fraction of...

  18. Adrenal Medullary Hyperplasia Is a Precursor Lesion for Pheochromocytoma in MEN2 Syndrome

    Directory of Open Access Journals (Sweden)

    Esther Korpershoek

    2014-10-01

    Full Text Available Adrenal medullary hyperplasias (AMHs are adrenal medullary proliferations with a size <1 cm, while larger lesions are considered as pheochromocytoma (PCC. This arbitrary distinction has been proposed decades ago, although the biological relationship between AMH and PCC has never been investigated. Both lesions are frequently diagnosed in multiple endocrine neoplasia type 2 (MEN2 patients in whom they are considered as two unrelated clinical entities. In this study, we investigated the molecular relationship between AMH and PCC in MEN2 patients. Molecular aberrations of 19 AMHs and 13 PCCs from 18 MEN2 patients were determined by rearranged during transfection (RET proto-oncogene mutation analysis and loss of heterozygosity (LOH analysis for chromosomal regions 1p13, 1p36, 3p, and 3q, genomic areas covering commonly altered regions in RET-related PCC. Identical molecular aberrations were found in all AMHs and PCCs, at similar frequencies. LOH was seen for chromosomes 1p13 in 8 of 18 (44%, 1p36 in 9 of 15 (60%, 3p12-13 in 12 of 18 (67%, and 3q23-24 in 10 of 16 (63% of AMHs, and for chromosome 1p13 in 13 of 13 (100%, 1p36 in 7 of 11 (64%, 3p12-13 in 4 of 11 (36%, and 3q23-24 in 11 of 12 (92% of PCCs. Our results indicate that AMHs are not hyperplasias and, in clinical practice, should be regarded as PCCs, which has an impact on diagnosis and treatment of MEN2 patients. We therefore propose to replace the term AMH by micro-PCC to indicate adrenal medullary proliferations of less than 1 cm.

  19. Comedo-DCIS is a precursor lesion for basal-like breast carcinoma: identification of a novel p63/Her2/neu expressing subgroup

    OpenAIRE

    Shekhar, Malathy P. V.; Kato, Ikuko; Nangia-Makker, Pratima; Tait, Larry

    2013-01-01

    Basal breast cancer comprises ~15% of invasive ductal breast cancers, and presents as high-grade lesions with aggressive clinical behavior. Basal breast carcinomas express p63 and cytokeratin 5 (CK5) antigens characteristic of the myoepithelial lineage, and typically lack Her2/neu and hormone receptor expression. However, there is limited data about the precursor lesions from which they emerge. Here we wished to determine whether comedo-ductal carcinoma in situ (comedo-DCIS), a high-risk in s...

  20. Squamous precursor lesions of the vulva: current classification and diagnostic challenges.

    Science.gov (United States)

    Hoang, Lien N; Park, Kay J; Soslow, Robert A; Murali, Rajmohan

    2016-06-01

    Growing evidence has established two major types of vulvar intraepithelial neoplasia (VIN), which correspond to two distinct oncogenic pathways to vulvar squamous cell carcinoma (VSCC). While the incidence of VSCC has remained relatively stable over the last three decades, the incidence of VIN has increased. VIN of usual type (uVIN) is human papillomavirus (HPV)-driven, affects younger women and is a multicentric disease. In contrast, VIN of differentiated type (dVIN) occurs in post-menopausal women and develops independent of HPV infection. dVIN often arises in a background of lichen sclerosus and chronic inflammatory dermatoses. Although isolated dVIN is significantly less common than uVIN, dVIN bears a greater risk for malignant transformation to VSCC and progresses over a shorter time interval. On histological examination, uVIN displays conspicuous architectural and cytological abnormalities, while the morphological features that characterise dVIN are much more subtle and raise a wide differential diagnosis. On the molecular level, dVIN is characterised by a higher number of somatic mutations, particularly in TP53. Here we review the classification, epidemiology, clinical features, histomorphology, ancillary markers and molecular genetics of both types of VIN, and discuss the morphological challenges faced by pathologists in interpreting these lesions. PMID:27113549

  1. Detection of serous precursor lesions in resected fallopian tubes from patients with benign diseases and a relatively low risk for ovarian cancer.

    Science.gov (United States)

    Nishida, Naoyo; Murakami, Fumihiro; Higaki, Koichi

    2016-06-01

    The frequency of ovarian cancers in Japan has increased; however, doubts have been raised concerning the mechanism by which high-grade serous adenocarcinomas (HGSCs) arise. Conventionally, HGSC is thought to originate from the ovarian surface epithelium or epithelial inclusion cyst. However, recent data indicate that HGSCs may in fact develop from precursor lesions in the fallopian tube, including epithelia with a p53 signature, serous tubal intraepithelial carcinomas (STICs), secretory cell outgrowths (SCOUTs), and tubal intraepithelial lesions in transition (TILT). Here, we determined the frequency of these fallopian tube precursors in surgically excised samples from 123 patients with benign pelvic diseases. We identified 12 cases with a p53 signature (9.7%), 26 with observable SCOUTs (21.1%), and 4 with TILT (3.2%), but no STIC cases. Although the lifetime risk for developing ovarian cancer is only around 1.4% for women without germ-line mutations, it is important to evaluate the presence of precursor lesions to understand HGSC pathogenesis better. Taken together, salpingectomy appears to be an option for women who are past their childbearing age and plan to undergo elective pelvic surgery. To our knowledge, this is the first study to investigate the presence of these specific precursors post-salpingectomy in low-risk patients. PMID:27250113

  2. Prognostic significance of DNA repair proteins MLH1, MSH2 and MGMT expression in non-small-cell lung cancer and precursor lesions

    OpenAIRE

    Cooper, W. A.; Kohonen-Corish, M R J; Chan, C; Kwun, S Y; McCaughan, B; Kennedy, C; Sutherland, R.L.; Lee, C-S.

    2008-01-01

    Aims To investigate the role of DNA repair proteins and their prognostic significance in non-small-cell lung cancer (NSCLC). Methods and results A retrospective analysis of 108 cases of stage I–II NSCLC was undertaken. Immunohistochemical expression of DNA repair proteins MLH1, MSH2 and MGMT was assessed using tissue microarrays of paraffin-embedded samples of invasive carcinoma and precursor lesions. Results were analysed in relation to clinicopathological parameters and patient survival. Re...

  3. Neuroanatomical localization and quantification of amyloid precursor protein mRNA by in situ hybridization in the brains of normal, aneuploid, and lesioned mice

    International Nuclear Information System (INIS)

    Amyloid precursor protein mRNA was localized in frozen sections from normal and experimentally lesioned adult mouse brain and from normal and aneuploid fetal mouse brain by in situ hybridization with a 35S-labeled mouse cDNA probe. The highest levels of hybridization in adult brain were associated with neurons, primarily in telencephalic structures. The dense labeling associated with hippocampal pyramidal cells was reduced significantly when the cells were eliminated by injection of the neurotoxin ibotenic acid but was not affected when electrolytic lesions were placed in the medial septum. Since the gene encoding amyloid precursor protein has been localized to mouse chromosome 16, the authors also examined the expression of this gene in the brains of mouse embryos with trisomy 16 and trisomy 19 at 15 days of gestation. RNA gel blot analysis and in situ hybridization showed a marked increase in amyloid precursor protein mRNA in the trisomy 16 mouse head and brain when compared with euploid littermates or with trisomy 19 mice

  4. Low NKp30, NKp46 and NKG2D expression and reduced cytotoxic activity on NK cells in cervical cancer and precursor lesions

    Directory of Open Access Journals (Sweden)

    Bravo-Cuellar Alejandro

    2009-06-01

    Full Text Available Abstract Background Persistent high risk HPV infection can lead to cervical cancer, the second most common malignant tumor in women worldwide. NK cells play a crucial role against tumors and virus-infected cells through a fine balance between activating and inhibitory receptors. Expression of triggering receptors NKp30, NKp44, NKp46 and NKG2D on NK cells correlates with cytolytic activity against tumor cells, but these receptors have not been studied in cervical cancer and precursor lesions. The aim of the present work was to study NKp30, NKp46, NKG2D, NKp80 and 2B4 expression in NK cells from patients with cervical cancer and precursor lesions, in the context of HPV infection. Methods NKp30, NKp46, NKG2D, NKp80 and 2B4 expression was analyzed by flow cytometry on NK cells from 59 patients with cervical cancer and squamous intraepithelial lesions. NK cell cytotoxicity was evaluated in a 4 hour CFSE/7-AAD flow cytometry assay. HPV types were identified by PCR assays. Results We report here for the first time that NK cell-activating receptors NKp30 and NKp46 are significantly down-regulated in cervical cancer and high grade squamous intraepithelial lesion (HGSIL patients. NCRs down-regulation correlated with low cytolytic activity, HPV-16 infection and clinical stage. NKG2D was also down-regulated in cervical cancer patients. Conclusion Our results suggest that NKp30, NKp46 and NKG2D down-regulation represent an evasion mechanism associated to low NK cell activity, HPV-16 infection and cervical cancer progression.

  5. Low NKp30, NKp46 and NKG2D expression and reduced cytotoxic activity on NK cells in cervical cancer and precursor lesions

    International Nuclear Information System (INIS)

    Persistent high risk HPV infection can lead to cervical cancer, the second most common malignant tumor in women worldwide. NK cells play a crucial role against tumors and virus-infected cells through a fine balance between activating and inhibitory receptors. Expression of triggering receptors NKp30, NKp44, NKp46 and NKG2D on NK cells correlates with cytolytic activity against tumor cells, but these receptors have not been studied in cervical cancer and precursor lesions. The aim of the present work was to study NKp30, NKp46, NKG2D, NKp80 and 2B4 expression in NK cells from patients with cervical cancer and precursor lesions, in the context of HPV infection. NKp30, NKp46, NKG2D, NKp80 and 2B4 expression was analyzed by flow cytometry on NK cells from 59 patients with cervical cancer and squamous intraepithelial lesions. NK cell cytotoxicity was evaluated in a 4 hour CFSE/7-AAD flow cytometry assay. HPV types were identified by PCR assays. We report here for the first time that NK cell-activating receptors NKp30 and NKp46 are significantly down-regulated in cervical cancer and high grade squamous intraepithelial lesion (HGSIL) patients. NCRs down-regulation correlated with low cytolytic activity, HPV-16 infection and clinical stage. NKG2D was also down-regulated in cervical cancer patients. Our results suggest that NKp30, NKp46 and NKG2D down-regulation represent an evasion mechanism associated to low NK cell activity, HPV-16 infection and cervical cancer progression

  6. Differentiating laryngeal carcinomas from precursor lesions by diffusion-weighted magnetic resonance imaging at 3.0 T: a preliminary study.

    Directory of Open Access Journals (Sweden)

    De-Sheng Shang

    Full Text Available BACKGROUND: Diffusion-weighted magnetic resonance imaging (DWI has been introduced in head and neck cancers. Due to limitations in the performance of laryngeal DWI, including the complex anatomical structure of the larynx leading to susceptibility effects, the value of DWI in differentiating benign from malignant laryngeal lesions has largely been ignored. We assessed whether a threshold for the apparent diffusion coefficient (ADC was useful in differentiating preoperative laryngeal carcinomas from precursor lesions by turbo spin-echo (TSE DWI and 3.0-T magnetic resonance. METHODS: We evaluated DWI and the ADC value in 33 pathologically proven laryngeal carcinomas and 17 precancerous lesions. RESULTS: The sensitivity, specificity, and accuracy were 81.8%, 64.7%, 76.0% by laryngostroboscopy, respectively. The sensitivity, specificity, and accuracy of conventional magnetic resonance imaging were 90.9%, 76.5%, 86.0%, respectively. Qualitative DWI analysis produced sensitivity, specificity, and accuracy values of 100.0, 88.2, and 96.0%, respectively. The ADC values were lower for patients with laryngeal carcinoma (mean 1.195±0.32×10(-3 mm(2/s versus those with laryngeal precancerous lesions (mean 1.780±0.32×10(-3 mm(2/s; P<0.001. ROC analysis showed that the area under the curve was 0.956 and the optimum threshold for the ADC was 1.455×10(-3 mm(2/s, resulting in a sensitivity of 94.1%, a specificity of 90.9%, and an accuracy of 92.9%. CONCLUSIONS: Despite some limitations, including the small number of laryngeal carcinomas included, DWI may detect changes in tumor size and shape before they are visible by laryngostroboscopy. The ADC values were lower for patients with laryngeal carcinoma than for those with laryngeal precancerous lesions. The proposed cutoff for the ADC may help distinguish laryngeal carcinomas from laryngeal precancerous lesions.

  7. Mutagens, N-nitroso compounds and their precursors in gastric juice from patients with and without precancerous lesions of the stomach.

    Science.gov (United States)

    Pignatelli, B; Malaveille, C; Rogatko, A; Hautefeuille, A; Thuillier, P; Muñoz, N; Moulinier, B; Berger, F; De Montclos, H; Lambert, R

    1993-01-01

    This study examined whether elevated risk of gastric cancer is associated with high levels of total N-nitroso compounds (NOC), their precursors and nitrosation-dependent genotoxins in gastric juice (GJ). An improved method for quantifying total NOC was used and genotoxicity was assayed in E. coli. Results from patients (n = 210) with or without precancerous lesions of the stomach and living in three areas with up to 8-fold variations in gastric cancer risk (U.K., France, Colombia) were compared. The level of nitrite (range 4 and highest in samples from Colombia. The results (a) provide no support that intragastric total NOC levels are elevated in subjects with precancerous stomach lesions or living in a high risk area for stomach cancer; (b) confirm that a high nitrite level and elevated pH in GJ are strongly associated, the level of nitrite being associated with precancerous stomach conditions only in Colombia; (c) reveal the presence of precursor compounds in GJ, that after nitrosation yield direct mutagens that probably contain NOC and other substances. As their concentrations were significantly higher in achlorhydric subjects and highest in Colombian patients, these data together provide support for a role of intragastrically formed nitrite-derived direct mutagens in gastric cancer aetiology. PMID:8280498

  8. Bone marrow abnormalities and early bone lesions in multiple myeloma and its precursor disease: a prospective study using functional and morphologic imaging.

    Science.gov (United States)

    Bhutani, Manisha; Turkbey, Baris; Tan, Esther; Korde, Neha; Kwok, Mary; Manasanch, Elisabet E; Tageja, Nishant; Mailankody, Sham; Roschewski, Mark; Mulquin, Marcia; Carpenter, Ashley; Lamping, Elizabeth; Minter, Alex R; Weiss, Brendan M; Mena, Esther; Lindenberg, Liza; Calvo, Katherine R; Maric, Irina; Usmani, Saad Z; Choyke, Peter L; Kurdziel, Karen; Landgren, Ola

    2016-05-01

    The incidence and importance of bone marrow involvement and/or early bone lesions in multiple myeloma (MM) precursor diseases is largely unknown. This study prospectively compared the sensitivity of several imaging modalities in monoclonal gammopathy of undetermined significance (MGUS), smoldering multiple myeloma (SMM) and MM. Thirty patients (10 each with MGUS, SMM and MM) were evaluated with skeletal survey, [(18)F]FDG-PET/CT, [(18)F]NaF-PET/CT and morphologic dynamic contrast enhanced (DCE)-MRI. An additional 16 SMM patients had skeletal surveys and FDG-PET/CT. Among MGUS patients, DCE-MRI found only one focal marrow abnormality; other evaluations were negative. Among 26 SMM patients, five (19%) were re-classified as MM based on lytic bone lesions on CT and six had unifocal or diffuse marrow abnormality. Among MM, marrow abnormalities were observed on FDG-PET/CT in 8/10 patients and on DCE-MRI in nine evaluable patients. Abnormal NaF uptake was observed only in MM patients with lytic lesions on CT, providing no additional clinical information. PMID:26690712

  9. HPV16-E2 induces prophase arrest and activates the cellular DNA damage response in vitro and in precursor lesions of cervical carcinoma.

    Science.gov (United States)

    Xue, Yuezhen; Toh, Shen Yon; He, Pingping; Lim, Thimothy; Lim, Diana; Pang, Chai Ling; Abastado, Jean-Pierre; Thierry, Françoise

    2015-10-27

    Cervical intraepithelial neoplasia (CIN) is caused by human papillomavirus (HPV) infection and is the precursor to cervical carcinoma. The completion of the HPV productive life cycle depends on the expression of viral proteins which further determines the severity of the cervical neoplasia. Initiation of the viral productive replication requires expression of the E2 viral protein that cooperates with the E1 viral DNA helicase. A decrease in the viral DNA replication ability and increase in the severity of cervical neoplasia is accompanied by simultaneous elevated expression of E6 and E7 oncoproteins. Here we reveal a novel and important role for the HPV16-E2 protein in controlling host cell cycle during malignant transformation. We showed that cells expressing HPV16-E2 in vitro are arrested in prophase alongside activation of a sustained DDR signal. We uncovered evidence that HPV16-E2 protein is present in vivo in cells that express both mitotic and DDR signals specifically in CIN3 lesions, immediate precursors of cancer, suggesting that E2 may be one of the drivers of genomic instability and carcinogenesis in vivo. PMID:26474276

  10. Hsp90 in the continuum of breast ductal carcinogenesis: Evaluation in precursors, preinvasive and ductal carcinoma lesions

    International Nuclear Information System (INIS)

    Hsp90 (heat shock protein90) is a chaperone protein essential for preserving and regulating the function of various cellular proteins. Elevated Hsp90 expression seems to be a trait of breast cancer and may be an integral part of the coping mechanisms that cancer cells exhibit vis-à-vis stress. This manuscript tries to examine the immunohistochemical expression of Hsp90 all along the continuum of breast ductal lesions encompassing ductal hyperplasia without atypia (DHWithoutA), atypical ductal hyperplasia (ADH), ductal carcinoma in situ (DCIS) and invasive ductal carcinoma (IDC). Tissue specimens were taken from 30 patients with DHWithoutA, 31 patients with ADH, 51 with DCIS and 51 with IDC. Immunohistochemical assessment of Hsp90 was performed both in the lesion and the adjacent normal breast ducts and lobules; the latter serving as control. Concerning Hsp90 assessment the percentage of positive cells and the intensity were separately analyzed. Subsequently, the Allred score was calculated. Post hoc analysis on the correlations between Hsp90 Allred score and possible predictors (grade, nodal status, tumor size, ER Allred score, PR Allred score, c-erbB-2 status and triple negative status) was conducted in IDC. Hsp90 exhibited mainly cytoplasmic immunoreactivity. Hsp90 Allred score exhibited an increasing trend along the continuum of breast ductal lesions (Spearman's rho = 0.169, p = 0.031). Compared to the adjacent normal ducts and lobules, no statistically significant differences were noted in DHwithoutA, ADH and DCIS. Hsp90 expression (intensity, positive cells, Allred score) was higher in IDC, compared to the adjacent normal tissue. Higher Hsp90 expression was observed in grade 2/3 IDCs (borderline association) and tumors of larger size. At the univariable analysis, higher Hsp90 expression was associated with higher ER Allred score, PR Allred score and c-erbB-2 positivity in IDC. Triple-negative IDCs exhibited significantly lower Hsp90 expression. The

  11. Hsp90 in the continuum of breast ductal carcinogenesis: Evaluation in precursors, preinvasive and ductal carcinoma lesions

    Directory of Open Access Journals (Sweden)

    Patsouris Effstratios

    2010-07-01

    Full Text Available Abstract Background Hsp90 (heat shock protein90 is a chaperone protein essential for preserving and regulating the function of various cellular proteins. Elevated Hsp90 expression seems to be a trait of breast cancer and may be an integral part of the coping mechanisms that cancer cells exhibit vis-à-vis stress. This manuscript tries to examine the immunohistochemical expression of Hsp90 all along the continuum of breast ductal lesions encompassing ductal hyperplasia without atypia (DHWithoutA, atypical ductal hyperplasia (ADH, ductal carcinoma in situ (DCIS and invasive ductal carcinoma (IDC. Methods Tissue specimens were taken from 30 patients with DHWithoutA, 31 patients with ADH, 51 with DCIS and 51 with IDC. Immunohistochemical assessment of Hsp90 was performed both in the lesion and the adjacent normal breast ducts and lobules; the latter serving as control. Concerning Hsp90 assessment the percentage of positive cells and the intensity were separately analyzed. Subsequently, the Allred score was calculated. Post hoc analysis on the correlations between Hsp90 Allred score and possible predictors (grade, nodal status, tumor size, ER Allred score, PR Allred score, c-erbB-2 status and triple negative status was conducted in IDC. Results Hsp90 exhibited mainly cytoplasmic immunoreactivity. Hsp90 Allred score exhibited an increasing trend along the continuum of breast ductal lesions (Spearman's rho = 0.169, p = 0.031. Compared to the adjacent normal ducts and lobules, no statistically significant differences were noted in DHwithoutA, ADH and DCIS. Hsp90 expression (intensity, positive cells, Allred score was higher in IDC, compared to the adjacent normal tissue. Higher Hsp90 expression was observed in grade 2/3 IDCs (borderline association and tumors of larger size. At the univariable analysis, higher Hsp90 expression was associated with higher ER Allred score, PR Allred score and c-erbB-2 positivity in IDC. Triple-negative IDCs exhibited

  12. MALDI Mass Spectrometry Imaging Reveals Decreased CK5 Levels in Vulvar Squamous Cell Carcinomas Compared to the Precursor Lesion Differentiated Vulvar Intraepithelial Neoplasia.

    Science.gov (United States)

    Zhang, Chao; Arentz, Georgia; Winderbaum, Lyron; Lokman, Noor A; Klingler-Hoffmann, Manuela; Mittal, Parul; Carter, Christopher; Oehler, Martin K; Hoffmann, Peter

    2016-01-01

    Vulvar cancer is the fourth most common gynecological cancer worldwide. However, limited studies have been completed on the molecular characterization of vulvar squamous cell carcinoma resulting in a poor understanding of the disease initiation and progression. Analysis and early detection of the precursor lesion of HPV-independent vulvar squamous cell carcinoma (VSCC), differentiated vulvar intraepithelial neoplasia (dVIN), is of great importance given dVIN lesions have a high level of malignant potential. Here we present an examination of adjacent normal vulvar epithelium, dVIN, and VSCC from six patients by peptide Matrix-assisted laser desorption/ionization Mass Spectrometry Imaging (MALDI-MSI). The results reveal the differential expression of multiple peptides from the protein cytokeratin 5 (CK5) across the three vulvar tissue types. The difference observed in the relative abundance of CK5 by MALDI-MSI between the healthy epithelium, dVIN, and VSCC was further analyzed by immunohistochemistry (IHC) in tissue from eight VSCC patients. A decrease in CK5 immunostaining was observed in the VSCC compared to the healthy epithelium and dVIN. These results provide an insight into the molecular fingerprint of the vulvar intraepithelial neoplasia that appears to be more closely related to the healthy epithelium than the VSCC. PMID:27399691

  13. MALDI Mass Spectrometry Imaging Reveals Decreased CK5 Levels in Vulvar Squamous Cell Carcinomas Compared to the Precursor Lesion Differentiated Vulvar Intraepithelial Neoplasia

    Directory of Open Access Journals (Sweden)

    Chao Zhang

    2016-07-01

    Full Text Available Vulvar cancer is the fourth most common gynecological cancer worldwide. However, limited studies have been completed on the molecular characterization of vulvar squamous cell carcinoma resulting in a poor understanding of the disease initiation and progression. Analysis and early detection of the precursor lesion of HPV-independent vulvar squamous cell carcinoma (VSCC, differentiated vulvar intraepithelial neoplasia (dVIN, is of great importance given dVIN lesions have a high level of malignant potential. Here we present an examination of adjacent normal vulvar epithelium, dVIN, and VSCC from six patients by peptide Matrix-assisted laser desorption/ionization Mass Spectrometry Imaging (MALDI-MSI. The results reveal the differential expression of multiple peptides from the protein cytokeratin 5 (CK5 across the three vulvar tissue types. The difference observed in the relative abundance of CK5 by MALDI-MSI between the healthy epithelium, dVIN, and VSCC was further analyzed by immunohistochemistry (IHC in tissue from eight VSCC patients. A decrease in CK5 immunostaining was observed in the VSCC compared to the healthy epithelium and dVIN. These results provide an insight into the molecular fingerprint of the vulvar intraepithelial neoplasia that appears to be more closely related to the healthy epithelium than the VSCC.

  14. Quality of life in women with cervical precursor lesions and cancer:a prospective, 6-month, hospital-based study in China

    Institute of Scientific and Technical Information of China (English)

    Zhi-Mei Zhao; Xiong-Fei Pan; Si-Han Lv; Yao Xie; Shao-Kai Zhang; You-Lin Qiao; Xiao-Rong Qi; Chun-Xia Yang; Fang-Hui Zhao

    2014-01-01

    The overal survival of patients with cervical cancer has improved due to detection at an early stage and availability of comprehensive treatments in China. As patients’ lives prolonged, it is important to understand their health-related quality of life (QoL) during and after treatment. We used the EQ-5D questionnaire to assess QoL of 194 patients with cervical lesions at Sichuan University West China Second Hospital between May 2010 and January 2011. Patients were surveyed before primary treatment and at 1, 3, and 6 months after primary treatment. Results showed a consistent decline in EQ-5D scores in the spectrum of cervical lesions at each time point after treatment (alP < 0.05). For patients with precursor lesions, there was an increasing trend along the timeline of treatment (P < 0.01). For patients with early-stage cervical cancer, EQ-5D scores declined in the first month (P = 0.01) and gradualy increased to higher levels at 6 months post-treatment than those before treatment (P < 0.01). EQ-5D scores followed a similar trend in patients with advanced cervical cancer (P = 0.04), though they did not statisticaly rebound after 6 months (0.84± 0.19 vs. 0.86± 0.11,P = 0.62). Regarding advanced cervical cancer, EQ-5D scores for women above 40 years of age appeared to recover more rapidly and reached higher levels than those for women below 40 years (P = 0.03). Caution and extra care are recommended in the early period of cervical cancer treatment given the slight deterioration in the QoL, and in particular, for younger cervical cancer patients. Our study implies that health care providers may need to improve the health-related QoL of cervical cancer patients.

  15. N-nitroso compounds, genotoxins and their precursors in gastric juice from humans with and without precancerous lesions of the stomach.

    Science.gov (United States)

    Pignatelli, B; Malaveille, C; Chen, C; Hautefeuille, A; Thuillier, P; Muñoz, N; Moulinier, B; Berger, F; De Montclos, H; Ohshima, H

    1991-01-01

    We are investigating the interrelationships between levels of total N-nitroso compounds (NOC), genotoxic activity (both before and after nitrosation), degree of bacterial colonization in gastric juice and degree of severity or absence of precancerous lesions of the stomach. The mean level of constitutive total NOC in gastric juice was similar in the different groups of patients, but it was higher in acidic gastric juice (n = 30) than in gastric juice at pH greater than 4.5 (n = 12). Acid-catalysed nitrosation of gastric juice in vitro increased the concentration of total NOC by up to several thousand fold, to a maximum of 1330 mumol/l. Genotoxicity, expressed as SOS-inducing potency per 100 microliters of gastric juice was measurable in only 20% of gastric juice samples tested. After acid-catalysed nitrosation, however, all samples showed genotoxic activity, the mean SOS-inducing potency being four to seven times greater than the corresponding constitutive value. There was no association between the mean SOS-inducing potency of gastric juice and the severity of precancerous lesions. The mean SOS-inducing potency of neutral or basic gastric juice was slightly greater than that of acidic samples. In a kinetic study on N-nitrosation of gastric juice in vitro, a mixture of amino and amido substrates was nitrosated; both qualitative and quantitative individual differences in nitrosatable substrates in gastric juice were seen. Fractionation of acidic, neutral and basic nitrosated gastric juice samples revealed a preponderance of nonvolatile, unknown NOC with varying polarities. The results of our study suggest that only pH determines the nature and level of precursors of NOC and of nitrosation-dependent genotoxins in gastric juice. PMID:1855844

  16. HPV16-E2 induces prophase arrest and activates the cellular DNA damage response in vitro and in precursor lesions of cervical carcinoma

    OpenAIRE

    Xue, Yuezhen; Toh, Shen Yon; He, Pingping; Lim, Thimothy; Lim, Diana; Pang, Chai Ling; Abastado, Jean-Pierre; Thierry, Françoise

    2015-01-01

    Cervical intraepithelial neoplasia (CIN) is caused by human papillomavirus (HPV) infection and is the precursor to cervical carcinoma. The completion of the HPV productive life cycle depends on the expression of viral proteins which further determines the severity of the cervical neoplasia. Initiation of the viral productive replication requires expression of the E2 viral protein that cooperates with the E1 viral DNA helicase. A decrease in the viral DNA replication ability and increase in th...

  17. Augmented serum level of major histocompatibility complex class I-related chain A (MICA) protein and reduced NKG2D expression on NK and T cells in patients with cervical cancer and precursor lesions

    International Nuclear Information System (INIS)

    Cervical cancer is the second most common cancer in women worldwide. NK and cytotoxic T cells play an important role in the elimination of virus-infected and tumor cells through NKG2D activating receptors, which can promote the lysis of target cells by binding to the major histocompatibility complex class I-related chain A (MICA) proteins. Increased serum levels of MICA have been found in patients with epithelial tumors. The aim of this study was to compare the levels of soluble MICA (sMICA) and NKG2D-expressing NK and T cells in blood samples from patients with cervical cancer or precursor lesions with those from healthy donors. Peripheral blood with or without heparin was collected to obtain mononuclear cells or sera, respectively. Serum sMICA levels were measured by ELISA and NKG2D-expressing immune cells were analyzed by flow cytometry. Also, a correlation analysis was performed to associate sMICA levels with either NKG2D expression or with the stage of the lesion. Significant amounts of sMICA were detected in sera from nearly all patients. We found a decrease in the number of NKG2D-expressing NK and T cells in both cervical cancer and lesion groups when compared to healthy donors. Pearson analysis showed a negative correlation between sMICA and NKG2D-expressing T cells; however, we did not find a significant correlation when the analysis was applied to sMICA and NKG2D expression on NK cells. Our results show for the first time that high sMICA levels are found in sera from patients with both cervical cancer and precursor lesions when compared with healthy donors. We also observed a diminution in the number of NKG2D-expressing NK and T cells in the patient samples; however, a significant negative correlation between sMICA and NKG2D expression was only seen in T cells

  18. CpG Methylation Analysis of HPV16 in Laser Capture Microdissected Archival Tissue and Whole Tissue Sections from High Grade Anal Squamous Intraepithelial Lesions: A Potential Disease Biomarker

    Science.gov (United States)

    Molano, Monica; Tabrizi, Sepehr N.; Garland, Suzanne M.; Roberts, Jennifer M.; Machalek, Dorothy A.; Phillips, Samuel; Chandler, David; Hillman, Richard J.; Grulich, Andrew E.; Jin, Fengyi; Poynten, I. Mary; Templeton, David J.; Cornall, Alyssa M.

    2016-01-01

    Incidence and mortality rates of anal cancer are increasing globally. More than 90% of anal squamous cell carcinomas (ASCC) are associated with human papillomavirus (HPV). Studies on HPV-related anogenital lesions have shown that patterns of methylation of viral and cellular DNA targets could potentially be developed as disease biomarkers. Lesion-specific DNA isolated from formalin-fixed paraffin-embedded (FFPE) tissues from existing or prospective patient cohorts may constitute a valuable resource for methylation analysis. However, low concentrations of DNA make these samples technically challenging to analyse using existing methods. We therefore set out to develop a sensitive and reproducible nested PCR-pyrosequencing based method to accurately quantify methylation at 10 CpG sites within the E2BS1, E2BS2,3,4 and Sp1 binding sites in the viral upstream regulatory region of HPV16 genome. Methylation analyses using primary and nested PCR-pyrosequencing on 52 FFPE tissue [26 paired whole tissue sections (WTS) and laser capture microdissected (LCM) tissues] from patients with anal squamous intraepithelial lesions was performed. Using nested PCR, methylation results were obtained for the E2BS1, E2BS2,3,4 and Sp1 binding sites in 86.4% of the WTS and 81.8% of the LCM samples. Methylation patterns were strongly correlated within median values of matched pairs of WTS and LCM sections, but overall methylation was higher in LCM samples at different CpG sites. High grade lesions showed low methylation levels in the E2BS1 and E2BS2 regions, with increased methylation detected in the E2BS,3,4/Sp1 regions, showing the highest methylation at CpG site 37. The method developed is highly sensitive in samples with low amounts of DNA and demonstrated to be suitable for archival samples. Our data shows a possible role of specific methylation in the HPV16 URR for detection of HSIL. PMID:27529629

  19. CpG Methylation Analysis of HPV16 in Laser Capture Microdissected Archival Tissue and Whole Tissue Sections from High Grade Anal Squamous Intraepithelial Lesions: A Potential Disease Biomarker.

    Science.gov (United States)

    Molano, Monica; Tabrizi, Sepehr N; Garland, Suzanne M; Roberts, Jennifer M; Machalek, Dorothy A; Phillips, Samuel; Chandler, David; Hillman, Richard J; Grulich, Andrew E; Jin, Fengyi; Poynten, I Mary; Templeton, David J; Cornall, Alyssa M

    2016-01-01

    Incidence and mortality rates of anal cancer are increasing globally. More than 90% of anal squamous cell carcinomas (ASCC) are associated with human papillomavirus (HPV). Studies on HPV-related anogenital lesions have shown that patterns of methylation of viral and cellular DNA targets could potentially be developed as disease biomarkers. Lesion-specific DNA isolated from formalin-fixed paraffin-embedded (FFPE) tissues from existing or prospective patient cohorts may constitute a valuable resource for methylation analysis. However, low concentrations of DNA make these samples technically challenging to analyse using existing methods. We therefore set out to develop a sensitive and reproducible nested PCR-pyrosequencing based method to accurately quantify methylation at 10 CpG sites within the E2BS1, E2BS2,3,4 and Sp1 binding sites in the viral upstream regulatory region of HPV16 genome. Methylation analyses using primary and nested PCR-pyrosequencing on 52 FFPE tissue [26 paired whole tissue sections (WTS) and laser capture microdissected (LCM) tissues] from patients with anal squamous intraepithelial lesions was performed. Using nested PCR, methylation results were obtained for the E2BS1, E2BS2,3,4 and Sp1 binding sites in 86.4% of the WTS and 81.8% of the LCM samples. Methylation patterns were strongly correlated within median values of matched pairs of WTS and LCM sections, but overall methylation was higher in LCM samples at different CpG sites. High grade lesions showed low methylation levels in the E2BS1 and E2BS2 regions, with increased methylation detected in the E2BS,3,4/Sp1 regions, showing the highest methylation at CpG site 37. The method developed is highly sensitive in samples with low amounts of DNA and demonstrated to be suitable for archival samples. Our data shows a possible role of specific methylation in the HPV16 URR for detection of HSIL. PMID:27529629

  20. Archiving challenges

    OpenAIRE

    Ringersma, J.

    2010-01-01

    Teaching slides on: What is a digital archive? Parties involved in digital archiving Archiving challenges organization of data coherence and persistency access and safety Language archiving software Different users, different needs For: Saami Language Documentation and Revitalization. Winter school, Bodø, Norway

  1. Gaia archive

    CERN Document Server

    Hypki, Arkadiusz

    2016-01-01

    The Gaia archive is being designed and implemented by the DPAC Consortium. The purpose of the archive is to maximize the scientific exploitation of the Gaia data by the astronomical community. Thus, it is crucial to gather and discuss with the community the features of the Gaia archive as much as possible. It is especially important from the point of view of the GENIUS project to gather the feedback and potential use cases for the archive. This paper presents very briefly the general ideas behind the Gaia archive and presents which tools are already provided to the community.

  2. Archiving Websites

    DEFF Research Database (Denmark)

    Brügger, Niels

    This book treats the micro archiving of websites, i.e. archiving by researchers, students or others without special technical knowledge who, using a standard computer, wish to save a website for further study. The phenomenon is discussed from the standpoint that Internet research must be able...... is reached. Firstly, unlike other well-known media, the Internet does not simply exist in a form suited to being archived, but rather is first formed as an object of study in the archiving, and it is formed differently depending on who does the archiving, when, and for what purpose. Secondly, this means...... that there is an element of subjective creation in the archived material, so that methodical deliberations are necessary — in other words, the answers to why and how the archived material has been created. These conclusions form the starting point for the last section of the book, which, based on comprehensive tests...

  3. Benign Lesions of The Vocal Fold

    Directory of Open Access Journals (Sweden)

    Ozgur Surmelioglu

    2013-02-01

    Full Text Available Benign lesions of vocal folds are common disorders. Fifty percent of patients who have sound complaints are found to have these lesions after endoscopic and stroboscopic examinations. Benign vocal fold diseases are primarily caused by vibratory trauma. However they may also occur as a result of viral infections and congenital causes. These lesions are often presented with the complaints of dysphonia. [Archives Medical Review Journal 2013; 22(1.000: 86-95

  4. Thermoset precursor

    International Nuclear Information System (INIS)

    This invention pertains to a distinctive thermoset precursor which is prepared by mixing a resin composition (A) which can be hardened by ionizing radiation, and a resin composition (B) which can be hardened by heat but cannot be hardened by, or is resistant to, ionizing radiation, and by coating or impregnating a molding or other substrate with a sheet or film of this mixture and irradiating this with an ionizing radiation. The principal components of composition (A) and (B) can be the following: (1) an acrylate or methacrylate and an epoxy resin and an epoxy resin hardener; (2) an unsaturated polyester resin and epoxy resin and an epoxy resin hardener; (3) a diacrylate or dimethacrylate or polyethylene glycol and an epoxy resin; (4) an epoxy acrylates or epoxy methacrylate obtained by the addition reaction of epoxy resin and acrylic or methacrylic acid

  5. Reproducibilidad del diagnóstico histopatológico de lesiones precursoras del carcinoma gástrico en tres países latinoamericanos Reproducibility of histopathologic diagnosis of precursor lesions of gastric carcinoma in three Latin American countries

    Directory of Open Access Journals (Sweden)

    Elena Kasamatsu

    2010-10-01

    Full Text Available Objetivo. Evaluar la concordancia en el diagnóstico de lesiones precursoras del carcinoma gástrico de tipo intestinal entre observadores con diferente experiencia. Material y métodos. Se estudiaron 1 056 casos de biopsias gástricas: 341 de Colombia, 382 de México y 333 de Paraguay. En el diagnóstico de cada caso participaron patólogos sin experiencia en patología gastrointestinal (A, patólogos con experiencia en patología gastrointestinal (B y expertos que trabajan en un centro de referencia internacional (C. Resultados. La concordancia (k entre patólogos inexpertos y expertos fue pobre en el diagnóstico de gastritis atrófica (k=0.04 a 0.12 y displasia (k=0.11 a 0.05 y buena en el diagnóstico de metaplasia intestinal (k=0.52 a 0.58; la supervisión de un patólogo inexperto por un experto mejoró notablemente la concordancia en el diagnóstico de gastritis atrófica (k=0.65 y metaplasia intestinal (k=0.91 y, en un menor grado, de displasia (k=0.28. Al comparar la concordancia entre expertos antes y después de la reunión de consenso no hubo variación en el diagnóstico de gastritis atrófica (k=0.57; la concordancia varió de buena a excelente en el de metaplasia intestinal (k=0.67 a 0.81 y de pobre a buena en el de displasia (k=0.18 a 0.66. Conclusión. Los principales problemas se presentan en el diagnóstico de la gastritis crónica atrófica y la displasia. La concordancia interobservador depende de la experiencia del observador y la lectura de consenso.Objective. The aim was to evaluate the concordance in the diagnosis of precursor lesions of intestinal-type gastric carcinoma among observers with different levels of experience. Material and Methods. Gastric biopsies from 1 056 cases were studied: 341 from Colombia, 382 from Mexico, and 333 from Paraguay. Pathologists without experience (A and with experience (B in gastrointestinal pathology, as well as experts working in an international reference center (C participated in

  6. Archival Descriptions from the National Archives Catalog

    Data.gov (United States)

    National Archives and Records Administration — Archival Descriptions from the National Archives Catalog data set provides archival descriptions of the permanent holdings of the federal government in the custody...

  7. Visualizing archives: Spanish archives map

    OpenAIRE

    Colmenero-Ruiz, María-Jesús

    2016-01-01

    The 2014/2015 academic year was the first to be taught the Master in Archives, Records Management and Digital Continuity at the University Carlos III Madrid, based on a blended learning model of attendance. This article describes the implementation of a visualization project based on geolocation of Spanish archives and its justification. The project arose from an optional practice proposed to the students of the subject “Re-use of data and documents” of this master course. This subject is opt...

  8. Archival Research Catalog (ARC) Archival Descriptions

    Data.gov (United States)

    National Archives and Records Administration — The Archival Research Catalog (ARC) data set provides archival descriptions of the permanent holdings of the federal government in the custody of the National...

  9. Lesões precursoras do câncer cervicouterino: evolução histórica e subsídios para consulta de enfermagem ginecológica Lesiones precursoras del cáncer cervical-útero: evolución histórica consolidando la consulta de enfermería ginecológica Cervical-uterine cancer precursor lesions: historical evolution supporting the gynecological nursing consultation

    Directory of Open Access Journals (Sweden)

    Maria Cristina de Melo Pessanha Carvalho

    2010-09-01

    ácticas de consulta de enfermería ginecológica con abordajes educativas, contemplando la población femenina en acciones preventivas y incentivo al tratamiento.Study emerged from an article of the master degree that illustrates the phases of the historical evolution of the precursor lesions of the cervical-uterine cancer. Thus, it is a question of the history about, delineating the relevance of this knowledge for the nurse's practice in care in the woman's health. The precursor lesions concept of the cervical-uterine cancer, initiates itself from the XIX century, beginning with studies of the cells altered. It had as objective: describe the diverse historical phases of the cervical-uterine cancer. A qualitative, descriptive-analytical study, using time cutting in the period of 1940 to 2008. The data were raised by means of bibliographical reference as primary spring and about the resource BIREME, By means of this study was possible to score the different classifications that already existed, highlighting the Brazilian Nomenclature was important to correspond the needs and the profile of the health of the women of Brazil. This study is the starting point to support the gynecological nursing consultation practices with educational approaches, contemplating the female population in preventive actions and incentive to the treatment.

  10. Rastreamento de lesões precursoras do carcinoma espino-celular anal em indivíduos portadores do HIV Tracking precursor lesions of anal squamous cell carcinoma in individuals with HIV

    Directory of Open Access Journals (Sweden)

    Caio Sergio Rizkallah Nahas

    2011-06-01

    ,000 inhabitants. METHODS: Was performed literature review in consultation with periodic Medline / Pubmed, Lilacs and Scielo crossing Trackingm, Precancerous conditions, Anus neoplasms and HIV descriptors. Besides the review,was added to this work the authors'personal experiences, and obtained at the Department of Gastroenterology - Surgical Division, in ICESP - Cancer Institute of the State of São Paulo Octavio Frias de Oliveira, in Department of Diseases Infectious - House of AIDS and in the Department of Coloproctology, Hospital das Clinicas, University of São Paulo, Brazil. CONCLUSIONS: HIV + is a major risk factor in developing squamous cell carcinoma anal in individuals infected with HPV. The evaluation of these patients should not restrict itself to the eradication of warts, but mainly include the screening of subclinical dysplastic lesions potentially neoplastic. Despite the screening methods are still not ideal, the great benefit of screening is based on the fact offer closely monitored, making possible the prevention or detection of increasingly early anal squamous cell carcinoma.

  11. Influência da adequabilidade da amostra sobre a detecção das lesões precursoras do câncer cervical Influence of adequacy of the sample on detection of the precursor lesions of the cervical cancer

    Directory of Open Access Journals (Sweden)

    Rita Goreti Amaral

    2008-11-01

    Full Text Available OBJETIVO: avaliar se a adequabilidade da amostra influencia na detecção das lesões precursoras do câncer do colo do útero. MÉTODOS: este foi um estudo de corte transversal, realizado no período de Janeiro de 2004 a Dezembro de 2005. Foram incluídos 10.951 resultados de exames citopatológicos cervicais, tendo como base usuárias do Sistema Único de Saúde de Goiânia, Goiás. Essas mulheres procuraram, espontaneamente, os serviços do Programa Saúde da Família ou Unidades Básicas de Saúde. A coleta foi feita por médicos e enfermeiros por meio da técnica convencional para rastreamento de câncer do colo do útero. Os esfregaços analisados foram classificados de acordo com o Sistema Bethesda, sendo a adequabilidade da amostra definida durante o escrutínio de rotina e categorizada como: satisfatória; satisfatória, porém apresentando fatores que prejudicam parcialmente a análise; e insatisfatória. Os resultados obtidos foram armazenados no programa Epi-Info 3.3.2. Para a comparação entre os resultados alterados e a adequabilidade da amostra dos esfregaços citopatológicos utilizou-se o teste do χ2. Foram consideradas significantes as diferenças em que a probabilidade de rejeição da hipótese de nulidade foi menor que 5% (pPURPOSE: to evaluate whether the sample adequacy influences the detection of precursor cervical cancer lesions. METHODS: a transversal study from January 2004 to December 2005. A number of 10,951 results of cervical cytotopathological exams from users of the National Health System (Sistema Único de Saúde, SUS in Goiânia, Goiás , Brazil, was studied. These women had spontaneously looked for the services from the Family Health Program or from the Basic Units of Health. Samples were collected by medical doctors and nurses, through the conventional technique to detect cervical cancer. The analyzed smears were classified by the Bethesda System, the sample adequacy being defined along the routine

  12. Molecular imaging in myeloma precursor disease

    OpenAIRE

    Mena, E.; Choyke, P; Tan, E; Landgren, O; Kurdziel, K

    2011-01-01

    Multiple myeloma (MM) is consistently preceded by its pre-malignant states, monoclonal gammopathy of undetermined significance (MGUS) and/or smoldering multiple myeloma (SMM). By definition, precursor conditions do not exhibit end-organ disease (anemia, hypercalcemia, renal failure, skeletal lytic lesions, or a combination of these). However, new imaging methods are demonstrating that some patients in the MGUS or SNM category are exhibiting early signs of MM.

  13. Performing Archives/Archives of Performance

    DEFF Research Database (Denmark)

    Performing Archives/Archives of Performance contributes to the ongoing critical discussions of performance and its disappearance, of the ephemeral and its reproduction, of archives and mediatized recordings of liveness. The many contributions by excellent scholars and artists from a broad range...... of interdisciplinary fields as well as from various locations in research geographies demonstrate that despite the extensive discourse on the relationship between performance and the archive, inquiry into the productive tensions between ephemerality and permanence is by no means outdated or exhausted. New ways...... of understanding archives, history, and memory emerge and address theories of enactment and intervention, while concepts of performance constantly proliferate and enable a critical focus on archival residue. The contributions in Performing Archives/Archives of Performance cover philosophical inquiries as well...

  14. [Presentation of the Lunar Precursor Robotics Program

    Science.gov (United States)

    Lavoie, Anthony R.

    2008-01-01

    The Lunar Precursor Robotics Program (LPRP) is the host program for the Exploration Systems Mission Directorate's (ESMD) lunar robotic precursor missions to the Moon. The program includes two missions, the Lunar Reconnaissance Orbiter (LRO), and the Lunar CRater Observation and Sensing Satellite (LCROSS). Both missions will provide the required lunar information to support development and operations of those systems required for Human lunar return. LPRP is developing a lunar mapping plan, Called the Lunar Mapping and Modeling Project, to create the capability to archive and present all data from LRO, LCROSS, historical lunar missions, and international lunar missions for future mission planning and operations. LPRP is also developing its educational and public outreach activities for the Vision for Space Exploration's first missions. LPRP is working closely with the Science Mission Directorate as their lunar activities come into focus.

  15. Clinical and biological significance of precursor lesions of intrahepatic cholangiocarcinoma

    OpenAIRE

    Ettel, Mark; Eze, Ogechukwu; Xu, Ruliang

    2015-01-01

    Cholangiocarcinoma (CC) is primarily a malignant tumor of older adults most prevalent in Southeast Asia, where liver fluke infestation is high. However the etiology in western countries is unknown. Although the incidence of extrahepatic cholangiocarcinoma has remained constant, incidence of intrahepatic CC (ICC) which differs in morphology, pathogenesis, risk factors, treatment and prognosis is increasing. While this increase is associated with hepatitis C virus infection, chronic nonalcoholi...

  16. Adenocarcinoma of the Uterine Cervix and its Precursor Lesion

    NARCIS (Netherlands)

    A. Baalbergen (Astrid)

    2014-01-01

    markdownabstract__Abstract__ More than 2000 years have elapsed since the first description of cervical cancer by Hippocrates. Aretaeus, an ancient Greek physician practicing in the first century before Christ, described uterine cancer as superficial and deep ulcers, which later infiltrate the uteru

  17. Reference Services in Archives.

    Science.gov (United States)

    Whalen, Lucille; And Others

    1986-01-01

    This 16-article issue focuses on history, policy, services, users, organization, evaluation, and automation of the archival reference process. Collections at academic research libraries, a technical university, Board of Education, business archives, a bank, labor and urban archives, a manuscript repository, religious archives, and regional history…

  18. Archives and the computer

    CERN Document Server

    Cook, Michael Garnet

    1980-01-01

    Archives and the Computer deals with the use of the computer and its systems and programs in archiving data and other related materials. The book covers topics such as the scope of automated systems in archives; systems for records management, archival description, and retrieval; and machine-readable archives. The book also features examples of systems for records management from different institutions such as theTyne and Wear Archive Department, Dyfed Record Office, and the University of Liverpool. Included in the last part are appendices. Appendix A is a directory of archival systems, Appen

  19. Archives and the computer

    CERN Document Server

    Cook, Michael Garnet

    1986-01-01

    Archives and the Computer deals with the use of the computer and its systems and programs in archiving data and other related materials. The book covers topics such as the scope of automated systems in archives; systems for records management, archival description, and retrieval; and machine-readable archives. The selection also features examples of archives from different institutions such as the University of Liverpool, Berkshire County Record Office, and the National Maritime Museum.The text is recommended for archivists who would like to know more about the use of computers in archiving of

  20. National Archives Catalog and API

    Data.gov (United States)

    National Archives and Records Administration — The National Archives Catalog is the online catalog of NARA's nationwide holdings in the Washington, DC area, Regional Archives, and Presidential Libraries.

  1. Earthquakes: hydrogeochemical precursors

    Science.gov (United States)

    Ingebritsen, Steven E.; Manga, Michael

    2014-01-01

    Earthquake prediction is a long-sought goal. Changes in groundwater chemistry before earthquakes in Iceland highlight a potential hydrogeochemical precursor, but such signals must be evaluated in the context of long-term, multiparametric data sets.

  2. The Dora Lange Archive

    DEFF Research Database (Denmark)

    Holm, Isak Winkel; Bjering, Jens Christian Borrebye

    2016-01-01

    The first season of Nic Pizzolatto's True Detective (2014) is not only a show about a murder, but also a show about how to gather and organize information in an archive. Having identified two archival problems—its temporal and topical extension—the article turns to Jacques Derrida's Archive Fever......: a Freudian Impression in order to explain how the archiving problems of the crime investigation are, in fact, intrinsic to any archiving practice. Lastly, the article addresses the political significance of the show's archiving problems by help of Derrida's text on the American Constitution and of Hardt...

  3. Archives Library Information Center

    Data.gov (United States)

    National Archives and Records Administration — ALIC is an online library catalog of books, periodicals, and other materials contained in Archives I and II and book collections located in other facilities.

  4. MAGE-A antigens in lesions of the oral mucosa.

    Science.gov (United States)

    Krauss, Eva; Rauthe, Stephan; Gattenlöhner, Stefan; Reuther, Tobias; Kochel, Michael; Kriegebaum, Ulrike; Kübler, Alexander C; Müller-Richter, Urs D A

    2011-06-01

    Oral squamous cell carcinoma develops continuously out of predamaged oral mucosa. For the physician and pathologist, difficulties arise in distinguishing precancerous from cancerous lesions. MAGE-A antigens are tumor antigens that are found solely in malignant transformed cells. These antigens might be useful in distinguishing precancerous from cancerous lesions. The aim of this study was to verify this assumption by comparing MAGE-A expression in benign, precancerous, and cancerous lesions of the oral mucosa. Retrospectively, biopsies of different oral lesions were randomly selected. The lesions that were included are 64 benign oral lesions (25 traumatic lesions (oral ulcers), 13 dental follicles, and 26 epulis), 26 oral lichen planus, 123 epithelial precursor lesions (32 epithelial hyperplasia found in leukoplakias, 24 epithelial dysplasia found in leukoplakias, 26 erythroplasia with oral epithelial dysplasia, and 41 carcinomas in situ in erythroleukoplakias). The lesions were immunohistochemically stained with the poly-MAGE-A antibody 57B, and the results were compared. Biopsies of oral lichen planus, oral ulcers, dental follicles, epulis, and leukoplakia without dysplasia showed no positive staining for MAGE-A antigens. Leukoplakia with dysplasia, dysplasia, and carcinomata in situ displayed positive staining in 33%, 65%, and 56% of the cases, respectively. MAGE-A antigens were not detectable via immunohistochemistry in benign lesions of the oral mucosa. The staining rate of dysplastic precancerous lesions or malignant lesions ranged from 33% to 65%. The MAGE-A antigens might facilitate better differentiation between precancerous and cancerous lesions of the oral mucosa. PMID:20174843

  5. My Dream Archive

    Science.gov (United States)

    Phelps, Christopher

    2007-01-01

    In this article, the author shares his experience as he traveled from island to island with a single objective--to reach the archives. He found out that not all archives are the same. In recent months, his daydreaming in various facilities has yielded a recurrent question on what would constitute the Ideal Archive. What follows, in no particular…

  6. Calorimeter Process Variable Archiving

    Energy Technology Data Exchange (ETDEWEB)

    Huffman, David; /Fermilab

    2002-01-14

    These steps were taken to maintain weekly archives: (1) Friday morning you stop the archiver and wait for it to finish writing data (the lock file will be removed from the directory); (2) move the current archive information to a PC via FTP; (3) remove all previous archive information in the previous directory; (4) move the current archive into the previous directory; (5) start a new archive; (6) burn a CDROM of the archive; and (7) copy the current archive to a specific directory. There are 2 ways to check if the Calorimeter Archiver is running, either through the WEB based front end or directly from a command line. Once the archiver is running it can be monitored from a WEB page. This only works with a browser launched from the online machine running the archiver. Each time the browser is reloaded there should be an update reported in the last write check field. You might have to wait a few minutes to see the update. Calorimetry currently takes readings every (300 sec.) 5 minutes. The second method to verify the archiver is running is to issue a command from a Linux cluster machine.

  7. Untangling ENSO Precursors

    Science.gov (United States)

    Pegion, K.; Alexander, M. A.

    2014-12-01

    There are several proposed precursors to the El Nino-Southern Oscillation (ENSO) that may provide the ability to predict ENSO as much as one year in advance. Some of these precursors are associated with stochastic forcing from extratropical atmospheric variability. Two examples are the seasonal footprinting mechanism (SFM) and the Pacific meridional mode (PMM). Both of these ENSO precursors are thought to be forced by the North Pacific Oscillation (NPO), a north-south sea level pressure dipole in the north Pacific. Additionally, both the PMM and SFM are thought to impact the tropics through wind evaporation SST feedbacks and have a correlation with ENSO up to one year in advance. These two precursors are discussed interchangeably throughout the literature and various indices used to define them co-mingle them. As a result, whether they are independent of each other or are part of the same process has not been investigated. The research presented is focused on untangling the relationship between the PMM, SFM, NPO, and ENSO using observational datasets and model simulations. Observational results demonstrate that these two mechanisms are different, are forced by different atmospheric circulations, and result in different manifestations of ENSO. Modeling results highlight the extent to which climate models can simulate these relationships and their impact on the simulation of ENSO.

  8. Introduction: Consider the Archive.

    Science.gov (United States)

    Yale, Elizabeth

    2016-03-01

    In recent years, historians of archives have paid increasingly careful attention to the development of state, colonial, religious, and corporate archives in the early modern period, arguing that power (of various kinds) was mediated and extended through material writing practices in and around archives. The history of early modern science, likewise, has tracked the production of scientific knowledge through the inscription and circulation of written records within and between laboratories, libraries, homes, and public spaces, such as coffeehouses and bookshops. This Focus section interrogates these two bodies of scholarship against each other. The contributors ask how archival digitization is transforming historical practice; how awareness of archival histories can help us to reconceptualize our work as historians of science; how an archive's layered purposes, built up over centuries of record keeping, can shape the historical narratives we write; and how scientific knowledge emerging from archives gained authority and authenticity. PMID:27197412

  9. The EM Earthquake Precursor

    Science.gov (United States)

    Jones, K. B., II; Saxton, P. T.

    2013-12-01

    Many attempts have been made to determine a sound forecasting method regarding earthquakes and warn the public in turn. Presently, the animal kingdom leads the precursor list alluding to a transmission related source. By applying the animal-based model to an electromagnetic (EM) wave model, various hypotheses were formed, but the most interesting one required the use of a magnetometer with a differing design and geometry. To date, numerous, high-end magnetometers have been in use in close proximity to fault zones for potential earthquake forecasting; however, something is still amiss. The problem still resides with what exactly is forecastable and the investigating direction of EM. After the 1989 Loma Prieta Earthquake, American earthquake investigators predetermined magnetometer use and a minimum earthquake magnitude necessary for EM detection. This action was set in motion, due to the extensive damage incurred and public outrage concerning earthquake forecasting; however, the magnetometers employed, grounded or buried, are completely subject to static and electric fields and have yet to correlate to an identifiable precursor. Secondly, there is neither a networked array for finding any epicentral locations, nor have there been any attempts to find even one. This methodology needs dismissal, because it is overly complicated, subject to continuous change, and provides no response time. As for the minimum magnitude threshold, which was set at M5, this is simply higher than what modern technological advances have gained. Detection can now be achieved at approximately M1, which greatly improves forecasting chances. A propagating precursor has now been detected in both the field and laboratory. Field antenna testing conducted outside the NE Texas town of Timpson in February, 2013, detected three strong EM sources along with numerous weaker signals. The antenna had mobility, and observations were noted for recurrence, duration, and frequency response. Next, two

  10. Periodontal bone lesions

    International Nuclear Information System (INIS)

    In the course of life the periodontum is subject to changes which may be physiological or pathological. Intraoral radiographs give insight into the hard structures of the dentomaxillar region and provides information on lesions in the bone of the periodontum in that they show radiopacities and radiolucencies caused by such lesions. In this thesis the relation is investigated between the true shape and dimensions of periodontal bone lesions and their radiographic images. A method is developed and tested of making standardized and reproducible radiographs suitable for longitudinal studies of periodontal lesions. Also the possibility is demonstrated of an objective and reproducible interpretation of radiographic characteristics of periodontal bone lesions. (Auth.)

  11. 宫颈鳞癌演进过程P16INK4a及Hh-Gli信号通路相关蛋白表达及其相关性研究%Involvement of P16INK4a and Sonic Hedgehog Signaling Pathways in Squamous Cell Carcinoma of Uterine Cervix and Its Precursor Lesions

    Institute of Scientific and Technical Information of China (English)

    苗劲蔚; 张永清; 徐春玉; 房纯; 邓小虹

    2012-01-01

    To investigate the expression and the relationship of P16INK4a and sonic hedgehog signal pathway in cervical squamous cell carcinoma and its precursor lesions. The expression of P16INK4a, Smo, Ptch and Gli in different HPV types positive cell lines were detected by Western-blot. A tissue microarray constructed with 20 normal cervical tissues and 100 uterine cervical cancers and related lesions (28 squamous cell carcinomas, 26 cervical intraepithelial neoplasia (CIN) Ⅲ, 16 CIN Ⅱ , 12 CIN Ⅰ , 18 tumor-adjacent tissue specimens) was immunohistochemically analyzed with anti- P16INK4a, Shh, Patched (Ptch), Smoothened (Smo), Gli antibodies. The correlation between their expressions was analyzed. There was no significant difference among different HPV type cell lines regarding the expression of P16INK4a and Shh, Ptch and Gli proteins(P > 0.05). The expression of P16INK4a and the Hh-signaling molecules was greatly enhanced in cervical carcinoma tissues, compared with that in normal epithelium and tumor-adjacent tissues (P 0.05), whereas, in case of P16INK4a, Shh, Smo, and Gli, the differences among CIN Ⅰ , CIN Ⅱ and CIN Ⅲ were significant (P < 0.05). The expression of P16INK4a protein was significantly correlated with that of Shh, Smo and Gli protein in CIN Ⅱ -CIN Ⅲ and cervical carcinoma and was correlated with that of Shh, Smo only in carcinoma tissue. P16INK4a and the Hh-Gli signaling pathways were extensively activated in the development and evolution of cervical cancer, and the overexpression of P16INK4a was correlated with Hh-signaling pathways. The abnormal Hh-signaling pathways maybe much associated with Smo protein overexpression induced by Shh, which can upregulate the expression of Gli protein.%探讨P16INK4a及Sonic hedgehog (Hh-Gli)信号通路蛋白在宫颈癌及癌前病变(CIN)中的表达相关性及其意义.采用Western-blot方法检测HPV16阳性及HPV18阳性宫颈癌细胞系P16INK4a及Hh-Gli信号通路蛋白Smo、Ptch及Gli表达.

  12. Data Archive Project

    OpenAIRE

    Kemppainen, Timo-Pekka

    2015-01-01

    In the modern world, digital data archiving and accessing is an issue that needs tailored solutions. This thesis gives one example of designing and implementing a data archiving solution using time tested technologies. Helsinki Metropolia University of Applied Sciences had a need to archive their contracts in digital format instead of using old file cabinets. Specifications were created together with the customer at the start of the project. The project was to produce a complete product fo...

  13. Nearline Web Archiving

    OpenAIRE

    Xie, Zhiwu; Nayyar, Krati; Fox, Edward A

    2016-01-01

    In this paper, we propose a modified approach to real­time transactional web archiving. It leverages the web caching infrastructure that is already prevalent on web servers. Instead of archiving web content at HTTP transaction time, in our approach the archiving happens when the cached copy expires and is about to be expunged. Before the deletion, all expired cache copies are combined and then sent to the web archive in small batches. Since the cache is purged at much lower frequency than HTT...

  14. The GTC Public Archive

    Science.gov (United States)

    Alacid, J. Manuel; Solano, Enrique

    2015-12-01

    The Gran Telescopio Canarias (GTC) archive is operational since November 2011. The archive, maintained by the Data Archive Unit at CAB in the framework of the Spanish Virtual Observatory project, provides access to both raw and science ready data and has been designed in compliance with the standards defined by the International Virtual Observatory Alliance (IVOA) to guarantee a high level of data accessibility and handling. In this presentation I will describe the main capabilities the GTC archive offers to the community, in terms of functionalities and data collections, to carry out an efficient scientific exploitation of GTC data.

  15. Inventing the Archive

    DEFF Research Database (Denmark)

    Eskildsen, Kasper Risbjerg

    2013-01-01

    This article investigates the emergence of the archive as the primary venue for the production of historical knowledge in the 19th century. The turn to archival research, the article argues, may be considered as a response to the discussions about the problems of testimony that dominated 18th......- and early 19th-century German writings on the methodology and epistemology of historical research. These discussions, especially regarding the epistemic virtues of witnesses, also helped create the particular culture of knowledge-making within German historical scholarship that enabled the archival turn...... of the 19th-century archival turn....

  16. Archival bone marrow samples

    DEFF Research Database (Denmark)

    Lund, Bendik; Najmi, Laeya A; Wesolowska-Andersen, Agata;

    2015-01-01

    AB Archival samples represent a significant potential for genetic studies, particularly in severe diseases with risk of lethal outcome, such as in cancer. In this pilot study, we aimed to evaluate the usability of archival bone marrow smears and biopsies for DNA extraction and purification, whole...... with samples stored for 4 to 10 years. Acceptable call rates for SNPs were detected for 7 of 42 archival samples. In conclusion, archival bone marrow samples are suitable for DNA extraction and multiple marker analysis, but WGA was less successful, especially when longer fragments were analyzed. Multiple SNP...

  17. Meteorological Archival Facility

    Data.gov (United States)

    Federal Laboratory Consortium — FUNCTION: The Bergen Data Center (BDC) provides data archival capability for meteorological and oceanographic data. DESCRIPTION: The BDC operates as a resource for...

  18. DCC Briefing Paper: Database archiving

    OpenAIRE

    Müller, Heiko

    2009-01-01

    In a computational context, data archiving refers to the storage of electronic documents, data sets, multimedia files, and so on, for a defined period of time. Database archiving is usually seen as a subset of data archiving. Database archiving focuses on archiving data that are maintained under the control of a database management system and structured under a database schema, e.g., a relational database. The primary goal of database archiving is to maintain access to data in case it is late...

  19. Unit 20 - GIS as Archives

    OpenAIRE

    Unit 03, CC in GIS; National Center for Geographic Information and Analysis (UC Santa Barbara, SUNY at Buffalo, University of Maine)

    1990-01-01

    This unit introduces the idea of a GIS database serving as a project or archive database, contrasting it with the traditional geographic archive, the map library. It discusses issues of data currency, justifying the need for digital geographic archives, suitability of data for archiving, platforms, distribution, user interface and costs vs. benefits of digital archives. It illustrates these issues with several examples of spatial data archive systems.

  20. Intraductal Proliferative Lesions of the Breast—Terminology and Biology Matter: Premalignant Lesions or Preinvasive Cancer?

    OpenAIRE

    Maria Mauri; Lucio Fortunato; Leopoldo Costarelli; Domenico Campagna

    2012-01-01

    Morphological criteria for the diagnosis of intraductal proliferative lesions of the breast have been an object of research and much controversy, and its terminology is rather confusing. Knowledge of the molecular aspects of this disease probably necessitates further research to clarify if these entities can be identified as breast cancer precursors or as a malignant preinvasive disease. These issues are of great interest not only for their biological implications, but also to the clinician w...

  1. Lesion activity assessment

    DEFF Research Database (Denmark)

    Ekstrand, K R; Zero, D T; Martignon, S;

    2009-01-01

    This chapter focusses on the probability of a caries lesion detected during a clinical examination being active (progressing) or arrested. Visual and tactile methods to assess primary coronal lesions and primary root lesions are considered. The evidence level is rated as low (R(w)), as there are...... response to cariogenic plaque as well as lesion arrest. Based on this understanding, different clinical scoring systems have been developed to assess the severity/depth and activity of lesions. A recent system has been devised by the International Caries Detection and Assessment System Committee. The...... literature suggests that there is a fair agreement between visual/tactile external scripts of caries and the severity/depth of the lesion. The reproducibility of the different systems is, in general, substantial. No single clinical predictor is able to reliably assess activity. However, a combination of...

  2. Reverse tracing of precursors and earthquake precursors in Taiwan

    Institute of Scientific and Technical Information of China (English)

    WANG Li-ping; LI Yong; MA Li; ZHANG Shu-mei

    2008-01-01

    In this paper, we investigate the precursors of large earthquakes in the eastern region of Taiwan by means of the reverse tracing of precursors. We discuss the parameters which are suitable for the seismic chains and intermedi-ate-term patterns in this region and obtain the threshold of the patterns. Applying the linear discriminate method to the intermediate-term patterns of seismic chains, we present an approach for exploring the precursors of large earthquakes. The results show that this method can reduce the false alarm rate for large earthquakes in this region, and the reverse tracing of precursors can be applied to the eastern region of Taiwan.

  3. Online archives of Science

    CERN Multimedia

    GS Department

    2009-01-01

    CERN Library has enabled till 26th June 2009 a trial access to the online archives of Science, starting in 1880. You are welcome to test this resource at http://www.sciencemag.org/archive/ Please contact mailto:Anne.Gentil-Beccot@cern.ch, for any feedback to share.

  4. Generation of nonlinear vortex precursors

    CERN Document Server

    Chen, Yue-Yue; Liu, Chengpu

    2016-01-01

    We numerically study the propagation of a few-cycle pulse carrying orbital angular momentum (OAM) through a dense atomic system. Nonlinear precursors consisting of high-order vortex har- monics are generated in the transmitted field due to ultrafast Bloch oscillation. The nonlinear precursors survive to propagation effects and are well separated with the main pulse, which provide a straightforward way of measuring precursors. By the virtue of carrying high-order OAM, the obtained vortex precursors as information carriers have potential applications in optical informa- tion and communication fields where controllable loss, large information-carrying capacity and high speed communication are required.

  5. Generation of Nonlinear Vortex Precursors

    Science.gov (United States)

    Chen, Yue-Yue; Feng, Xun-Li; Liu, Chengpu

    2016-07-01

    We numerically study the propagation of a few-cycle pulse carrying orbital angular momentum (OAM) through a dense atomic system. Nonlinear precursors consisting of high-order vortex harmonics are generated in the transmitted field due to carrier effects associated with ultrafast Bloch oscillation. The nonlinear precursors survive to propagation effects and are well separated with the main pulse, which provides a straightforward way to measure precursors. By virtue of carrying high-order OAM, the obtained vortex precursors as information carriers have potential applications in optical information and communication fields where controllable loss, large information-carrying capacity, and high speed communication are required.

  6. Differentiated vulvar intraepithelial neoplasia is often found in lesions, previously diagnosed as lichen sclerosus, which have progressed to vulvar squamous cell carcinoma

    NARCIS (Netherlands)

    van de Nieuwenhof, Hedwig P.; Bulten, Johan; Hollema, Harrie; Dommerholt, Rianne G.; Massuger, Leon F. A. G.; van der Zee, Ate G. J.; de Hullu, Joanne A.; van Kempen, Leon C. L. T.

    2011-01-01

    Lichen sclerosus is considered to be the precursor lesion of vulvar squamous cell carcinoma, of which only 2-5% progress to squamous cell carcinoma. Differentiated vulvar intraepithelial neoplasia (VIN) has been proposed to be the direct precursor lesion, but this is a recently recognized, and a dif

  7. Imaging Pediatric Vascular Lesions

    Science.gov (United States)

    Nguyen, Tuyet A.; Krakowski, Andrew C.; Naheedy, John H.; Kruk, Peter G.

    2015-01-01

    Vascular anomalies are commonly encountered in pediatric and dermatology practices. Most of these lesions are benign and easy to diagnose based on history and clinical exam alone. However, in some cases the diagnosis may not be clear. This may be of particular concern given that vascular anomalies may occasionally be associated with an underlying syndrome, congenital disease, or serious, life-threatening condition. Defining the type of vascular lesion early and correctly is particularly important to determine the optimal approach to management and treatment of each patient. The care of pediatric patients often requires collaboration from a multitude of specialties including pediatrics, dermatology, plastic surgery, radiology, ophthalmology, and neurology. Although early characterization of vascular lesions is important, consensus guidelines regarding the evaluation and imaging of vascular anomalies does not exist to date. Here, the authors provide an overview of pediatric vascular lesions, current classification systems for characterizing these lesions, the various imaging modalities available, and recommendations for appropriate imaging evaluation. PMID:26705446

  8. Imaging Pediatric Vascular Lesions.

    Science.gov (United States)

    Nguyen, Tuyet A; Krakowski, Andrew C; Naheedy, John H; Kruk, Peter G; Friedlander, Sheila Fallon

    2015-12-01

    Vascular anomalies are commonly encountered in pediatric and dermatology practices. Most of these lesions are benign and easy to diagnose based on history and clinical exam alone. However, in some cases the diagnosis may not be clear. This may be of particular concern given that vascular anomalies may occasionally be associated with an underlying syndrome, congenital disease, or serious, life-threatening condition. Defining the type of vascular lesion early and correctly is particularly important to determine the optimal approach to management and treatment of each patient. The care of pediatric patients often requires collaboration from a multitude of specialties including pediatrics, dermatology, plastic surgery, radiology, ophthalmology, and neurology. Although early characterization of vascular lesions is important, consensus guidelines regarding the evaluation and imaging of vascular anomalies does not exist to date. Here, the authors provide an overview of pediatric vascular lesions, current classification systems for characterizing these lesions, the various imaging modalities available, and recommendations for appropriate imaging evaluation. PMID:26705446

  9. Benign Proliferative Breast Lesions and Risk of Cancer

    Directory of Open Access Journals (Sweden)

    Serap Erel

    2010-06-01

    Full Text Available Benign breast lesions (BBL includes a wide variety of histologic entities, which have been broadly classified into non-proliferative lesions, proliferative lesions without atypia, and hyperplasia with atypia. With the increased use of mammography, more benign lesions are being detected, and in order to estimate the risk of breast cancer for specific histologic categories is of great importance to guide clinical management. Women with proliferative lesions without atypia are at slightly increased risk of subsequent breast cancer, whereas women with proliferative lesions with atypia have a higher risk. The risk is 1.5- 2-fold in women with proliferative lesions without atypia, 4-5-fold in women with proliferative lesions with atypia, and 8-10 fold in women with ductal carcinoma in situ. Age at diagnosis of BBL, menopausal status, family history of breast cancer in a first-degree relative, and time since BBL diagnosis on risk of breast cancer are important for risk evaluation. [Archives Medical Review Journal 2010; 19(3.000: 155-167

  10. Archiving the Relaxed Consistency Web

    OpenAIRE

    Xie, Zhiwu; Van de Sompel, Herbert; Liu, Jinyang; Van Reenen, Johann; Jordan, Ramiro

    2013-01-01

    The historical, cultural, and intellectual importance of archiving the web has been widely recognized. Today, all countries with high Internet penetration rate have established high-profile archiving initiatives to crawl and archive the fast-disappearing web content for long-term use. As web technologies evolve, established web archiving techniques face challenges. This paper focuses on the potential impact of the relaxed consistency web design on crawler driven web archiving. Relaxed consist...

  11. Reversible focal splenial lesions

    Energy Technology Data Exchange (ETDEWEB)

    Gallucci, Massimo; Limbucci, Nicola [University of L' Aquila, Department of Radiology, S. Salvatore Hospital, L' Aquila (Italy); Paonessa, Amalia [Loreto Nuovo Hospital, Department of Neuroradiology, Napoli (Italy); Caranci, Ferdinando [Federico II University, Department of Neurological Sciences, Napoli (Italy)

    2007-07-15

    Reversible focal lesions in the splenium of the corpus callosum (SCC) have recently been reported.They are circumscribed and located in the median aspect of the SCC. On MRI, they are hyperintense on T2-W and iso-hypointense on T1-W sequences, with no contrast enhancement. On DWI, SCC lesions are hyperintense with low ADC values, reflecting restricted diffusion due to cytotoxic edema. The common element is the disappearance of imaging abnormalities with time, including normalization of DWI. Clinical improvement is often reported. The most established and frequent causes of reversible focal lesions of the SCC are viral encephalitis, antiepileptic drug toxicity/withdrawal and hypoglycemic encephalopathy. Many other causes have been reported, including traumatic axonal injury. The similar clinical and imaging features suggest a common mechanism induced by different pathological events leading to the same results. Edema and diffusion restriction in focal reversible lesions of the SCC have been attributed to excitotoxic mechanisms that can result from different mechanisms; no unifying relationship has been found to explain all the pathologies associated with SCC lesions. In our opinion, the similar imaging, clinical and prognostic aspects of these lesions depend on a high vulnerability of the SCC to excitotoxic edema and are less dependent on the underlying pathology. In this review, the relevant literature concerning reversible focal lesions in the SCC is analyzed and hypotheses about their pathogenesis are proposed. (orig.)

  12. Oral Lesions in Neonates

    Science.gov (United States)

    Rao, Roopa S; Majumdar, Barnali; Jafer, Mohammed; Maralingannavar, Mahesh; Sukumaran, Anil

    2016-01-01

    ABSTRACT Oral lesions in neonates represent a wide range of diseases often creating apprehension and anxiety among parents. Early examination and prompt diagnosis can aid in prudent management and serve as baseline against the future course of the disease. The present review aims to enlist and describe the diagnostic features of commonly encountered oral lesions in neonates. How to cite this article: Patil S, Rao RS, Majumdar B, Jafer M, Maralingannavar M, Sukumaran A. Oral Lesions in Neonates. Int J Clin Pediatr Dent 2016;9(2):131-138. PMID:27365934

  13. Mariner 10 Image Archive

    Data.gov (United States)

    National Aeronautics and Space Administration — The Mariner 10 Image Archive includes tools to view shaded relief maps of the surface of Mercury, a 3D globe, and all images acquired by NASA's Mariner 10 mission.

  14. Emergency_RDS_ARCHIVE

    Data.gov (United States)

    Vermont Center for Geographic Information — Archive of past 9-1-1 data releases at rough yearly intervals chosen from availbable datasets from 1999 to present. For a historical overview on the genesis of this...

  15. The Digital Archive Experience

    DEFF Research Database (Denmark)

    Søndergaard, Morten

    2009-01-01

    This article, as well as the book, investigates the ways in which new digital media may enhance the experience of the art-archive. Taken as a whole, the new media is a vital component of a 'transdisciplinary' and transformative field, a cultural landscape that is changing rapidly the conditions...... and domains of the archive and the (art)museum. How, then, should the functions and strengths of both archive and museum be shaped to meet those cultural and technological changes? When the Internet and world wide web became 'the place to be' commercially, museums followed suit and established their own sites....... The book discusses the challenges of the archive and the (art)museum in the age of digital media. It is based upon documentation from a research project, MAP - Media Art Platform, that drew upon the talents and collaboration of many institutions, artists, programmers, art historians, designers and others...

  16. Sequence Read Archive (SRA)

    Data.gov (United States)

    U.S. Department of Health & Human Services — The Sequence Read Archive (SRA) stores raw sequencing data from the next generation of sequencing platforms including Roche 454 GS System®, Illumina Genome...

  17. The Herschel Science Archive

    OpenAIRE

    Verdugo, Eva

    2015-01-01

    The Herschel mission required a Science Archive able to serve data to very different users: The own Data Analysis Software (both Pipeline and Interactive Analysis), the consortia of the different instruments and the scientific community. At the same time, the KP consortia were committed to deliver to the Herschel Science Centre,  the processed products corresponding to the data obtained as part of their Science Demonstration Phase and the Herschel Archive should include the capability to...

  18. FTP archives for physics

    International Nuclear Information System (INIS)

    We have established archives for programs, data, papers etc. in physics (mainly for plasma physics). The archives are located at computer ftp.muni.cz in the directory pub/muni.cz/physics. These archives can be reached by anonymous FTP or by gopher server gopher.muni.cz (147.251.4.33). At the present time, programs for PC, cross sections for electrons, swarm parameters and rate constants stored are in the archives. We would like to collect the programs for calculations in physics (mainly for PC). We suppose that each program should have a testing example and some description. We would also like to collect physical constants and experimental or theoretical data (e.g. cross sections, swarm parameters and rate constants), which are important for other calculation or for comparison with the results of others studies. Interested scholars are invited to sent us their programs, data, preprints and reports for these archives. All files in the archives are in public domain and can be obtained using computer network Internet

  19. Anal cancer precursor lesions in HIV-positive and HIV-negative patients seen at a tertiary health institution in Brazil Lesões precursoras do câncer anal em pacientes HIV-positivos e HIV-negativos atendidos numa instituição de saúde terciária no Brasil

    OpenAIRE

    Ivan Tramujas da Costa e Silva; José Ribamar de Araújo; Rosilene Viana de Andrade; Celso Rômulo Barbosa Cabral; Felicidad Santos Gimenez; Adriana Gonçalves Daumas Pinheiro Guimarães; Ticiane Costa Martins; Lucília Rocha Lopes; Luiz Carlos de Lima Ferreira

    2011-01-01

    Purpose: To investigate the prevalence of anal squamous intraepithelial lesions (ASIL) or anal cancer in patients attended at the Tropical Medicine Foundation of Amazonas. Methods: 344 patients consecutively attended at the institution, in 2007/2008, were distributed in the following strata according to presence/abscense of at risk conditions for anal cancer: Group 1 _ HIV-positive men-who-have-sex-with-men (101); Group 2 _ HIV-positive females (49); Group 3 _ patients without any at risk con...

  20. Managing Carious Lesions

    DEFF Research Database (Denmark)

    Schwendicke, F; Frencken, J E; Bjørndal, L;

    2016-01-01

    The International Caries Consensus Collaboration undertook a consensus process and here presents clinical recommendations for carious tissue removal and managing cavitated carious lesions, including restoration, based on texture of demineralized dentine. Dentists should manage the disease dental...... caries and control activity of existing cavitated lesions to preserve hard tissues and retain teeth long-term. Entering the restorative cycle should be avoided as far as possible. Controlling the disease in cavitated carious lesions should be attempted using methods which are aimed at biofilm removal or...... permanent teeth,selective removal to soft dentineshould be performed, although in permanent teeth,stepwise removalis an option. The evidence and, therefore, these recommendations support less invasive carious lesion management, delaying entry to, and slowing down, the restorative cycle by preserving tooth...

  1. Hypervascular liver lesions.

    Science.gov (United States)

    Kamaya, Aya; Maturen, Katherine E; Tye, Grace A; Liu, Yueyi I; Parti, Naveen N; Desser, Terry S

    2009-10-01

    Hypervascular hepatocellular lesions include both benign and malignant etiologies. In the benign category, focal nodular hyperplasia and adenoma are typically hypervascular. In addition, some regenerative nodules in cirrhosis may be hypervascular. Malignant hypervascular primary hepatocellular lesions include hepatocellular carcinoma, fibrolamellar carcinoma, and peripheral cholangiocarcinoma. Vascular liver lesions often appear hypervascular because they tend to follow the enhancement of the blood pool; these include hemangiomas, arteriovenous malformations, angiosarcomas, and peliosis. While most gastrointestinal malignancies that metastasize to the liver will appear hypovascular on arterial and portal-venous phase imaging, certain cancers such as metastatic neuroendocrine tumors (including pancreatic neuroendocrine tumors, carcinoid, and gastrointestinal stromal tumors) tend to produce hypervascular metastases due to the greater recruitment of arterial blood supply. Finally, rare hepatic lesions such as glomus tumor and inflammatory pseudotumor may have a hypervascular appearance. PMID:19842564

  2. Diffuse cavitary lung lesions

    Energy Technology Data Exchange (ETDEWEB)

    Grunzke, Mindy; Garrington, Timothy [University of Colorado Denver, Department of Pediatrics, Aurora, CO (United States); The Children' s Hospital, Rick Wilson Center for Cancer and Blood Disorders, Aurora, CO (United States); Hayes, Kari [The Children' s Hospital, Pediatric Radiology, Aurora, CO (United States); Bourland, Wendy [Children' s Hospital at St. Francis, Warren Clinic, Inc., Tulsa, OK (United States)

    2010-02-15

    An 11-year-old girl presented with a 2-month history of progressively worsening cough, daily fevers, and weight loss. A chest radiograph revealed multiple cystic cavitary lung lesions. An extensive infectious work-up was negative. Chest CT verified multiple cavitary lung lesions bilaterally, and [F-18]2-fluoro-2-deoxy-D-glucose ({sup 18}F-FDG) positron emission tomography with CT (PET/CT) showed increased uptake in the lung lesions as well as regional lymph nodes. Subsequent biopsy of an involved lymph node confirmed classical Hodgkin lymphoma, nodular sclerosis type. This case represents an unusual presentation for a child with Hodgkin lymphoma and demonstrates a role for {sup 18}F-FDG PET/CT in evaluating a child with cavitary lung lesions. (orig.)

  3. Transnational archives: the Canadian case

    Directory of Open Access Journals (Sweden)

    Julia Creet

    2011-05-01

    Full Text Available This paper is a brief overview of the concept of the transnational archive as a counterpoint to the idea that a national archive is necessarily a locus of a static idea of nation. The Canadian national archives is used as a case study of an archives that was transnational in its inception, and one that has continued to change in its mandate and materials as a response to patterns in migration and changing notions of multiculturalism as a Canadian federal policy. It introduces the most recent formation of the transnational archive and its denizens: the genealogical archive inhabited by family historians.

  4. Download - KEGG MEDICUS | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...F URLs by Artio About This Database Database Description Download License Update History of This Database Site Policy | Contact Us Download - KEGG MEDICUS | LSDB Archive ...

  5. Download - TP Atlas | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...Ls by Artio About This Database Database Description Download License Update History of This Database Site Policy | Contact Us Download - TP Atlas | LSDB Archive ...

  6. Protein - AT Atlas | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...base Description Download License Update History of This Database Site Policy | Contact Us Protein - AT Atlas | LSDB Archive ...

  7. Download - RGP caps | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...atabase Description Download License Update History of This Database Site Policy | Contact Us Download - RGP caps | LSDB Archive ...

  8. Main - KOME | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ... Download License Update History of This Database Site Policy | Contact Us Main - KOME | LSDB Archive ...

  9. Download - PLACE | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ... About This Database Database Description Download License Update History of This Database Site Policy | Contact Us Download - PLACE | LSDB Archive ...

  10. Nucleotide Sequence - KOME | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...rtio About This Database Database Description Download License Update History of This Database Site Policy | Contact Us Nucleotide Sequence - KOME | LSDB Archive ...

  11. Reference - PLACE | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ... Artio About This Database Database Description Download License Update History of This Database Site Policy | Contact Us Reference - PLACE | LSDB Archive ...

  12. Download - AT Atlas | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...base Description Download License Update History of This Database Site Policy | Contact Us Download - AT Atlas | LSDB Archive ...

  13. Trimming information - KOME | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...SEF URLs by Artio About This Database Database Description Download License Update History of This Database Site Policy | Contact Us Trimming information - KOME | LSDB Archive ...

  14. Download - GETDB | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...io About This Database Database Description Download License Update History of This Database Site Policy | Contact Us Download - GETDB | LSDB Archive ...

  15. Main data - RMG | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...Description Download License Update History of This Database Site Policy | Contact Us Main data - RMG | LSDB Archive ...

  16. Experiments list - DGBY | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...This Database Database Description Download License Update History of This Database Site Policy | Contact Us Experiments list - DGBY | LSDB Archive ...

  17. Download - Plabrain DB | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us Plabrain...escription Download License Update History of This Database Site Policy | Contact Us Download - Plabrain DB | LSDB Archive ...

  18. Main - RPSD | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ... File URL: ftp://ftp.biosciencedbc.jp/archive/rpsd/LATEST/rpsd_main_sjis.zip File... size: 120 KB File name: rpsd_main_utf8.zip File URL: ftp://ftp.biosciencedbc.jp/archive/rpsd/LATEST/rpsd_ma...icense Update History of This Database Site Policy | Contact Us Main - RPSD | LSDB Archive ...

  19. Main - PLACE | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...URL: ftp://ftp.biosciencedbc.jp/archive/place/LATEST/place_main.zip File size: 48...97) Joomla SEF URLs by Artio About This Database Database Description Download License Update History of This Database Site Policy | Contact Us Main - PLACE | LSDB Archive ...

  20. Entire Sequence - RMG | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...us RAP-DB genome browser. Data file File name: rmg_seq.zip File URL: ftp://ftp.biosciencedbc.jp/archive/rmg/...n Download License Update History of This Database Site Policy | Contact Us Entire Sequence - RMG | LSDB Archive ...

  1. ORF information - KOME | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...e longest ORFs Data file File name: kome_orf_infomation.zip File URL: ftp://ftp.biosciencedbc.jp/archive/kom...e Description Download License Update History of This Database Site Policy | Contact Us ORF information - KOME | LSDB Archive ...

  2. Product annotations - KOME | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...ile name: kome_product_annotation.zip File URL: ftp://ftp.biosciencedbc.jp/archiv...ate History of This Database Site Policy | Contact Us Product annotations - KOME | LSDB Archive ...

  3. Envirion - KEGG MEDICUS | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ... file File name: kegg_medicus_environ_en.zip File URL: ftp://ftp.biosciencedbc.jp/archive/kegg-medicus/LATES...oomla SEF URLs by Artio About This Database Database Description Download License Update History of This Database Site Policy | Contact Us Envirion - KEGG MEDICUS | LSDB Archive ...

  4. Basical information - KOME | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...ation about full-length cDNA clones Data file File name: kome_basical_information.zip File URL: ftp://ftp.biosciencedbc.jp/archiv...base Database Description Download License Update History of This Database Site Policy | Contact Us Basical information - KOME | LSDB Archive ...

  5. Training in the Archives: Archival Research as Professional Development

    Science.gov (United States)

    Buehl, Jonathan; Chute, Tamar; Fields, Anne

    2012-01-01

    This article describes the rationale and efficacy of a graduate-level teaching module providing loosely structured practice with real archives. Introducing early career scholars to archival methods changed their beliefs about knowledge, research, teaching, and their discipline(s). This case study suggests that archives can be productive training…

  6. Life Sciences Data Archive (LSDA)

    Data.gov (United States)

    National Aeronautics and Space Administration — NASA's Life Sciences Data Archive (LSDA) is an active archive that provides information and data from 1961 (Mercury Project) through current flight and flight...

  7. Ten years of archival science

    NARCIS (Netherlands)

    E. Ketelaar

    2010-01-01

    This article reviews how the journal Archival Science--International Journal on Recorded Information in the first 10 years has endeavoured to be integrated, interdisciplinary, and intercultural in promoting the development of archival science as an autonomous scientific discipline.

  8. 20 Years of Archive Fever

    OpenAIRE

    Atkins, Guy; Bulley, James

    2014-01-01

    "It is what is happening, right here, when a house, the Freuds' last house, becomes a museum: the passage from one institution to another." (Jacques Derrida, 'Archive Fever') Presented as a gift to the Freud Museum, Jacques Derrida's 1994 lecture 'Archive Fever' remains a compelling work for scholars and artists interested in the relationship between archives, memory, and technology. Originally titled 'The Concept of the Archive: A Freudian Impression', Derrida's deconstruction of the...

  9. Queering archives: A roundtable discussion

    OpenAIRE

    Arondekar, A; Cvetkovich, A; Hanhardt, CB; Kunzel, R; Nyong O, T; Rodríguez, JM; Stryker, S.

    2015-01-01

    © 2015 by MARHO: The Radical Historians’ Organization, Inc. “Queering Archives: A Roundtable Discussion” provides a reflection on histories of queer archives studies, while marking out some key directions for the field's future development. As a broad conversation about the career of the queer archival, as both intellectual project and political practice, this discussion focuses on developments and limits within North American queer studies of the archive, which emerges as a central object of...

  10. Old and New Archives

    Directory of Open Access Journals (Sweden)

    Ioana Vasiloiu

    2015-01-01

    Full Text Available Library and museum archives are real testimony of collective memory. Old or new, their "universe" is fascinating. They are the path to an almost forgotten world with all its cultural and intellectual problems or allow us to reconsider the social, historical, political and cultural present. The inestimable value of their manuscripts, books and periodicals made medieval Romanian library archives to be famous in that age. Its content figured out the Romanian humanist's vast intellectual activity and their connection to European values. Their remains, which can be found today especially at Romanian Academy Library, depict some aspects of Romanian medieval cultural life. Particularly, with its huge number of manuscripts, books and periodicals, the National Romanian Literature Museum archives contribute to Romanian history reconstruction from the commencement to present.

  11. In through the Archive

    DEFF Research Database (Denmark)

    Breinbjerg, Morten; Fritsch, Jonas; Bertelsen, Olav W.

    In this paper we will present a project in which we have orchestrated a collective listening process framed around the notion of the echo - and the interactive listening machine Ekkomaten – to build a participatory sound archive that reflects people’s perceptions and imaginations of a local...... community in the city of Aarhus Denmark. The archive is seen as indicative to the rhythm and nature of the place revealing not only aspects of the lives that unfold, but also how people sense and interpret the local community through their auditory sensibility. During the project we have asked people of all...... in the area for many years. The sound material has been organized in an archive, whichis handled by custom build software (API), and accessible through a physical, designfictional machine called Ekkomaten. In the paper, we would like to discuss the project in relation to the following subjects: 1) Methodology...

  12. Lesiones deportivas Sports injuries

    OpenAIRE

    Isabel Cristina Gallego Ching; Santiago Patiño Giraldo; Elkín Arango V.; Mónica Paola Clavijo Rodríguez; Jorge Alberto Osorio Ciro

    2007-01-01

    El estrés generado por la práctica deportiva ha originado una mayor probabilidad de que los atletas presenten lesiones agudas y crónicas. En el ámbito mundial existen diferentes investigaciones acerca de la incidencia de lesiones deportivas. La comparación de sus resultados es difícil por las diferencias en las características de la población y en la forma de reportar los datos, que varía ampliamente entre los estudios (proporciones o tasas de incidencia o tasas por cada 100 ó 1.000 participa...

  13. Cultivating archives: meanings and identities

    NARCIS (Netherlands)

    E. Ketelaar

    2012-01-01

    By cultivating archives through successive activations, people and communities define their identities. In these activations, the meanings of archives are constructed and reconstructed. Archives are not a static artifact imbued with the record creator’s voice alone, but a dynamic process involving a

  14. The Ethics of Archival Research

    Science.gov (United States)

    McKee, Heidi A.; Porter, James E.

    2012-01-01

    What are the key ethical issues involved in conducting archival research? Based on examination of cases and interviews with leading archival researchers in composition, this article discusses several ethical questions and offers a heuristic to guide ethical decision making. Key to this process is recognizing the person-ness of archival materials.…

  15. Digital audiovisual archives

    CERN Document Server

    Stockinger, Peter

    2013-01-01

    Today, huge quantities of digital audiovisual resources are already available - everywhere and at any time - through Web portals, online archives and libraries, and video blogs. One central question with respect to this huge amount of audiovisual data is how they can be used in specific (social, pedagogical, etc.) contexts and what are their potential interest for target groups (communities, professionals, students, researchers, etc.).This book examines the question of the (creative) exploitation of digital audiovisual archives from a theoretical, methodological, technical and practical

  16. Costs of Archival Storage

    DEFF Research Database (Denmark)

    Nielsen, Anders Bo; Thirifays, Alex; Kejser, Ulla Bøgvad

    2012-01-01

    This paper presents an analysis of the cost of archival storage. The study is part of a project conducted by The Danish National Archives, The Royal Library, and The State and University Library to develop a generic cost model for digital preservation (CMDP). The purposes of the study were to...... determine the costs of establishing and maintaining a preservation solution destined for long-term preservation of digital materials and to develop a tool capable of doing this operation. In order to fulfill the purposes, the project employed a combination of own and external experience as well as the OAIS...

  17. Relations among traumatic subdural lesions.

    OpenAIRE

    Lee, K. S.; Doh, J. W.; Bae, H. G.; Yun, I. G.

    1996-01-01

    Acute subdural hematoma (ASDH), chronic subdural hematoma (CSDH) and subdural hygroma (SDG) occur in the subdural space, usually after trauma. We tried to find a certain relationship among these three traumatic subdural lesions in 436 consecutive patients. We included all subdural lesions regardless of whether they were main or not. We evaluated the distribution, age incidence and interval from injury to diagnosis of these lesions, and the frequency of new subdural lesions in each lesion. ASD...

  18. Genital lesions following bestiality

    OpenAIRE

    Mittal A; Shenoi Shrutakirthi; Kumar K; Sharma PS

    2000-01-01

    A 48-year-old man presented with painful genital lesions with history of bestiality and abnor-mal sexual behaviour. Examination revealed multiple irregular tender ulcers and erosions, with phimosis and left sided tender inguinal adenopathy. VDRL, TPHA, HIV-ELISA were negative. He was treated with ciprofloxacin 500mg b.d. along with saline compresses with complete resolution.

  19. Genital lesions following bestiality

    Directory of Open Access Journals (Sweden)

    Mittal A

    2000-01-01

    Full Text Available A 48-year-old man presented with painful genital lesions with history of bestiality and abnor-mal sexual behaviour. Examination revealed multiple irregular tender ulcers and erosions, with phimosis and left sided tender inguinal adenopathy. VDRL, TPHA, HIV-ELISA were negative. He was treated with ciprofloxacin 500mg b.d. along with saline compresses with complete resolution.

  20. Morel-Lavallee lesion

    Institute of Scientific and Technical Information of China (English)

    Li Hui; Zhang Fangjie; Lei Guanghua

    2014-01-01

    Objective To review current knowledge of the Morel-Lavallee lesion (MLL) to help clinicians become familiar with this entity.Familiarization may decrease missed diagnoses and misdiagnoses.It could also help steer the clinician to the proper treatment choice.Data sources A search was performed via PubMed and EMBASE from 1966 to July 2013 using the following keywords:Morel-Lavallee lesion,closed degloving injury,concealed degloving injury,Morel-Lavallee effusion,Morel-Lavallee hematoma,posttraumatic pseudocyst,posttraumatic soft tissue cyst.Study selection Chinese and English language literatures relevant to the subject were collected.Their references were also reviewed.Results Morel-Lavallee lesion is a relatively rare condition involving a closed degloving injury.It is characterized by a filled cystic cavity created by separation of the subcutaneous tissue from the underlying fascia.Apart from the classic location over the region of the greater trochanter,MLLs have been described in other parts of the body.The natural history of MLL has not yet been established.The lesion may decrease in volume,remain stable,enlarge progressively or show a recurrent pattern.Diagnosis of MLL was often missed or delayed.Ultrasonography,computed tomography,and magnetic resonance imaging have great value in the diagnosis of MLL.Treatment of MLL has included compression,local aspiration,open debridement,and sclerodesis.No standard treatment has been established.Conclusions A diagnosis of MLL should be suspected when a soft,fluctuant area of skin or chronic recurrent fluid collection is found in a region exposed to a previous shear injury.Clinicians and radiologists should be aware of both the acute and chronic appearances to make the correct diagnosis.Treatment decisions should base on association with fractures,the condition of the lesion,symptom and desire of the patient.

  1. NASA Data Archive Evaluation

    Science.gov (United States)

    Holley, Daniel C.; Haight, Kyle G.; Lindstrom, Ted

    1997-01-01

    The purpose of this study was to expose a range of naive individuals to the NASA Data Archive and to obtain feedback from them, with the goal of learning how useful people with varied backgrounds would find the Archive for research and other purposes. We processed 36 subjects in four experimental categories, designated in this report as C+R+, C+R-, C-R+ and C-R-, for computer experienced researchers, computer experienced non-researchers, non-computer experienced researchers, and non-computer experienced non-researchers, respectively. This report includes an assessment of general patterns of subject responses to the various aspects of the NASA Data Archive. Some of the aspects examined were interface-oriented, addressing such issues as whether the subject was able to locate information, figure out how to perform desired information retrieval tasks, etc. Other aspects were content-related. In doing these assessments, answers given to different questions were sometimes combined. This practice reflects the tendency of the subjects to provide answers expressing their experiences across question boundaries. Patterns of response are cross-examined by subject category in order to bring out deeper understandings of why subjects reacted the way they did to the archive. After the general assessment, there will be a more extensive summary of the replies received from the test subjects.

  2. Software Archive Related Issues

    Science.gov (United States)

    Angelini, Lorella

    2008-01-01

    With the archive opening of the major X-ray and Gamma ray missions, the school is intended to provide information on the resource available in the data archive and the public software. This talk reviews the archive content, the data format for the major active missions Chandra, XMM-Newton, Swift, RXTE, Integral and Suzaku and the available software for each of these missions. It will explain the FITS format in general and the specific layout for the most popular mission, explaining the role of keywords and how they fit in the multimission standard approach embrace by the High Energy Community. Specifically, it reviews : the difference data levels and the difference software applicable; the popular/standard method of analysis for high level products such as spectra, timing and images; the role of calibration in the multi mission approach; how to navigate the archive query databases. It will present also how the school is organized and how the information provided will be relevant to each of the afternoon science projects that will be proposed to the students and led by a project leader

  3. Open Archives Initiative

    OpenAIRE

    McMillan, Gail

    2004-01-01

    This presentation, which was given at the annual meeting of the Society of Scholarly Publishing on June 1, 2000, describes the Open Archives Initiative (OAI), a protocol for exchanging content between digital repositories. The presentation outlines OAI's history, core components, key stakeholders, and ongoing developments. Presented at the Society for Scholarly Publishing: June 1, 2000

  4. Demyelinative chiamal lesions.

    Science.gov (United States)

    Spector, R H; Glaser, J S; Schatz, N J

    1980-12-01

    To clarify the clinical syndrome of demyelinative chiasmal involvement, six case histories were analyzed and the literature was reviewed. This entitity is characterized by especial predilection for women in the third to fifth decades; visual deficites of a chiasmal pattern that may be modest to marked, with a generallly good prognosis for functional recovery; and other signs and symptoms, not necessarily severe, of scattered lesions of the neuraxis. Neuroradiological studies, especially laminography of the sellar area and computerized tomography, must be employed to rule out a suprasellar mass lesion. The efficacy of systemic corticosteroid therapy is moot, but it seems reasonable to use such agents during acute stages, especially where vision is severely reduced on both sides. PMID:7447764

  5. Trending analysis of precursor events

    International Nuclear Information System (INIS)

    The Accident Sequence Precursor (ASP) Program of United States Nuclear Regulatory Commission (U.S.NRC) identifies and categorizes operational events at nuclear power plants in terms of the potential for core damage. The ASP analysis has been performed on yearly basis and the results have been published in the annual reports. This paper describes the trends in initiating events and dominant sequences for 459 precursors identified in the ASP Program during the 1969-94 period and also discusses a comparison with dominant sequences predicted in the past Probabilistic Risk Assessment (PRA) studies. These trends were examined for three time periods, 1969-81, 1984-87 and 1988-94. Although the different models had been used in the ASP analyses for these three periods, the distribution of precursors by dominant sequences show similar trends to each other. For example, the sequences involving loss of both main and auxiliary feedwater were identified in many PWR events and those involving loss of both high and low coolant injection were found in many BWR events. Also, it was found that these dominant sequences were comparable to those determined to be dominant in the predictions by the past PRAs. As well, a list of the 459 precursors identified are provided in Appendix, indicating initiating event types, unavailable systems, dominant sequences, conditional core damage probabilities, and so on. (author)

  6. Novel Precursors for Chalcogenide Materials

    OpenAIRE

    Oyetunde, Temidayo Timothy

    2011-01-01

    The University of Manchester Temidayo Timothy Oyetunde, PhDNovel Chalcogenide Precursors for Materials2011.Abstract Metal chalcogenides (sulfides, selenides and tellurides) are materials of current interest due to their peculiar properties such as optoelectronic, magnetooptic, thermoelectric and piezoelectric displays. These semiconducting materials have potential applications in solar cell devices, infrared detectors and ambient thermoelectric generators. Previously, these materials...

  7. PAGOSA Sample Problem. Elastic Precursor

    Energy Technology Data Exchange (ETDEWEB)

    Weseloh, Wayne N. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Clancy, Sean Patrick [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2016-02-03

    A PAGOSA simulation of a flyer plate impact which produces an elastic precursor wave is examined. The simulation is compared to an analytic theory for the Mie-Grüneisen equation of state and an elastic-perfectly-plastic strength model.

  8. A retrospective analysis of thyroid lesions containing mature adipose tissue

    Directory of Open Access Journals (Sweden)

    Recep Bedir

    2014-06-01

    Full Text Available Objectives: The aim of this retrospective study was to investigate the lesions containing mature adipose tissues in surgical materials of the patients who underwent thyroidectomy operation owing to the diagnosis of nodular goiter. Methods: A total of 2800 pathologic specimens of thyroidectomies stained with hematoxylin-eosin were collected between January 2010 and November 2013 in Recep Tayyip Erdogan University School of Medicine. Pathologic sections were selected from pathology archive and re-examined. Upon examination, we determined 10 lesions with mature adipose tissue within thyroid parenchyma. Results: Thyroid lesions containing mature adipose tissue were observed in 10 (0.004 % of 2800 thyroidectomy materials. Eight of the patients were female and two of them were male. Minimum, maximum and median age of the patients were found to be 31, 74 and 52 years respectively. All of the cases had underwent a bilateral total thyroidectomy operation. In macroscopic examination of the only one cases, a homogenous yellow-gray color was observed. In other cases a large number of colloid-rich nodules of various sizes were observed. On microscopic examination, five adipose tissues in the nodules (adenolipoma-thyrolipoma, four scattered foci of mature adipose tissues (heterotopic adiposis and one diffuse infiltrating mature adipose tissue on entire thyroid gland (diffuse thyrolipomatosis were determined among mature adipose tissue containing lesions. A follicular variant of papillary microcarcinoma was found in two of thyrolipoma cases. Conclusion: Nodular thyroid lesions containing mature adipose tissue, as a result of particularly on the outer surface of the gland and parathyroid glands containining mature adipose tissue may mimic parathyroid gland lesion. Therefore, to prevent from inappropriate treatments, pathologists should be aware of these kinds of lesions, especially when they are investigating the lesions of parathyroid glands during an

  9. Asymptomatic ischemic cerebral lesions

    International Nuclear Information System (INIS)

    For the purpose of studying the incidence, pathomorphology and etiology of asymptomatic ischemic cerebral lesions, we carried out a brain MRI study on 65 patients with diabetes mellitus accompanied with hypertension who are thought to belong to a high risk group of ischemic cerebrovascular diseases. Excluding the abnormality of tendon reflex due to diabetic neuropathy, sixty percent of the total patients had some mild neurological signs and symptoms, most of them was discrepancy in tendon reflex. The percentage of the patients in whom MRI disclosed some abnormalities was as high as 70%, they were lacunar stroke, multiple lacunar state, cortical infarct, and patchy high signal lesions visible only in the T2 weighted image. Lacunes or these patchy high signal lesions (considered to be the dilatation of the perivascular space or true lacunes) tended to be found along the border zone or the terminal zone. These results indicate that asymptomatic patients in whom MRI discloses the abnormalities should be considered as candidates for the future onset of multi-infarct. (author)

  10. Atypical idiopathic inflammatory demyelinating lesions

    DEFF Research Database (Denmark)

    Wallner-Blazek, Mirja; Rovira, Alex; Fillipp, Massimo; Rocca, Mara A; Miller, Andrew David; Schmierer, Klaus; Frederiksen, Jette; Gass, Achim; Gama, Hugo; Tilbery, Charles P; Rocha, Antonio J; Flores, José; Barkhof, Frederik; Seewann, Alexandra; Palace, Jacqueline; Yousry, Tarek; Montalban, Xavier; Enzinger, Christian; Fazekas, Franz

    2013-01-01

    Atypical lesions of a presumably idiopathic inflammatory demyelinating origin present quite variably and may pose diagnostic problems. The subsequent clinical course is also uncertain. We, therefore, wanted to clarify if atypical idiopathic inflammatory demyelinating lesions (AIIDLs) can be class...

  11. Basal ganglia lesions in children and adults

    International Nuclear Information System (INIS)

    The term “basal ganglia” refers to caudate and lentiform nuclei, the latter composed of putamen and globus pallidus, substantia nigra and subthalamic nuclei and these deep gray matter structures belong to the extrapyramidal system. Many diseases may present as basal ganglia abnormalities. Magnetic resonance imaging (MRI) and computed tomography (CT) – to a lesser degree – allow for detection of basal ganglia injury. In many cases, MRI alone does not usually allow to establish diagnosis but together with the knowledge of age and circumstances of onset and clinical course of the disease is a powerful tool of differential diagnosis. The lesions may be unilateral: in Rassmussen encephalitis, diabetes with hemichorea/hemiballism and infarction or – more frequently – bilateral in many pathologic conditions. Restricted diffusion is attributable to infarction, acute hypoxic–ischemic injury, hypoglycemia, Leigh disease, encephalitis and CJD. Contrast enhancement may be seen in cases of infarction and encephalitis. T1-hyperintensity of the lesions is uncommon and may be observed unilaterally in case of hemichorea/hemiballism and bilaterally in acute asphyxia in term newborns, in hypoglycemia, NF1, Fahr disease and manganese intoxication. Decreased signal intensity on GRE/T2*-weighted images and/or SWI indicating iron, calcium or hemosiderin depositions is observed in panthotenate kinase-associated neurodegeneration, Parkinson variant of multiple system atrophy, Fahr disease (and other calcifications) as well as with the advancing age. There are a few papers in the literature reviewing basal ganglia lesions. The authors present a more detailed review with rich iconography from the own archive

  12. Basal ganglia lesions in children and adults

    Energy Technology Data Exchange (ETDEWEB)

    Bekiesinska-Figatowska, Monika, E-mail: m.figatowska@mp.pl [Department of Diagnostic Imaging, Institute of Mother and Child, ul. Kasprzaka 17a, 01-211 Warsaw (Poland); Mierzewska, Hanna, E-mail: h.mierzewska@gmail.com [Department of Neurology of Children and Adolescents, Institute of Mother and Child, ul. Kasprzaka 17a, 01-211 Warsaw (Poland); Jurkiewicz, Elżbieta, E-mail: e-jurkiewicz@o2.pl [Department of Diagnostic Imaging, Children' s Memorial Health Institute, Al. Dzieci Polskich 20, 04-730 Warsaw (Poland)

    2013-05-15

    The term “basal ganglia” refers to caudate and lentiform nuclei, the latter composed of putamen and globus pallidus, substantia nigra and subthalamic nuclei and these deep gray matter structures belong to the extrapyramidal system. Many diseases may present as basal ganglia abnormalities. Magnetic resonance imaging (MRI) and computed tomography (CT) – to a lesser degree – allow for detection of basal ganglia injury. In many cases, MRI alone does not usually allow to establish diagnosis but together with the knowledge of age and circumstances of onset and clinical course of the disease is a powerful tool of differential diagnosis. The lesions may be unilateral: in Rassmussen encephalitis, diabetes with hemichorea/hemiballism and infarction or – more frequently – bilateral in many pathologic conditions. Restricted diffusion is attributable to infarction, acute hypoxic–ischemic injury, hypoglycemia, Leigh disease, encephalitis and CJD. Contrast enhancement may be seen in cases of infarction and encephalitis. T1-hyperintensity of the lesions is uncommon and may be observed unilaterally in case of hemichorea/hemiballism and bilaterally in acute asphyxia in term newborns, in hypoglycemia, NF1, Fahr disease and manganese intoxication. Decreased signal intensity on GRE/T2*-weighted images and/or SWI indicating iron, calcium or hemosiderin depositions is observed in panthotenate kinase-associated neurodegeneration, Parkinson variant of multiple system atrophy, Fahr disease (and other calcifications) as well as with the advancing age. There are a few papers in the literature reviewing basal ganglia lesions. The authors present a more detailed review with rich iconography from the own archive.

  13. HEASARC Software Archive

    Science.gov (United States)

    White, Nicholas (Technical Monitor); Murray, Stephen S.

    2003-01-01

    (1) Chandra Archive: SAO has maintained the interfaces through which HEASARC gains access to the Chandra Data Archive. At HEASARC's request, we have implemented an anonymous ftp copy of a major part of the public archive and we keep that archive up-to- date. SAO has participated in the ADEC interoperability working group, establishing guidelines or interoperability standards and prototyping such interfaces. We have provided an NVO-based prototype interface, intending to serve the HEASARC-led NVO demo project. HEASARC's Astrobrowse interface was maintained and updated. In addition, we have participated in design discussions surrounding HEASARC's Caldb project. We have attended the HEASARC Users Group meeting and presented CDA status and developments. (2) Chandra CALDB: SA0 has maintained and expanded the Chandra CALDB by including four new data file types, defining the corresponding CALDB keyword/identification structures. We have provided CALDB upgrades for the public (CIAO) and for Standard Data Processing. Approximately 40 new files have been added to the CALDB in these version releases. There have been in the past year ten of these CALDB upgrades, each with unique index configurations. In addition, with the inputs from software, archive, and calibration scientists, as well as CIAO/SDP software developers, we have defined a generalized expansion of the existing CALDB interface and indexing structure. The purpose of this is to make the CALDB more generally applicable and useful in new and future missions that will be supported archivally by HEASARC. The generalized interface will identify additional configurational keywords and permit more extensive calibration parameter and boundary condition specifications for unique file selection. HEASARC scientists and developers from SAO and GSFC have become involved in this work, which is expected to produce a new interface for general use within the current year. (3) DS9: One of the decisions that came from last year

  14. A disappearing neonatal skin lesion.

    LENUS (Irish Health Repository)

    Hawkes, Colin Patrick

    2012-01-31

    A preterm baby girl was noted at birth to have a firm, raised, non-tender skin lesion located over her right hip. She developed three similar smaller lesions on her ear, buttock and right knee. All lesions had resolved by 2 months of age.

  15. HyperArchiver: an EPICS archiver prototype based on Hypertable

    International Nuclear Information System (INIS)

    This work started in the context of NSLS2 project at Brookhaven National Laboratory. The NSLS2 control system foresees a very high number of PV variables and has strict requirements in terms of archiving/retrieving rate: our goal was to store 10 K PV/sec and retrieve 4 K PV/sec for a group of 4 signals. The HyperArchiver is an EPICS Archiver implementation engined by Hypertable, an open source database whose internal architecture is derived from Google's Big Table. We discuss the performance of HyperArchiver and present the results of some comparative tests. (authors)

  16. Archives, Education, and Access: Learning at Interference Archive

    Directory of Open Access Journals (Sweden)

    Bonnie Gordon

    2016-07-01

    Full Text Available Archives are a tool for education and the access policy of an archive affects what kind of education takes place in its space. In this paper, we describe how Interference Archive (IA, a community archive in Brooklyn, New York, provides access through an open stacks policy and experiential learning, which allows for unique educational opportunities. These methods of providing access are intended to subvert representational power, allowing visitors, donors, and volunteers to take part in deciding how histories are told, how materials are accessed, and how the collection is re-used as a resource for learning about contemporary and historical social movements.

  17. Les archives des bagnes

    Directory of Open Access Journals (Sweden)

    Archives Nationales d’Outre-Mer

    2008-01-01

    Full Text Available Les établissements pénitentiaires coloniaux étaient administrés par le ministère de la Marine et des Colonies, puis par le ministère des Colonies (1881, en liaison avec les ministères de la Justice et de l’Intérieur. Les archives ont par conséquent été versées aux Archives nationales d’outre-mer avec le fonds du ministère des Colonies.Le fonds représente environ 760 ml (5358 articles. Il concerne presque exclusivement les bagnes de Guyane et de Nouvelle-Calédonie et couvre la période 1852-1...

  18. Surgical treatment of gallbladder polypoid lesions

    Directory of Open Access Journals (Sweden)

    Pejić Miljko A.

    2003-01-01

    with biliary colic should be managed conservatively. Cholecystectomy is also indicated in patients with large gallbladder polyps sized over 10 mm irrespective of symptomatology. In patients with gallbladder polypoid lesions smaller than 10 mm, cholecystectomy is indicated only if complicating factors are present, e.g., age over 50 years and coexistence of gallstones. If the gallbladder polyp is smaller than 10 mm and complicating factors are absent, the "watch-and-wait" strategy seems to be recommendable. CONCLUSION Although gallbladder polyps are rare, they represent a significant health problem because they may be a precursor to gallbladder cancer. On the basis of the available data, and the results that we have gained in our study we suggest that gallbladder should be extirpated in cases when: 1. symptomatic lesions are present regardless of size; 2. polyps larger than 10 mm are present because they represent a risk for gallbladder cancer; 3. polyps are showing rapid increase in size. Polyps less than 10 mm that are incidentally identified and not removed should be assessed by ultrasonography at least every six months. This is especially critical for sessile polyps, in which the possibility of a small cancerous polyp is greater than in pedunculated polyps. Also, asymptomatic lesions less than 10 mm in diameter should be removed if patient is older than 50 years or if he has concomitant gallbladder calculosis.

  19. Archiving tools for EOS

    Science.gov (United States)

    Sindrilaru, Elvin-Alin; Peters, Andreas-Joachim; Duellmann, Dirk

    2015-12-01

    Archiving data to tape is a critical operation for any storage system, especially for the EOS system at CERN which holds production data for all major LHC experiments. Each collaboration has an allocated quota it can use at any given time therefore, a mechanism for archiving "stale" data is needed so that storage space is reclaimed for online analysis operations. The archiving tool that we propose for EOS aims to provide a robust client interface for moving data between EOS and CASTOR (tape backed storage system) while enforcing best practices when it comes to data integrity and verification. All data transfers are done using a third-party copy mechanism which ensures point-to- point communication between the source and destination, thus providing maximum aggregate throughput. Using ZMQ message-passing paradigm and a process-based approach enabled us to achieve optimal utilisation of the resources and a stateless architecture which can easily be tuned during operation. The modular design and the implementation done in a high-level language like Python, has enabled us to easily extended the code base to address new demands like offering full and incremental backup capabilities.

  20. Critical experiment data archiving

    International Nuclear Information System (INIS)

    Critical experiment facilities produced a large number of important data during the past 45 years; however, many useful data remain unpublished. The unpublished material exists in the form of experimenters' logbooks, notes, photographs, material descriptions, etc., This data could be important for computer code validation, understanding the physics of criticality, facility design, or for setting process limits. In the past, criticality specialists have been able to obtain unpublished details by direct contact with the experimenters. Obviously, this will not be possible indefinitely. Most of the US critical experiment facilities are now closed, and the experimenters are moving to other jobs, retiring, or otherwise becoming unavailable for this informal assistance. Also, the records are in danger of being discarded or lost during facility closures, cleanup activities, or in storage. A project was begun in 1989 to ensure that important unpublished data from critical experiment facilities in the United States are archived and made available as a resource of the US Department of Energy's (DOE's) Nuclear Criticality Information System (NCIS). The objective of this paper is to summarize the project accomplishments to date and bring these activities to the attention of those who might be aware of the location of source information needed for archiving and could assist in getting the materials included in the archive

  1. Critical experiment data archiving

    International Nuclear Information System (INIS)

    Critical experiment facilities produced a large amount of important data during the past forty-five years. However, much useful data remains unpublished. The unpublished material exists in the form of experimenters' logbooks, notes, photographs, material descriptions, etc. This data could be important for computer code validation, understanding the physics of criticality, facility design, or for setting process limits. In the past, criticality specialists have been able to obtain unpublished details by direct contact with the experimenters. Obviously, this will not be possible indefinitely. Most of the US critical experiment facilities are now closed and the experimenters are moving to other jobs, retiring, or otherwise becoming unavailable for this informal assistance. Also, the records are in danger of being discarded or lost during facility closures, cleanup activities, or in storage. A project was begun in 1989 to ensure that important unpublished data from critical experiment facilities in the United States are archived and made available as a resource of the US Department of Energy's Nuclear Criticality Information System. The objective of this paper is to summarize the project accomplishments to date and bring these activities to the attention of those who might be aware of the location of source information needed for archiving, and could assist us in getting the materials included in the archive

  2. The Yohkoh Legacy Archive

    Science.gov (United States)

    Acton, L. W.; Takeda, A.; McKenzie, D. E.

    2008-12-01

    Yohkoh was a Japan/US/UK mission for the study of high energy processes on the sun. Scientific operation extended from September 1991 until 14 December 2001, nearly an entire solar activity cycle. Observations included full-disk soft and hard x-ray imaging, hard x-ray spectroscopy, and high resolution flare spectroscopy in S XV, Ca XIX, Fe XXV and Fe XXVI from the Bent Crystal Spectrometer (BCS). The Yohkoh Legacy Archive (YLA) brings together all Yohkoh observational data along with extensive documentation required for a full understanding of instrumentation, mission operations, and data reduction and correction. Extensive meta-data aid the user in efficiently accessing the data base. Creation of the YLA has been the work of 8 years; the top objective has been to present the extensive Yohkoh database in a form fully usable for scientists or students who are unfamiliar with Yohkoh instrumentation. The YLA may be accessed at http://solar.physics.montana.edu/ylegacy or through the Virtual Solar Observatory (VSO), although the VSO capability is still under development. Data from the Yohkoh hard x-ray instruments and BCS are presented in flare list formats. The Soft X-ray Telescope (SXT) images are available in quantitative and movie formats. This long, uniform, archive of SXT images is especially useful for solar cycle studies as well as high resolution soft x-ray flare studies. Examples of YLA data products and research enabled by the archive will be presented.

  3. Data Quality in Web Archiving

    OpenAIRE

    Spaniol, Marc; Denev, Dimitar; Mazeika, Arturas; Weikum, Gerhard

    2009-01-01

    Web archives preserve the history of Web sites and have high long-term value for media and business analysts. Such archives are maintained by periodically re-crawling entire Web sites of interest. From an archivist's point of view, the ideal case to ensure highest possible data quality of the archive would be to ``freeze'' the complete contents of an entire Web site during the time span of crawling and capturing the site. Of course, this is practically infea...

  4. Archived film analysis and restoration

    OpenAIRE

    Rares, A.

    2004-01-01

    The progressive degradation of current film archives poses a serious threat to the preservation of our cultural and technical heritage. Digitization and digital restoration are currently the most viable solutions for the long term preservation and high quality restoration of filmed material. They also open the path for more effective search, reuse and distribution of the archived content. This thesis covers various aspects of digital restoration applied to archived film. The main focus here l...

  5. Columnar cell lesions and subsequent breast cancer risk: a nested case-control study

    OpenAIRE

    Aroner, Sarah A.; Collins, Laura Christine; Schnitt, Stuart Jay; Connolly, James Leo; Colditz, Graham A; Tamimi, Rulla May

    2010-01-01

    Introduction: Histologic and genetic evidence suggests that at least some columnar cell lesions (CCL) of the breast represent precursor lesions in the low-grade breast neoplasia pathway. However, the risk of subsequent breast cancer associated with the presence of CCL in a benign breast biopsy is poorly understood.Methods The authors examined the association between the presence of CCL and subsequent breast cancer risk in a nested case-control study of benign breast disease (BBD) and breast c...

  6. Molecular Mechanism and Potential Targets for Blocking HPV-Induced Lesion Development

    OpenAIRE

    Madrid-Marina, V.; K. Torres-Poveda; Peralta-Zaragoza, O.; V. H. Bermúdez-Morales; E. Guzmán-Olea

    2011-01-01

    Persistent infection with high-risk HPV is the etiologic agent associated with the development of cervical cancer (CC) development. However, environmental, social, epidemiological, genetic, and host factors may have a joint influence on the risk of disease progression. Cervical lesions caused by HPV infection can be removed naturally by the host immune response and only a small percentage may progress to cancer; thus, the immune response is essential for the control of precursor lesions and C...

  7. Lesiones deportivas Sports injuries

    Directory of Open Access Journals (Sweden)

    Isabel Cristina Gallego Ching

    2007-04-01

    Full Text Available El estrés generado por la práctica deportiva ha originado una mayor probabilidad de que los atletas presenten lesiones agudas y crónicas. En el ámbito mundial existen diferentes investigaciones acerca de la incidencia de lesiones deportivas. La comparación de sus resultados es difícil por las diferencias en las características de la población y en la forma de reportar los datos, que varía ampliamente entre los estudios (proporciones o tasas de incidencia o tasas por cada 100 ó 1.000 participantes o tasas por horas de juego o por número de partidos jugados. Las tasas varían entre 1,7 y 53 lesiones por 1.000 horas de práctica deportiva, entre 0,8 y 90,9 por 1.000 horas de entrenamiento, entre 3,1 y 54,8 por 1.000 horas de competición y de 6,1 a 10,9 por 100 juegos. La gran variación entre las tasas de incidencia se explica por las diferencias existentes entre los deportes, los países, el nivel competitivo, las edades y la metodología empleada en los estudios. Se ha definido la lesión deportiva como la que ocurre cuando los atletas están expuestos a la práctica del deporte y se produce alteración o daño de un tejido, afectando el funcionamiento de la estructura. Los deportes de contacto generan mayor riesgo de presentar lesiones; se destacan al respecto los siguientes: fútbol, rugby, baloncesto, balonmano, artes marciales y jockey. Las lesiones ocurren con mayor probabilidad en las competencias que en el entrenamiento. Stress generated by sports practice has increased the probability that athletes suffer from acute and chronic injuries. Worldwide, there have been many different investigations concerning the incidence of sport injuries. The different ways in which results have been presented makes it difficult to compare among them. Rates of sports injuries vary between 1.7 and 53 per 1.000 hours of sports practice; 0.8 and 90.9 per 1.000 hours of training; 3.1 and 54.8 per 1.000 hours of competition, and 6.1 and 10.9 per 100

  8. Lesiones en corredores amateurs

    OpenAIRE

    Natale, Vanesa

    2011-01-01

    Se realizó un estudio tomando como muestra a 100 corredores amateurs de la ciudad de Mar del Plata, en la cual el objetivo general fue determinar cuáles son las patologías más frecuentes en corredores. Correr no es solo un deporte en si mismo sino que tiene elementos de otras actividades deportivas, es decir, que las lesiones de los corredores también son comunes en otros tipos de deportes. El número de deportistas aumenta diariamente y al mismo tiempo aumentan el número de per...

  9. Study of genital lesions

    Directory of Open Access Journals (Sweden)

    Anand Kumar B

    2003-03-01

    Full Text Available A total of one hundred patients (75 males and 25 females age ranged from 17-65 years with genital lesions attending the STD clinic of Bowring and LC Hospitals Bangalore constituted the study group. Based on clinical features, the study groups were classified as syphilis (39, chancroid (30, herpes genitolis (13, condylomato lato (9, LGV (7t condylomata acuminata (5, genital scabies (3, granuloma inguinole (2 and genital candidiasis (1. In 68% microbiological findings confirmed the clinical diagnosis. Of the 100 cases 13% and 2% were positive for HIV antibodies and HbsAg respectively.

  10. Precursor polymer compositions comprising polybenzimidazole

    Energy Technology Data Exchange (ETDEWEB)

    Klaehn, John R.; Peterson, Eric S.; Orme, Christopher J.

    2015-07-14

    Stable, high performance polymer compositions including polybenzimidazole (PBI) and a melamine-formaldehyde polymer, such as methylated, poly(melamine-co-formaldehyde), for forming structures such as films, fibers and bulky structures. The polymer compositions may be formed by combining polybenzimidazole with the melamine-formaldehyde polymer to form a precursor. The polybenzimidazole may be reacted and/or intertwined with the melamine-formaldehyde polymer to form the polymer composition. For example, a stable, free-standing film having a thickness of, for example, between about 5 .mu.m and about 30 .mu.m may be formed from the polymer composition. Such films may be used as gas separation membranes and may be submerged into water for extended periods without crazing and cracking. The polymer composition may also be used as a coating on substrates, such as metal and ceramics, or may be used for spinning fibers. Precursors for forming such polymer compositions are also disclosed.

  11. Precursor incident program at EDF

    International Nuclear Information System (INIS)

    The precursor program was started by EDF in 1994, after an investigation of the US NRC's Accident Sequence Precursor Program. Since then, reported operational events identified as Safety Outstanding Events have been analyzed whenever possible using probabilistic methods based on PSAs. Analysis provides an estimate of the remaining protection against core damage at the time the incident occurred. Measuring the incidents' severity enables to detect incidents important regarding safety. Moreover, the most efficient feedback actions can be derived from the main accident sequences identified through the analysis. Therefore, incident probabilistic analysis provides a way to assess priorities in terms of treatment and resource allocation, and so, to implement countermeasures preventing further occurrence and development of the most significant incidents. As some incidents cannot be analyzed using this method, probabilistic analysis can only be one among the methods used to assess the nuclear power plants' safety level. Nevertheless, it provides an interesting complement to classical methods of deterministic studies. (author)

  12. The Innate Lymphoid Cell Precursor.

    Science.gov (United States)

    Ishizuka, Isabel E; Constantinides, Michael G; Gudjonson, Herman; Bendelac, Albert

    2016-05-20

    The discovery of tissue-resident innate lymphoid cell populations effecting different forms of type 1, 2, and 3 immunity; tissue repair; and immune regulation has transformed our understanding of mucosal immunity and allergy. The emerging complexity of these populations along with compounding issues of redundancy and plasticity raise intriguing questions about their precise lineage relationship. Here we review advances in mapping the emergence of these lineages from early lymphoid precursors. We discuss the identification of a common innate lymphoid cell precursor characterized by transient expression of the transcription factor PLZF, and the lineage relationships of innate lymphoid cells with conventional natural killer cells and lymphoid tissue inducer cells. We also review the rapidly growing understanding of the network of transcription factors that direct the development of these lineages. PMID:27168240

  13. A Galvanotaxis Assay for Analysis of Neural Precursor Cell Migration Kinetics in an Externally Applied Direct Current Electric Field

    OpenAIRE

    Babona-Pilipos, Robart; Popovic, Milos R.; Morshead, Cindi M.

    2012-01-01

    The discovery of neural stem and progenitor cells (collectively termed neural precursor cells) (NPCs) in the adult mammalian brain has led to a body of research aimed at utilizing the multipotent and proliferative properties of these cells for the development of neuroregenerative strategies. A critical step for the success of such strategies is the mobilization of NPCs toward a lesion site following exogenous transplantation or to enhance the response of the endogenous precursors that are fou...

  14. Whistler precursors on a VLF transmitter signal

    International Nuclear Information System (INIS)

    Whistler precursors are discrete emissions which are occasionally seen just before two-hop whistlers. Most theories of precursors assume they are triggered emissions and focus on creating a triggering signal with the proper time delay from the causative sferic. Whistler precursors have now been seen on a signal from the Siple VLF transmitter. Phase analysis shows that these precursors are caused by a rapid increase in growth activity, and not by a triggering signal

  15. The Scent of the Digital Archive. Dilemmas with Archive Digitisation

    NARCIS (Netherlands)

    C. Jeurgens

    2013-01-01

    Archival infrastructure is changing at a rapid pace as a consequence of digitisation. The effort to digitise analogue collections seems to have benefits only for researchers. Still, only a fraction of analogue archive material is currently available in digital form. This article raises some of the p

  16. Analyzing Archival Intelligence: A Collaboration between Library Instruction and Archives

    Science.gov (United States)

    Hensley, Merinda Kaye; Murphy, Benjamin P.; Swain, Ellen D.

    2014-01-01

    Although recent archival scholarship promotes the use of primary sources for developing students' analytical research skills, few studies focus on standards or protocols for teaching or assessing archival instruction. Librarians have designed and tested standards and learning assessment strategies for library instruction, and archivists would do…

  17. Social Media and Archives: A Survey of Archive Users

    Science.gov (United States)

    Washburn, Bruce; Eckert, Ellen; Proffitt, Merrilee

    2013-01-01

    In April and May of 2012, the Online Computer Library Center (OCLC) Research conducted a survey of users of archives to learn more about their habits and preferences. In particular, they focused on the roles that social media, recommendations, reviews, and other forms of user-contributed annotation play in archival research. OCLC surveyed faculty,…

  18. OPS index - KOME | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...la SEF URLs by Artio About This Database Database Description Download License Update History of This Database Site Policy | Contact Us OPS index - KOME | LSDB Archive ...

  19. High Energy Astrophysics Science Archive Research Center

    Data.gov (United States)

    National Aeronautics and Space Administration — The High Energy Astrophysics Science Archive Research Center (HEASARC) is the primary archive for NASA missions dealing with extremely energetic phenomena, from...

  20. A New Treatment of Musculoskeletal System Lesions: Platelet Rich Plasma

    Directory of Open Access Journals (Sweden)

    Bayram Kelle

    2012-08-01

    Full Text Available Platelet rich plasma (PRP is a treatment modality that is very popular in recent years. It is obtained by centrifuging autologous blood. Although it has been used for tendon lesions, it could also used for many other lesions. Vascularization of tendons is relatively insufficient and therefore the treatment is difficult. They tend to be chronic. Although there are other treatments methods, the results are not always satisfactory. There are no known side effects of PRP. However, the effectiveness is highly controversial. Some studies indicated that PRP is very effective, but some say that PRP is ineffective. In this review we try to analyze the effectiveness and usability of PRP. [Archives Medical Review Journal 2012; 21(4.000: 236-245

  1. Contribution of constitutively proliferating precursor cell subtypes to dentate neurogenesis after cortical infarcts

    Directory of Open Access Journals (Sweden)

    Oberland Julia

    2010-11-01

    Full Text Available Abstract Background It is well known that focal ischemia increases neurogenesis in the adult dentate gyrus of the hippocampal formation but the cellular mechanisms underlying this proliferative response are only poorly understood. We here investigated whether precursor cells which constitutively proliferate before the ischemic infarct contribute to post-ischemic neurogenesis. To this purpose, transgenic mice expressing green fluorescent protein (GFP under the control of the nestin promoter received repetitive injections of the proliferation marker bromodeoxyuridine (BrdU prior to induction of cortical infarcts. We then immunocytochemically analyzed the fate of these BrdU-positive precursor cell subtypes from day 4 to day 28 after the lesion. Results Quantification of BrdU-expressing precursor cell populations revealed no alteration in number of radial glia-like type 1 cells but a sequential increase of later precursor cell subtypes in lesioned animals (type 2a cells at day 7, type 3 cells/immature neurons at day 14. These alterations result in an enhanced survival of mature neurons 4 weeks postinfarct. Conclusions Focal cortical infarcts recruit dentate precursor cells generated already before the infarct and significantly contribute to an enhanced neurogenesis. Our findings thereby increase our understanding of the complex cellular mechanisms of postlesional neurogenesis.

  2. Long term e-archiving

    OpenAIRE

    Dobratz, Susanne

    2002-01-01

    Conclusions of the breakout session "Long term e-archiving". Looking at the motto of this workshop “Gaining independence with e-Print archives and OAI” it suggests first of all that using e-Print publishing methods especially in the sense of a scholarly non-profit publishing independently from any commercial publishing house offers a unique chance to scientists.

  3. Anal cancer precursor lesions in HIV-positive and HIV-negative patients seen at a tertiary health institution in Brazil Lesões precursoras do câncer anal em pacientes HIV-positivos e HIV-negativos atendidos numa instituição de saúde terciária no Brasil

    Directory of Open Access Journals (Sweden)

    Ivan Tramujas da Costa e Silva

    2011-02-01

    Full Text Available Purpose: To investigate the prevalence of anal squamous intraepithelial lesions (ASIL or anal cancer in patients attended at the Tropical Medicine Foundation of Amazonas. Methods: 344 patients consecutively attended at the institution, in 2007/2008, were distributed in the following strata according to presence/abscense of at risk conditions for anal cancer: Group 1 _ HIV-positive men-who-have-sex-with-men (101; Group 2 _ HIV-positive females (49; Group 3 _ patients without any at risk condition for anal cancer (53; Group 4 _ HIV-positive heterosexual men (38; Group 5 _ HIV-negative patients, without anoreceptive sexual habits, but with other at risk conditions for anal cancer (45; Group 6 _ HIV-negative men-who-have-sex-with-men (26; and Group 7 _ HIV-negative anoreceptive females (32. The histopathological results of biopsies guided by high-resolution anoscopy were analyzed by frequentist and bayesian statistics in order to calculate the point-prevalence of ASIL/cancer and observe any eventual preponderance of one group over the other. Results: The point-prevalence of ASIL for all the patients studied was 93/344 (27%, the difference between HIV-positive and negative patients being statistically significant (38.3% versus 13.5%; p Objetivo: Investigar a prevalência de lesões intraepiteliais escamosas anais (ASIL ou câncer anal em pacientes atendidos na Fundação de Medicina Tropical do Amazonas. Métodos: 344 pacientes consecutivamente atendidos na instituição, em 2007/2008, foram distribuídos nos seguintes estratos conforme a presença/ausência de fatores de risco para o câncer anal: Grupo 1 _ homens-que-fazem-sexo-com-homens HIV-positivos (101; Grupo 2 _ mulheres HIV-positivas (49; Grupo 3 _ pacientes sem condição de risco para o câncer anal (53; Grupo 4 _ homens heterossexuais HIV-positivos (38; Grupo 5 _ pacientes HIV-negativos, sem hábitos sexuais anorreceptivos, mas com outras condições de risco para o câncer anal (45

  4. Prevalência da infecção por Helicobacter pylori e das lesões precusoras do câncer gástrico em pacientes dispéticos Prevalence of Helicobacter pylori infection and gastric cancer precursor lesions in patients with dyspepsia

    Directory of Open Access Journals (Sweden)

    Leandro Bizarro Muller

    2007-06-01

    foi menor que 1. CONCLUSÃO: A prevalência da infecção por H. pylori foi alta (76% e os indivíduos infectados apresentaram probabilidade 10 vezes maior para a ocorrência de lesão da mucosa gástrica. Gastrite crônica não-atrófica apresentou prevalência de 77%, gastrite atrófica 3% e metaplasia intestinal 15%. A infecção pelo H. pylori determinou uma probabilidade 3 vezes maior para o desenvolvimento de gastrite crônica não-atrófica e não determinou risco para a ocorrência de gastrite atrófica e metaplasia intestinal, sugerindo que possivelmente outros fatores de risco, além do H. pylori, estejam envolvidos no processo da carcinogênese gástrica.BACKGROUND: Helicobacter pylori infection has been considered to play significant role in gastric carcinogenesis, but only a minority of people who harbor this organism will develop gastric cancer. H. pylori infection first causes chronic non atrophic gastritis. Chronic non atrophic gastritis may evolve to atrophic gastritis and intestinal metaplasia and finally to dysplasia and adenocarcinoma. AIMS: To estimate the prevalence of H. pylori infection and the precancerous gastric lesions and their relationship, in patients with dyspeptic symptoms who underwent upper gastrointestinal endoscopy at a reference center in the central region of Rio Grande do Sul state, Brazil. METHODS: We analyzed gastric biopsies taken from corpus and antrum of patients who underwent upper gastrointestinal endoscopy for H. pylori detection, between 1994 and 2003. According to Sydney system, chronic non atrophic gastritis, atrophic gastritis and intestinal metaplasia were diagnosed by histological examination (H-E stain. The histological diagnoses were related to H. pylori infection status. RESULTS: Biopsies from 2,019 patients were included in the study. Patients mean age was 52 (±15 and 59% were female. Seventy six percent had H. pylori infection. Normal mucosa, chronic non atrophic gastritis, atrophic gastritis and intestinal

  5. EPRINT ARCHIVE USER SURVEY

    CERN Multimedia

    2001-01-01

    University of Southampton invites the CERN community to participate in a survey Professor Stevan Harnad is conducting on current users and non-users of Eprint Archives. http://www.eprints.org/survey/ The findings will be used to suggest potential enhancements of the services as well as to get a deeper understanding of the very rapid developments in the on-line dissemination and use of scientific and scholarly research. (The survey is anonymous. Revealing your identity is optional and it will be kept confidential.)

  6. Mycetoma: Nonvenereal perineal lesions

    Directory of Open Access Journals (Sweden)

    Gupta Shweta

    2010-01-01

    Full Text Available Mycetoma is a chronic, granulomatous disease of the skin, and subcutaneous tissue, which sometimes involves muscle, bones, and neighboring organs. It is characterized by tumefaction, abscess formation, and fistulae with discharge of grains from sinuses. Mycetoma can be caused by various species of fungi (eumycetoma and aerobic actinomycetes (actinomycetoma, which occur as saprophytes in soil or plants. A tentative diagnosis sufficient to initiate treatment may be made on the basis of grain color. For instance, melanoid grains are always caused by fungi and ochroid or pale grains by actinomycetes. Although this is not the thumbrule, there are exceptional reports too. As trauma favors infection, most lesions are on the foot and lower leg but they may occur anywhere on the body mimicking actinomycosis. However, lab investigations and culture are important tool to differentiate apart from the clinical picture. We are reporting atypical case with unusual site of presentation (perineum and thigh of mycetoma.

  7. Internet Art and the Archive

    Directory of Open Access Journals (Sweden)

    Karin Wagner

    2007-07-01

    Full Text Available Internet art is ephemeral by nature and several initiatives have been taken to preserve it for the future. Apart from formal archives holding art of this kind, there are also artworks which exist outside these web based institutions. In what way can they be regarded as archived? In the article, criteria are suggested which can be used to judge whether an artwork is active or archived and these criteria are applied in the analysis of twelve different artworks. Different kinds of dating are important for how the status of a work is perceived by the visitor. The concepts of explicit and implicit archiving are used to characterize archiving of Internet art, where works can be "dead" and "alive" at the same time.

  8. Community archiving of imaging studies

    Science.gov (United States)

    Fritz, Steven L.; Roys, Steven R.; Munjal, Sunita

    1996-05-01

    The quantity of image data created in a large radiology practice has long been a challenge for available archiving technology. Traditional methods ofarchiving the large quantity of films generated in radiology have relied on warehousing in remote sites, with courier delivery of film files for historical comparisons. A digital community archive, accessible via a wide area network, represents a feasible solution to the problem of archiving digital images from a busy practice. In addition, it affords a physician caring for a patient access to imaging studies performed at a variety ofhealthcare institutions without the need to repeat studies. Security problems include both network security issues in the WAN environment and access control for patient, physician and imaging center. The key obstacle to developing a community archive is currently political. Reluctance to participate in a community archive can be reduced by appropriate design of the access mechanisms.

  9. Archiving: The Overlooked Spreadsheet Risk

    CERN Document Server

    Lemieux, Victoria

    2008-01-01

    This paper maintains that archiving has been overlooked as a key spreadsheet internal control. The case of failed Jamaican commercial banks demonstrates how poor archiving can lead to weaknesses in spreadsheet control that contribute to operational risk. In addition, the Sarbanes-0xley Act contains a number of provisions that require tighter control over the archiving of spreadsheets. To mitigate operational risks and achieve compliance with the records-related provisions of Sarbanes-Oxley, the author argues that organisations should introduce records management programmes that provide control over the archiving of spreadsheets. At a minimum, spreadsheet archiving controls should identify and ensure compliance with retention requirements, support document production in the event of regulatory inquiries or litigation, and prevent unauthorised destruction of records.

  10. Precursor films in wetting phenomena

    OpenAIRE

    Popescu, M. N.; Oshanin, G.; Dietrich, S.; Cazabat, A. -M.

    2012-01-01

    The spontaneous spreading of non-volatile liquid droplets on solid substrates poses a classic problem in the context of wetting phenomena. It is well known that the spreading of a macroscopic droplet is in many cases accompanied by a thin film of macroscopic lateral extent, the so-called precursor film, which emanates from the three-phase contact line region and spreads ahead of the latter with a much higher speed. Such films have been usually associated with liquid-on-solid systems, but in t...

  11. Pigmented Lesions of the Vulva

    OpenAIRE

    Gürol Açıkgöz; Çağlayan Çağdaş Demirci; Ercan Arca

    2012-01-01

    Pigmented lesions on the vulva are rare and their non specific features cause difficulties in their diagnosis and differential diagnosis. Because of their localization, it is difficult to follow up vulvar lesions, which are generally noticed coincidentally by patients. Vulvar pigmented lesions are classified clinically as macules/papules and patches/plaques to provide ease of the diagnosis. Nevi, angiokeratomas, seborrheic keratosis, melanoma, basal cell carcinoma and squamous cell carcinoma ...

  12. Cystic lesions of the liver

    OpenAIRE

    Rosado, E.; J Pereira; Bouchaibi, S; Bali, M

    2014-01-01

    LEARNING OBJECTIVES: To present the CT and MRI features of the cystic liver lesions, with emphasis on the differential diagnosis. BACKGROUND: Cystic liver lesions are a frequent finding in abdominal imaging and may represent a broad spectrum of entities, ranging from benign developmental cysts to malignant neoplasms. Radiological features of various cystic liver lesions frequently overlap. Therefore, it is necessary to integrate imaging with clinical and laboratorial findings. The most imp...

  13. Microbiological aspects of endoperiodontal lesion

    OpenAIRE

    Cristiane Tokunaga; Bruno Monguilhott Crozeta; Mariangela Schmitt Bonato; Beatriz Serrato Coelho; Flares Baratto-Filho; Flávia Sens Fagundes Tomazinho

    2013-01-01

    Introduction: The endoperiodontal lesion occurs when a tooth undergoing endodontic disease is united to a periodontal lesion with apical progression. Many times, the differential diagnosis between the endodontic and periodontal disease can be of difficult execution and the correct diagnosis and planing of the treatment is of main importance for a good prognosis Objective: To identify the main microorganisms within the lesion of endodontic and periodontal origin and correlate them with the en...

  14. Radio-induced brain lesions

    Directory of Open Access Journals (Sweden)

    Gorgan Mircea Radu

    2014-03-01

    Full Text Available Introduction : Radiotherapy, an important tool in multimodal oncologic treatment, can cause radio-induced brain lesion development after a long period of time following irradiation.

  15. MALIGNANCY IN LARGE COLORECTAL LESIONS

    Directory of Open Access Journals (Sweden)

    Carlos Eduardo Oliveira dos SANTOS

    2014-09-01

    Full Text Available Context The size of colorectal lesions, besides a risk factor for malignancy, is a predictor for deeper invasion Objectives To evaluate the malignancy of colorectal lesions ≥20 mm. Methods Between 2007 and 2011, 76 neoplasms ≥20 mm in 70 patients were analyzed Results The mean age of the patients was 67.4 years, and 41 were women. Mean lesion size was 24.7 mm ± 6.2 mm (range: 20 to 50 mm. Half of the neoplasms were polypoid and the other half were non-polypoid. Forty-two (55.3% lesions were located in the left colon, and 34 in the right colon. There was a high prevalence of III L (39.5% and IV (53.9% pit patterns. There were 72 adenomas and 4 adenocarcinomas. Malignancy was observed in 5.3% of the lesions. Thirty-three lesions presented advanced histology (adenomas with high-grade dysplasia or early adenocarcinoma, with no difference in morphology and site. Only one lesion (1.3% invaded the submucosa. Lesions larger than 30 mm had advanced histology (P = 0.001. The primary treatment was endoscopic resection, and invasive carcinoma was referred to surgery. Recurrence rate was 10.6%. Conclusions Large colorectal neoplasms showed a low rate of malignancy. Endoscopic treatment is an effective therapy for these lesions.

  16. Comparative molecular pathology of sporadic hyperplastic polyps and neoplastic lesions from the same individual

    OpenAIRE

    Zauber, P; Sabbath-Solitare, M; Marotta, S; Zauber, A.; T. Bishop

    2004-01-01

    Aim: The biology of colorectal hyperplastic polyps is of considerable relevance, because recent evidence suggests that under certain circumstances hyperplastic polyps may be precursors of neoplasms. The aim of this study was to assess and compare the clinical and molecular characteristics of hyperplastic polyps and neoplastic lesions removed from patients without the hyperplastic polyposis syndrome.

  17. Multimedia medical archiving system

    Science.gov (United States)

    Sood, Arun K.; Atallah, George C.; Rao, Amar; Perez-Lopez, Kathleen G.; Freedman, Matthew T.

    1995-11-01

    The demand for digital radiological imaging and archiving applications has been increasingly rapidly. These digital applications offer significant advantages to the physician over the traditional film-based technique. They result in faster and better quality services, support remote access and conferencing capabilities, provide on demand service availability, eliminate film processing costs, and most significantly, they are suitable services for the evolving global information super highway. Several existing medical multimedia systems incorporate and utilize those advanced technical features. However, radiologists are seeking an order of magnitude improvement in the overall current system design and performance indices (such as transactions response times, system utilization and throughput). One of the main technical concern radiologists are raising is the miss-filing occurrence. This even will decrease the radiologist productivity; introduce unnecessarily workload; and will result in total customer dissatisfaction. This paper presents Multimedia Medical Archiving System, which can be used in hospitals and medical centers for storing and retrieving radiological images. Furthermore, this paper emphasizes a viable solution for the miss-filing problem. The results obtained demonstrate and quantify the improvement in the overall radiological operations. Specifically this paper demonstrates an order of 80% improvement in the response time for retrieving images. This enhancement in system performance directly translates to a tremendous improvement in the radiologist's productivity.

  18. (Per)Forming Archival Research Methodologies

    Science.gov (United States)

    Gaillet, Lynee Lewis

    2012-01-01

    This article raises multiple issues associated with archival research methodologies and methods. Based on a survey of recent scholarship and interviews with experienced archival researchers, this overview of the current status of archival research both complicates traditional conceptions of archival investigation and encourages scholars to adopt…

  19. Ethics and Truth in Archival Research

    Science.gov (United States)

    Tesar, Marek

    2015-01-01

    The complexities of the ethics and truth in archival research are often unrecognised or invisible in educational research. This paper complicates the process of collecting data in the archives, as it problematises notions of ethics and truth in the archives. The archival research took place in the former Czechoslovakia and its turbulent political…

  20. IATROGENIC BILIARY LESIONS

    Directory of Open Access Journals (Sweden)

    J. M. Schiappa

    2007-10-01

    Full Text Available Iatrogenic bile duct injury carries a high rate of morbidity. After the introduction of laparoscopiccholecystectomy the incidence of these injuries has at least doubled, and even after the learningcurve, the incidence has remained of about 0.5%. Etiology of the iatrogenic biliary injuries is theresult of the anatomical conditions (biliary or vascular anomalies, pathology (acute cholecystitis,adhesions, technical equipment, surgeon (the lerning curve. The type of the injuries, thediagnostic procedures and therapeutic approach are discussed. Most of the minor bile duct injuries,including cystic duct leaks and bile duct strictures, are well treatable with endoscopic techniques,whereas most of the major injuries require operative treatment, which at optimal circumstancesgives good results. Interdisciplinary cooperation and early referral to an experienced center iscrucial in the management of these iatrogenic lesions. The best „treatment” for this iatrogenicpathology is prevention: surgical access adapted to morphology, good exposure of the hepatoduodenalspace, good identification of structures before tying, appropriate dissection, selectivecholangiography, great care with the use of electrosurgery.

  1. Spontaneous feline mammary intraepithelial lesions as a model for human estrogen receptor- and progesterone receptor-negative breast lesions

    International Nuclear Information System (INIS)

    Breast cancer is the most frequently diagnosed cancer in women. Intraepithelial lesions (IELs), such as usual ductal hyperplasia (UH), atypical ductal hyperplasia (ADH), and ductal carcinoma in situ (DCIS) are risk factors that predict a woman's chance of developing invasive breast cancer. Therefore, a comparative study that establishes an animal model of pre-invasive lesions is needed for the development of preventative measures and effective treatment for both mammary IELs and tumors. The purpose of this study was to characterize the histologic and molecular features of feline mammary IELs and compare them with those in women. Formalin-fixed, paraffin-embedded specimens (n = 205) from 203 female cats with clinical mammary disease were retrieved from the archives of the Purdue University Animal Disease Diagnostic Laboratory and Veterinary Teaching Hospital (West Lafayette, IN), and the Department of Pathology and Veterinary Clinic, School of Veterinary Medicine (Sassari, Italy). Histologic sections, stained with hematoxylin and eosin (HE), were evaluated for the presence of IELs in tissue adjacent to excised mammary tumors. Lesions were compared to those of humans. Immunohistochemistry for estrogen receptor (ER-alpha), progesterone receptor (PR), human epidermal growth factor receptor 2 (HER-2/neu) and Ki-67 was performed in IELs and adjacent tumor tissues. Intraepithelial lesions were found in 57 of 203 (28%) feline mammary specimens and were categorized as UH (27%), ADH (29%), and DCIS (44%). Most IELs with atypia (ADH and DCIS) were associated with mammary cancer (91%), whereas UH was associated with benign lesions in 53% of cases. Feline IELs were remarkably similar to human IELs. No ER or PR immunoreactivity was detected in intermediate-grade or high-grade DCIS or their associated malignant tumors. HER-2 protein overexpression was found in 27% of IELs. The remarkable similarity of feline mammary IELs to those of humans, with the tendency to lose hormone

  2. Nonsurgical management of periapical lesions

    Directory of Open Access Journals (Sweden)

    Fernandes Marina

    2010-01-01

    Full Text Available Periapical lesions develop as sequelae to pulp disease. They often occur without any episode of acute pain and are discovered on routine radiographic examination. The incidence of cysts within periapical lesions varies between 6 and 55%. The occurrence of periapical granulomas ranges between 9.3 and 87.1%, and of abscesses between 28.7 and 70.07%. It is accepted that all inflammatory periapical lesions should be initially treated with conservative nonsurgical procedures. Studies have reported a success rate of up to 85% after endodontic treatment of teeth with periapical lesions. A review of literature was performed by using electronic and hand searching methods for the nonsurgical management of periapical lesions. Various methods can be used in the nonsurgical management of periapical lesions: the conservative root canal treatment, decompression technique, active nonsurgical decompression technique, aspiration-irrigation technique, method using calcium hydroxide, Lesion Sterilization and Repair Therapy, and the Apexum procedure. Monitoring the healing of periapical lesions is essential through periodic follow-up examinations.

  3. Newspaper archives : a knowledge asset

    OpenAIRE

    Pujari, Anita; Pai, Priya

    2005-01-01

    This paper deals with Newspaper Content as a source of knowledge and how Times Archives of the Times Group has converted the 166-year span of socio-political content of “The Times of India” and the 43 year economic and business barometer “The Economic Times” into an easily accessible Archive. The value of this Archive as a Knowledge Asset lies in its potential of being recalled, researched, reused and re-expressed by the various ventures of the Group. This paper describes the process of Micro...

  4. Adrenal lymphangioma: clinicopathologic and immunohistochemical characteristics of a rare lesion.

    Science.gov (United States)

    Ellis, Carla L; Banerjee, Priya; Carney, Erin; Sharma, Rajni; Netto, George J

    2011-07-01

    Adrenal lymphangiomas, also known as cystic adrenal lymphangiomas, are rare, benign vascular lesions that usually remain asymptomatic throughout life. Although previously adrenal lymphangioma lesions were primarily found at autopsy, they are currently detected during imaging work-up for unrelated causes and are likely to imitate other adrenocortical or adrenal medullary neoplasms. We aimed to retrospectively review all adrenal lymphangioma cases at our hospital and further document their lymphatic origin by immunohistochemical staining. A search of surgical pathology records (1984-2008) was conducted. All hematoxylin and eosin sections were retrieved from archives and reviewed by 2 pathologists in the study. Clinical information was gathered from electronic medical records. Representative paraffin-embedded sections from each case were selected for immunohistochemical analysis using monoclonal antibodies D2-40 and AE1/AE3. A total of 9 adrenal lymphangioma cases were identified (6 women and 3 men). All 9 patients were adults at time of diagnosis with a mean age of 42 years (range, 28-56 years). There were 7 white patients, 1 African American patient, and 1 Asian patient. The average size of an adrenal lymphangioma lesion was 4.9 cm (range, 2.0-13.5 cm). Adrenal lymphangioma was twice more frequently located on the right side (6 right-sided and 3 left-sided). Clinically, 4 (44%) of the 9 lesions presented with abdominal, flank, or back pain. One lymphangioma was found during work-up for labile hypertension. The remaining 4 lesions (44%) were asymptomatic and incidentally found during imaging studies for unrelated causes. Surgical removal was achieved by total adrenalectomy in 8 of the 9 lesions and by partial adrenalectomy in the remaining case. No evidence of recurrence or development of a contralateral lesion was encountered in any of the patients. Histologically, our adrenal lymphangiomas showed a typical multicystic architecture with dilated spaces lined by

  5. Download - Society Catalog | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...ip (41.9 KB) - Downlaod via FTP Joomla SEF URLs by Artio About This Database Database Description Download License Update History

  6. Download - Trypanosomes Database | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...earch and download Downlaod via FTP Joomla SEF URLs by Artio About This Database Database Description Download License Update History

  7. Download - RGP gmap | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available FTP Joomla SEF URLs by Artio About This Database Database Description Download License Update History of This Database Site Policy | Contact Us Download - RGP gmap | LSDB Archive ...

  8. Open archive solutions to traditional archive/library cooperation

    Directory of Open Access Journals (Sweden)

    Donatella Castelli

    2003-09-01

    Full Text Available The diffusion of Internet is changing the role of archives and libraries and it is opening a wide range of new possibilities. The new vision is that in few years it will be possible to cross-access multiple libraries, archives, museums, and data repositories. The implementation of this revolutionary vision requires the solution of a number of technical, organizational, sociological, and economical issues. Recently, the proposal of a new, low cost technical solution for open repositories of pre-print material, the Open Archives Initiative Protocol for Metadata Harvesting ( OAI-PMH, has greatly stimulated the discussion about these issues in many application frameworks. This paper overviews the status of this discussion in the library and conventional archives frameworks.

  9. The diagnosis and management of pre-invasive breast disease: Genetic alterations in pre-invasive lesions

    International Nuclear Information System (INIS)

    The development of modern molecular genetic techniques has allowed breast cancer researchers to clarify the multistep model of breast carcinogenesis. Laser capture microdissection coupled with comparative genomic hybridisation and/or loss-of-heterozygosity methods have confirmed that many pre-invasive lesions of the breast harbour chromosomal abnormalities at loci known to be altered in invasive breast carcinomas. Current data do not provide strong evidence for ductal hyperplasia of usual type as a precursor lesion, although some are monoclonal proliferations; however, atypical hyperplasia and in situ carcinoma appear to be nonobligate precursors. We review current knowledge and the contribution of molecular genetics in the understanding of breast cancer precursors and pre-invasive lesions

  10. License - Plabrain DB | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us Plabrain... . If you use data from this database, please be sure attribute this database as follows: Plabrain DB © 2010...me and URL of this database (http://dbarchive.lifesciencedb.jp/english/en/plabrain-db/desc.html) in the arti...se Database Description Download License Update History of This Database Site Policy | Contact Us License - Plabrain DB | LSDB Archive ...

  11. Premarital precursors of marital infidelity.

    Science.gov (United States)

    Allen, Elizabeth S; Rhoades, Galena Kline; Stanley, Scott M; Markman, Howard J; Williams, Tamara; Melton, Jessica; Clements, Mari L

    2008-06-01

    Premarital precursors of infidelity were evaluated in a sample of 72 couples (N = 144) who were taking part in a longitudinal study of marriage. Premarital self-report and observational data were compared for couples who experienced infidelity and those who did not experience infidelity in the first years of marriage. Couples in which the male engaged in marital infidelity were characterized, premaritally, by significantly lower male sexual satisfaction, lower male positive communication, and higher female invalidation, whereas couples in which the female went on to engage in infidelity were characterized, premaritally, by significantly lower levels of female positive communication, higher levels of male and female negative communication, and higher levels of male and female invalidation. Implications of the findings for future research on the prediction and prevention of infidelity are discussed. PMID:18605124

  12. Effect of Detergents on Streptolysin S Precursor

    OpenAIRE

    Calandra, Gary B.

    1980-01-01

    Group A streptococci which produce streptolysin S contain a cellular precursor to streptolysin S in the membranes and cytoplasm which is activatable by blending in a Vortex mixer with glass beads and ribonucleic acid (RNA)-core (RNA preparation from yeast). Although no activation of precursor occurred when it was mixed with detergents, it was activated when blended with glass beads and detergents such as Tergitol NP-40 and Brij 35. Maximum activation of precursor was achieved in 1 to 2% deter...

  13. Overview of ALD Precursors and Reaction Mechanisms

    OpenAIRE

    Gordon, Roy Gerald

    2011-01-01

    Successful use of ALD requires suitable chemical precursors used under reaction conditions that are appropriate for them. There are many requirements for ALD precursors: sufficient volatility, thermal stability and reactivity with substrates and with the films being deposited. In addition, it is easier to produce the required vapors if the precursor is liquid at room temperature, or if it is a solid with melting point below the vaporization temperature, or if it is soluble in an inert solvent...

  14. Small Data Archives and Libraries

    Science.gov (United States)

    Holl, A.

    2010-10-01

    Preservation is important for documenting original observations, and existing data are an important resource which can be re-used. Observatories should set up electronic data archives and formulate archiving policies. VO (Virtual Observatory) compliance is desirable; even if this is not possible, at least some VO ideas should be applied. Data archives should be visible and their data kept on-line. Metadata should be plentiful, and as standard as possible, just like file formats. Literature and data should be cross-linked. Libraries can play an important role in this process. In this paper, we discuss data archiving for small projects and observatories. We review the questions of digitization, cost factors, manpower, organizational structure and more.

  15. NCEI Marine Geology Data Archive

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Marine Geologic data compilations and reports in the NCEI archive are from academic and government sources around the world. Over ten terabytes of analyses,...

  16. Shoichi Sakata: His Life and Physics ---Collections of Materials in Sakata Memorial Archival Library---

    Science.gov (United States)

    Tanabashi, M.

    Shoichi Sakata and his Nagoya School made a lot of important achievements at the predawn of the particle physics revolution. The ``two-meson'' theory (introduction of the second generation leptons), the ``C-meson theory'' (a theory which inspired Tomonaga's renormalization theory), the ``Sakata model'' (a precursor to the quark model), and the ``Maki-Nakagawa-Sakata'' theory on the neutrino mixings are among them. These outputs are now regarded as essential ingredients in modern particle physics. Sakata also took his leadership in setting up democratic administration system in his theoretical particle physics group (E-ken). It was this democratic atmosphere in which many excellent physicists were brought up as Sakata's diciples. In this talk, I introduce Sakata and his achievements in physics, showing various materials archived in the Sakata Memorial Archival Library (SMAL), an archival repository of primary material showing Sakata's activities. These SMAL documents vividly show Sakata's way of thinking in his approach to the new physics.

  17. Amyloid Precursor Protein Processing in Alzheimer’s Disease

    Directory of Open Access Journals (Sweden)

    Adwait BHADBHADE

    2012-03-01

    Full Text Available How to Cite this Article: Bhadbhade A, Cheng DW. Amyloid Precursor Protein Processing in Alzheimer’s Disease. Iranian Journal of Child Neurology2012;6(1:1-5.Alzheimer’s disease (AD is a progressive neurodegenerative disorder and a leading cause of dementia. The AD is characterized by presence of intraneuronal tangles and extracellular plaques in the brain. The plaques are composed of dense and mostly insoluble deposits of amyloid beta peptide (Aβ, formed by sequential cleavage of the Amyloid Precursor Protein (APP, by two pathways amyloidogenic and non-amyloidogenic. Tangles are composed of paired helical fragments, which aggregate to form, microtubular protein tau. Although Aβ plaques are established to be the cause of the disease, there exist genetic factors and other pathological identifications in addition to these which are an integral part of the disease. This article gives an overview into the mechanism of APP action, genetic factors and other pathological identifications contributing to Alzheimer’s disease formation.References Brookmeyer R, Gray S, Kawas C. Projections of Alzheimer’s disease in the United States and the public health impact of delaying disease onset. American Journal of Public Health 1998;88(9:1337. Hebert LE, Scherr PA, Bienias JL, Bennett DA, Evans DA. Alzheimer disease in the US population. Arch Neurol 2003;60(8:1119-22. Möller HJ, Graeber M. The case described by Alois Alzheimer in 1911. European Archives of Psychiatry and Clinical Neuroscience 1998:248(3:111-122. Selkoe D J. (2002. Deciphering the genesis and fate of amyloid beta-protein yields novel therapies for Alzheimer disease. J Clinic Investigat 2002;110(10: 1375-82. Wolfe MS. Tau mutations in neurodegenerative diseases. J Biolog Chem 2009;284(10:6021. Selkoe DJ. Alzheimer’s disease: genes, proteins, and therapy. Physiological reviews 2001;81(2:741. Selkoe DJ. The cell biology of [beta]-amyloid precursor protein and presenilin in Alzheimer

  18. Archiving in the networked world

    OpenAIRE

    Seadle, Michael

    2011-01-01

    Purpose – This paper aims to focus on how long-term digital archiving systems are tested and what benchmarks and other metrics are necessary for that testing to produce data that the community can use to make decisions. Design/methodology/approach – The article reviews recent literature about digital archiving systems involving public and semi-public tests. It then looks specifically at the rules and metrics needed for doing public or semi-public testing for three specific issues: triggeri...

  19. Applied Archival Downloading with Wget

    OpenAIRE

    Kellen Kurschinski

    2013-01-01

    Archival websites offer a wealth of resources to historians, but increased accessibility does not always translate into increased utility. In other words, while online collections often allow historians to access hitherto unavailable or cost-prohibitive materials, they can also be limited by the manner in which content is presented and organized. Take for example the Indian Affairs Annual Reports database hosted on the Library and Archives Canada [LAC] website. Say you wanted to download an e...

  20. A histopathological overview of ovarian lesions in Benin City, Nigeria: How common are the functional cysts?

    OpenAIRE

    Gerald Dafe Forae; Jonathan Umezulike Aligbe

    2014-01-01

    Aim: The aim of this study is to highlight the histopathological synopsis of ovarian lesions with emphasis on functional ovarian cysts and to compare our study with findings of other centers. Materials and Methods: Hematoxylin and eosin stained-slides of ovarian biopsies diagnosed at the Ashamas Foundation Diagnostic Centre, Benin City for 10 years were archived, scrutinized, and studied. Request forms were analyzed for clinical biodata and diagnosis, and data were analyzed with Statistical P...

  1. Autoimmune Metaplastic Atrophic Gastritis: Recognizing Precursor Lesions for Appropriate Patient Evaluation.

    Science.gov (United States)

    Pittman, Meredith E; Voltaggio, Lysandra; Bhaijee, Feriyl; Robertson, Scott A; Montgomery, Elizabeth A

    2015-12-01

    Autoimmune metaplastic atrophic gastritis (AMAG) is a significant risk factor for pernicious anemia and gastric neoplasia. Still, the histologic features of AMAG are frequently overlooked, especially in the early stages of the disease. The purpose of our study, therefore, was to catalogue the progression of histologic changes that precede the development of AMAG in affected individuals. Over a 2-year period (2012 to 2014), the diagnosis of AMAG was rendered on material from 113 patients seen at Johns Hopkins Hospital (∼1.8% of "in house" gastric biopsies). Prior gastric body biopsies had been performed on 54 (48%) patients in the cohort, and the majority of these specimens had also shown AMAG. Eighteen of the previous biopsies, however, carried a diagnosis other than AMAG: 13 inactive chronic gastritis, 2 acute Helicobacter pylori gastritis, and 1 each of eosinophilic gastritis, iron pill gastritis, and proton-pump inhibitor-like effect. Upon review of these 18 biopsies, the most common histologic findings were heavy full-thickness or deep lamina propria chronic inflammation (12), inflammatory destruction of oxyntic glands (12), metaplasia (intestinal, pyloric, or pancreatic acinar) (10), prominent lamina propria eosinophils (8), and parietal cell pseudohypertrophy (4). At least 2 of these features were present in the majority (13, 72%) of the biopsies. In addition, 7 (58%) of these patients were also found to have another autoimmune or inflammatory disorder before the diagnosis of AMAG. Although subtle, histologic features of developing AMAG are identifiable in routine gastric body biopsies. When metaplasia, full-thickness chronic inflammation, and/or oxyntic destruction are seen, a note suggesting laboratory testing and/or close clinical follow-up in this subset of patients may be warranted. PMID:26291507

  2. Factitious lesions of the hand

    Directory of Open Access Journals (Sweden)

    Ricardo Kaempf de Oliveira

    2013-08-01

    Full Text Available OBJECTIVE: The presence of a lesion with atypical presentation, obscure clinical history, which does not improve with classic treatments, shall raise the red flag of the medical team. In such cases, the hypothesis of a factitious lesion shall be considered. Many times the correct diagnosis on the initial assessment may avoid high-cost diagnostic tests, unnecessary treatments, and time consumption of the medical team. We present here two classic cases of factitious lesions that, similar to those described in the literature, is difficult to diagnose and difficult to treat.

  3. Nerve lesioning with direct current

    Science.gov (United States)

    Ravid, E. Natalie; Shi Gan, Liu; Todd, Kathryn; Prochazka, Arthur

    2011-02-01

    Spastic hypertonus (muscle over-activity due to exaggerated stretch reflexes) often develops in people with stroke, cerebral palsy, multiple sclerosis and spinal cord injury. Lesioning of nerves, e.g. with phenol or botulinum toxin is widely performed to reduce spastic hypertonus. We have explored the use of direct electrical current (DC) to lesion peripheral nerves. In a series of animal experiments, DC reduced muscle force by controlled amounts and the reduction could last several months. We conclude that in some cases controlled DC lesioning may provide an effective alternative to the less controllable molecular treatments available today.

  4. Differential diagnosis of sacral lesions

    International Nuclear Information System (INIS)

    The authors reviewed the teaching files of Temple University Hospital and Children's Hospital of Philadelphia and selected the best representative cases of various lesions of the sacrum. They selected the following lesions: metastasis, chondrosarcoma, chrodoma, plasmacytoma, giant cell tumor, osteogenic sarcoma, Ewing sarcoma, neuroblastoma, neurofibrosarcoma, hemangiopericytoma, osteoblastoma, ossifying fibroma, eosinophilic granuloma, aneurysmal bone cyst, sacrococcygeal teratoma, anterior meningocele, endodermal sinus tumor, and stress fracture. The authors illustrate, for each lesion, the likely age range, sights of predilection, likelihood of occurrence in the sacrum, and radiographic findings helpful in limiting the differential diagnosis. They demonstrate the value of bone scintigraphy in detecting, and CT in confirming, stress fractures of the sacrum

  5. PHAEOHYPHOMYCOSIS: CUTANEOUS, SUBCUTANEOUS, NASOPHARYNGEAL LESIONS

    Directory of Open Access Journals (Sweden)

    M. Rasoolinejad

    1999-06-01

    Full Text Available Phaeohyphomycosis is an amalgam of clinical diseases caused by a wide variety of dematiaceous fungi. We are reporting on a 16 year-old patient from Amol with subcutaneous cervical nodes and nasopharyngeal lesions of phaeohypho"nmycosis that were confirmed by pathological examination, direct smear, and culture. After treatment with an oral triazole (Itraconazole for 4 months, all nodes and lesions disappeared and treatment was stopped A new lesion appeared on his chest wall 8 months, therapy with itraconazole was restarted and commuted for a long time.

  6. Multipotent skin-derived precursors: adult neural crest-related precursors with therapeutic potential

    OpenAIRE

    Fernandes, Karl J.L; Toma, Jean G; Miller, Freda D.

    2007-01-01

    We previously made the surprising finding that cultures of multipotent precursors can be grown from the dermis of neonatal and adult mammalian skin. These skin-derived precursors (SKPs) display multi-lineage differentiation potential, producing both neural and mesodermal progeny in vitro, and are an apparently novel precursor cell type that is distinct from other known precursors within the skin. In this review, we begin by placing these findings within the context of the rapidly evolving ste...

  7. Leading time domain seismic precursors

    Science.gov (United States)

    Boucouvalas, A. C.; Gkasios, M.; Keskebes, A.; Tselikas, N. T.

    2014-08-01

    The problem of predicting the occurrence of earthquakes is threefold. On one hand it is necessary to predict the date and magnitude of an earthquake, and on the other hand the location of the epicenter. In this work after a brief review of the state of earthquake prediction research, we report on a new leading time precursor for determining time onset of earthquake occurrence. We report the linking between earthquakes of the past with those which happen in the future via Fibonacci, Dual and Lucas numbers (FDL) numbers. We demonstrate it here with two example seed earthquakes at least 100 years old. Using this leading indicator method we can predict significant earthquake events >6.5R, with good accuracy approximately +- 1 day somewhere in the world. From a single seed we produce at least 100 trials simultaneously of which 50% are correct to +- 1day. The indicator is based on Fibonacci, Dual and Lucas numbers (FDL). This result hints that the log periodic FDL numbers are at the root of the understanding of the earthquake mechanism. The theory is based on the assumption that each occurred earthquake discontinuity can be thought of as a generating source of FDL time series. (The mechanism could well be linked to planetary orbits). When future dates are derived from clustering and convergence from previous strong earthquake dates at an FDL time distance, then we have a high probability for an earthquake to occur on that date. We set up a real time system which generates FDL time series from each previous significant earthquake (>7R) and we produce a year to year calendar of high probability earthquake dates. We have tested this over a number of years with considerable success. We have applied this technique for strong (>7R) earthquakes across the globe as well as on a restricted region such as the Greek geographic region where the magnitude is small (>4R-6.5R). In both cases the success of the method is impressive. It is our belief that supplementing this method with

  8. Post-radiotherapeutic heart lesions

    International Nuclear Information System (INIS)

    Heart structures have traditionally been considered radioresistant. In fact all tissues subjected to radiotherapy can develop lesions. Possible damage includes: - pericardiac fibrosis, the commonest and best individualized, associated with a constriction this leads to a stoppage pattern usually occurring late, around the 18th month. Its frequency depends directly on the total radiation dose; - fibrous myocarditis by direct damage to the heart muscle; - stenosis type lesions of the large coronary trunks; - in exceptional cases lesions of the aorta: hyperplastic degenerescence of the intima and adventitia or of the aortic sigmoid valvules and the mitral valves. Three observations are reported, concerning a coronary, a pericardiac and a coronary, myocardiac and pericardiac lesion. Following this account the irradiation techniques and main experimental data are reviewed and the prophylactic and therapeutic consequences to be derived from our observations and those of the literature are examined

  9. Traumatic lesions of pulmonary parenchyma

    International Nuclear Information System (INIS)

    Five cases of post-traumatic pulmonary lesions (contusion, laceration and hematoma) are presented. The pathophysiology, radiological aspects and differential diagnosis are reviewed. The benign evolution showing the absorption in short time, without medical interference is emphasized. (Author)

  10. MRI of Focal Liver Lesions.

    Science.gov (United States)

    Albiin, Nils

    2012-05-01

    Magnetic resonance imaging, MRI has more advantages than ultrasound, computed tomography, CT, positron emission tomography, PET, or any other imaging modality in diagnosing focal hepatic masses. With a combination of basic T1 and T2 weighted sequences, diffusion weighted imaging, DWI, and hepatobiliary gadolinium contrast agents, that is gadobenate dimeglumine (Gd-BOPTA) and gadoxetic acid (Gd-EOB), most liver lesions can be adequately diagnosed. Benign lesions, as cyst, hemangioma, focal nodular hyperplasia, FNH or adenoma, can be distinguished from malignant lesions. In a non-cirrhotic liver, the most common malignant lesions are metastases which may be hypovascular or hypervascular. In the cirrhotic liver hepatocellular carcinoma, HCC, is of considerable importance. Besides, intrahepatic cholangiocarcinoma and other less common malignancies has to be assessed. In this review, the techniques and typical MRI features are presented as well as the new algorithm issued by American Association for the Study of the Liver Diseases (AASLD). PMID:23049491

  11. Rapid synthesis of macrocycles from diol precursors

    DEFF Research Database (Denmark)

    Wingstrand, Magnus; Madsen, Charlotte Marie; Clausen, Mads Hartvig

    2009-01-01

    A method for the formation of synthetic macrocycles with different ring sizes from diols is presented. Reacting a simple diol precursor with electrophilic reagents leads to a cyclic carbonate, sulfite or phosphate in a single step in 25-60% yield. Converting the cyclization precursor to a bis...

  12. Rheological behavior of precursor PPV monolayers

    NARCIS (Netherlands)

    Luinge, JW; Nijboer, GW; Hagting, JG; Vorenkamp, EJ; Fuller, GG; Schouten, AJ

    2004-01-01

    The rheological behavior of different precursor poly(p-phenylene vinylene) (prec-PPV) monolayers at the air-water interface was investigated using an interfacial stress rheometer (ISR). This device nicely reveals a transition of the precursor poly(2,5-dimethoxy-1,4 phenylene vinylene) (prec-DMePPV)

  13. Nanometals and colloids as catalyst precursors

    Energy Technology Data Exchange (ETDEWEB)

    Boennemann, H.H. [Max-Planck-Institut fuer Kohlenforschung (Germany)

    1995-12-01

    Mono- or plurimetallic nanometals and colloids stabilized by surfactant molecules are discussed as pre-prepared precursors for heterogeneous catalysts. This {open_quotes}precursor concept{close_quotes} provides a novel access to supported metal catalysts having active components of controlled particle size, intermetallic ratio and particle structure on surfaces. Possible applications will also be presented.

  14. Papillary Immature Metaplasia of the Anal Canal: A Low-grade Lesion That Can Mimic a High-grade Lesion.

    Science.gov (United States)

    Roberts, Jennifer M; Cornall, Alyssa M; Ekman, Deborah; Law, Carmella; Poynten, I Mary; Jin, Fengyi; Hillman, Richard J; Templeton, David J; Tabrizi, Sepehr N; Garland, Suzanne M; Thurloe, Julia K; Grulich, Andrew E; Farnsworth, Annabelle

    2016-03-01

    In a natural history study of anal human papillomavirus (HPV) infection and HPV-related lesions among homosexual men in Sydney, Australia, we identified 15 examples of papillary immature metaplasia (PIM) in anal biopsy samples. PIM has previously been described in the cervix, but not in the anal canal. PIM is a form of exophytic low-grade squamous intraepithelial lesion (eLSIL) also known as condyloma. In contrast to the maturing keratinocytes and koilocytosis seen in conventional eLSIL, the slender papillary structures of PIM have a surface population of immature squamous cells. In our anal samples PIM was characterized by close proximity to conventional eLSIL, was negative for p16 (p16) expression, and revealed the presence of a single low-risk HPV genotype (either 6 or 11) in laser capture microdissected lesions. The clinical significance of recognizing PIM lies in preventing misdiagnosis as high-grade squamous intraepithelial lesion, (the presumed precursor to anal cancer), due to the morphologic immaturity of the cell population. In routine practice, awareness of anal canal PIM and p16 immunostaining will prevent this. Further study of the natural history of anal canal PIM is needed. PMID:26551619

  15. Rosacea with extensive extrafacial lesions

    OpenAIRE

    Pereira, TM; Vieira, AP; Sousa-Basto, A.

    2008-01-01

    Rosacea is a very common skin disorder in the clinical practice that primarily affects the convex areas of the face. Extrafacial rosacea lesions have occasionally been described, but extensive involvement is exceptional. In the absence of its typical clinical or histological features, the diagnosis of extrafacial rosacea may be problematic. We describe an unusual case of rosacea with very exuberant extrafacial lesions, when compared with the limited involvement of the face.

  16. Cutaneous lesions of the nose

    OpenAIRE

    Altmeyer Peter; Paech Volker; Thrandorf Christina; Sand Daniel; Sand Michael; Bechara Falk G

    2010-01-01

    Abstract Skin diseases on the nose are seen in a variety of medical disciplines. Dermatologists, otorhinolaryngologists, general practitioners and general plastic and dermatologic surgeons are regularly consulted regarding cutaneous lesions on the nose. This article is the second part of a review series dealing with cutaneous lesions on the head and face, which are frequently seen in daily practice by a dermatologic surgeon. In this review, we focus on those skin diseases on the nose where su...

  17. Precursor films in wetting phenomena

    International Nuclear Information System (INIS)

    The spontaneous spreading of non-volatile liquid droplets on solid substrates poses a classic problem in the context of wetting phenomena. It is well known that the spreading of a macroscopic droplet is in many cases accompanied by a thin film of macroscopic lateral extent, the so-called precursor film, which emanates from the three-phase contact line region and spreads ahead of the latter with a much higher speed. Such films have been usually associated with liquid-on-solid systems, but in the last decade similar films have been reported to occur in solid-on-solid systems. While the situations in which the thickness of such films is of mesoscopic size are fairly well understood, an intriguing and yet to be fully understood aspect is the spreading of microscopic, i.e. molecularly thin, films. Here we review the available experimental observations of such films in various liquid-on-solid and solid-on-solid systems, as well as the corresponding theoretical models and studies aimed at understanding their formation and spreading dynamics. Recent developments and perspectives for future research are discussed. (topical review)

  18. Precursor films in wetting phenomena.

    Science.gov (United States)

    Popescu, M N; Oshanin, G; Dietrich, S; Cazabat, A-M

    2012-06-20

    The spontaneous spreading of non-volatile liquid droplets on solid substrates poses a classic problem in the context of wetting phenomena. It is well known that the spreading of a macroscopic droplet is in many cases accompanied by a thin film of macroscopic lateral extent, the so-called precursor film, which emanates from the three-phase contact line region and spreads ahead of the latter with a much higher speed. Such films have been usually associated with liquid-on-solid systems, but in the last decade similar films have been reported to occur in solid-on-solid systems. While the situations in which the thickness of such films is of mesoscopic size are fairly well understood, an intriguing and yet to be fully understood aspect is the spreading of microscopic, i.e. molecularly thin, films. Here we review the available experimental observations of such films in various liquid-on-solid and solid-on-solid systems, as well as the corresponding theoretical models and studies aimed at understanding their formation and spreading dynamics. Recent developments and perspectives for future research are discussed. PMID:22627067

  19. Unusual lesions of the mediastinum

    Directory of Open Access Journals (Sweden)

    Fatima Shamsuddin

    2015-01-01

    Full Text Available Objectives: To study unusual lesions in the mediastinum, which do not originate from the thymus, lymph nodes, neural tissues or germ cells, and tissues that normally engender pathologic lesions in the mediastinum. Materials and Methods: Of the 65 cases seen, 12 unusual lesion were encountered in a 5½ year period from 2006 to 2011. Results: Two cases of nodular colloid goiter and one each of the mediastinal cyst, undifferentiated carcinoma, and Langerhans cell histiocytosis (LCH affected the anterosuperior mediastinum. In the middle mediastinum, one case each of the mesothelioma, malignant gastrointestinal stromal tumor (GIST, squamous cell carcinoma (SCC, solitary fibrous tumor (SFT, and pleomorphic sarcoma (PS was seen. One case of meningeal melanocytoma (Mme and primary pleural liposarcoma (PL involved the posterior mediastinum. Persistent disease was seen in LCH after 2 years. Of all the cases with malignant lesions, only the patient with SCC was alive after 1 year. Conclusion: The cases of primary and SCC, LCH, melanocytoma, liposarcoma and PS, and GIST are unexpected and very rarely have paradigms in the mediastinum. Radiologic impression and knowledge of the compartment where these lesions arose from hardly assisted in arriving at a definitive opinion as the lesions were not typical of this location. A high index of suspicion and the immunohistochemical profile facilitated the final diagnosis.

  20. Simulation of spiculated breast lesions

    Science.gov (United States)

    Elangovan, Premkumar; Alrehily, Faisal; Pinto, R. Ferrari; Rashidnasab, Alaleh; Dance, David R.; Young, Kenneth C.; Wells, Kevin

    2016-03-01

    Virtual clinical trials are a promising new approach increasingly used for the evaluation and comparison of breast imaging modalities. A key component in such an assessment paradigm is the use of simulated pathology, in particular, simulation of lesions. Breast mass lesions can be generally classified into two categories based on their appearance; nonspiculated masses and spiculated masses. In our previous work, we have successfully simulated non-spiculated masses using a fractal growth process known as diffusion limited aggregation. In this new work, we have extended the DLA model to simulate spiculated lesions by using features extracted from patient DBT images containing spiculated lesions. The features extracted included spicule length, width, curvature and distribution. This information was used to simulate realistic looking spicules which were attached to the surface of a DLA mass to produce a spiculated mass. A batch of simulated spiculated masses was inserted into normal patient images and presented to an experienced radiologist for review. The study yielded promising results with the radiologist rating 60% of simulated lesions in 2D and 50% of simulated lesions in DBT as realistic.

  1. The Planck Legacy Archive

    Science.gov (United States)

    Dupac, X.; Arviset, C.; Fernandez Barreiro, M.; Lopez-Caniego, M.; Tauber, J.

    2015-12-01

    The Planck Collaboration has released in 2015 their second major dataset through the Planck Legacy Archive (PLA). It includes cosmological, Extragalactic and Galactic science data in temperature (intensity) and polarization. Full-sky maps are provided with unprecedented angular resolution and sensitivity, together with a large number of ancillary maps, catalogues (generic, SZ clusters and Galactic cold clumps), time-ordered data and other information. The extensive cosmological likelihood package allows cosmologists to fully explore the plausible parameters of the Universe. A new web-based PLA user interface is made public since Dec. 2014, allowing easier and faster access to all Planck data, and replacing the previous Java-based software. Numerous additional improvements to the PLA are also being developed through the so-called PLA Added-Value Interface, making use of an external contract with the Planetek Hellas and Expert Analytics software companies. This will allow users to process time-ordered data into sky maps, separate astrophysical components in existing maps, simulate the microwave and infrared sky through the Planck Sky Model, and use a number of other functionalities.

  2. Spatial Modeling of Colonic Lesions With Geographic Information Systems

    Science.gov (United States)

    Imanieh, Mohammad Hadi; Goli, Ali; Imanieh, Mohammad Hossein; Geramizadeh, Bita

    2014-01-01

    Background: Geographic information system (GIS) software has been used in health care systems to display and analyze spatial pattern of diseases and health services. Objectives: This study was performed to assess spatial patterns of colon’s pathologic lesions based on the pathologic reports and assess whether it is possible to use GIS software in health services. Patients and Methods: Archives of pathology of Namazi and Faghihi hospitals, two main referral centers of south-west of Iran, were obtained and reviewed between January 2009 and September 2011 for biopsy reports of patients who underwent colonoscopy. Abnormal biopsies were categorized into five different subgroups according to the type of pathologic specimens. By GIS, spatial patterns of colon biopsies were plotted in different maps and spatial auto-correlation of colon biopsies was calculated using the Moran’s Index. Results: A total of 4815 biopsies from 2663 different patients were reviewed, 53.8% of which were men. Abnormal biopsies were 2781 of all specimens (57.8%). Neoplastic lesions, inflammatory bowel diseases and polyps were 9.3%, 19.3% and 29.2% of total biopsies, respectively. Pathologic biopsies were more common in the distal colon. Maps of all biopsies and maps of specific pathologies were manifested in GIS. Conclusions: Our study showed that left-sided lesions are still more common in the Iranian population. On the other hand, surveying the right side of colon is as important as the distal part, which necessitates total colonoscopy. PMID:25763265

  3. Oral and Maxillofacial Lesions in an Elderly Population in Shiraz, Iran

    Directory of Open Access Journals (Sweden)

    Pardis

    2014-06-01

    Full Text Available Background Aging causes many changes in human physiology, increasing the risk of pathologic conditions in elderly populations. Different studies have shown higher frequency of oral and maxillofacial lesions in older people. Knowing the prevalence and distribution of these lesions can help dentists in screening these patients. Objectives This study aimed to evaluate the frequency and distribution of oral pathologic lesions among patients referred to Oral Pathology Department of Shiraz Dental School. Patients and Methods By referring to archives of Oral Pathology Department of Shiraz University of Medical Sciences, the histopathological reports of all 231 patients aged 60 years or over were reviewed. The data were described and analyzed using SPSS software. Chi-square test was performed and a P value less than 0.05 was considered significant. Results The most prevalent lesion was oral lichen planus (21.6%, followed by inflammatory fibrous hyperplasia (15.8% and squamous cell carcinoma (7.6%. There was a statistically significant difference between men and women in the occurrence of odontogenic cysts and dermatologic diseases. (P = 0.018 and 0.002, respectively;chi-square =5.63 and 9.47, respectively.Moreover, non-neoplastic lesions were the most prevalent group of lesions in this study. Conclusions High frequency of life-threatening oral conditions among elderly populations makes it essential for dentists to pay special attention to the most frequent lesions and help enhance the life quality of elderlies by early diagnosis and management of these diseases.

  4. Archival storage solutions for PACS

    Science.gov (United States)

    Chunn, Timothy

    1997-05-01

    While they are many, one of the inhibitors to the wide spread diffusion of PACS systems has been robust, cost effective digital archive storage solutions. Moreover, an automated Nearline solution is key to a central, sharable data repository, enabling many applications such as PACS, telemedicine and teleradiology, and information warehousing and data mining for research such as patient outcome analysis. Selecting the right solution depends on a number of factors: capacity requirements, write and retrieval performance requirements, scaleability in capacity and performance, configuration architecture and flexibility, subsystem availability and reliability, security requirements, system cost, achievable benefits and cost savings, investment protection, strategic fit and more.This paper addresses many of these issues. It compares and positions optical disk and magnetic tape technologies, which are the predominant archive mediums today. Price and performance comparisons will be made at different archive capacities, plus the effect of file size on storage system throughput will be analyzed. The concept of automated migration of images from high performance, high cost storage devices to high capacity, low cost storage devices will be introduced as a viable way to minimize overall storage costs for an archive. The concept of access density will also be introduced and applied to the selection of the most cost effective archive solution.

  5. Vendor neutral archive in PACS

    Directory of Open Access Journals (Sweden)

    Tapesh Kumar Agarwal

    2012-01-01

    Full Text Available An archive is a location containing a collection of records, documents, or other materials of historical importance. An integral part of Picture Archiving and Communication System (PACS is archiving. When a hospital needs to migrate a PACS vendor, the complete earlier data need to be migrated in the format of the newly procured PACS. It is both time and money consuming. To address this issue, the new concept of vendor neutral archive (VNA has emerged. A VNA simply decouples the PACS and workstations at the archival layer. This is achieved by developing an application engine that receives, integrates, and transmits the data using the different syntax of a Digital Imaging and Communication in Medicine (DICOM format. Transferring the data belonging to the old PACS to a new one is performed by a process called migration of data. In VNA, a number of different data migration techniques are available to facilitate transfer from the old PACS to the new one, the choice depending on the speed of migration and the importance of data. The techniques include simple DICOM migration, prefetch-based DICOM migration, medium migration, and the expensive non-DICOM migration. "Vendor neutral" may not be a suitable term, and "architecture neutral," "PACS neutral," "content neutral," or "third-party neutral" are probably better and preferred terms. Notwithstanding this, the VNA acronym has come to stay in both the medical IT user terminology and in vendor nomenclature, and radiologists need to be aware of its impact in PACS across the globe.

  6. The ``One Archive'' for JWST

    Science.gov (United States)

    Greene, G.; Kyprianou, M.; Levay, K.; Sienkewicz, M.; Donaldson, T.; Dower, T.; Swam, M.; Bushouse, H.; Greenfield, P.; Kidwell, R.; Wolfe, D.; Gardner, L.; Nieto-Santisteban, M.; Swade, D.; McLean, B.; Abney, F.; Alexov, A.; Binegar, S.; Aloisi, A.; Slowinski, S.; Gousoulin, J.

    2015-09-01

    The next generation for the Space Telescope Science Institute data management system is gearing up to provide a suite of archive system services supporting the operation of the James Webb Space Telescope. We are now completing the initial stage of integration and testing for the preliminary ground system builds of the JWST Science Operations Center which includes multiple components of the Data Management Subsystem (DMS). The vision for astronomical science and research with the JWST archive introduces both solutions to formal mission requirements and innovation derived from our existing mission systems along with the collective shared experience of our global user community. We are building upon the success of the Hubble Space Telescope archive systems, standards developed by the International Virtual Observatory Alliance, and collaborations with our archive data center partners. In proceeding forward, the “one archive” architectural model presented here is designed to balance the objectives for this new and exciting mission. The STScI JWST archive will deliver high quality calibrated science data products, support multi-mission data discovery and analysis, and provide an infrastructure which supports bridges to highly valued community tools and services.

  7. The new European Hubble archive

    Science.gov (United States)

    De Marchi, Guido; Arevalo, Maria; Merin, Bruno

    2016-01-01

    The European Hubble Archive (hereafter eHST), hosted at ESA's European Space Astronomy Centre, has been released for public use in October 2015. The eHST is now fully integrated with the other ESA science archives to ensure long-term preservation of the Hubble data, consisting of more than 1 million observations from 10 different scientific instruments. The public HST data, the Hubble Legacy Archive, and the high-level science data products are now all available to scientists through a single, carefully designed and user friendly web interface. In this talk, I will show how the the eHST can help boost archival research, including how to search on sources in the field of view thanks to precise footprints projected onto the sky, how to obtain enhanced previews of imaging data and interactive spectral plots, and how to directly link observations with already published papers. To maximise the scientific exploitation of Hubble's data, the eHST offers connectivity to virtual observatory tools, easily integrates with the recently released Hubble Source Catalog, and is fully accessible through ESA's archives multi-mission interface.

  8. Download - RGP physicalmap | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us RGP physical...e File Simple search and download 1 README README_e.html - 2 YAC contig information rgp_physicalmap_yac_cont...igs.zip (1 KB) Simple search and download 3 YAC clone information rgp_physicalmap_yac_clones.zip (18.7 KB) S...imple search and download 4 Insert size of YAC clones rgp_physicalmap_insert_size...ase Description Download License Update History of This Database Site Policy | Contact Us Download - RGP physicalmap | LSDB Archive ...

  9. The Need to Ethics on Archive Profession

    OpenAIRE

    Hind Ulwy

    2007-01-01

    An article about ethics in archive profession, it states the concept of the profession and professional ethics, then the relation between the ethical responsibility and legal responsibility. Finally, it discuss the need for ethical rules in archive profession

  10. Preparation of precursor for stainless steel foam

    Institute of Scientific and Technical Information of China (English)

    ZHOU Xiang-yang; LI Shan-ni; LI Jie; LIU Ye-xiang

    2008-01-01

    The effects of polyurethane sponge pretreatment and slurry compositions on the slurry loading in precursor were discussed, and the,performances of stainless steel foams prepared from precursors with different slurry loadings and different particle sizes of the stainless steel powder were also investigated. The experimental results show that the pretreatment of sponge with alkaline solution is effective to reduce the jam of cells in precursor and ensure the slurry to uniformly distribute in sponge, and it is also an effective method for increasing the slurry loading in precursor; the mass fraction of additive A and solid content in slurry greatly affect the slurry loading in precursor, when they are kept in 9%-13% and 52%-75%, respectively, the stainless steel foam may hold excellent 3D open-cell network structure and uniform muscles; the particle size of the stainless steel powder and the slurry loading in precursor have great effects on the bending strength, apparent density and open porosity of stainless steel foam; when the stainless steel powder with particle size of 44 tan and slurry loading of 0.5 g/cm3 in precursor are used, a stainless steel foam can be obtained, which has open porosity of 81.2%, bending strength of about 51.76 MPa and apparent density of about 1.0 g/cm3.

  11. Morphogenesis of the demyelinating lesions in Baló's concentric sclerosis.

    Science.gov (United States)

    Barz, Helmut; Barz, Ulrich; Schreiber, Almut

    2016-06-01

    In tissues with elastic properties, an edema causes a raised tissue pressure and therefore a diminished blood flow. The authors assume that an increased tissue pressure due to local and/or relapsing edema may be the cause for incomplete necrosis (e.g. demyelinated lesions) or seldom complete necrosis in the brain. Newly forming demyelinating lesions seldom show small tissue bands with normal appearing myelin sheaths in the immediate vicinity of precursor lesions (Baló type of MS). The small myelinated bands are the result of a "protected zone" on the edge of previous demyelinated lesions. The authors explain this protected zone with two arguments. Firstly, the resorptive granulation tissue of more or less older lesions is relatively rich in capillaries. These capillaries may act as an energy reservoir that can nourish not only the plaque, but also a narrow adjacent myelinated tissue band by diffusion, even if the capillary blood flow in this tissue band is limited due to the greater tissue pressure of a new developing lesion in the neighborhood. Secondly, another protective mechanism may act simultaneously: older or more sclerosed lesions and small adherent bands of myelinated tissue with them may swell less in cases of an edema than in normal tissue. The hardening of the older lesions is caused by proliferated fiber-forming astrocytes in the sense of scarring. In an area with an increased tissue pressure, the capillaries are less compressed in a sclerosed lesion than in regions of normal grey and white matter. In addition, the adherent myelinated tissue band closest to the edge of a hardened plaque is better protected against swelling and compression than the further away tissue. Theoretically, this protection zone is comparable with protected blood vessels in the Haversian canals or the medullary spaces of bones. Both theses of protecting mechanisms at the edges of demyelinated lesions support the assumption of a hypoxic causation principle of demyelinating

  12. The Archive of the Hero City Novorossiysk

    OpenAIRE

    Sergey A. Saneev

    2015-01-01

    The article considers the history and current state of the archive of the city Novorossiysk. The conversions of the Novorossiysk archive were closely connected with the milestones of the city’s history. The author analyzes the changes in the system of completion of funds, material resources and staffing of the archive. The most commonly used funds and the possibilities of using archival documents by researchers are characterized.

  13. Models and methods for web archive crawling

    OpenAIRE

    Denev, Dimitar

    2012-01-01

    Web archives offer a rich and plentiful source of information to researchers, analysts, and legal experts. For this purpose, they gather Web sites as the sites change over time. In order to keep up to high standards of data quality, Web archives have to collect all versions of the Web sites. Due to limited resuources and technical constraints this is not possible. Therefore, Web archives consist of versions archived at various time points without guarantee for mutual consistency. This thes...

  14. Introduction to accident sequence precursor methodology

    International Nuclear Information System (INIS)

    The report consists of the following sections: (1) Introduction to the issue (Use of accident sequence precursor (ASP) programs; Definition of ASP, indicators, information; Status of ASP evaluation methodology); (2) Selection of potential precursors; (3) Detailed analysis of selected potential precursors (Methodology; ASP analysis software; Indicators and presentation of results); Potential for ASP evaluation at Czech nuclear power plants (Procedure for Conditional Core Damage Probability and Event Importance assessment by the NRC method; Experience in ASP in the Czech Republic; Application of the ASP evaluation method to the Dukovany NPP); Plan of Activities; and Conclusions. (P.A.)

  15. Isolation and distribution of rabbit keratocyte precursors

    OpenAIRE

    Mimura, Tatsuya; Amano, Shiro; Yokoo, Seiichi; Uchida, Saiko; Usui, Tomohiko; Yamagami, Satoru

    2008-01-01

    Purpose To isolate multipotent precursors from the rabbit corneal stroma and to compare the distribution and proliferative capacity of keratocyte precursors obtained from the central and peripheral regions of the corneal stroma. Methods The rabbit corneal stroma was divided into a peripheral region (6.0–10.0 mm in diameter) and a central region (6.0 mm in diameter). A sphere-forming assay was then performed to isolate precursors from the stroma of each region. To promote differentiation, isol...

  16. Cystic parotid gland lesion evaluation

    International Nuclear Information System (INIS)

    We evaluated differential diagnoses of cystic parotid gland lesions and the efficacy of preoperative diagnosis. Of 191 parotid gland nodules resected between January 2003 and October 2008, 167 (87%) were benign and 24 (13%) malignant. Thirty-five parotid gland nodules whose components were almost cystic were enrolled in this study. All cystic lesions were retrospectively evaluated with respect to preoperative diagnostic examinations and histopathological confirmed diagnosis. Cystic components in surgical specimens were also evaluated histopathologically. The relationships with magnetic resonance imaging (MRI) findings and histopathological confirmed diagnosis were studied. Of 35 cystic lesions, 11 were complete cystic masses and had no mural nodules, while remaining 24 were incomplete and had mural nodules. Histopathological examinations showed that 5 were nonneoplastic, 27 were cystic degenerations of benign tumors, and 3 were cystic degenerations of malignant tumors. In the 11 complete cysts, preoperative diagnosis could not be made using any modality, whether with fine needle aspiration cytology (FNAC), salivary scintigraphy, or 67-gallium citrate scintigraphy. Of 24 incomplete cysts, only 9 cystic Warthin tumors were diagnosed correctly before surgery. Studies of cystic components in MRI and histopathology suggested that hemorrhagic degeneration of malignant tumors should be kept in mind for cystic lesions showing hemorrhagic portions. Cystic parotid gland lesions are difficult to diagnose correctly before surgery, but the evaluation of cystic components by MRI and FNAC is helpful in differentiating between benign and malignant tumors. (author)

  17. Physical Review Online Archives (PROLA)

    Energy Technology Data Exchange (ETDEWEB)

    Thomas, T.; Davies, J.; Kilman, D.; Laroche, F. [and others

    1997-05-01

    In cooperation with the American Physical Society, the Computer Research and Applications Group (CIC-3 -- see Section 13 for an acronym glossary) at Los Alamos National Laboratory has developed and deployed a journal archive system called, The Physical Review OnLine Archive (PROLA). It is intended to be a complete, full service on-line archive of the existing issues of the journal Physical Review from its inception to the advent of a full-service electronic version. The fundamental goals of PROLA are to provide screen-viewable and printable images of every article, full-text and fielded search capability, good browsing features, direct article retrieval tools, and hyperlinking to all references, errata, and comments. The research focus is on transitioning large volumes of paper journals to a modern electronic environment.

  18. Encoded Archival Description as a Halfway Technology

    Science.gov (United States)

    Dow, Elizabeth H.

    2009-01-01

    In the mid 1990s, Encoded Archival Description (EAD) appeared as a revolutionary technology for publishing archival finding aids on the Web. The author explores whether or not, given the advent of Web 2.0, the archival community should abandon EAD and look for something to replace it. (Contains 18 notes.)

  19. 50 CFR 635.33 - Archival tags.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 8 2010-10-01 2010-10-01 false Archival tags. 635.33 Section 635.33..., DEPARTMENT OF COMMERCE ATLANTIC HIGHLY MIGRATORY SPECIES Management Measures § 635.33 Archival tags. (a) Implantation report. Any person affixing or implanting an archival tag into a regulated species must...

  20. 36 CFR 1275.24 - Archival processing.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false Archival processing. 1275.24... THE NIXON ADMINISTRATION Preservation and Protection § 1275.24 Archival processing. When authorized by the Archivist and until the commencement of archival processing in accordance with subpart D of...

  1. Archiving in the networked world

    OpenAIRE

    Seadle, Michael

    2011-01-01

    Purpose – The purpose of this paper is to investigate how extensively LOCKSS/CLOCKSS, Portico, and e-Depot provide long-term digital archiving for the journals listed in the Directory of Open Access Journals (DOAJ). Design/methodology/approach – The paper uses publicly available online data, which are processed in a set of PERL programs to measure the number of DOAJ articles in the three archiving systems. Findings – The findings show that only 8 per cent of the DOAJ titles are in LOCKS...

  2. Laryngeal Squamous Intraepithelial Lesions: An Updated Review on Etiology, Classification, Molecular Changes, and Treatment.

    Science.gov (United States)

    Gale, Nina; Gnepp, Douglas R; Poljak, Mario; Strojan, Primož; Cardesa, Antonio; Helliwell, Tim; Šifrer, Robert; Volavšek, Metka; Sandison, Ann; Zidar, Nina

    2016-03-01

    Laryngeal carcinogenesis is a multistep process, characterized by an accumulation of genetic changes associated with architectural and cytologic alterations, ranging from squamous hyperplasia to carcinoma in situ and encompassed by the terminology of squamous intraepithelial lesions (SILs). The etiology, classification, genetic changes, and malignant progression of these lesions are reviewed. Tobacco remains the principal etiological factor with gastroesophageal reflux disease recently considered as a possible factor. In contrast, there is little evidence that microbiological agents, especially human papillomavirus infection, are frequently involved in laryngeal carcinogenesis and probably subjectivity, remains the mainstay of accurate diagnosis, prognosis, and guidance for a patient's treatment. The currently used classifications, the dysplasia system, squamous intraepithelial neoplasia, and the Ljubljana classification, reflect different standpoints on this important topic. The modified Ljubljana classification, with good interobserver agreement, could be considered as a proposal for a unified classification of laryngeal SILs. This review also briefly discusses recently discovered genetic changes, such as CDKN2A and CTNNB1 genes, and chromosome instability of chromosomes 1 and 7; however, none of these can at present improve histologic diagnosis. Malignant progression of precursor lesions varies from 2% to 74%, according to different studies. Cold-steel microinstruments, CO2 laser, and radiotherapy are used to treat the different grades of precursor lesions. There is as yet no worldwide agreement on the treatment of high-grade lesions and carcinoma in situ. PMID:26849814

  3. Renal lesions of nondomestic felids.

    Science.gov (United States)

    Newkirk, K M; Newman, S J; White, L A; Rohrbach, B W; Ramsay, E C

    2011-05-01

    To comprehensively evaluate the occurrence of renal lesions in a variety of nondomestic felids, necropsy cases from 1978 to 2008 were reviewed from a municipal zoo and a large cat sanctuary for those in which the kidneys were examined histologically. Seventy exotic felids were identified (25 tigers, 18 lions, 6 cougars, 5 leopards, 3 snow leopards, 3 clouded leopards, 3 Canadian lynx, 2 ocelots, 2 bobcats, 2 cheetahs, 1 jaguar), and their histologic renal lesions were evaluated and compared. The most common lesion was tubulointerstitial nephritis (TIN); 36 of 70 (51%) cats were affected to some degree. Lymphocytic interstitial nephritis was the most common lesion in the tigers (9 of 25, 36%) and was rarely seen in other species. Although the renal pelvis was not available for all cats, 28 of 47 (60%) had some degree of lymphocytic pyelitis. There was no significant association between the presence of pyelitis and that of TIN. Only 1 cat had pyelonephritis. Renal papillary necrosis was present in 13 of 70 (19%) cats and was significantly associated with historical nonsteroidal anti-inflammatory drug treatment (odds ratio, 7.1; 95% confidence interval, 1.9 to 26.8). Only 1 cat (lion) had amyloid accumulation, and it was restricted to the corticomedullary junction. Primary glomerular lesions were absent in all cats. Intraepithelial pigment was identified in many of the cats but was not correlated with severity of TIN. Despite several previous reports describing primary glomerular disease or renal amyloidosis in exotic felids, these lesions were rare to absent in this population. PMID:20876911

  4. Protein - TP Atlas | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available otein information on other websites. Data file File name: tp_atlas_protein.zip Fi...le URL: ftp://ftp.biosciencedbc.jp/archive/tp_atlas/LATEST/tp_atlas_protein.zip File size: 49.8 KB Simple se...arch URL http://togodb.biosciencedbc.jp/togodb/view/tp_atlas_protein#en Data acquisition method - Data analy

  5. Encoded Archival Context (EAC) and Archival Description: Rationale and Background

    Science.gov (United States)

    Szary, Richard V.

    2005-01-01

    The use of contextual information about the creators and users of archival and manuscript resources has always been a critical method for discovering and providing access to them. Traditionally, this information has been unstructured and ephemeral, being part of the knowledge that experienced staff bring to reference queries. The development of…

  6. Images - RPSD | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available ures of the proteins of plant seven kinds, such as rice. Data file File name: rpsd_images.zip File URL: ftp:...//ftp.biosciencedbc.jp/archive/rpsd/LATEST/rpsd_images.zip File size: 18.3 MB Sim

  7. Lesions of juxtacortical origin (surface lesions of bone)

    Energy Technology Data Exchange (ETDEWEB)

    Kenan, S. (Dept. of Orthopaedics, Mount Sinai School of Medicine, New York, NY (United States)); Abdelwahab, I.F. (Dept. of Radiology, Mount Sinai School of Medicine, New York, NY (United States)); Klein, M.J. (Dept. of Pathology, Mount Sinai School of Medicine, New York, NY (United States)); Hermann, G. (Dept. of Radiology, Mount Sinai School of Medicine, New York, NY (United States)); Lewis, M.M. (Dept. of Orthopaedics, Mount Sinai School of Medicine, New York, NY (United States))

    1993-01-01

    A large variety of tumor and tumor-like conditions have been shown to originate from the surface of bone. Most surface lesions are associated with periosteal reaction. The periosteum is a multipotential membrane. Its cellular composition may give rise to a variety of both neoplasms and tumor-like conditions. To avoid misinterpretation, the orthopedist, radiologist, and pathologist should be familiar with the entire spectrum of surface lesions. A better understanding of the natural history and biological behavior at different lesional maturity stages and correlation of the history with the radiographic and pathological findings is essential to establish the correct diagnosis. A history of injury of blunt trauma is very important. A stress fracture may produce a periosteal reaction acd callus that can be difficult to distinguish from osteosarcoma. In this review article, the authors wish to describe and define each term by its anatomy and radiographic features while discussing the entire spectrum of surface lesions. All the illustrative cases in this review article have been proven histologically. (orig.)

  8. Precursor Parameter Identification for IGBT Prognostics

    Data.gov (United States)

    National Aeronautics and Space Administration — Precursor parameters have been identified to enable development of a prognostic approach for insulated gate bipolar transistors (IGBT). The IGBT were subjected to...

  9. Progress in molecular precursors for electronic materials

    Energy Technology Data Exchange (ETDEWEB)

    Buhro, W.E. [Washington Univ., St. Louis, MO (United States)

    1996-09-01

    Molecular-precursor chemistry provides an essential underpinning to all electronic-materials technologies, including photovoltaics and related areas of direct interest to the DOE. Materials synthesis and processing is a rapidly developing field in which advances in molecular precursors are playing a major role. This article surveys selected recent research examples that define the exciting current directions in molecular-precursor science. These directions include growth of increasingly complex structures and stoichiometries, surface-selective growth, kinetic growth of metastable materials, growth of size-controlled quantum dots and quantum-dot arrays, and growth at progressively lower temperatures. Continued progress in molecular-precursor chemistry will afford precise control over the crystal structures, nanostructures, and microstructures of electronic materials.

  10. Profiling Identifies Precursor Suspects: Notch Family Again!

    OpenAIRE

    Breunig, Joshua J.; Rakic, Pasko

    2010-01-01

    Newborn neurons in the adult dentate gyrus pass through several distinct precursor and progenitor classes prior to differentiation. In this issue of Cell Stem Cell, Lugert et al. (2010) characterized their strikingly different proliferative behaviors after neurogenic stimuli or aging.

  11. Flexibilidad y lesiones de futbolistas

    OpenAIRE

    Gocebate, Verónica

    2014-01-01

    Cabe destacar que en deporte se requiere de una correcta preparación física y el caso del fútbol no es diferente a cualquier otro. Este es un deporte en equipo que genera un desgaste físico y mental en cada partido en el cual se pueden sufrir diferentes lesiones. Son varios los factores que predisponen a que se produzcan lesiones, por lo que es importante un correcto entrenamiento diario. Objetivo: Determinar la relación entre los niveles de flexibilidad de la cadena muscula...

  12. Lesion detectability in digital radiography

    Science.gov (United States)

    Gagne, Robert M.; Boswell, Jonathan S.; Myers, Kyle J.; Peter, Guillaume

    2001-06-01

    The usefulness of Fourier-based measures of imaging performance has come into question for the evaluation of digital imaging systems. Figures of merit such as detective quantum efficiency are relevant for linear, shift-invariant systems with stationary noise. However, no digital imaging system is shift invariant, and realistic images do not satisfy the stationarity condition. Our methods for task- based evaluation of imaging systems, based on lesion detectability, do not require such assumptions. We have computed the performance of Hotelling and nonprewhitening matched-filter observers for the task of lesion detection in digital radiography.

  13. The Essex-Lopresti lesion

    OpenAIRE

    Wegmann, K.; Dargel, J; Burkhart, K. J.; Brüggemann, G. P.; Müller, L. P.

    2012-01-01

    The Essex-Lopresti lesion represents a severe injury of the forearm unit. In the 1940s, it’s pathology and consequences have already been mentioned by several authors. Over the course of time, the pathophysiology of the lesion was displayed in more detail. Therefore, an intensive analysis of the involved anatomic structures was done. The interosseous membrane was shown to play a major role in stabilising the forearm unit, in the situation of a fractured radial head, which is the primary stabi...

  14. Localized lesions in secondary syphillis

    International Nuclear Information System (INIS)

    The clinical manifestations of secondary syphilis are variable and can mimic many skin diseases, mostly being generalized and symmetrical in distribution. Localized lesions of secondary syphilis are rarely seen in dermatology clinics. We report an unusual presentation wherein a patient had localized lesions over face and soles only. There is a need for increased awareness on the part of physicians to recognize new patterns of syphilitic infection, together with a willingness to consider the diagnosis of syphilis in patients with unusual clinical features. (author)

  15. Lesiones frecuentes en atletas profesionales

    OpenAIRE

    Doyel, Crevecoer

    2015-01-01

    Durante la práctica del atletismo frecuentemente ocurren lesiones, afectando principalmente a los miembros inferiores. Las causas que las originan son muy diversas y tienen diferentes características de acuerdo al tipo de modalidad realizada dentro del atletismo. Objetivo: Analizar las características de las lesiones más frecuentes en miembros inferiores, en atletas corredores profesionales, de diferentes distancias, de ambos sexos, de entre 18 y 40 años de edad, que practican atletismo en...

  16. Molecular Mechanism and Potential Targets for Blocking HPV-Induced Lesion Development

    Directory of Open Access Journals (Sweden)

    E. Guzmán-Olea

    2012-01-01

    Full Text Available Persistent infection with high-risk HPV is the etiologic agent associated with the development of cervical cancer (CC development. However, environmental, social, epidemiological, genetic, and host factors may have a joint influence on the risk of disease progression. Cervical lesions caused by HPV infection can be removed naturally by the host immune response and only a small percentage may progress to cancer; thus, the immune response is essential for the control of precursor lesions and CC. We present a review of recent research on the molecular mechanisms that allow HPV-infected cells to evade immune surveillance and potential targets of molecular therapy to inhibit tumor immune escape.

  17. Molecular Mechanism and Potential Targets for Blocking HPV-Induced Lesion Development.

    Science.gov (United States)

    Guzmán-Olea, E; Bermúdez-Morales, V H; Peralta-Zaragoza, O; Torres-Poveda, K; Madrid-Marina, V

    2012-01-01

    Persistent infection with high-risk HPV is the etiologic agent associated with the development of cervical cancer (CC) development. However, environmental, social, epidemiological, genetic, and host factors may have a joint influence on the risk of disease progression. Cervical lesions caused by HPV infection can be removed naturally by the host immune response and only a small percentage may progress to cancer; thus, the immune response is essential for the control of precursor lesions and CC. We present a review of recent research on the molecular mechanisms that allow HPV-infected cells to evade immune surveillance and potential targets of molecular therapy to inhibit tumor immune escape. PMID:22220169

  18. Functional Analyses and Treatment of Precursor Behavior

    OpenAIRE

    Najdowski, Adel C; Wallace, Michele D; Ellsworth, Carrie L; MacAleese, Alicia N; Cleveland, Jackie M

    2008-01-01

    Functional analysis has been demonstrated to be an effective method to identify environmental variables that maintain problem behavior. However, there are cases when conducting functional analyses of severe problem behavior may be contraindicated. The current study applied functional analysis procedures to a class of behavior that preceded severe problem behavior (precursor behavior) and evaluated treatments based on the outcomes of the functional analyses of precursor behavior. Responding fo...

  19. Sequestration and Transport of Lignin Monomeric Precursors

    OpenAIRE

    Ke-Wei Zhang; Yu-Chen Miao; Chang-Jun Liu

    2011-01-01

    Lignin is the second most abundant terrestrial biopolymer after cellulose. It is essential for the viability of vascular plants. Lignin precursors, the monolignols, are synthesized within the cytosol of the cell. Thereafter, these monomeric precursors are exported into the cell wall, where they are polymerized and integrated into the wall matrix. Accordingly, transport of monolignols across cell membranes is a critical step affecting deposition of lignin in the secondarily thickened cell wall...

  20. Milk proteins as precursors of bioactive peptides

    OpenAIRE

    Marta Dziuba; Bartłomiej Dziuba; Anna Iwaniak

    2009-01-01

    Milk proteins, a source of bioactive peptides, are the subject of numerous research studies aiming to, among others, evaluate their properties as precursors of biologically active peptides. Physiologically active peptides released from their precursors may interact with selected receptors and affect the overall condition and health of humans. By relying on the BIOPEP database of proteins and bioactive peptides, developed by the Department of Food Biochemistry at the University of Warmia and M...

  1. Disseminated paracoccidioidomycosis diagnosis based on oral lesions

    Directory of Open Access Journals (Sweden)

    Liana Preto Webber

    2014-01-01

    Full Text Available Paracoccidioidomycosis (PCM is a deep mycosis with primary lung manifestations that may present cutaneous and oral lesions. Oral lesions mimic other infectious diseases or even squamous cell carcinoma, clinically and microscopically. Sometimes, the dentist is the first to detect the disease, because lung lesions are asymptomatic, or even misdiagnosed. An unusual case of PCM with 5 months of evolution presenting pulmonary, oral, and cutaneous lesions that was diagnosed by the dentist based on oral lesions is presented and discussed.

  2. Central versus institutional self-archiving

    OpenAIRE

    Harnad, Stevan

    2006-01-01

    NIH's, PLoS's, the Wellcome Trust's and now the UK MRC's unreflective support for PubMed Central (PMC), a Central Repository (CR), as the locus for direct self-archiving by authors is very unfortunate for Institutional Repositories (IRs), for self-archiving, and for Open Access (OA) progress in general. Alma Swan has published key papers on both OA self-archiving policy and institutional versus central self-archiving (IRs vs. CRs) analysing the reasons. (a) Institutional self-archiving and ce...

  3. Archiving Reproducible Research with R and Dataverse

    DEFF Research Database (Denmark)

    Leeper, Thomas

    2014-01-01

    Reproducible research and data archiving are increasingly important issues in research involving statistical analyses of quantitative data. This article introduces the dvn package, which allows R users to publicly archive datasets, analysis files, codebooks, and associated metadata in Dataverse...... Network online repositories, an open-source data archiving project sponsored by Harvard University. In this article I review the importance of data archiving in the context of reproducible research, introduce the Dataverse Network, explain the implementation of the dvn package, and provide example code...... for archiving and releasing data using the package....

  4. Prevalence of Human Papilloma Virus Infection in Malignant Lesions of the Uterine Cervix in Morocco

    International Nuclear Information System (INIS)

    Cervical cancer is one of the most common tumors afflicting women with a disproportionate mortality occurring in developing countries. The aim of this study was to determine the prevalence of high-risk oncogenic human Papilloma viruses (HPVs) in 193 archival cervical lesions of Moroccan women. The presence of high-risk HPVs in paraffin-embedded, formaldehyde-fixed cervical lesion specimens was detected by Polymerase Chain Reaction (PCR) using consensus primers complementary to late 1 (L1) gene of the genital HPVs. Amplified PCR products were verified and typed by Southern blot analysis using P-32 labeled DNA probes. HPV prevalence was found to be 89% in malignant lesions (138/155) and 68.4% in premalignant lesions (26/38). HPV 16 was detected in 61% (100/164); whereas HPV 18 in 33.5% (55/164), HPV 31 in 1.8% (3/164), HPV 33 in 1.2% (2/164), HPV 35 in 7.3% (12/164), and HPV 45 in 3.7 % (6/164) of lesions. Notably, multiple HPV type co-infections occurred only in malignant lesions and were present in 20.1% (33/164) of cases. The most common co-infection was HPV types 16 and 18, followed by HPV types 16 and 35. Thus, a high prevalence of HPV16/18 was observed in archival cervical cancers. Hence, relevant HPV typing information in cervical cancer is very important for further HPV vaccines design and application. (author)

  5. Imaging inflammatory acne: lesion detection and tracking

    Science.gov (United States)

    Cula, Gabriela O.; Bargo, Paulo R.; Kollias, Nikiforos

    2010-02-01

    It is known that effectiveness of acne treatment increases when the lesions are detected earlier, before they could progress into mature wound-like lesions, which lead to scarring and discoloration. However, little is known about the evolution of acne from early signs until after the lesion heals. In this work we computationally characterize the evolution of inflammatory acne lesions, based on analyzing cross-polarized images that document acne-prone facial skin over time. Taking skin images over time, and being able to follow skin features in these images present serious challenges, due to change in the appearance of skin, difficulty in repositioning the subject, involuntary movement such as breathing. A computational technique for automatic detection of lesions by separating the background normal skin from the acne lesions, based on fitting Gaussian distributions to the intensity histograms, is presented. In order to track and quantify the evolution of lesions, in terms of the degree of progress or regress, we designed a study to capture facial skin images from an acne-prone young individual, followed over the course of 3 different time points. Based on the behavior of the lesions between two consecutive time points, the automatically detected lesions are classified in four categories: new lesions, resolved lesions (i.e. lesions that disappear completely), lesions that are progressing, and lesions that are regressing (i.e. lesions in the process of healing). The classification our methods achieve correlates well with visual inspection of a trained human grader.

  6. Natural Learning Case Study Archives

    Science.gov (United States)

    Lawler, Robert W.

    2015-01-01

    Natural Learning Case Study Archives (NLCSA) is a research facility for those interested in using case study analysis to deepen their understanding of common sense knowledge and natural learning (how the mind interacts with everyday experiences to develop common sense knowledge). The database comprises three case study corpora based on experiences…

  7. Archived film analysis and restoration

    NARCIS (Netherlands)

    Rares, A.

    2004-01-01

    The progressive degradation of current film archives poses a serious threat to the preservation of our cultural and technical heritage. Digitization and digital restoration are currently the most viable solutions for the long term preservation and high quality restoration of filmed material. They al

  8. Teacher Evaluation: Archiving Teaching Effectiveness

    Science.gov (United States)

    Nielsen, Lance D.

    2014-01-01

    Teacher evaluation is a current hot topic within music education. This article offers strategies for K-12 music educators on how to promote their effectiveness as teachers through archival documentation in a teacher portfolio. Using the Danielson evaluation model (based on four domains of effective teaching practices), examples of music teaching…

  9. Preservation and Archives in Vietnam.

    Science.gov (United States)

    Henchy, Judith

    This report, based on visits to Vietnamese libraries and archives between 1987 and 1997, examines the largely unexplored corpus of Vietnamese textual resources in research institutions and libraries there and elsewhere, the associated problems of bibliographic control, and issues of preservation. The following topics are addressed: the history of…

  10. Odontogenic lesions in pediatric patients.

    Science.gov (United States)

    Fang, Qi-Gen; Shi, Shuang; Sun, Chang-Fu

    2014-05-01

    The purpose was to evaluate our 20-year experience of pediatric odontogenic lesions. Pediatric patients with a diagnosis of odontogenic lesion were identified. Three hundred ten patients were odontogenic; dentigerous cyst was seen in 62.0% of the cases. Most (70.2%) of them occurred in mixed dentition period, and it had a male preponderance. Odontogenic keratocystic tumor occurred in the permanent dentition period. It had an equal site distribution. Odontoma was seen in 20.0% of the cases. Its site of predilection was the mandible. Ameloblastoma was the most common odontogenic tumor. Most of the cases occurred in the permanent dentition period. It affected the male and female equally. Calcifying epithelioma odontogenic tumor was seen in 11.8% of the cases. All the lesions occurred in the primary dentition period. It had no sex or site preponderance. Myxoma was seen in 3.6% of the cases. It was most common in the permanent dentition period, and it was more frequent in the male. Iliac crest bone graft was successfully performed in 28 patients, postoperative infection occurred in 2 patients, and no donor-site dysfunctions were reported. The observed differences in lesion type and distribution in this study compared with previous researches may be attributable to genetic and geographic variation in the populations studied. Iliac crest bone graft was suggested for pediatric mandible reconstruction. PMID:24785745

  11. Pigmented Lesions of the Vulva

    Directory of Open Access Journals (Sweden)

    Gürol Açıkgöz

    2012-06-01

    Full Text Available Pigmented lesions on the vulva are rare and their non specific features cause difficulties in their diagnosis and differential diagnosis. Because of their localization, it is difficult to follow up vulvar lesions, which are generally noticed coincidentally by patients. Vulvar pigmented lesions are classified clinically as macules/papules and patches/plaques to provide ease of the diagnosis. Nevi, angiokeratomas, seborrheic keratosis, melanoma, basal cell carcinoma and squamous cell carcinoma are classified under the macules/papules, and post-inflammatory hyperpigmentation, physiological hyperpigmentation, melanosis and acanthosis nigricans are classified under the patch/plaque. Dermatoscopic examination, which is increasing recently, is very valuable for avoiding possible cosmetic and functional complications of surgical procedures. However, epidermal pigmentations such as vulvar melanosis and vulvar intraepitelyal neoplazi are dermatoscopically indistinguishable. It may also be difficult to diagnose vulvar melanoma clinically and dermatoscopically. Histological examination is the gold standard for the diagnosis of pigmented vulvar lesions, which are clinically and dermatoscopically indistinguishable. (Turk J Dermatol 2012; 6: 39-44

  12. Stereotactic lesioning for mental illness

    International Nuclear Information System (INIS)

    The authors report stereotactically created lesioning by radiofrequency or Cyberknife radiosurgery for patients with mental illness. Since 1993, thirty-eight patients have undergone stereotactic psychosurgery for medically intractable mental illnesses. Two patients had aggressive behavior. Twenty-five patients suffered from Obsessive-Compulsive Disorder (OCD) and ten patients had depression. Another patient suffered from atypical psychosis. Bilateral amygdalotomy and subcaudate tractotomy were done for aggressive behavior. Limbic leucotomy or anterior cingulotomy was done for CCD and subcaudate tractotomy with or without cingulotomy was done for depression. In twenty-three patients, the lesions were made by a radiofrequency (RF) lesion generator. In fifteen cases, the lesions were made with Cyberknife Radiosurgery (CKRS). The Overt Aggression Scale (OAS) declined from 8 to 2 with clinical improvement during follow up period. With long-term follow up (meaning 57 months) in 25 OCDs, the mean Yale Brown Obsessive Compulsive Score (YBOCS) declined from 34 to 13 (n = 25). The Hamilton Depression scale (HAMD) for ten patients with depression declined from 38.5 to 10.5 (n = 10). There was no operative mortality and no significant morbidity except one case with transient urinary incontinence. Authors suggest that stereotactic psychosurgery by RF and CKRS could be a safe and effective means of treating some medically intractable mental illnesses. (author)

  13. Microbiological aspects of endoperiodontal lesion

    Directory of Open Access Journals (Sweden)

    Cristiane Tokunaga

    2013-06-01

    Full Text Available Introduction: The endoperiodontal lesion occurs when a tooth undergoing endodontic disease is united to a periodontal lesion with apical progression. Many times, the differential diagnosis between the endodontic and periodontal disease can be of difficult execution and the correct diagnosis and planing of the treatment is of main importance for a good prognosis Objective: To identify the main microorganisms within the lesion of endodontic and periodontal origin and correlate them with the endoperiodontal lesion. Literature review: The search strategy comprised the electronic studies of databases such as PubMed and Cochrane on the microbiology of the endodontic and periodontal systems through employing the following keywords: microbiology, endodontics, periodontal pocket. Results: There were similarities in the endodontic and periodontal microflora. However, the number of microorganisms within the cross infection is limited, including Bacteroides, Eubacteria, Fusobacteria, spirochaetes, Wolinella. The bacterias forming the red complex are closely related to the severity of the periodontal disease and can also participate in the pathogenesis of the periradicular abscesses. Conclusion: There are many communication routes between the periodontium and pulpal tissue, therefore the contamination from um tissue to another can occur, existing a microbiological inter-relationship between these tissues.

  14. Secondary syphilis lesions resembling pityriasis

    International Nuclear Information System (INIS)

    This case report describes a male patient who presented with generalized, centrally-ulcerated papules with crusts and hypopigmented macules. Initially, differential diagnostic considerations included pityriasis lichenoides but the serology for syphilis was positive and there was a rapid response to penicillin with clearing of the lesions at the end of three weeks treatment. (author)

  15. Scalable Data Mining and Archiving for the Square Kilometre Array

    Science.gov (United States)

    Jones, D. L.; Mattmann, C. A.; Hart, A. F.; Lazio, J.; Bennett, T.; Wagstaff, K. L.; Thompson, D. R.; Preston, R.

    2011-12-01

    curation and automatic ingestion for the MeerKAT/KAT-7 precursor instrument in South Africa, helping to catalog and archive correlator and sensor output from KAT-7, and to make the information available for downstream science analysis. These efforts, supported by the increasing availability of high-quality open source software, represent a concerted effort to seek a cost-conscious methodology for maintaining the integrity of observational data from the upstream instrument to the archive, and at the same time ensuring that the data, with its richly annotated catalog of meta-data, remains a viable resource for research into the future.

  16. Archives of Atmospheric Lead Pollution

    Science.gov (United States)

    Weiss, Dominik; Shotyk, William; Kempf, Oliver

    Environmental archives such as peat bogs, sediments, corals, trees, polar ice, plant material from herbarium collections, and human tissue material have greatly helped to assess both ancient and recent atmospheric lead deposition and its sources on a regional and global scale. In Europe detectable atmospheric lead pollution began as early as 6000years ago due to enhanced soil dust and agricultural activities, as studies of peat bogs reveal. Increased lead emissions during ancient Greek and Roman times have been recorded and identified in many long-term archives such as lake sediments in Sweden, ice cores in Greenland, and peat bogs in Spain, Switzerland, the United Kingdom, and the Netherlands. For the period since the Industrial Revolution, other archives such as corals, trees, and herbarium collections provide similar chronologies of atmospheric lead pollution, with periods of enhanced lead deposition occurring at the turn of the century and since 1950. The main sources have been industry, including coal burning, ferrous and nonferrous smelting, and open waste incineration until c.1950 and leaded gasoline use since 1950. The greatest lead emissions to the atmosphere all over Europe occurred between 1950 and 1980 due to traffic exhaust. A marked drop in atmospheric lead fluxes found in most archives since the 1980s has been attributed to the phasing out of leaded gasoline. The isotope ratios of lead in the various archives show qualitatively similar temporal changes, for example, the immediate response to the introduction and phasing out of leaded gasoline. Isotope studies largely confirm source assessments based on lead emission inventories and allow the contributions of various anthropogenic sources to be calculated.

  17. TUMOR SUPPRESSOR GENE TP53 MUTATIONS IN ATYPICAL VASCULAR LESIONS OF THE BREAST SKIN FOLLOWING RADIOTHERAPY

    OpenAIRE

    Santi, Raffaella; Cetica, Valentina; Franchi, Alessandro; Pepi, Monica; Cesinaro, Anna Maria; Miracco, Clelia; Paglierani, Milena; De Giorgi, Vincenzo; Delfino, Chiara; Difonzo, Elisa Margherita; Pimpinelli, Nicola; Bianchi, Simonetta; Sardi, Iacopo; Santucci, Marco; Massi, Daniela

    2011-01-01

    Abstract Atypical vascular lesions (AVL) occurring at the site of radiotherapy represent an uncommon but well-documented complication in the setting of breast-conserving therapy for breast carcinoma. Although the biological behavior of AVL has been regarded to be benign, it has been suggested that AVL may represent a precursor of angiosarcoma. A better understanding of the biology of AVL is essential in order to assess appropriate patient management. The purpose of the present s...

  18. Imaging of Chest Wall Lesions in Children

    Directory of Open Access Journals (Sweden)

    A. Hekmatnia

    2008-01-01

    Full Text Available Chest wall lesions in childhood include a wide range of pathologies; Benign lesions include lipoma, neurofibroma, lymphangioma, hemangioma, and mesenchymal hamartoma."nMalignant lesions include Neuroblastoma, Rhabdo-myosarcoma, Ewing sarcoma, and Askin tumor."nSystemic diseases such as leukemia, lymphoma, Langerhans cell histiocytosis, and also infections such as tuberculosis, and actinomycosis may also cause chest wall lesions."nThe imaging characteristics of these lesions are re-viewed, but only a minority of the lesions shows diagnostic imaging features, and most of lesions re-quire biopsy and histopathological examination for "ndefinitive diagnosis."nThe role of different modalities is discussed with an emphasis on magnetic resonance imaging for demonstrating lesion morphology and local spread. Computed tomography and neuclear medicine being used mainly to assess remote disease."nIn this lecture, we discuss about imaging of chest wall lesions in children.

  19. Petrous apex lesions in the pediatric population

    Energy Technology Data Exchange (ETDEWEB)

    Radhakrishnan, Rupa [University of Cincinnati College of Medicine, Department of Radiology, Cincinnati, OH (United States); Cincinnati Children' s Hospital Medical Center, Department of Radiology, Cincinnati, OH (United States); Son, Hwa Jung [University of Cincinnati College of Medicine, Department of Otolaryngology-Head and Neck Surgery, Cincinnati, OH (United States); Koch, Bernadette L. [Cincinnati Children' s Hospital Medical Center, Department of Radiology, Cincinnati, OH (United States)

    2014-03-15

    A variety of abnormal imaging findings of the petrous apex are encountered in children. Many petrous apex lesions are identified incidentally while images of the brain or head and neck are being obtained for indications unrelated to the temporal bone. Differential considerations of petrous apex lesions in children include ''leave me alone'' lesions, infectious or inflammatory lesions, fibro-osseous lesions, neoplasms and neoplasm-like lesions, as well as a few rare miscellaneous conditions. Some lesions are similar to those encountered in adults, and some are unique to children. Langerhans cell histiocytosis (LCH) and primary and metastatic pediatric malignancies such as neuroblastoma, rhabomyosarcoma and Ewing sarcoma are more likely to be encountered in children. Lesions such as petrous apex cholesterol granuloma, cholesteatoma and chondrosarcoma are more common in adults and are rarely a diagnostic consideration in children. We present a comprehensive pictorial review of CT and MRI appearances of pediatric petrous apex lesions. (orig.)

  20. Coming out in the archives: the Hall-Carpenter Archives at the London School of Economics

    OpenAIRE

    Donnelly, Sue

    2008-01-01

    The archive and journal collections of the Hall-Carpenter Archives (HCA) have been housed at the LSE since 1988. The archive, named in honour of novelist Radclyffe Hall and socialist writer, Edward Carpenter, was founded in 1982 to document the development of gay activism in the UK since the publication of the Wolfenden Report in 1958. The archive operated as an independent archive based at the London Lesbian and Gay Centre for several years before being transferred to the Archives of the Lon...

  1. Molecular mechanisms of cholangiocarcinogenesis: are biliary intraepithelial neoplasia and intraductal papillary neoplasms of the bile duct precursors to cholangiocarcinoma?

    Science.gov (United States)

    Bickenbach, Kai; Galka, Eva; Roggin, Kevin King

    2009-04-01

    Cholangiocarcinoma (CC) is a rare, malignant neoplasm that can develop from any site within the intrahepatic or extrahepatic biliary tree. Although the key steps of cholangiocarcinogenesis remain unknown, it has been hypothesized that CC may develop through two key premalignant precursor lesions: biliary intraepithelial neoplasia (BilIN) and intraductal papillary neoplasm of the bile duct (IPNB). These lesions probably are analogous to pancreatic intraepithelial neoplasia and intraductal papillary mucinous neoplasm, respectively. This article outlines the molecular basis of cholangiocarcinogenesis through the BilIN and IPNB pathways. It highlights the genetic mutations that alter cellular proliferation, tumor suppression, and impairment of critical mucinous, cell-adhesion, and matrix proteins. PMID:19306808

  2. Database Description - RMG | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us RMG Database... Description General information of database Database name RMG Alternative name Rice Mitochondri...ational Institute of Agrobiological Sciences E-mail : Database classification Nucleotide Sequence Databases ...Organism Taxonomy Name: Oryza sativa Japonica Group Taxonomy ID: 39947 Database description This database co...e of rice mitochondrial genome and information on the analysis results. Features and manner of utilization of database

  3. Database Description - RPSD | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us RPSD Database... Description General information of database Database name RPSD Alternative name Summary inform...n National Institute of Agrobiological Sciences Toshimasa Yamazaki E-mail : Database classification Structure Database...idopsis thaliana Taxonomy ID: 3702 Taxonomy Name: Glycine max Taxonomy ID: 3847 Database description We have...nts such as rice, and have put together the result and related informations. This database contains the basi

  4. Home | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available downloadable, it may not be fully used, cited or rightly acknowledged by the (research) communities. This i...nstitute of Agrobiological Sciences Junichi Yonemaru QTL Rice The database of Rice QTL information extracted from published research...r contribution of each research to life science. Lifescience Database Archive Arc...n forms friendly to different types of users in public and private institutions, and thereby supports furthe

  5. Comment - Taxonomy Icon | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...ame of species Icon File name of the icon (The icon is displayed in Simple Search.) Image File name of the i...mage posted on the icon entry (The image is displayed in Simple Search.) License License of the image posted... on the icon entry (This License information is shown at Image column in Simple Search

  6. Protein - Trypanosomes Database | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credit s ] BLAST Search Image Search Home About Archive Update History Contact us Trypanosomes ... ail Data name Protein Description of data contents It ... is a summaly table of protein information; such as ... otein. There is also information of candidate inhibit or of the protein. Data file File name: trypanosome ... ciencedbc.jp/togodb/view/trypanosome#en Data acquisit ion method - Data analysis method - Number of data ... entries 17 entries Data it em Description symbol Symbol of the protein name Na ...

  7. The Gaia Archive at ESAC: a VO-inside archive

    Science.gov (United States)

    Gonzalez-Nunez, J.

    2015-12-01

    The ESDC (ESAC Science Data Center) is one of the active members of the IVOA (International Virtual Observatory Alliance) that have defined a set of standards, libraries and concepts that allows to create flexible,scalable and interoperable architectures on the data archives development. In the case of astronomy science that involves the use of big catalogues, as in Gaia or Euclid, TAP, UWS and VOSpace standards can be used to create an architecture that allows the explotation of this valuable data from the community. Also, new challenges arise like the implementation of the new paradigm "move code close to the data", what can be partially obtained by the extension of the protocols (TAP+, UWS+, etc) or the languages (ADQL). We explain how we have used VO standards and libraries for the Gaia Archive that, not only have producing an open and interoperable archive but, also, minimizing the developement on certain areas. Also we will explain how we have extended these protocols and the future plans.

  8. Lethal, potentially lethal lesion model

    Energy Technology Data Exchange (ETDEWEB)

    Curtis, S.B.

    1983-07-01

    A theoretical framework to describe the formation of lethal mutations by radiation is presented. Lesions that are repaired (and misrepaired) in each type of experiment described (delayed plating and split dose) are assumed to be the same. In this model the same (potentially lethal) lesions cause both sublethal and potentially lethal damage. Potentially lethal damage is defined as damage which may be modified by alterations in postirradiation conditions. Sublethal damage is cellular damage whose accumulation may lead to lethality. A crucial consideration in the expression of the damage is the kind of medium in which the cells are placed during the repair period. Fresh or growth medium (F-medium) is assumed to cause fixation of damage after about 3 hours, while no fixation (only misrepair) occurs in conditioned medium (C-medium).

  9. Cytologic diagnosis of pulmonary lesions.

    Science.gov (United States)

    Rossi, Esther Diana; Mulè, Antonino; Maggiore, Claudia; Miraglia, Antonella; Lauriola, Libero; Vecchio, Fabio Maria; Fadda, Guido

    2004-01-01

    The major types of cytologic preparations used in most laboratories to detect the lesions of the lower respiratory tract (LRT) are examined. These methods include sputum, bronchial washing, bronchial brushing, bronchoalveolar lavage (BAL) and fine-needle aspiration biopsy (FNAB). Sputum represents the simplest and most cost-effective sampling method even though fiberoptic bronchoscopy and radiologic guided FNAB are superseding it as the first diagnostic choice in most cases. There are advantages and disadvantages associated with each technique:bronchial brushing and FNABs tend to preserve both the cellular details and their architectural arrangement whereas sputum and bronchial washing often cause a variable degree of cellular degeneration and fragmentation. As a result, most pulmonary lesions may be detected and correctly diagnosed if multiple techniques are used to acquire diagnostic material. CT-guided FNAB represents the most effective method to achieve a correct diagnosis in pulmonary tumors. PMID:15852720

  10. Adult subependymal neural precursors, but not differentiated cells, undergo rapid cathodal migration in the presence of direct current electric fields.

    Directory of Open Access Journals (Sweden)

    Robart Babona-Pilipos

    Full Text Available BACKGROUND: The existence of neural stem and progenitor cells (together termed neural precursor cells in the adult mammalian brain has sparked great interest in utilizing these cells for regenerative medicine strategies. Endogenous neural precursors within the adult forebrain subependyma can be activated following injury, resulting in their proliferation and migration toward lesion sites where they differentiate into neural cells. The administration of growth factors and immunomodulatory agents following injury augments this activation and has been shown to result in behavioural functional recovery following stroke. METHODS AND FINDINGS: With the goal of enhancing neural precursor migration to facilitate the repair process we report that externally applied direct current electric fields induce rapid and directed cathodal migration of pure populations of undifferentiated adult subependyma-derived neural precursors. Using time-lapse imaging microscopy in vitro we performed an extensive single-cell kinematic analysis demonstrating that this galvanotactic phenomenon is a feature of undifferentiated precursors, and not differentiated phenotypes. Moreover, we have shown that the migratory response of the neural precursors is a direct effect of the electric field and not due to chemotactic gradients. We also identified that epidermal growth factor receptor (EGFR signaling plays a role in the galvanotactic response as blocking EGFR significantly attenuates the migratory behaviour. CONCLUSIONS: These findings suggest direct current electric fields may be implemented in endogenous repair paradigms to promote migration and tissue repair following neurotrauma.

  11. Implant periapical lesion. Case report

    OpenAIRE

    Gregory Venetis, Fotis Iordanidis, Paraskevi Giovani, Lambros Zouloumis

    2011-01-01

    Ιmplant periapical lesion (IPL) is probably not a uniform entity in all cases presented in the literature. Asseptic bone necrosis may be a cause for some of the IPLs, whilst the presence of microorganisms is not always detectable with conventional methods. A case of IPL in a male patient who underwent an extraction of 12 tooth and an immediate implantation at this site is presented. Eight months postoperatively, an IPL was revealed on radiologic examination. After surgical exploration, the IP...

  12. Cystic Lesions in Autoimmune Pancreatitis

    OpenAIRE

    Gompertz, Macarena; Morales, Claudia; Aldana, Hernán; Castillo, Jaime; Berger, Zoltán

    2015-01-01

    Autoimmune pancreatitis (AIP) can be chronic or recurrent, but frequently completely reversible after steroid treatment. A cystic lesion in AIP is a rare finding, and it can mimic a pancreatic cystic neoplasm. Difficulties in an exact diagnosis interfere with treatment, and surgery cannot be avoided in some cases. We report the history of a 63-year-old male presenting with jaundice and pruritus. AIP was confirmed by imaging and elevated IgG4 blood levels, and the patient completely recovered ...

  13. Symmetrical thalamic lesions in infants.

    OpenAIRE

    Eicke, M.; Briner, J; Willi, U; Uehlinger, J; Boltshauser, E

    1992-01-01

    Clinical observations and findings on imaging are reported in six newborns with symmetrical thalamic lesions (STL). In three cases the diagnosis was confirmed by postmortem examination. Characteristic observations in this series and 17 previously reported cases include no evidence of perinatal asphyxia, high incidence of polyhydramnios, absent suck and swallow, absent primitive reflexes, appreciable spasticity at or within days of birth, lack of psychomotor development, and death within days ...

  14. Radiological diagnosis of adrenal lesions

    International Nuclear Information System (INIS)

    Among all the radiological examination techniques, CT is today, besides scintigraphy, the method of choice as far as the detection of functional adrenal lesions is concerned. In primary aldosteronism, CT classification of the syndrome is based on the detection of an adenoma which can be reliably detected in adenoma sizes up to 8-10 mm. Thus, 70 to 80% of Conn's syndromes can be classified. In adrenal Cushing's syndrome, the distinction between adenoma and carcinoma of the adrenal gland is up to CT and can usually be easily made due to the characteristic morphology of each type of lesion. In case of a typcial adrenal or juxtaadrenal tumor location, detection of a pheochromocytoma is likewise easy. In ectopic and multiple pheochromocytomas or such as occur as part of a MEN-syndrome, the situation is quite different. If lesions of the adrenal gland are found by accident in examinations otherwise indicated, the question arises whether the process is malignant or benign. In this respect, all the traditional imaging methods, including CT, involve a considerable factor or uncertainity, especially if a malignant tumor is anamnestically known and the question of metastases arises. According to recent information, MR-imaging seems to be advantageous concerning this difficult differential diagnosis. (orig.)

  15. Proceedings of the workshop on precursor analysis

    International Nuclear Information System (INIS)

    The purpose of the meeting was to provide a forum for open discussion on the state-of-the-art of Precursor Analysis to all professional parties involved, i.e. industry, regulators and support organizations. The meeting was intended to discuss insights both from the operating experience point of view and from the PA methodology point of view. Therefore, it was considered interesting to bring together specialists in the use and application of operational feedback (mainly covered via NEA CSNI/WGOE) and specialists in methodological aspects of Precursor Analysis (mainly covered via CSNI/WGRISK). Cross-fertilization of insights and experiences was expected to be beneficial for both sides. The major effort in Precursor Analysis is carried out on a limited set of safety significant events that occurred at commercial nuclear power plants. Thus, an objective of the Workshop was also to explore, to which extent Precursor Analysis is already applied to other types of nuclear installations (fuel fabrication, research reactors, etc.). In session 1, introductory remarks were given by representatives of WGOE and WGRISK, the two OECD/NEA working groups respectively on Operating Experience and Risk. Sessions 2, 5 and 6 focused on national programs of probabilistic precursor analysis. Contributions from US, Germany, Switzerland, Finland, Czech Republic, Belgium and Japan were presented. Sessions 7 and 8 brought further prospects on the national programs, combined with information on more specific applications. These sessions contained contributions from Hungary, US, Spain, and France. Session 3 was mainly dealing with the more classical (non probabilistic) approach of the analysis of operational events, with contributions from Finland, Belgium, and Sweden. A consultant company (Enconet) presented a newly developed method and a computer tool. Session 4 focused on methodological aspects, and the development of guidelines and models for probabilistic precursor analysis. It included a

  16. The PSA: Planetary Science Archive

    Science.gov (United States)

    Barthelemy, M.; Martinez, S.; Heather, D.; Vazquez, J. L.; Arviset, C.; Osuna, P.; PSA development Team

    2012-04-01

    Scientific and engineering data from ESA's planetary missions are made accessible to the world-wide scientific community via the Planetary Science Archive (PSA). The PSA consists of online services incorporating search, preview, download, notification and delivery basket functionality. Besides data from the GIOTTO spacecraft and several ground-based cometary observations, the PSA contains data from the Mars Express, Venus Express, Rosetta, SMART-1 and Huygens missions. The focus of the PSA activities is on the long-term preservation of data and knowledge from ESA's planetary missions. Scientific users can access the data online using several interfaces: - The Advanced Search Interface allows complex parameter based queries, providing the end user with a facility to complete very specific searches on meta-data and geometrical parameters. By nature, this interface requires careful use and heavy interaction with the end-user to input and control the relevant search parameters. - The Map-based Interface is currently operational only for Mars Express HRCS and OMEGA data. This interface allows an end-user to specify a region-of-interest by dragging a box onto a base map of Mars. From this interface, it is possible to directly visualize query results. The Map-based and Advanced interfaces are linked and cross-compatible. If a user defines a region-of-interest in the Map-based interface, the results can be refined by entering more detailed search parameters in the Advanced interface. - The FTP Browser Interface is designed for more experienced users, and allows for direct browsing and access of the data set content through ftp-tree search. Each dataset contains documentation and calibration information in addition to the scientific or engineering data. All data are prepared by the corresponding instrument teams, mostly located in Europe. PSA supports the instrument teams in the full archiving process, from the definition of the data products, meta-data and product labels

  17. Columnar cell lesions and pseudoangiomatous hyperplasia like stroma: is there an epithelial-stromal interaction?

    Science.gov (United States)

    Recavarren, Rosemary A; Chivukula, Mamatha; Carter, Gloria; Dabbs, David J

    2009-01-01

    The significance of association between cancer and its microenvironment has been increasingly recognized. It has been shown in animal models that interaction between neoplastic epithelial cells and adjacent stroma can modulate tumor behavior. Carcinoma associated stromal cells can transform normal epithelial cells into neoplastic cells. In breast, columnar cell lesions are non-obligate precursors of low grade ductal carcinoma in situ. Columnar cell lesions can be seen intimately associated with PASH-like-stroma, a lesion we termed as CCPLS. Our aim is to investigate epithelial-stromal interactions in CCPLS and compare them to PASH without columnar cell lesions in breast core needle biopsies. Normal terminal duct lobular unit (TDLU) epithelium was seen in association with columnar cell lesions as well as PASH. Eight (8) cases of each category were examined by a panel of immunostains: CD117 (C-kit), CD34, CD105, bFGF, AR, ER-beta, MIB-1. We observed a markedly decreased expression of c-kit in columnar cell lesions compared to TDLU-epithelium. CD105 showed a quantitative increase in activated vessels in CCPLS compared to PASH. A subset of CCPLS and PASH were androgen receptor positive. A strong nuclear positivity for ER-beta is observed in the epithelium and stroma of all CCPLS cases. We conclude that (1) activated blood vessels predominate in CCPLS; (2) A molecular alteration is signified by c-kit loss in columnar cell lesions; (3) ER-beta and androgen receptor positivity indicate CCPLS are hormonally responsive lesions. Our study suggests an intimate vascular and hormone dependent epithelial-stromal interaction exists in CCPLS lesions. PMID:19918332

  18. Nonlinear magnetohydrodynamics of edge localized mode precursors

    International Nuclear Information System (INIS)

    A possible origin of edge-localized-mode (ELM) precursors based on nonlinear ideal peeling-ballooning mode is reported. Via nonlinear variational principle, a nonlinear evolution equation of the radial displacement is derived and solved, analytically. Besides an explosive growth in the initial nonlinear phase, it is found that the local displacement evolves into an oscillating state in the developed nonlinear phase. The nonlinear frequency of the ELM precursors scales as ωpre∼x1/3ξ^ψ,in2/3n, with x position in radial direction, ξ^ψ,in strength of initial perturbation, and n toroidal mode number

  19. Download - RGP estmap2001 | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...e Description Download License Update History of This Database Site Policy | Contact Us Download - RGP estmap2001 | LSDB Archive ...

  20. Image File - AT Atlas | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...io About This Database Database Description Download License Update History of This Database Site Policy | Contact Us Image File - AT Atlas | LSDB Archive ...

  1. Update History of This Database - GETDB | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us GETDB Update History... Download License Update History of This Database Site Policy | Contact Us Update History of This Database - GETDB | LSDB Archive ...

  2. PIR search result - KOME | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ... Download License Update History of This Database Site Policy | Contact Us PIR search result - KOME | LSDB Archive ...

  3. Download - GenLibi | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...ription Download License Update History of This Database Site Policy | Contact Us Download - GenLibi | LSDB Archive ...

  4. Download - ClEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...bout This Database Database Description Download License Update History of This Database Site Policy | Contact Us Download - ClEST | LSDB Archive ...

  5. Download - RGP gmap2000 | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...out This Database Database Description Download License Update History of This Database Site Policy | Contact Us Download - RGP gmap2000 | LSDB Archive ...

  6. Download - RGP gmap98 | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...tio About This Database Database Description Download License Update History of This Database Site Policy | Contact Us Download - RGP gmap98 | LSDB Archive ...

  7. Download - tRNADB-CE | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...abase Database Description Download License Update History of This Database Site Policy | Contact Us Download - tRNADB-CE | LSDB Archive ...

  8. Download - Q-TARO | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...s Database Database Description Download License Update History of This Database Site Policy | Contact Us Download - Q-TARO | LSDB Archive ...

  9. Images on Comment (PNG format) - Taxonomy Icon | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...n Download License Update History of This Database Site Policy | Contact Us Images on Comment (PNG format) - Taxonomy Icon | LSDB Archive ...

  10. Organ weight - Open TG-GATEs | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us Open...load License Update History of This Database Site Policy | Contact Us Organ weight - Open TG-GATEs | LSDB Archive ...

  11. Individual list - Open TG-GATEs | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us Open... History of This Database Site Policy | Contact Us Individual list - Open TG-GATEs | LSDB Archive ...

  12. Cell sample - Open TG-GATEs | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us Open...ase Description Download License Update History of This Database Site Policy | Contact Us Cell sample - Open TG-GATEs | LSDB Archive ...

  13. Cell viability - Open TG-GATEs | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us Open... Database Description Download License Update History of This Database Site Policy | Contact Us Cell viability - Open TG-GATEs | LSDB Archive ...

  14. Hematology - Open TG-GATEs | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us Open...base Description Download License Update History of This Database Site Policy | Contact Us Hematology - Open TG-GATEs | LSDB Archive ...

  15. Biochemistry - Open TG-GATEs | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us Open...e Database Description Download License Update History of This Database Site Policy | Contact Us Biochemistry - Open TG-GATEs | LSDB Archive ...

  16. Pathological items - Open TG-GATEs | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us Open... This Database Site Policy | Contact Us Pathological items - Open TG-GATEs | LSDB Archive ...

  17. Body weight - Open TG-GATEs | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us Open...d License Update History of This Database Site Policy | Contact Us Body weight - Open TG-GATEs | LSDB Archive ...

  18. Taxonomy Icon Images (PNG format) - Taxonomy Icon | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...se Database Description Download License Update History of This Database Site Policy | Contact Us Taxonomy Icon Images (PNG format) - Taxonomy Icon | LSDB Archive ...

  19. Download - AcEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...t This Database Database Description Download License Update History of This Database Site Policy | Contact Us Download - AcEST | LSDB Archive ...

  20. Archiving Government Documents using DSpace

    OpenAIRE

    Devakos, Rea

    2005-01-01

    Description: A collaborative multi-phased pilot to archive Canadian government documents using DSpace Participants: The Ontario Council of University Libraries (OCUL), a 20 member consortium, is working with municipalities, special and community college libraries. Objectives: To address long standing and widespread concerns about the rapid rate of disappearance of electronic government documents, as well as the desire for greater efficiencies possible through shared catalogu...

  1. Archiving in the networked world

    OpenAIRE

    Seadle, Michael

    2011-01-01

    The purpose is to investigate: 1) how many journal titles are both in LOCKSS and in Portico? 2) what is the relationship of small publishers to LOCKSS/CLOCKSS and Portico? 2) what is the relationship of large publishers to LOCKSS/CLOCKSS and Portico? The article describes describes how data from Portico, LOCKSS, and CLOCKSS was cleaned and analyzed using Perl programs to discover duplications. The findings show a significant overlap among the archiving systems. It also shows that Portico has...

  2. System Architecture for a Hubble Legacy Archive

    Science.gov (United States)

    Miller, W. W., III; Gaffney, N.; Jenkner, H.; Whitmore, B.

    2007-10-01

    The Space Telescope Science Institute (STScI), in collaboration with the European Coordinating Facility (ECF) and the Canadian Astronomy Data Centre (CADC), is studying the development of an enhanced archive for the Hubble Space Telescope (HST). Distinct from (but complimentary to) the existing archive system at the STScI, development of this enhanced archive affords the opportunity to leverage modern architectural and design principles toward meeting project objectives and serving the archive community. To wit, the STScI is designing the entire system as a service-oriented architecture (SOA). Composed of loosely-coupled, highly-interoperable Web services, an SOA embodies a great deal of flexibility in meeting future needs placed on the HST archive while also positioning it well within the emerging Virtual Observatory (VO) framework. A high-level architecture for the enhanced archive at the STScI is presented.

  3. Detecting uterine glandular lesions: Role of cervical cytology

    Science.gov (United States)

    Bansal, Baneet; Gupta, Parikshaa; Gupta, Nalini; Rajwanshi, Arvind; Suri, Vanita

    2016-01-01

    Background: The sensitivity of cervical cytology for detection of glandular lesions is reported to be low. We conducted this study to assess the diagnostic accuracy of cervical Papanicolaou (Pap) smears for uterine glandular lesions and to compare the diagnostic utility of conventional and liquid-based cytology (LBC) smears for glandular lesions. Materials and Methods: Archived histopathology records of all cases reported as endocervical and endometrial adenocarcinoma in the study period were identified and the available corresponding Pap smears (in preceding 1 year) were retrieved. In addition, the Pap smears reported as glandular cell abnormalities (GCA) during the same study period were retrieved. The overall prevalence of GCA, sensitivity, and specificity of Pap smears for the detection of GCA was calculated. The diagnostic accuracy of conventional and LBC smears for the diagnosis of GCA was also compared. Results: The prevalence of GCA in our study was 0.32%. The overall specificity of Pap smears for the diagnosis of GCA was 60.8%, this was not significantly different between conventional and LBC smears (P = 0.4). The overall sensitivity of Pap smears for the detection of GCA was 41.8%; LBC smears had significantly better sensitivity as compared to conventional smears for the detection of endometrial as compared to endocervical adenocarcinoma (P Pap smears is low. The specificity of Pap smears, for diagnosis of GCA, was found to be moderate. However, the overall sensitivity of Pap smears for the detection of GCA was low, though better for LBC as compared to conventional smears. PMID:27014363

  4. Commercial imagery archive product development

    Science.gov (United States)

    Sakkas, Alysa

    1999-12-01

    The Lockheed Martin (LM) team had garnered over a decade of operational experience in digital imagery management and analysis for the US Government at numerous worldwide sites. Recently, it set out to create a new commercial product to serve the needs of large-scale imagery archiving and analysis markets worldwide. LM decided to provide a turnkey commercial solution to receive, store, retrieve, process, analyze and disseminate in 'push' or 'pull' modes components and adapted and developed its own algorithms to provide added functionality not commercially available elsewhere. The resultant product, Intelligent Library System, satisfies requirements for (a) a potentially unbounded, data archive automated workflow management for increased user productivity; (c) automatic tracking and management of files stored on shelves; (d) ability to ingest, process and disseminate data involves with bandwidths ranging up to multi-gigabit per second; (e) access through a thin client- to-server network environment; (f) multiple interactive users needing retrieval of filters in seconds from both archived images or in real time, and (g) scalability that maintains information throughput performance as the size of the digital library grows.

  5. Surgical treatment of gallbladder polypoid lesions

    OpenAIRE

    Pejić Miljko A.; Milić Dragan J.

    2003-01-01

    INTRODUCTION Polypoid lesions of the gallbladder can be divided into benign and malignant categories. Malignant polypoid lesions include carcinomas of the gallbladder, which is the fifth most common malignancy of the gastrointestinal tract and the most common malignancy of the biliary tract. Benign polypoid lesions of the gallbladder are divided into true tumors and pseudotumors. Pseudotumors account for most of polypoid lesions of the gallbladder, and include polyps, hyperplasia, and other m...

  6. A Policy-based Institutional Web Archiving System with Adjustable Exposure of Archived Resources

    OpenAIRE

    Hiiragi, Wasuke; Sakaguchi, Tetsuo; Sugimoto, Shigeo

    2009-01-01

    Despite the recognition that Archiving Web content is important and Web archiving systems freely crawl and collect resources on the Web for preservation, they have difficulties in collecting all versions of a single Web page and in preserving a collected resource with policies of use given by its creator. In order to solve the problems, we have proposed an Institutional Web Archiving System, which collects resources with the archiving policy given to the resources by its ...

  7. Tumefactive intracranial presentation of precursor B-cell acute lymphoblastic leukemia

    Energy Technology Data Exchange (ETDEWEB)

    Forester, Craig M. [University of Utah, Salt Lake City, UT (United States); Braunreiter, Chi L. [University of Utah, Division of Pediatric Hematology Oncology, Primary Children' s Medical Center, Salt Lake City, UT (United States); Helen DeVos Children' s Hospital, Department of Pediatric Hematology Oncology, Grand Rapids, MI (United States); Yaish, Hasan; Afify, Zeinab [University of Utah, Division of Pediatric Hematology Oncology, Primary Children' s Medical Center, Salt Lake City, UT (United States); Hedlund, Gary L. [Primary Children' s Medical Center, Department of Pediatric Radiology, Salt Lake City, UT (United States)

    2009-11-15

    In children, leukemia is the most common malignancy, and approximately 75% of leukemias are acute lymphoblastic leukemia (ALL). Central nervous system leukemia is found at diagnosis in fewer than 5% of children with ALL. Leukemic intracranial masses have been described with acute myeloid leukemia, but ALL presenting as a mass lesion is rare. We describe a unique case of an intracranial confirmed precursor B cell (pre-B) ALL mass in a 13-year-old girl that was diagnosed by brain CT, MRI and cerebral angiography, and confirmed by biopsy. This report details pertinent history and distinguishing imaging features of an intracranial ALL tumefaction. (orig.)

  8. Web Archiving and Digital Libraries (WADL)

    OpenAIRE

    Edward A Fox; Xie, Zhiwu

    2015-01-01

    This workshop will explore integration of Web archiving and digital libraries, so the complete life cycle involved is covered: creation/authoring, uploading/publishing in the Web (2.0), (focused) crawling, indexing, exploration (searching, browsing), ..., archiving (of events). It will include particular coverage of current topics of interest:, big data, mobile web archiving, and systems (e.g., Memento, SiteStory, Uninterruptible Web Service).

  9. CLASSIFYING NODULAR LESIONS OF ORAL CAVITY

    OpenAIRE

    Sumit Bhateja

    2013-01-01

    Diagnosis of many lesions of the oral cavity is challenging to most cliniciansbecause of their uncommon prevalence. A number of cystic, osteodystrophic,microbial, tumor and tumor like lesions of the oral cavity are present withcharacteristic exophytic/raised surface; which makes their diagnosis and studysimpler. The present article is attempted at classifying the common nodular lesions ofthe oral cavity.

  10. Lytic clavicular lesions in fibromatosis colli

    International Nuclear Information System (INIS)

    Two patients with fibromatosis colli (congenital torticollis) presented with lytic lesions in the clavicle at the insertion of the fibrosed clavicular head of the sternocleidomastoid muscle. Biopsy of one lesion showed intraosseous fibrosis. These lesions are probably not uncommon but radiographs are rarely performed in uncomplicated cases. (orig.)

  11. Lytic clavicular lesions in fibromatosis colli

    Energy Technology Data Exchange (ETDEWEB)

    Sartoris, D.J.; Parker, B.R.; Mochizuki, R.M.

    1983-06-01

    Two patients with fibromatosis colli (congenital torticollis) presented with lytic lesions in the clavicle at the insertion of the fibrosed clavicular head of the sternocleidomastoid muscle. Biopsy of one lesion showed intraosseous fibrosis. These lesions are probably not uncommon but radiographs are rarely performed in uncomplicated cases.

  12. Update History of This Database - KEGG MEDICUS | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us KEGG MEDICUS Update Histo...io About This Database Database Description Download License Update History of Th...is Database Site Policy | Contact Us Update History of This Database - KEGG MEDICUS | LSDB Archive ... ...ry of This Database Date Update contents 2014/05/09 KEGG MEDICUS English archive si

  13. Organizing archival records a practical method of arrangement and description for small archives

    CERN Document Server

    Carmicheal, David W

    2012-01-01

    Organizing Archival Records equips non-professional archivists with the skills to tackle one of the most challenging tasks of archiving: arranging and describing archival materials. Carmichael brings this third edition into the 21st century with extended discussions about computerizing the process, making descriptions available on the web, and organizing electronic records.

  14. PLACE search result - KOME | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...ce_search_result.zip File URL: ftp://ftp.biosciencedbc.jp/archive/kome/LATEST/kom...n Download License Update History of This Database Site Policy | Contact Us PLACE search result - KOME | LSDB Archive ...

  15. Blocks search result - KOME | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...://ftp.biosciencedbc.jp/archive/kome/LATEST/kome_blocks_search_result.zip File si...atabase Site Policy | Contact Us Blocks search result - KOME | LSDB Archive ...

  16. Cluster - ClEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...including Blastx search results and GO annotations Data file File name: clest_cluster.zip File URL: ftp://ftp.biosciencedbc.jp/archiv...istory of This Database Site Policy | Contact Us Cluster - ClEST | LSDB Archive ...

  17. Cluster Table - KAIKOcDNA | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...dentical cDNA sequences that make up cluster. Data file File name: kaiko_cdna_cluster.zip File URL: ftp://ftp.biosciencedbc.jp/archiv...scription Download License Update History of This Database Site Policy | Contact Us Cluster Table - KAIKOcDNA | LSDB Archive ...

  18. Genotype data - RGP gmap98 | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...URL: ftp://ftp.biosciencedbc.jp/archive/rgp-gmap98/LATEST/rgp_gmap98_genotype_dat...his Database Database Description Download License Update History of This Database Site Policy | Contact Us Genotype data - RGP gmap98 | LSDB Archive ...

  19. Mapping data detail - KOME | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...ct (IRGSP) Data file File name: kome_mapping_data_detail.zip File URL: ftp://ftp.biosciencedbc.jp/archiv...istory of This Database Site Policy | Contact Us Mapping data detail - KOME | LSDB Archive ...

  20. tRNA - RMG | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...genomes of other plants. Data file File name: rmg_trna.zip File URL: ftp://ftp.biosciencedbc.jp/archive/rmg/...cription Download License Update History of This Database Site Policy | Contact Us tRNA - RMG | LSDB Archive ...

  1. Tos17 link result - KOME | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...s17 mutant clones Data file File name: kome_tos17_link_result.zip File URL: ftp://ftp.biosciencedbc.jp/archiv...te History of This Database Site Policy | Contact Us Tos17 link result - KOME | LSDB Archive ...

  2. 75 FR 63141 - Information Collection; Research Data Archive Use Tracking

    Science.gov (United States)

    2010-10-14

    ...; ] DEPARTMENT OF AGRICULTURE Forest Service Information Collection; Research Data Archive Use Tracking AGENCY... organizations on the currently approved information collection, Research Data Archive Use Tracking. DATES..., Monday through Friday. SUPPLEMENTARY INFORMATION: Title: Research Data Archive Use Tracking. OMB...

  3. Chronique des Archives 2010-2011

    OpenAIRE

    Eichenlaub, Jean-Luc

    2012-01-01

    La Chronique des Archives rendant compte des activités 2009 est parue dans la Revue d’Alsace no136, 2010, p. 391‑397. Le lecteur a pu avoir un aperçu des activités des Archives départementales (Bas‑Rhin, Haut‑Rhin, Territoire de Belfort) et des archives municipales de Belfort, Colmar, Erstein, Guebwiller, Illkirch, Illzach, Ingersheim, Mulhouse, Munster, Saint-Louis, Turckheim, Strasbourg. Il n’y a pas eu de Chronique des Archives complète dans la Revue d’Alsace no137, 2011, mais une page con...

  4. Seventy Years of the Journal "Medical Archives".

    Science.gov (United States)

    Masic, Izet

    2016-02-01

    This year journal "Medical Archives" celebrates 70th anniversary of its continuing publication. Medical Archives is oldest biomedical journal in Bosnia and Herzegovina and one of the oldest medical journals in Europe, established in the year 1947, as official scientific and professional journal of Association of Physicians of Bosnia and Herzegovina. Until present Medical Archives has published over 5000 articles. Today Medical Archives is internationally recognized medical peer-reviewed indexed journal, visible in more than 30 international on-line databases. PMID:26980925

  5. Biochemical Removal of HAP Precursors from Coal

    Energy Technology Data Exchange (ETDEWEB)

    Gregory J. Olson

    1997-05-12

    Column biooxidation tests with Kentucky coal confirmed results of earlier shake flask tests showing significant removal from the coal of arsenic, selenium, cobalt, manganese, nickel and cadmium. Rates of pyrite biooxidation in Kentucky coal were only slightly more than half the rates found previously for Indiana and Pittsburgh coals. Removal of pyrite from Pittsburgh coal by ferric ion oxidation slows markedly as ferrous ions accumulate in solution, requiring maintenance of high redox potentials in processes designed for removal of pyrite and hazardous air pollutant (HAP) precursors by circulation of ferric solutions through coal. The pyrite oxidation rates obtained in these tests were used by Unifield Engineering to support the conceptual designs for alternative pyrite and HAP precursor bioleaching processes for the phase 2 pilot plant. Thermophilic microorganisms were tested to determine if mercury could be mobilized from coal under elevated growth temperatures. There was no evidence for mercury removal from coal under these conditions. However, the activity of the organisms may have liberated mercury physically. It is also possible that the organisms dissolved mercury and it readsorbed to the clay preferentially. Both of these possibilities are undergoing further testing. The Idaho National Engineering and Environmental Laboratory�s (INEEL) slurry column reactor was operated and several batches of feed coal, product coal, waste solids and leach solutions were submitted to LBL for HAP precursor analysis. Results to date indicate significant removal of mercury, arsenic and other HAP precursors in the combined physical-biological process.

  6. Detection of earthquake magnetic precursors candidates

    OpenAIRE

    Korepanov, Valery; Dudkin, Fedir

    2012-01-01

    A new approach is developed to find a source of pre-EQ ULF electromagnetic activity of lithospheric origin. For separation and localization of EQ magnetic precursors a new polarization ellipse technique has been developed to process the measurements data acquired from 3-component magnetometers.

  7. PRECURSORS OF EARTHQUAKES: VLF SIGNALSIONOSPHERE IONOSPHERE RELATION

    OpenAIRE

    Mustafa ULAS; ATA, Fikret; Hasan Hüseyin BALIK

    2013-01-01

    lot of people have died because of earthquakes every year. Therefore It is crucial to predict the time of the earthquakes reasonable time before it had happed. This paper presents recent information published in the literature about precursors of earthquakes. The relationships between earthquakes and ionosphere are targeted to guide new researches in order to study further to find novel prediction methods.

  8. Milk proteins as precursors of bioactive peptides

    Directory of Open Access Journals (Sweden)

    Marta Dziuba

    2009-03-01

    Full Text Available Milk proteins, a source of bioactive peptides, are the subject of numerous research studies aiming to, among others, evaluate their properties as precursors of biologically active peptides. Physiologically active peptides released from their precursors may interact with selected receptors and affect the overall condition and health of humans. By relying on the BIOPEP database of proteins and bioactive peptides, developed by the Department of Food Biochemistry at the University of Warmia and Mazury in Olsztyn (www.uwm.edu.pl/biochemia, the profiles of potential activity of milk proteins were determined and the function of those proteins as bioactive peptide precursors was evaluated based on a quantitative criterion, i.e. the occurrence frequency of bioactive fragments (A. The study revealed that milk proteins are mainly a source of peptides with the following types of activity: antihypertensive (Amax = 0.225, immunomodulating (0.024, smooth muscle contracting (0.011, antioxidative (0.029, dipeptidyl peptidase IV inhibitors (0.148, opioid (0.073, opioid antagonistic (0.053, bonding and transporting metals and metal ions (0.024, antibacterial and antiviral (0.024, and antithrombotic (0.029. The enzymes capable of releasing bioactive peptides from precursor proteins were determined for every type of activity. The results of the experiment indicate that milk proteins such as lactoferrin, α-lactalbumin, β-casein and κ-casein hydrolysed by trypsin can be a relatively abundant source of biologically active peptides.

  9. Targeting bactoprenol-coupled cell envelope precursors.

    Science.gov (United States)

    Ulm, Hannah; Schneider, Tanja

    2016-09-01

    Targeting the bactoprenol-coupled cell wall precursor lipid II is a validated antibacterial strategy. In this review, selected prototype lipid II-binding antibiotics of different chemical classes are discussed. Although these compounds attack the same molecular target, they trigger nuanced and diverse cellular effects. Consequently, the mechanisms of antibacterial resistance and the likelihood of resistance development may vary substantially. PMID:27495122

  10. History, Archives and the Internet

    Directory of Open Access Journals (Sweden)

    Robert, Jean-Claude

    2012-03-01

    Full Text Available The relationship between historians and archives is generally taken for granted. But this impression is misleading. Across the world, the building of archival collections involves a complicated process of selection and destruction. Traditionally, historians do not really know how this process is being conducted and very often a good proportion of them believe that all documents should be kept. The evolution of history and the questioning of the archives by philosophers cannot be ignored and these have changed the relationship between historians and archives. However, the construction of tomorrow’s archives is happening right now, and historians should be prepared to find a way to participate in this operation. The role of archivists is central in the whole process. In the past, archivists generally received a basic training as historians, but since the 1950s, they have been more and more involved with other disciplines like library or information sciences. They became professionals in a new discipline. Historians should take notice of this reality and be prepared to work with archivists on an equal footing. They must learn what archivists are doing and join them to help create archival collections for the future. The last part of the paper takes a quick looks at the evolution of the Internet as an addition, or rather than as an extension, of archival holdings.

    La relación de los historiadores con los archivos se considera segura, pero esta impresión confunde. En todo el mundo, la construcción de colecciones de archivo supone un complejo proceso de selección y destrucción. Los historiadores no suelen conocer este proceso, creyendo que todos los documentos se conservan. La evolución de la historiografía y el cuestionamiento de los archivos por los filósofos no se pueden ignorar, pues han cambiado la relación entre historiadores y archivos. Pero la construcción de archivos futuros sucede hoy, y los historiadores deben estar

  11. Detection of Chemical Precursors of Explosives

    Science.gov (United States)

    Li, Jing

    2012-01-01

    Certain selected chemicals associated with terrorist activities are too unstable to be prepared in final form. These chemicals are often prepared as precursor components, to be combined at a time immediately preceding the detonation. One example is a liquid explosive, which usually requires an oxidizer, an energy source, and a chemical or physical mechanism to combine the other components. Detection of the oxidizer (e.g. H2O2) or the energy source (e.g., nitromethane) is often possible, but must be performed in a short time interval (e.g., 5 15 seconds) and in an environment with a very small concentration (e.g.,1 100 ppm), because the target chemical(s) is carried in a sealed container. These needs are met by this invention, which provides a system and associated method for detecting one or more chemical precursors (components) of a multi-component explosive compound. Different carbon nanotubes (CNTs) are loaded (by doping, impregnation, coating, or other functionalization process) for detecting of different chemical substances that are the chemical precursors, respectively, if these precursors are present in a gas to which the CNTs are exposed. After exposure to the gas, a measured electrical parameter (e.g. voltage or current that correlate to impedance, conductivity, capacitance, inductance, etc.) changes with time and concentration in a predictable manner if a selected chemical precursor is present, and will approach an asymptotic value promptly after exposure to the precursor. The measured voltage or current are compared with one or more sequences of their reference values for one or more known target precursor molecules, and a most probable concentration value is estimated for each one, two, or more target molecules. An error value is computed, based on differences of voltage or current for the measured and reference values, using the most probable concentration values. Where the error value is less than a threshold, the system concludes that the target

  12. Serum vitamin D levels of patients with oral squamous cell carcinoma (OSCC) and expression of vitamin D receptor in oral precancerous lesions and OSCC

    OpenAIRE

    Grimm, Martin; Cetindis, Marcel; Biegner, Thorsten; Lehman, Max; Munz, Adelheid; Teriete, Peter; Reinert, Siegmar

    2015-01-01

    Background: Resistance to programmed cell death (apoptosis) is a crucial factor for the carcinogenesis of oral squamous cell carcinoma (OSCC). Vitamin D (calcitriol) may overcome apoptosis resistance in tumor cells of OSCC. Vitamin D receptor (VDR) expression in oral precancerous lesions of OSCC has not been analyzed and serum vitamin D level seems to be a predictor of cancer development. Material and Methods: Expression of VDR was analyzed in normal oral mucosa (n=5), oral precursor lesions ...

  13. Laser capture microdissection as a tool to evaluate human papillomavirus genotyping and methylation as biomarkers of persistence and progression of anal lesions

    OpenAIRE

    Cornall, Alyssa M; Roberts, Jennifer M; Molano, Monica; Machalek, Dorothy A; Phillips, Samuel; Hillman, Richard J; Grulich, Andrew E; Jin, Fengyi; Poynten, I Mary; Templeton, David J; Garland, Suzanne M; Tabrizi, Sepehr N.

    2015-01-01

    Introduction Anal squamous cell carcinoma is preceded by persistent infection with high-risk human papillomavirus (HPV) and the cancer precursor, high-grade squamous intraepithelial lesion (HSIL). Detection of specific HPV genotypes and HPV-related biomarkers may be an option for primary anal screening. However, more data on the natural history of HPV-related anal lesions are required. The outcomes from this study will enhance our understanding of the clinical and biological behaviour of HPV-...

  14. Structure and mechanism for DNA lesion recognition

    Institute of Scientific and Technical Information of China (English)

    Wei Yang

    2008-01-01

    A fundamental question in DNA repair is how a lesion is detected when embedded in millions to billions of normal base pairs. Extensive structural and functional studies reveal atomic details of DNA repair protein and nucleic acid interactions. This review summarizes seemingly diverse structural motifs used in lesion recognition and suggests a general mechanism to recognize DNA lesion by the poor base stacking. After initial recognition of this shared struc-tural feature of lesions, different DNA repair pathways use unique verification mechanisms to ensure correct lesion identification and removal.

  15. Theory of pairwise lesion interaction

    International Nuclear Information System (INIS)

    A comparison between repair time constants measured both at the molecular and cellular levels has shown that the DNA double strand break is the molecular change of key importance in the causation of cellular effects such as chromosome aberrations and cell inactivation. Cell fusion experiments provided the evidence that it needs the pairwise interaction between two double strand breaks - or more exactly between the two ''repair sites'' arising from them in the course of enzymatic repair - to provide the faulty chromatin crosslink which leads to cytogenetic and cytolethal effects. These modern experiments have confirmed the classical assumption of pairwise lesion interaction (PLI) on which the models of Lea and Neary were based. It seems worthwhile to continue and complete the mathematical treatment of their proposed mechanism in order to show in quantitative terms that the well-known fractionation, protraction and linear energy transfer (LET) irradiation effects are consequences of or can at least be partly attributed to PLI. Arithmetic treatment of PLI - a second order reaction - has also the advantage of providing a prerequisite for further investigations into the stages of development of misrepair products such as chromatin crosslinks. It has been possible to formulate a completely arithmetic theory of PLI by consequently applying three biophysically permitted approximations - pure first order lesion repair kinetics, dose-independent repair time constants and low yield of the ionization/lesion conversion. The mathematical approach will be summarized here, including several formulae not elaborated at the time of previous publications. We will also study an application which sheds light on the chain of events involved in PLI. (author)

  16. Pancreatic Lesion: Malignancy or Abscess?

    Science.gov (United States)

    Shulik, Oleg; Cavanagh, Yana; Grossman, Matthew

    2016-01-01

    BACKGROUND Pancreatic abscesses are rare. They may be seen in patients with pancreatic inflammation or pancreatitis. Patients with pancreatic abscesses may have abdominal pain, fever, chills, and nausea/vomiting or an inability to eat. Presentation with alternate symptomatology is extremely unusual. CASE REPORT A 67-year-old Asian male presented with painless, afebrile obstructive jaundice and a CA 19-9 of 1732 IU. He was found to have a 3.1×2.4 cm low-density lesion in the head of the pancreas and the right lobe of the liver, suggesting malignancy. Surgical management was considered, however additional diagnostic workup, including an endoscopic retrograde cholangiopancreatography (ERCP), was performed to complete staging of the presumed mass. A smooth, 3-cm-long, tapering stricture was found it the common bile duct. It was stented from the common hepatic duct to the duodenum. Subsequent endoscopic ultrasound (EUS) evaluation of the pancreatic head lesion revealed a drainable fluid collection that was aspirated and found to contain pyogenic material on pathology. The patient's symptoms resolved, and he was subsequently managed conservatively. A repeat ERCP confirmed complete resolution of the previously visualized cystic lesion. Interestingly, laboratory values showed concomitant normalization of CA 19-9 to 40 IU. CONCLUSIONS EUS-guided biopsy is not widely regarded as a required step before surgery, in the management of patients with pancreatic masses. It is generally reserved for determination of resectability or staging, and only utilized when clinically indicated. However, this practice may be associated with an inherently significant risk of misdiagnosis and subsequent unnecessary surgery, as illustrated by this case. Malignancy was initially suspected in our patient and surgical resection was recommended. Endoscopic measures were only pursued to complete staging. We propose that EUS-guided biopsy may be a crucial diagnostic step in the management algorithm

  17. Self-inflicted skin lesions

    DEFF Research Database (Denmark)

    Ring, Hans Christian; Smith, Matthias Nybro; Jemec, Gregor B E

    2014-01-01

    The current literature on the management of self-inflicted skin lesions points to an overall paucity of treatments with a high level of evidence (randomized controlled trials, controlled trials, or meta-analyses). In order to improve the communication between dermatologists and mental health...... professionals, the European Society for Dermatology and Psychiatry (ESDaP) recently proposed a classification of psychodermatological terms in order to establish a coherent use of terms across the medical fields involved. We reviewed current and previous psychodermatological diagnoses in order to clarify how...

  18. Toward a Greater Discourse: Issues in Religious Archives

    Directory of Open Access Journals (Sweden)

    Robert Presutti

    2010-06-01

    Full Text Available The topic of religious archives, a catalyst of much discussion in archival literature, has traditionally been overlooked within the discourse of the American Theological Library Association (ATLA. This essay provides a survey analysis of three pertinent issues in religious archives with the intention of generating a wider discussion on religious archives within ATLA. These issues include the role of graduate archival education, the effects of religious faith on both the archival record and the individual archivist, and the idea of a theology of archives. An extended review of the contributions of James O’Toole to the discussion of religious archives is utilized.

  19. Animation archives: collaboration with archivists, academics, and practitioners

    OpenAIRE

    Taylor, Rebekah

    2015-01-01

    How animation archives can be promoted and made accessible through collaboration - the paper looks at workshops in collaboration with academics, interviews with academics using archives, and infographics.

  20. Download - RMG | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us RMG Down...load First of all, please read the license of this database. Data names and data descriptions are about the down...Click the links on Data Name for descriptions of the data. # Data name File Simple search and down...load 1 README README_e.html - 2 Main data rmg_main.zip (1 KB) Simple search and download 3 ...Entire Sequence rmg_seq.zip (142 KB) - 4 Genes (including RNA editing information) rmg_gene.zip (3 KB) Simple search and down

  1. Download - Taxonomy Icon | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us Taxonomy Icon Down...load Please note that the data Commment and Images on Comment, shown in the bottom half of... of all, please read the license of this database. Data names and data descriptions are about the down...atabase. Click the links on Data Name for descriptions of the data. # Data name File Simple search and downl...oad 1 README README_e.html - 2 Taxonomy Icon Data taxonomy_icon_en.zip (14.1 KB) Simple search and down

  2. Download - Gclust Server | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us Gclust Server Down...load First of all, please read the license of this database. Data names and data descriptions are about the down...umber of characters in a cell exceeds the maximum size given in MS Excel. # Data name File Simple search and down...nd their annotation for 95 organism species. gclust_seq.zip (152MB) Simple search and download 3 Cluster bas...ed on sequence comparison of homologous proteins of 95 organism species gclust_cluster.zip (8.72MB) Simple search and down

  3. Download - RPSD | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us RPSD Down...load First of all, please read the license of this database. Data names and data descriptions are about the down... Click the links on Data Name for descriptions of the data. # Data name File Simple search and down....zip (120 KB, UTF-8) Simple search and download 3 Images rpsd_images.zip (18.3 MB) - Downlaod via FTP Joomla... SEF URLs by Artio About This Database Database Description Download License Upda

  4. Download - KOME | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us KOME Down...load First of all, please read the license of this database. Data names and data descriptions are about the down... Click the links on Data Name for descriptions of the data. # Data name File Simple search and down...load 1 README README_e.html - 2 Main kome_main.zip (1.3 KB) Simple search and download 3 B...asical information kome_basical_information.zip (607 KB) Simple search and download 4 Mapping data kome_mapp

  5. Download - DGBY | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us DGBY Down...load First of all, please read the license of this database. Data names and data descriptions are about the down... Click the links on Data Name for descriptions of the data. # Data name File Simple search and down...load 1 README README_e.html - 2 Experiments List dgby_main_en.zip (1KB) Simple search and down...zip (90KB) Original File(Excel): High-sugar_stress.xls (674KB) Simple search and download 7 Phenome data - F

  6. Mapping data - KOME | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available ome sequences obtained from the International Rice Genome Sequencing Project (IRGSP) Dat...a file File name: kome_mapping_data.zip File URL: ftp://ftp.biosciencedbc.jp/arch...ive/kome/LATEST/kome_mapping_data.zip File size: 723 KB Simple search URL http://togodb.biosciencedbc.jp/tog...a detail Data name Mapping data Description of data contents Mapping information with the japonica rice gen...abase Description Download License Update History of This Database Site Policy | Contact Us Mapping data - KOME | LSDB Archive ...

  7. Database Description - GETDB | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us GETDB Database... Description General information of database Database name GETDB Alternative name Gal4 Enhancer Trap Insertion Database... +81-78-306-3183 E-mail: Database classification Expression Invertebrate genome database Organism Taxonomy N...ame: Drosophila melanogaster Taxonomy ID: 7227 Database description About 4,600 i...nsertion lines of enhancer trap lines based on the Gal4-UAS method were generated in Drosophila, and all of

  8. Database Description - DMPD | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us DMPD Database... Description General information of database Database name DMPD Alternative name Dynamic Macrophage Pathway CSML Databas...108-8639 Tel: +81-3-5449-5615 FAX: +83-3-5449-5442 E-mail: Database classification Metabolic and Signaling P...malia Taxonomy ID: 40674 Database description DMPD collects pathway models of transcriptional regulation and... signal transduction in CSML format for dymamic simulation based on the curation of descriptions about LPS a

  9. STUDY OF OVARIAN LESIONS IN CHILDREN

    Directory of Open Access Journals (Sweden)

    Nagarjuna

    2015-11-01

    Full Text Available : AIM: To study ovarian lesions in paediatric patients. MATERIALS AND METHODS: All cases of ovarian lesions presenting to Niloufer Hospital during the study period spanning 7 years were included in the study. All cases were clinically examined and evaluated with serum markers like α-fetoprotein and β-HCG, ultrasonography of abdomen and pelvis and contrast enhanced computed tomography of abdomen and pelvis. The cases were managed either conservatively or surgically depending on the diagnosis. RESULTS: A total of 36 cases of ovarian lesions presented to Niloufer Hospital during the study period. The age of the patients ranged from newborn to 14 years. The most common presenting symptom was an abdominal or pelvic mass. The most common ultrasound character of the non-neoplastic ovarian lesion was cystic whereas that of a neoplastic ovarian lesion was complex or mixed. Non neoplastic lesions were present in 22 patients. Neoplastic lesions were seen in 14 patients. CONCLUSION: Physiological or functional ovarian cysts are the commonest ovarian lesions seen in the paediatric age group. Ultrasonogram is accurate and very reliable in distinguishing neoplastic from non-neoplastic and malignant from benign ovarian lesions. Non-neoplastic lesions can be managed conservatively in about 40% of cases. Neoplastic lesions in children require a less radical approach in order to preserve ovarian function.

  10. Dieulafoy's lesion of duodenum: a case report

    Directory of Open Access Journals (Sweden)

    Wagholikar Gajanan D

    2003-01-01

    Full Text Available Abstract Background Dieulafoy's lesion is an uncommon but important cause of recurrent upper gastrointestinal bleeding. Extragastric location of Dieulafoy's lesion is rare. We report two cases of Dieulafoy's lesion of the duodenum and discuss the management of this extremely uncommon entity. Case presentation Two cases of massive upper gastro-intestinal bleeding in young adults due to Dieulafoy's lesion of the duodenum are reported. Endoscopic diagnosis was possible in both cases. Hemostasis was achieved successfully by endoscopic adrenaline injection. The endoscopic appearance, pitfalls in the diagnosis and management of this rare lesion are discussed. Conclusions Endoscopic diagnosis of extragastric Dieulafoy's lesion can be difficult because of the small size and obscure location of the lesion. Increased awareness and careful and early endoscopic evaluation following the bleeding episode are the key to accurate diagnosis. Adrenaline injection is one of the important endoscopic modalities for control of bleeding.

  11. Is zero underestimation feasible? Extended Vacuum-assisted breast biopsy in solid lesions – a blind study

    Directory of Open Access Journals (Sweden)

    Domeyer Philip

    2007-05-01

    Full Text Available Abstract Background Vacuum-Assisted Breast Biopsy (VABB is effective for the preoperative diagnosis of non-palpable mammographic solid lesions. The main disadvantage is underestimation, which might render the management of atypical ductal hyperplasia (ADH, and ductal carcinoma in situ (DCIS difficult. This study aims to develop and assess a modified way of performing VABB. Patients and methods A total of 107 women with non-palpable mammographic breast solid tumors BI-RADS 3 and 4 underwent VABB with 11G, on the stereotactic Fischer's table. 54 women were allocated to the recommended protocol and 24 cores were obtained according to the consensus meeting in Nordesterdt (1 offset-main target in the middle of the lesion and one offset inside. 53 women were randomly allocated to the extended protocol and 96 cores were excised (one offset-main target in the middle of the lesion and 7 peripheral offsets. A preoperative diagnosis was established. Women with a preoperative diagnosis of precursor/preinvasive/invasive lesion underwent open surgery. A second pathologist, blind to the preoperative results and to the protocol made the postoperative diagnosis. The percentage of the surface excised via VABB was retrospectively calculated on the mammogram. The discrepancy between preoperative and postoperative diagnoses along with the protocol adopted and the volume removed were evaluated by Fisher's exact test and Mann-Whitney-Wilcoxon test, respectively. Results Irrespectively of the protocol adopted, 82.2% of the lesions were benign. 14.0% of the lesions were malignancies (5.1% of BI-RADS 3, 5.3% of BI-RADS 4A, 25% of BI-RADS 4B, and 83.3% of BI-RADS 4C lesions. 3.7% of the biopsies were precursor lesions. There was no evidence of underestimation in either protocols. In the standard protocol, the preoperative/postoperative diagnoses were identical. In the extended protocol, the postoperative diagnosis was less severe than the preoperative in 55.5% of cases

  12. Long-term Preservation of Archives in the Archives of the Republic of Slovenia

    Directory of Open Access Journals (Sweden)

    Tatjana Hajtnik

    2013-09-01

    Full Text Available ABSTRACTThe expansion of e-communication results in the growing quantity of electronic documents whichneed to be preserved for future generations because of different reasons. New archival regulationon long-term preservation of digital records in Slovenia accepted in 2006 offers new possibilities for pro-active long-term preservation of digital records and assigns a wide range of new roles tothe Archives of the Republic of Slovenia whose primary goal is to preserve national archival heritage. The article aims to present different roles of the Archives of the Republic of Slovenia in the field of effective long-term preservation of digital records with emphasis on archival collections.

  13. Study of the precursor and non-precursor implosion regimes in wire array Z-pinches

    International Nuclear Information System (INIS)

    Star-like and closely spaced nested wire array configurations were investigated in precursor and non-precursor implosions. Closely spaced nested cylindrical arrays have inner and outer arrays with equal wire numbers, and inner and outer wires aligned to each other. The gap between the outer and inner wires is not more than 1 mm. Calculation of magnetic fields shows that the small gap results in a reversed, outward j × B force on the inner wires. Closely spaced arrays of 6–16 wires with outer diameter of 16 mm and with gaps of ΔR = 0.25–1 mm were tested. 6–8-wire arrays with a gap of ΔR = 0.4–1 mm imploded without precursor, but precursor was present in loads with 12–16 wires and ΔR = 0.25–1 mm. Implosion dynamics of closely spaced arrays was similar to that of star-like arrays. Implosion time was found to decrease with decreased wire numbers. Star array configurations were designed with a numerical scheme to implode with or without precursor. The lack of precursor resulted in a marginal improvement in total x-ray yield and power, and up to 20% increase in Al K-shell yield. The Al K-shell radiated energy was found to increase with decreasing the number of arrays in closely spaced and star-like wire arrays.

  14. E-Learning im Museum und Archiv

    OpenAIRE

    Gruber, Marion

    2009-01-01

    Gruber, M. R. (2009). E-Learning im Museum und Archiv. Vermittlung von Kunst und Kultur im Informationszeitalter. Saarbrücken: VDM Verlag Dr. Müller. Available on http://www.amazon.de/E-Learning-Museum-Archiv-Vermittlung-Informationszeitalter/dp/3639204654/ref=sr_1_2?ie=UTF8&s=books&qid=1258383814&sr=1-2

  15. 22 CFR 171.6 - Archival records.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Archival records. 171.6 Section 171.6 Foreign Relations DEPARTMENT OF STATE ACCESS TO INFORMATION AVAILABILITY OF INFORMATION AND RECORDS TO THE PUBLIC General Policy and Procedures § 171.6 Archival records. The Department ordinarily transfers records to...

  16. Enlivening Dance History Pedagogy through Archival Projects

    Science.gov (United States)

    Randall, Tresa

    2012-01-01

    Dance archives can bring students into contact with historical subjects through artifacts of the past. This article advocates the use of archival projects in undergraduate dance history courses, arguing that such hands-on learning activities give students dynamic and interactive experiences of history. The author describes a creative project she…

  17. Huge Music Archives on Mobile Devices

    DEFF Research Database (Denmark)

    Blume, H.; Bischl, B.; Botteck, M.;

    2011-01-01

    The availability of huge nonvolatile storage capacities such as flash memory allows large music archives to be maintained even in mobile devices. With the increase in size, manual organization of these archives and manual search for specific music becomes very inconvenient. Automated dynamic...

  18. The Dutch archival act and harmonisation

    NARCIS (Netherlands)

    Havermans, J.B.G.A.

    2010-01-01

    ln 1993, the first document on indoor air quality parameters was presented to improve the storage conditions for archival records. Since 1995, these recommendations were included in the Dutch Archival Act. The conditions were based on international and national studies, presented by Vosteen for the

  19. Archival Representation in the Digital Age

    Science.gov (United States)

    Zhang, Jane

    2012-01-01

    This study analyzes the representation systems of three digitized archival collections using the traditional archival representation framework of provenance, order, and content. The results of the study reveal a prominent role of provenance representation, a compromised role of order representation, and an active role of content representation in…

  20. Sprint methods for web archive research

    NARCIS (Netherlands)

    Huurdeman, H.C.; Ben David, A.; Samar, T.

    2013-01-01

    Web archives provide access to snapshots of the Web of the past, and could be valuable for research purposes. However, access to these archives is often limited, both in terms of data availability, and interfaces to this data. This paper explores new methods to overcome these limitations. It present

  1. A dialogue between archive, knowledge and technology

    Directory of Open Access Journals (Sweden)

    Henrique Machado dos Santos

    2015-11-01

    Full Text Available Objective. Perform a brief reflection on knowledge management in archives, emphasizing the connections necessary for a dialogue between archive, knowledge and technology. Method. It consists in review of material previously published in the areas of Management Science, Archival Science and Information Science. The sources consulted consist of books, theses, texts on websites and scientific journal articles indexed in Google Scholar. Thus, the collected data is analyzed qualitatively. Results. There is a close relationship between the archive, knowledge and technology. In this sense, the document has the role of interlocutor in this dialogue. The interdisciplinary scenario envisioned, enhance existing rapprochement between the archival practices and knowledge management, in order to make possible a feedback cycle that will support the practices related to the management, either, of knowledge, of information or of documents. Conclusions. There is need for further studies to address the potential of the archives in order to fill possible gaps theory thus reach multiple looks more points interdisciplinary convergence. Finally, there is the informational potential of archives, then mediated by technology information, can enrich the knowledge management practices, and for this it is essential to strengthen the interdisciplinary relationships between Management Science, Archival Science and Information Science.

  2. Online archives of Science

    CERN Multimedia

    GS Department

    2009-01-01

    CERN Library has enabled a trial access to the online archives of Science, starting in 1880, until 26 June. You are welcome to test this resource at http://www.sciencemag.org/archive/ Please contact Anne.Gentil-Beccot@cern.ch, for any feedback.

  3. Active preservation - otherwise no archives

    Energy Technology Data Exchange (ETDEWEB)

    Norberg, E. [National Swedish Archives, Stockholm (Sweden)

    1996-12-01

    The role and history of national and regional archives in Sweden is discussed. It is noted that large portions of our cultural heritage can not be set aside for long-term preservation due to several facts: Some events are never documented, Important records are never set aside, Important information is stored on media that are not suitable for long-term preservation, Information can not be accessed due to inadequate search aids, Eliminations are made due to lack of space. Strategies for an action plan to save valuable material are briefly outlined, and the importance of international cooperation is stressed.

  4. Picture archival and communication systems

    International Nuclear Information System (INIS)

    Providing high quality care through an efficient delivery system is the aim of every health care organization. With the phenomenal rise of computer technology in recent times, it has become possible to store and communicate medical images in digital format. PACS systems are generally based on a dedicated computer, which can access data stored in the digital image processors of different imaging modalities and transfer this data at high speeds to remote viewing consoles, to archival storage media and to other computer systems either within the hospital or at remote locations

  5. Active preservation - otherwise no archives

    International Nuclear Information System (INIS)

    The role and history of national and regional archives in Sweden is discussed. It is noted that large portions of our cultural heritage can not be set aside for long-term preservation due to several facts: Some events are never documented, Important records are never set aside, Important information is stored on media that are not suitable for long-term preservation, Information can not be accessed due to inadequate search aids, Eliminations are made due to lack of space. Strategies for an action plan to save valuable material are briefly outlined, and the importance of international cooperation is stressed

  6. Data archiving and analysis for CWDD

    International Nuclear Information System (INIS)

    A computer system has been developed to handle archiving and analysis of data acquired during operations of the Continuous Wave Deuterium Demonstrator (CWDD). Data files generated by the CWDD Instrumentation and Control system are transferred across a local area network to the CWDD Archive system where they are enlisted into the archive and stored on removeable media optical disk drives. A relational database management system maintains an on-line database catalog of all archived files. This database contains information about file contents and formats, and holds signal parameter configuration tables needed to extract and interpret data from the files. Software has been developed to assist the selection and retrieval of data on demand based upon references in the catalog. Data retrieved from the archive is transferred to commercial data visualization applications for viewing, plotting and analysis

  7. Nonlinear magnetohydrodynamics of edge localized mode precursors

    Energy Technology Data Exchange (ETDEWEB)

    Guo, Z. B., E-mail: guozhipku@gmail.com [State Key Laboratory of Nuclear Physics and Technology, School of Physics, Peking University, Beijing (China); WCI Center for Fusion Theory, NFRI, Gwahangno 113, Yusung-gu, Daejeon 305-333 (Korea, Republic of); Wang, Lu [SEEE, Huazhong University of Science and Technology, Wuhan, Hubei 430074 (China); Wang, X. G. [State Key Laboratory of Nuclear Physics and Technology, School of Physics, Peking University, Beijing (China)

    2015-02-15

    A possible origin of edge-localized-mode (ELM) precursors based on nonlinear ideal peeling-ballooning mode is reported. Via nonlinear variational principle, a nonlinear evolution equation of the radial displacement is derived and solved, analytically. Besides an explosive growth in the initial nonlinear phase, it is found that the local displacement evolves into an oscillating state in the developed nonlinear phase. The nonlinear frequency of the ELM precursors scales as ω{sub pre}∼x{sup 1/3}ξ{sup ^}{sub ψ,in}{sup 2/3}n, with x position in radial direction, ξ{sup ^}{sub ψ,in} strength of initial perturbation, and n toroidal mode number.

  8. Functional Nanoporous Polymers from Block Copolymer Precursors

    DEFF Research Database (Denmark)

    Guo, Fengxiao

    functionalities remains a great challenge due to the limitation of available polymer synthesis and the nanoscale confinement of the porous cavities. The main topic of this thesis is to develop methods for fabrication of functional nanoporous polymers from block copolymer precursors. A method has been developed......Abstract Self-assembly of block copolymers provides well-defined morphologies with characteristic length scales in the nanometer range. Nanoporous polymers prepared by selective removal of one block from self-assembled block copolymers offer great technological promise due to their many potential......, where living anionic polymerization and atom transfer radical polymerization (ATRP) are combined to synthesize a polydimethylsiloxane-b-poly(tert-butyl acrylate)-b-polystyrene (PDMS-b-PtBA-b-PS) triblock copolymer precursor. By using either anhydrous hydrogen fluoride or trifluoroacetic acid, PtBA block...

  9. A Novel Synthesis of Biomolecular Precursors

    Science.gov (United States)

    Saladino, Raffaele; et al.

    2004-07-01

    We discuss the role of formamide, a product of hydrolysis of hydrogen cyanide (HCN), as precursor of relevant components of nucleic acids in prebiotic conditions and describe the efficient synthesis of purine, adenine, cytosine, thymine, and 5-hydroxymethyluracil. The remarkable formation of some purine acyclonucleosides is also reported, providing a possible solution to the problem of the elusive origin of nucleosides under prebiotic conditions. The role of catalysts as CaCO3, silica, alumina, TiO2 and others in enhancing and variegating the yields of these compounds is described. In addition, formamide acts as a selective agent in the degradation of bases, nucleosides and DNA oligomers. Taken together, these observations reveal a formamide-based synthesis/degradation cycle whose properties provide an equilibration mechanism for the pool of prebiotic precursors.

  10. Lunar Robotic Precursor Missions Using Electric Propulsion

    OpenAIRE

    Winski, Richard G.

    2006-01-01

    A trade study is carried out for the design of electric propulsion based lunar robotic precursor missions. The focus is to understand the relationships between payload mass delivered, electric propulsion power, and trip time. The results are compared against a baseline system using chemical propulsion with LOX/H2. The major differences between the chemical propulsion based and electric propulsion based systems are presented in terms of the payload mass and trip time. It is shown that solar e...

  11. Phonon Theory of Martensitic Transformation Precursors

    OpenAIRE

    Jin, Yongmei M.; Wang, Yu. U.

    2014-01-01

    A phonon theory of precursor phenomena in martensitic phase transformations is developed. Extending Gr\\"uneisen theory of thermal expansion, this theory addresses the effects of deformation-dependent low-energy phonons on the structural, thermal, and elastic behaviors of pre-martensitic cubic crystals that undergo incomplete phonon softening. It reveals spontaneous symmetry breaking, pre-martensitic transformation, phonon domains, and tweed structure. The theory naturally explains the ubiquit...

  12. Radiation response of rodent neural precursor cells

    International Nuclear Information System (INIS)

    Full text: Therapeutic irradiation of the brain can cause cognitive dysfunction that is not treatable or well understood. Several lines of evidence from our laboratory suggest that radiation induced inhibition of neurogenesis in the hippocampus may be involved. To understand the mechanisms underlying these observations, we initiated studies using neural precursor cells isolated from the adult rat hippocampus. Cells were cultured exponentially and analyzed for acute (0-24h) and chronic (3-33 day) changes in apoptosis and oxidative stress following exposure to X-rays. Oxidative stress was measured using a dye sensitive to reactive oxygen species (ROS) and apoptosis was measured using annexin V binding; each endpoint was quantified by fluorescent automated cell sorting (FACS). Following exposure to X-rays, neural precursor cells exhibit a dose-responsive increase in the level of ROS and apoptosis over acute and chronic time frames. ROS and apoptosis were maximal at 12h, increasing 35 and 37% respectively over that of unirradiated controls. ROS and apoptosis peaked again at 24h, increasing 31 and 21% respectively over controls. Chronic levels of ROS and apoptosis were persistently elevated in a dose-dependent manner. ROS showed significant increases (34-180%) over a 3-4 week interval, while increases in apoptosis were less dramatic, rising 45% by week one before dropping to background. Irradiation of rat neural precursor cells was associated with an increase in p53 protein levels, and the activation of G1/S and G2/M checkpoints. These data suggest that the apoptotic and ROS responses may be tied to p53 dependent regulation of cell cycle control and stress activated pathways. We propose that oxidative stress plays a critical role in the radiation response of neural precursor cells, and discuss how this might contribute to the inhibition of neurogenesis and the cognitive impairment observed in the irradiated CNS

  13. PRECURSORS OF EARTHQUAKES: VLF SIGNALSIONOSPHERE IONOSPHERE RELATION

    Directory of Open Access Journals (Sweden)

    Mustafa ULAS

    2013-01-01

    Full Text Available lot of people have died because of earthquakes every year. Therefore It is crucial to predict the time of the earthquakes reasonable time before it had happed. This paper presents recent information published in the literature about precursors of earthquakes. The relationships between earthquakes and ionosphere are targeted to guide new researches in order to study further to find novel prediction methods.

  14. Proinsulin: from hormonal precursor to neuroprotective factor

    OpenAIRE

    Flora de Pablo

    2011-01-01

    In the last decade, non-canonical functions have been described for several molecules with hormone-like activities in different stages of vertebrate development. Since its purification in the 1960s, proinsulin has been one of the best described hormonal precursors, though it has been overwhelmingly studied in the context of insulin, the mature protein secreted by the pancreas. Beginning with our discovery of the presence and precise regulation of proinsulin mRNA in early neurulation and neuro...

  15. Proinsulin: From Hormonal Precursor to Neuroprotective Factor

    OpenAIRE

    De La Rosa, Enrique J; Pablo, Flora de

    2011-01-01

    In the last decade, non-canonical functions have been described for several molecules with hormone-like activities in different stages of vertebrate development. Since its purification in the 1960s, proinsulin has been one of the best described hormonal precursors, though it has been overwhelmingly studied in the context of insulin, the mature protein secreted by the pancreas. Beginning with our discovery of the presence and precise regulation of proinsulin mRNA in early neurulation and neuro...

  16. Probe measurements on a shock precursor

    International Nuclear Information System (INIS)

    A shock front of speed V/sub s/ from 0.6 to 5 x 106 cm/sec is launched by a capacitor discharge in one end of a 10 cm i.d. Pyrex pipe 150 cm long. Initial gas pressures range from 0.05 to 1.35 Torr of argon and observations with internal probes are carried out at positions down the tube, z of 73 to 117 cm. A steady magnetic field is applied and the shock, detected by pressure traces, compresses the field by 1.7: 1. Ahead of this shock a precursor is found which produces a magnetic field change which is abrupt (risetime=0.7 μsec) and substantial (approximately 50% of the imposed field). The size of this diamagnetic field change increases with V/sub s/ in agreement with a simple diamagnetic model which includes substantial radial flow. The location of precursor field change moves upstream toward the shock with reduced V/sub s/ and the strength of the field change is reduced at radii nearer the tube walls. Measurements of excitation temperature yield values of kT/sub e/=2.0 eV for the shock and 2.5 eV for the precursor region

  17. Ionospheric precursors for crustal earthquakes in Italy

    Science.gov (United States)

    Perrone, L.; Korsunova, L. P.; Mikhailov, A. V.

    2010-04-01

    Crustal earthquakes with magnitude 6.0>M≥5.5 observed in Italy for the period 1979-2009 including the last one at L'Aquila on 6 April 2009 were considered to check if the earlier obtained relationships for ionospheric precursors for strong Japanese earthquakes are valid for the Italian moderate earthquakes. The ionospheric precursors are based on the observed variations of the sporadic E-layer parameters (h'Es, fbEs) and foF2 at the ionospheric station Rome. Empirical dependencies for the seismo-ionospheric disturbances relating the earthquake magnitude and the epicenter distance are obtained and they have been shown to be similar to those obtained earlier for Japanese earthquakes. The dependences indicate the process of spreading the disturbance from the epicenter towards periphery during the earthquake preparation process. Large lead times for the precursor occurrence (up to 34 days for M=5.8-5.9) tells about a prolong preparation period. A possibility of using the obtained relationships for the earthquakes prediction is discussed.

  18. Ionospheric precursors for crustal earthquakes in Italy

    Directory of Open Access Journals (Sweden)

    L. Perrone

    2010-04-01

    Full Text Available Crustal earthquakes with magnitude 6.0>M≥5.5 observed in Italy for the period 1979–2009 including the last one at L'Aquila on 6 April 2009 were considered to check if the earlier obtained relationships for ionospheric precursors for strong Japanese earthquakes are valid for the Italian moderate earthquakes. The ionospheric precursors are based on the observed variations of the sporadic E-layer parameters (h'Es, fbEs and foF2 at the ionospheric station Rome. Empirical dependencies for the seismo-ionospheric disturbances relating the earthquake magnitude and the epicenter distance are obtained and they have been shown to be similar to those obtained earlier for Japanese earthquakes. The dependences indicate the process of spreading the disturbance from the epicenter towards periphery during the earthquake preparation process. Large lead times for the precursor occurrence (up to 34 days for M=5.8–5.9 tells about a prolong preparation period. A possibility of using the obtained relationships for the earthquakes prediction is discussed.

  19. Cellular Kinetics of Perivascular MSC Precursors

    Directory of Open Access Journals (Sweden)

    William C. W. Chen

    2013-01-01

    Full Text Available Mesenchymal stem/stromal cells (MSCs and MSC-like multipotent stem/progenitor cells have been widely investigated for regenerative medicine and deemed promising in clinical applications. In order to further improve MSC-based stem cell therapeutics, it is important to understand the cellular kinetics and functional roles of MSCs in the dynamic regenerative processes. However, due to the heterogeneous nature of typical MSC cultures, their native identity and anatomical localization in the body have remained unclear, making it difficult to decipher the existence of distinct cell subsets within the MSC entity. Recent studies have shown that several blood-vessel-derived precursor cell populations, purified by flow cytometry from multiple human organs, give rise to bona fide MSCs, suggesting that the vasculature serves as a systemic reservoir of MSC-like stem/progenitor cells. Using individually purified MSC-like precursor cell subsets, we and other researchers have been able to investigate the differential phenotypes and regenerative capacities of these contributing cellular constituents in the MSC pool. In this review, we will discuss the identification and characterization of perivascular MSC precursors, including pericytes and adventitial cells, and focus on their cellular kinetics: cell adhesion, migration, engraftment, homing, and intercellular cross-talk during tissue repair and regeneration.

  20. Applied Archival Downloading with Wget

    Directory of Open Access Journals (Sweden)

    Kellen Kurschinski

    2013-09-01

    Full Text Available Archival websites offer a wealth of resources to historians, but increased accessibility does not always translate into increased utility. In other words, while online collections often allow historians to access hitherto unavailable or cost-prohibitive materials, they can also be limited by the manner in which content is presented and organized. Take for example the Indian Affairs Annual Reports database hosted on the Library and Archives Canada [LAC] website. Say you wanted to download an entire report, or reports for several decades. The current system allows a user the option to read a plaintext version of each page, or click on the “View a scanned page of original Report” link, which will take the user to a page with LAC’s embedded image viewer. This allows you to see the original document, but it is also cumbersome because it requires you to scroll through each individual page. Moreover, if you want the document for offline viewing, the only option is to right click –> save as each image to a directory on your computer. If you want several decades’ worth of annual reports, you can see the limits to the current means of presentation pretty easily. This lesson will allow you to overcome such an obstacle.

  1. Data Transfer Study HPSS Archiving

    Energy Technology Data Exchange (ETDEWEB)

    Wynne, James [Oak Ridge National Laboratory (ORNL); Parete-Koon, Suzanne T [ORNL; Mitchell, Quinn [Oak Ridge National Laboratory (ORNL); White, Stanley R [ORNL

    2015-01-01

    The movement of the large amounts of data produced by codes run in a High Performance Computing (HPC) environment can be a bottleneck for project workflows. To balance filesystem capacity and performance requirements, HPC centers enforce data management policies to purge old files to make room for new computation and analysis results. Users at Oak Ridge Leadership Computing Facility (OLCF) and many other HPC user facilities must archive data to avoid data loss during purges, therefore the time associated with data movement for archiving is something that all users must consider. This study observed the difference in transfer speed from the originating location on the Lustre filesystem to the more permanent High Performance Storage System (HPSS). The tests were done with a number of different transfer methods for files that spanned a variety of sizes and compositions that reflect OLCF user data. This data will be used to help users of Titan and other Cray supercomputers plan their workflow and data transfers so that they are most efficient for their project. We will also discuss best practice for maintaining data at shared user facilities.

  2. Cutaneous lesions in new born

    Directory of Open Access Journals (Sweden)

    Sachdeva Meenakshi

    2002-11-01

    Full Text Available Five hundred unselected newborn babies delivered in the Department of Obstetrics and Gynaecology, Unit II of SGBT Hospital attached to Government Medical College, Amritsar during April 2000 to October 2000 were examined for cutaneous lesions daily for the first five days after birth. Different cutaneous lesions were seen in 474(94. 8% newborns. The physiological skin changes observed in order of frequency were Epstein pearls in 305(61%, Mongolian spot in 301(60. 2%, superficial cutaneous desquamation in 200(40%, icterus in 128(25. 6%, milia in 119(23. 8%, sebaceous gland hyperplasia in 107 (21. 4%, occipital alopecia in 94(18. 8%, lanugo in 72(14. 4%, peripheral cyanosis in 47(9. 4%, breast hypertrophy in 29(5. 8% and miniature puberty in 28(5. 6% newborns. Of the transient non-infective skin diseases, erythema toxicum neonatorum was observed most commonly in 105(21 %, followed by miliaria rubra in 103(20. 6% and acne neonatorum in 27(5. 4% newborns. The naevi and other developmental defects in the descending order were salmon patch in 69(13. 8%, congenital melanocytic noevi in 10(2%, accessory tragi in 3(0.6%, spina bifida in 2(0.4%, hydrocephalus in 1(0.2% and poliosis in 1(0.2% newborns. Cradle cap was the only dermatitis observed in 50(10% newborns. One (0.2% case each of Harlequin ichthyosis and labial cyst was seen.

  3. Reverse Detection of Short-Term Earthquake Precursors

    OpenAIRE

    V. Keilis-Borok; Shebalin, P.; Gabrielov, A.; Turcotte, D.

    2003-01-01

    We introduce a new approach to short-term earthquake prediction based on the concept of selforganization of seismically active fault networks. That approach is named "Reverse Detection of Precursors" (RDP), since it considers precursors in reverse order of their appearance. This makes it possible to detect precursors undetectable by direct analysis. Possible mechanisms underlying RDP are outlined. RDP is described with a concrete example: we consider as short-term precursors the newly introdu...

  4. Radiologic aspects of the Galeazzi lesion

    International Nuclear Information System (INIS)

    In lesions of the forearm that included a fracture of the distal two thirds of the radial shaft, a concomitant disruption of the distal radio-ulnar joint was found in 20 out of 38 cases. In 15 cases a typical Galeazzi lesion was present. Dislocation of the distal radio-ulnar joint frequently goes unrecognized. The clinical significance of a lesion in the distal radio-ulnar joint is related to its prognostic value. (orig.)

  5. Management of Anal Squamous Intraepithelial Lesions

    OpenAIRE

    Pineda, Carlos E.; Welton, Mark L.

    2009-01-01

    Anal squamous intraepithelial lesions include both low-grade squamous intraepithelial lesions (LSIL) and high-grade squamous intraepithelial lesions (HSIL) and are caused by chronic infection with the human papillomavirus (HPV). The disease is increasing in both incidence and prevalence, especially among patients with the following risk factors: homosexual men, acquired or iatrogenic immunosuppression, and presence of other HPV-related diseases. Although the natural history of the disease is ...

  6. Examining Activism in Practice: A Qualitative Study of Archival Activism

    Science.gov (United States)

    Novak, Joy Rainbow

    2013-01-01

    While archival literature has increasingly discussed activism in the context of archives, there has been little examination of the extent to which archivists in the field have accepted or incorporated archival activism into practice. Scholarship that has explored the practical application of archival activism has predominately focused on case…

  7. Thermophysical lesions caused by HZE particles

    International Nuclear Information System (INIS)

    This paper deals with a type of damage caused by heavy particles that may occur in subcellular structures. These lesions are called thermophysical radiation injury and are similar to damage produced in solids by HZE particles. This chapter summarizes some of the experimental evidence for the presence of these lesions in certain mammalian tissues including the retina, brain, cornea, lens of mice and seeds of corn. Of all tissues examined, only the cornea exhibited a type of lesion which would fulfill the criteria of thermophysical lesions

  8. The Web Lecture Archive Project: Archiving ATLAS Presentations and Tutorials

    CERN Multimedia

    Herr, J

    2004-01-01

    The geographical diversity of the ATLAS Collaboration presents constant challenges in the communication between and training of its members. One important example is the need for training of new collaboration members and/or current members on new developments. The Web Lecture Archive Project (WLAP), a joint project between the University of Michigan and CERN Technical Training, has addressed this challenge by recording ATLAS tutorials in the form of streamed "Web Lectures," consisting of synchronized audio, video and high-resolution slides, available on demand to anyone in the world with a Web browser. ATLAS software tutorials recorded by WLAP include ATHENA, ATLANTIS, Monte Carlo event generators, Object Oriented Analysis and Design, GEANT4, and Physics EDM and tools. All ATLAS talks, including both tutorials and meetings are available at http://www.wlap.org/browser.php?ID=atlas. Members of the University of Michigan Physics Department and Media Union, under the framework of the ATLAS Collaboratory Project ...

  9. Chromosomal aberrations in benign and malignant Bilharzia-associated bladder lesions analyzed by comparative genomic hybridization

    International Nuclear Information System (INIS)

    Bilharzia-associated bladder cancer (BAC) is a major health problem in countries where urinary schistosomiasis is endemic. Characterization of the genetic alterations in this cancer might enhance our understanding of the pathogenic mechanisms of the disease but, in contrast to nonbilharzia bladder cancer, BAC has rarely been the object of such scrutiny. In the present study, we aimed to characterize chromosomal imbalances in benign and malignant post-bilharzial lesions, and to determine whether their unique etiology yields a distinct cytogenetic profile as compared to chemically induced bladder tumors. DNAs from 20 archival paraffin-embedded post-bilharzial bladder lesions (6 benign and 14 malignant) obtained from Sudanese patients (12 males and 8 females) with a history of urinary bilharziasis were investigated for chromosomal imbalances using comparative genomic hybridization (CGH). Subsequent FISH analysis with pericentromeric probes was performed on paraffin sections of the same cases to confirm the CGH results. Seven of the 20 lesions (6 carcinomas and one granuloma) showed chromosomal imbalances varying from 1 to 6 changes. The most common chromosomal imbalances detected were losses of 1p21-31, 8p21-pter, and 9p and gain of 19p material, seen in three cases each, including the benign lesion. Most of the detected imbalances have been repeatedly reported in non-bilharzial bladder carcinomas, suggesting that the cytogenetic profiles of chemical- and bilharzia-induced carcinomas are largely similar. However, loss of 9p seems to be more ubiquitous in BAC than in bladder cancer in industrialized countries

  10. A histopathological overview of ovarian lesions in Benin City, Nigeria: How common are the functional cysts?

    Directory of Open Access Journals (Sweden)

    Gerald Dafe Forae

    2014-07-01

    Full Text Available Aim: The aim of this study is to highlight the histopathological synopsis of ovarian lesions with emphasis on functional ovarian cysts and to compare our study with findings of other centers. Materials and Methods: Hematoxylin and eosin stained-slides of ovarian biopsies diagnosed at the Ashamas Foundation Diagnostic Centre, Benin City for 10 years were archived, scrutinized, and studied. Request forms were analyzed for clinical biodata and diagnosis, and data were analyzed with Statistical Package for Social Sciences (SPSS version 17. Results: A total of 236 ovarian biopsies were reviewed. Of this, 121 (51.3% were nonneoplastic. Again 79 (33.5% were benign neoplastic tumors and 36 (15.6% were malignant tumors. Out of the 121 nonneoplastic (functional cysts lesions, corpus luteal cyst was the most commonly encountered, constituting 41 (33.9%. The peaks age incidence for nonneoplastic and benign neoplastic lesions occurred in the 3 rd decade. Two peaks age incidence was noted for malignant tumors-5 th and 7 th decades. Germ cell tumor constituted the most common neoplastic ovarian tumor (n = 59; 51.8% diagnosed. Conclusion: Functional ovarian cysts were the most commonly encountered ovarian lesions in our locality. The most common variety of functional cyst was corpus luteal cyst and hemorrhagic cyst with majority occurring in the reproductive age groups. Among the ovarian tumors, germ cell tumors were the most commonly seen.

  11. ESA Science Archives and associated VO activities

    Science.gov (United States)

    Arviset, Christophe; Baines, Deborah; Barbarisi, Isa; Castellanos, Javier; Cheek, Neil; Costa, Hugo; Fajersztejn, Nicolas; Gonzalez, Juan; Fernandez, Monica; Laruelo, Andrea; Leon, Ignacio; Ortiz, Inaki; Osuna, Pedro; Salgado, Jesus; Tapiador, Daniel

    ESA's European Space Astronomy Centre (ESAC), near Madrid, Spain, hosts most of ESA space based missions' scientific archives, in planetary (Mars Express, Venus Express, Rosetta, Huygens, Giotto, Smart-1, all in ESA Planetary Science Archive), in astronomy (XMM-Newton, Herschel, ISO, Integral, Exosat, Planck) and in solar physics (Soho). All these science archives are operated by a dedicated Science Archives and Virtual Observatory Team (SAT) at ESAC, enabling common and efficient design, development, operations and maintenance of the archives software systems. This also ensures long term preservation and availability of such science archives, as a sustainable service to the science community. ESA space science data can be accessed through powerful and user friendly user interface, as well as from machine scriptable interface and through VO interfaces. Virtual Observatory activities are also fully part of ESA archiving strategy and ESA is a very ac-tive partner in VO initiatives in Europe through Euro-VO AIDA and EuroPlanet and worldwide through the IVOA (International Virtual Observatory Alliance) and the IPDA (International Planetary Data Alliance).

  12. European distributed seismological data archives infrastructure: EIDA

    Science.gov (United States)

    Clinton, John; Hanka, Winfried; Mazza, Salvatore; Pederson, Helle; Sleeman, Reinoud; Stammler, Klaus; Strollo, Angelo

    2014-05-01

    The European Integrated waveform Data Archive (EIDA) is a distributed Data Center system within ORFEUS that (a) securely archives seismic waveform data and related metadata gathered by European research infrastructures, and (b) provides transparent access to the archives for the geosciences research communities. EIDA was founded in 2013 by ORFEUS Data Center, GFZ, RESIF, ETH, INGV and BGR to ensure sustainability of a distributed archive system and the implementation of standards (e.g. FDSN StationXML, FDSN webservices) and coordinate new developments. Under the mandate of the ORFEUS Board of Directors and Executive Committee the founding group is responsible for steering and maintaining the technical developments and organization of the European distributed seismic waveform data archive and the integration within broader multidisciplanry frameworks like EPOS. EIDA currently offers uniform data access to unrestricted data from 8 European archives (www.orfeus-eu.org/eida), linked by the Arclink protocol, hosting data from 75 permanent networks (1800+ stations) and 33 temporary networks (1200+) stations). Moreover, each archive may also provide unique, restricted datasets. A webinterface, developed at GFZ, offers interactive access to different catalogues (EMSC, GFZ, USGS) and EIDA waveform data. Clients and toolboxes like arclink_fetch and ObsPy can connect directly to any EIDA node to collect data. Current developments are directed to the implementation of quality parameters and strong motion parameters.

  13. Archival services and technologies for scientific data

    International Nuclear Information System (INIS)

    After analysis and publication, there is no need to keep experimental data online on spinning disks. For reliability and costs inactive data is moved to tape and put into a data archive. The data archive must provide reliable access for at least ten years following a recommendation of the German Science Foundation (DFG), but many scientific communities wish to keep data available much longer. Data archival is on the one hand purely a bit preservation activity in order to ensure the bits read are the same as those written years before. On the other hand enough information must be archived to be able to use and interpret the content of the data. The latter is depending on many also community specific factors and remains an areas of much debate among archival specialists. The paper describes the current practice of archival and bit preservation in use for different science communities at KIT for which a combination of organizational services and technical tools are required. The special monitoring to detect tape related errors, the software infrastructure in use as well as the service certification are discussed. Plans and developments at KIT also in the context of the Large Scale Data Management and Analysis (LSDMA) project are presented. The technical advantages of the T10 SCSI Stream Commands (SSC-4) and the Linear Tape File System (LTFS) will have a profound impact on future long term archival of large data sets.

  14. SIOExplorer: Opening Archives for Education

    Science.gov (United States)

    Miller, S. P.; Staudigl, H.; Johnson, C.; Helly, J.; Day, D.

    2003-04-01

    The SIOExplorer project began with a desire to organize the data archives of the Scripps Institution of Oceanography, which include the observations from 822 cruises over 50 years. Most of the data volume comes from 244 multibeam seafloor swath mapping cruises since 1982. Rather than just create an online archive or a website, the decision was made to build a fully searchable digital library, and to include related historical images and documents from the SIO Archives in the SIO Library. It soon became apparent that much of the material would be appealing to students of all ages, as well as the general public. Access to several global databases was added, along with the seamount catalog and geochemical resources of www.earthref.org. SIOExplorer has now become a part of the National Science Digital Library (www.nsdl.org) and can be accessed directly at http://SIOExplorer.ucsd.edu. From the beginning, it was obvious that a scalable Information Technology architecture would be needed. Data and documents from three separate organizations would need to be integrated initially, with more to follow in subsequent years. Each organization had its own data standards and formats. Almost no metadata existed. With millions of files and approximately 1 terabyte of data, we realized that a team approach would be required, combining the expertise of SIO, the UCSD Libraries and the San Diego Supercomputer Center. General purpose tools have now been developed to automate collection development, create and manage metadata, and geographically search the library. Each digital object in the library has an associated metadata structure, which includes a Dublin Core block along with domain-specific blocks, as needed. Objects can be searched geospatially, temporally, by keyword, and by expert-level. For example, expert-level classification makes it possible to screen out research-grade contents, revealing material appropriate for the selected grade, such as K-6. Now that the library has

  15. Gastrointestinal Polypoid Lesions: The Albanian Reality

    Directory of Open Access Journals (Sweden)

    Gentiana Cekodhima

    2015-12-01

    Full Text Available Background: Gastrointestinal polypoid lesions are a well-known cause of possible future malignant lesions. Screening for these lesions, especially for colon polyps, has reduced morbidity and mortality from malignant tumors. To our best knowledge, no screening program on gastrointestinal polypoid lesions exists in Albania and no former study has been performed to check the distribution of these lesions. Therefore, our aim was to study the distribution of gastrointestinal polypoid lesions in a symptomatic outpatient population. Methods: This study included five hundred seventy five consecutive patients referred to perform an endoscopic examination, regardless of their specific complains and of their possible diagnosis, to one of the two Endoscopy Centers in Tirana in the period between January 1st 2008 and December 31st 2013. At least one polyp was resected and histologically examined in all included patients. Results: A total of 575 patients, of which 345 males (60.0%, aged 51.9 years (standard deviation 16.97 years, were examined and their data inserted in the statistical analysis. In total, 88 cases were identified with malignant pathologies of which 50 cases (56.8% were males. No case of malignancy was diagnosed among the nine esophageal specimens, but among the specimens resected from the stomach, small intestine and large intestine, were respectively diagnosed 21 (20.0%, 9 (40.9% and 58 (13.2% malignant lesions. Patients with malignant lesions were older (57.4 ± 16.8 years old in contrast to those with benign lesions (50.5 ± 17.0 years old (p = 0.004. Conclusion: Our study is the first one to offer figures on the polypoid lesions distribution and characteristics in the Albanian population. Large intestine is the main site where such lesions occur, but anyhow the small intestine presented a larger proportion of malignancy.

  16. Simulating the mammographic appearance of circumscribed lesions

    International Nuclear Information System (INIS)

    Optimization performance of digital image post-processing techniques in mammography requires controlled conditions of data sets permitting quantitative representation of image characteristics of pathological findings. Digital test objects, although objective and quantitative, do not mimic mammographic appearance and clinical data sets do not provide adequate sets of values of the various pathological finding characteristics. This can be overcome by digital simulation of pathological findings and superimposition on mammographic images. A simple method for simulation of mammographic appearance of radiopaque and/or radiolucent circumscribed lesions is presented. Circumscribed lesions are simulated using grey-level transformation functions which shift and compress the range of the initial pixel grey-level values in a region of interest (ROI) of a digitized mammographic image, according to grey-level analysis in 200 ROIs of real circumscribed lesions from digitized mammographic images. Simulation addresses lesion image characteristics, such as elliptical shape, orientation, halo sign for radiopaque lesions and capsule for radiolucent lesions, and is implemented in a user-driven PC-based interactive application. The appearance of the lesions is evaluated by six radiologists on a sample of 60 real and 60 simulated radiopaque lesions with the use of receiver operating characteristic (ROC) analysis. The area under the ROC curve, pooling the responses of the observers, was 0.55±0.03 indicating no statistically significant difference between real and simulated lesions (p>0.05). The method adequately simulates the mammographic appearance of circumscribed lesions and could be used to generate circumscribed lesion data sets for performance evaluation of image processing techniques, as well as education purposes. (orig.)

  17. Localization of lesions in aphasia, (2)

    International Nuclear Information System (INIS)

    The relationship between the focus and the extent of the lesions and the various symptoms was investigated. 1. Broca aphasics: More than 80% of the group with obvious anarthric components had lesions of the third frontal gyrus involving Broca's area and the lower part of the precental gyrus as well as opercular and insular regions. The size of the lesions of this group was significantly larger than that of the group without marked anarthric components, and the latter was proved to have little localizing value. 2. Wernicke aphasics: The group with poor reading comprehension had cortical and/or subcortical lesions, involving posterior parts of both superior and middle temporal gyri as well as the supramarginal gyrus. On the other hand, lesions of the group with poor auditory comprehension were more anteriorly located and localized in the deep structures. Lesions of the group with poor Token test scores were large and scattered more anteriorly and/or posteriorly compared with those of the group with good Token test scores. 3. Amnestic aphaiscs: The group with poor naming scores had somewhat larger lesions than the group with good naming scores, and the lesions were scattered about the left hemisphere. The finding has proved that both groups had little localizing value. 4. Conduction aphasics: Lesions of the non-fluent type were significantly larger than those of the fluent type and distributed more anteriorly. However, highly involved lesions were located in the supramarginal gyrus and posterior parts of superior and/or middle temporal gyri. 5. Global aphasics: Lesions of the group with good articulation and prosody were observed to distribute more posteriorly in comparison with those of the other global aphasics. (J.P.N.)

  18. Lesiones del ligamento cruzado anterior

    Directory of Open Access Journals (Sweden)

    Alejandro Álvarez López

    2015-01-01

    Full Text Available Fundamento: el ligamento cruzado anterior desempeña un papel muy importante en la estabili-dad de la rodilla. La incidencia de esta afección es alta en pacientes que practican deportes de contacto y de no ser tratados de forma adecuada, los resultados son desfavorables. Objetivo: profundizar en los factores necesarios para el tratamiento adecuado de enfermos con esta lesión y evitar las complicaciones. Método: se realizó una revisión bibliográfica de un total de 300 artículos publicados en Pubmed, Hinari y Medline mediante el localizador de información Endnote, de ellos se utilizaron 52 citas selecciona-das para realizar la revisión, 48 de ellas de los últimos cinco años donde se incluyeron seis libros. Desarrollo: se discuten los aspectos relacionados con el diagnóstico clínico e imaginológico. Se aborda la clasificación de esta lesión en cuanto a varios aspectos como: tiempo, lesión de ligamentos u ósea, aislada o combinada y parcial o total. Se mencionan los parámetros para obtener resultados satisfac-torios al considerar factores como la edad del enfermo, lesiones asociadas y tiempo de la lesión. Se relacio-nan los requisitos para la selección del implante y se mostró las ventajas y desventajas de cada tipo de in-jerto. Las complicaciones de esta cirugía están relacionadas con la técnica quirúrgica y médicas. Conclusiones: las lesiones del ligamento son entidades traumáticas que afectan por lo general a pacientes jóvenes. Para lograr un resultado satisfactorio en el tratamiento es necesario el conocimiento de su anatomía, clasificación, tipo de injerto a emplear según sus ventajas y desventajas.

  19. Archives and societal provenance Australian essays

    CERN Document Server

    Piggott, Michael

    2012-01-01

    Records and archival arrangements in Australia are globally relevant because Australia's indigenous people represent the oldest living culture in the world, and because modern Australia is an ex-colonial society now heavily multicultural in outlook. Archives and Societal Provenance explores this distinctiveness using the theoretical concept of societal provenance as propounded by Canadian archival scholars led by Dr Tom Nesmith. The book's seventeen essays blend new writing and re-workings of earlier work, comprising the fi rst text to apply a societal provenance perspective to a national sett

  20. Long Term Archiving and CCSDS Standards

    Science.gov (United States)

    Boucon, Danièle

    This article presents some conceptual and implementation CCSDS -Consultative Committee for Space Data Systemsstandards for long term archiving. It focuses on the most recent one, the Producer Archive Interface Specification (PAIS) standard. This standard, currently available as a draft on the CCSDS web site, will be published by the beginning of 2014. It will enable the Producer to share with the Archive a sufficiently precise and unambiguous formal definition of the Digital Objects to be produced and transferred, by means of a model. It will also enable a precise definition of the packaging of these objects in the form of Submission Information Packages (SIPs), including the order in which they should be transferred.

  1. Making Nuclear Malaysia Email Archives Portable

    International Nuclear Information System (INIS)

    Nuclear Malaysia e-mails can be accessed from any computer and anywhere, even worldwide, via web access. However, this mobility is lost when the e-mails are moved to a personal computer into archive files such as Microsoft Outlook data files. Outlook e-mail archives can only be read on the computer where it is stored. This removal has to be done because of storage space constraints on the e-mail server. This paper shows how e-mail archives can be made portable, brought and read anywhere using a free portable e-mail client application such as Mozilla Thunderbird, Portable Edition. (author)

  2. Passive Archives or Storages for Action?

    DEFF Research Database (Denmark)

    McQuaid, Sara Dybris

    comprehensive and egalitarian approach to accessing the past found in digital oral history; and the other considering the ‘power’ of the digital archive. Adopting the idea that story-telling as a form of ‘witnessing’ is also an ethico-political act (Kurasawa 2009), the paper discusses what kind of discourses...... may be empowered by the digitalisation of memory in oral history archives. The contested realm in which these archives operate condition how they are funded, assembled, described, opened and maintained in the process of which some stories may be privileged and others marginalised or subsumed (Brown...

  3. Data Mining the Internet Archive Collection

    Directory of Open Access Journals (Sweden)

    Caleb McDaniel

    2014-03-01

    Full Text Available The collections of the Internet Archive (IA include many digitized sources of interest to historians, including early JSTOR journal content, John Adams’s personal library, and the Haiti collection at the John Carter Brown Library. In short, to quote Programming Historian Ian Milligan, “The Internet Archive rocks.” In this lesson, you’ll learn how to download files from such collections using a Python module specifically designed for the Internet Archive. You will also learn how to use another Python module designed for parsing MARC XML records, a widely used standard for formatting bibliographic metadata.

  4. Update History of This Database - TMBETA-GENOME | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us TMBETA-GENOME Update Hist...site is opened. Joomla SEF URLs by Artio About This Database Database Description Download License Update History... of This Database Site Policy | Contact Us Update History of This Database - TMBETA-GENOME | LSDB Archive ... ...ory of This Database Date Update contents 2015/03/09 TMBETA-GENOME English archive

  5. CEL file attachments - Open TG-GATEs | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us Open...om Gene expression data, includes the related part of this dataset as a TSV file named Attributes.tsv. Data file File name: Open...-tggates_AllAttribute.zip File URL: ftp://ftp.biosciencedbc.jp/archive/open-tggates/LATEST/Open...ase Site Policy | Contact Us CEL file attachments - Open TG-GATEs | LSDB Archive ...

  6. Sequence Collection - TMBETA-GENOME | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us TM...ultiple chromosomes, the entry set for each chormosome is given individually. Data file File name: tm...beta_genome_sequence_collection.zip File URL: ftp://ftp.biosciencedbc.jp/archive/tmbeta-genome/LATEST/tm...beta_genome_sequence_collection.zip File size: 8.8 KB Simple search URL http://togodb.biosci...base Site Policy | Contact Us Sequence Collection - TMBETA-GENOME | LSDB Archive ...

  7. Reframing transitions and contesting memories: the archive and the archival object in Peruvian cinema

    OpenAIRE

    Barrow, Sarah

    2016-01-01

    This essay considers the stories behind the production and screening of two very different Peruvian films that both reveal much about the way the archive, the archival object and archival fragment have worked to disrupt and force a reconsideration of key moments in Peruvian political history of the twentieth century. One, a feature film by Francisco Lombardi, Ojos que no ven/Eyes that don’t see (2003), provides a provocative perspective on the impact of the televisual revelations of the corru...

  8. Analyse du discours et archive

    OpenAIRE

    Maingueneau, Dominique

    2007-01-01

    Les recherches qui se réclament de "l’analyse du discours" connaissent un développement considérable dans le monde entier ; en revanche, "l’école française d’analyse du discours" (AD) traverse une crise d’identité depuis le début des années 80. Dans cet exposé nous voudrions explorer les raisons de cette crise, puis préciser le concept d’archive qui, à notre sens, permet de prolonger la voie ouverte à la fin des années 1960. Mais il ne s’agit que d’une des voies possibles, dès lors que, comme...

  9. Hot sample archiving. Revision 3

    International Nuclear Information System (INIS)

    This Engineering Study revision evaluated the alternatives to provide tank waste characterization analytical samples for a time period as recommended by the Tank Waste Remediation Systems Program. The recommendation of storing 40 ml segment samples for a period of approximately 18 months (6 months past the approval date of the Tank Characterization Report) and then composite the core segment material in 125 ml containers for a period of five years. The study considers storage at 222-S facility. It was determined that the critical storage problem was in the hot cell area. The 40 ml sample container has enough material for approximately 3 times the required amount for a complete laboratory re-analysis. The final result is that 222-S can meet the sample archive storage requirements. During the 100% capture rate the capacity is exceeded in the hot cell area, but quick, inexpensive options are available to meet the requirements

  10. Medical Archive Recording System (MARS

    Directory of Open Access Journals (Sweden)

    Mohammad Reza Tajvidi

    2007-08-01

    Full Text Available In this talk, one of the most efficient, and reliable integrated tools for CD/DVD production workflow, called Medical Archive Recording System (MARS by ETIAM Company, France, which is a leader in multimedia connectivity for healthcare in Europe, is going to be introduced. "nThis tool is used to record all patient studies, route the studies to printers and PACS automatically, print key images and associated reports and log all study production for automated post processing/archiving. Its benefits vary from multi-departmental system to highly customizability, IHE compliancy, high productivity, inclusion of workflow manager and web interface."nAn automated user-friendly DICOM viewer is in-cluded in this tool, which is used to display reports and key image. It also allows comparing several stu-dies on several discs."nThe viewer supports all DICOM objects including compressed images such as JPEG, JPEG 2000, RLE etc. and video added-value non-image DICOM ob-jects."nThe ETIAM MARS is offered in two versions: MARS 15d for medium productions and MARS 20d for medium to large productions. Some of the new features that are added are supports for Windows Vista, support of new DICOM objects (enhanced CT, MR, XA, Encapsulated PDF ... IHE PDI update, creation of object keys for key images; importing non-standard reports form files and many other features."nThe tool enables users to create, verify and index CDs and DVDs by simply sending studies from any DICOM node.

  11. Main: 1IBJ [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available Chloroplast Precursor Orderedlocusnames=At3g57050; Orfnames=F24i3.130; Arabidopsis Thaliana Molecule: Cysta...THSTVNNTTDSLNTMNIKEEASVSTLLVNLDNKFDPFDAMSTPLYQTATFKQPSAIENGPYDYTRSGNPTRDALESLLAKLDKADRAFCFTSGMAALSAVTHLIKNGE...EIVAGDDVYGGSDRLLSQVVPRSGVVVKRVNTTKLDEVAAAIGPQTKLVWLESPTNPRQQISDIRKISEMAHAQGALVLVD

  12. Main: 1UVB [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1UVB イネ Rice Oryza sativa L. Nonspecific Lipid-Transfer Protein 1 Precursor Oryza S...LAAPHAAVAITCGQVNSAVGPCLTYARGGAGPSAACCSGVRSLFAAASTTADRRTACNCLKNAARGIKGLNAGNAASIPSKCGVSVPYTISASIDCSRVS rice_1UVB.jpg ...

  13. Main: 1UVC [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1UVC イネ Rice Oryza sativa L. Nonspecific Lipid-Transfer Protein 1 Precursor Oryza S... Da MARAQLVLVALVAALLLAAPHAAVAITCGQVNSAVGPCLTYARGGAGPSAACCSGVRSLFAAASTTADRRTACNCLKNAARGIKGLNAGNAASIPSKCGVSVPYTISASIDCSRVS rice_1UVC.jpg ...

  14. Biomimetic synthesis for precursor of muscone

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    Muscone is a precious fragrant compound scarce in nature. Many attempts have been made to synthesize this unique natural product. In this work, the one- carbon unit transfer reaction of tetrahydrofolate coenzyme was initiated. Benzimidazolium salt was used as the tetrahydrofolate coenzyme model at formic acid oxidation level and di-Grignard reagent as the nucleophile to which one-carbon unit was transferred; the biomimetic synthesis of 2,15- hexade-canedione, a precursor of muscone, was successfully accomplished by using the addition-hydrolysis reaction of benzimidazolium salt with Grignard reagent. And an impor-tant useful method for the synthesis of muscone is provided.

  15. Ballooning instability precursors to high β disruptions

    International Nuclear Information System (INIS)

    Strongly ballooning modes have been found as precursors to high β disruptions on TFTR. The modes are typically localized to a region spanning about 60 degree in the toroidal direction. The toroidal localization is associated with lower frequency, global Magneto-Hydro-Dynamic (MHD) activity, typically an ideal n = 1 kink mode. They have moderate to high frequency (f = 10--20 frot), implying toroidal mode numbers in the range n = 10--20. The growth rates for the modes are large, of order 104/sec

  16. Development of precursors to produce metallic foams

    OpenAIRE

    Lopes, Bruno Pinto

    2011-01-01

    As espumas metálicas produzidas por metalurgia de pós têm vindo a ser cada vez mais utilizadas nas mais diversas aplicações. Actualmente estes materiais estão a ser utilizados em estruturas ultraleves, de absorção de energia e de amortecimento sonoro em veículos automóveis, comboios, eléctricos e aeronaves. O principal objectivo desta dissertação prendeu-se com o desenvolvimento de material precursor de qualidade para o fabrico de espumas de ligas de Alumínio. Para o efeito foram testados ...

  17. Cerebral CT of ischaemic lesions

    Energy Technology Data Exchange (ETDEWEB)

    Aulich, A.

    1981-11-25

    The diagnosis of stroke must first be established by clinical examination. CT has proved useful for confirmation of the diagnosis and provides a global intracranial picture of morphological changes in cerebral vascular diseases. A hemorrhage can be recognized with certainty at the first CT examination as the cause of the stroke, but in the detection of a lesion due to ischemia an important role is played by the correct choice of the time of examination, and in some cases also of the check-up with contrast medium. The differential diagnosis between infarct in the acute stage and encephalitis or gliomas of low-grade malignity can be difficult. A decision can often only be made after a series of examinations. Postmalacial conditions are often difficult to differentiate from defects due to other causes, such as hemorrhage, head injury, postoperative states and after encephalitis. A knowledge of the anamnesis and the clinical findings is indispensable for CT evaluation. In assessing the prognosis before vascular surgery on the extracranial brain-supplying vessels the performance of a CT examination should be advised. A warning is given against the use of CT as a screening method.

  18. Transarterial chemoembolization of liver lesions

    International Nuclear Information System (INIS)

    Full text: TACE is an image-guided, non-surgical procedure that is used to treat malignant lesions in the liver (mostly hepatocellular carcinoma). the procedure uses a catheter to deliver both chemotherapy medication and embolization materials into the blood vessels that lead to the tumor. This allows doctors to treat tumors that are not accessible using conventional surgery or radiation treatments. TACE derives its beneficial effect by two primary mechanisms. Most tumors within the liver are supplied by the proper hepatic artery, so arterial embolization preferentially interrupts the tumor’s blood supply and stalls growth until neovascularization. Secondly, focused administration of chemotherapy allows for delivery of a higher dose to the tissue while simultaneously reducing systemic exposure, which is typically the dose limiting factor. this effect is potentiated by the fact that the chemotherapeutic drug is not washed out from the tumor vascular bed by blood flow after embolization. Effectively, this results in a higher concentration of drug to be in contact with the tumor for a longer period of time. We are presenting our experience with TACE

  19. [Mandibular lesions in multiple myeloma].

    Science.gov (United States)

    Scutellari, P N; Orzincolo, C

    1992-03-01

    A review was made of 237 cases of multiple myeloma seen at the Institute of Radiology and Hematology of the Ferrara University from 1984 through 1990. The results showed skeletal involvement of the mandible to be present in 25 patients (10.54%). The diagnosis of multiple myeloma was based on the following criteria: 1) increased number of abnormal, atypical or immature plasma cells in the bone marrow; 2) the presence of a monoclonal protein in the serum or urine; 3) bone lesions consistent with those of myeloma. Symptoms include pain and swelling of the oral cavity, tooth mobility and loss, numbness along the inferior dental nerve, and paresthesia of the lower lip. The typical radiographic appearance is a well-defined "punched-out" lytic defect, solitary or multiple; sometimes, the defect enlarges and appears "bubbly" or septated. Permeative lytic areas, with blurred outlines, are a rare pattern, which is radiologically indistinguishable from skeletal metastases. The involvement of the oral cavity and jaw in multiple myeloma has been often reported in literature: nevertheless, if radiographs of the jaws had been systematically taken in all the cases, its incidence would probably have been much higher than previously suspected. PMID:1579669

  20. Biogenic hardparts: Difficult archives of the geological past (Invited)

    Science.gov (United States)

    Immenhauser, A.; Schone, B. R.; Hoffmann, R.; Niedermayr, A.

    2013-12-01

    Biomineralized exo- or endoskeletons of fossil marine invertebrates are widespread and diverse components of the Phanerozoic rock record of Earth's past and present oceans. Exoskeletons serve as protection against environmental pressure or predators, whilst endoskeletons can act as support or serve as an attachment for muscles and ligaments and hence as a mechanism for transmitting muscular forces. Biogenic hard parts represent sophisticated products resulting from the hierarchical interaction of inorganic minerals (95%) and macromolecular organic matrices, forming commonly less than 5%. The significance of many biogenic carbonate archives lies in the time-resolved growth patterns and their ability to record ambient environmental conditions in the form of multiple geochemical properties (multi-proxy archives) that have been widely used to assess past oceanic seawater properties. Here, we compile and review published work dealing with crystallization pathways of skeletal hard parts secreted by mollusks (i.e., bivalves and cephalopods) as well as brachiopods as widely used archives of ancient neritic epeiric settings. Bivalves and cephalopods (e.g., extinct ammonoids and belemnites and extant Sepia, Nautilus and Spirula) all form accretionary calcitic, aragonitic or vateritic skeletal hard parts. Despite the fact that mollusks and brachiopods form part of very different branches of the animal phylogenetic tree, their biomineralization strategies are surprisingly similar. Our main focus lies in a critical assessment of the complex pathways of ions and aquo-complexes from their source (seawater) to the final product (biomineral). We do this as an attempt to critically test the commonly held hypothesis that many fossil hard parts precipitated (under favorable conditions and pending subsequent diagenetic alteration) in equilibrium with seawater. Two main observations stand out: (1) the present knowledge on pathways and mechanisms (e.g., ion channel trans-membrane or

  1. White Matter Lesion Progression in LADIS

    DEFF Research Database (Denmark)

    Schmidt, Reinhold; Berghold, Andrea; Jokinen, Hanna; Gouw, Alida A; van der Flier, Wiesje M; Barkhof, Frederik; Scheltens, Philip; Petrovic, Katja; Madureira, Sofia; Verdelho, Ana; Ferro, Jose M; Waldemar, Gunhild; Wallin, Anders; Wahlund, Lars-Olof; Poggesi, Anna; Pantoni, Leonardo; Inzitari, Domenico; Fazekas, Franz; Erkinjuntti, Timo

    2012-01-01

    BACKGROUND AND PURPOSE: White matter lesion (WML) progression has been advocated as a surrogate marker in intervention trials on cerebral small vessel disease. We assessed the rate of visually rated WML progression, studied correlations between lesion progression and cognition, and estimated samp...

  2. Cathepsin Protease Inhibition Reduces Endometriosis Lesion Establishment.

    Science.gov (United States)

    Porter, Kristi M; Wieser, Friedrich A; Wilder, Catera L; Sidell, Neil; Platt, Manu O

    2016-05-01

    Endometriosis is a gynecologic disease characterized by the ectopic presence of endometrial tissue on organs within the peritoneal cavity, causing debilitating abdominal pain and infertility. Current treatments alleviate moderate pain symptoms associated with the disorder but exhibit limited ability to prevent new or recurring lesion establishment and growth. Retrograde menstruation has been implicated for introducing endometrial tissue into the peritoneal cavity, but molecular mechanisms underlying attachment and invasion are not fully understood. We hypothesize that cysteine cathepsins, a group of powerful extracellular matrix proteases, facilitate endometrial tissue invasion and endometriosis lesion establishment in the peritoneal wall and inhibiting this activity would decrease endometriosis lesion implantation. To test this, we used an immunocompetent endometriosis mouse model and found that endometriotic lesions exhibited a greater than 5-fold increase in active cathepsins compared to tissue from peritoneal wall or eutopic endometrium, with cathepsins L and K specifically implicated. Human endometriosis lesions also exhibited greater cathepsin activity than adjacent peritoneum tissue, supporting the mouse results. Finally, we tested the hypothesis that inhibiting cathepsin activity could block endometriosis lesion attachment and implantation in vivo. Intraperitoneal injection of the broad cysteine cathepsin inhibitor, E-64, significantly reduced the number of attached endometriosis lesions in our murine model compared to vehicle-treated controls demonstrating that cathepsin proteases contribute to endometriosis lesion establishment, and their inhibition may provide a novel, nonhormonal therapy for endometriosis. PMID:26482207

  3. Imaging granulomatous lesions with optical coherence tomography

    DEFF Research Database (Denmark)

    Banzhaf, Christina; Jemec, Gregor B E

    2012-01-01

    To investigate and compare the presentation of granulomatous lesions in optical coherence tomography (OCT) images and compare this to previous studies of nonmelanoma skin tumors.......To investigate and compare the presentation of granulomatous lesions in optical coherence tomography (OCT) images and compare this to previous studies of nonmelanoma skin tumors....

  4. Pediatric multifocal liver lesions evaluated by MRI

    Directory of Open Access Journals (Sweden)

    Majed Almotairi

    2015-01-01

    Full Text Available Objective: The purpose of this study is to present our experience with MRI evaluation of multifocal liver lesions in children and describe the MRI characteristics of these lesions. Patients and Methods: A retrospective review of consecutive MRI exams performed for the evaluation of multiple liver lesions between 1 January 2007 and 31 December 2012 was done to note the number of lesions, the size of the largest lesion, MR signal characteristics, and background liver. Final diagnosis was assigned to each case based on pathology in the available cases and a combination of clinical features, imaging features, and follow-up in the remaining cases. Results: A total of 48 children (22 boys, 26 girls; age between 3 months and 18 years with average age 10.58 years and median age 11 years were included in the study. Totally 51 lesion diagnoses were seen in 48 children that included 17 focal nodular hyperplasia (FNH, 8 hemangiomas, 7 metastases, 6 regenerative nodules, 3 adenomas, 3 abscesses, and one each of angiomyolipoma, epithelioid hemangioendothelioma, focal fatty infiltration, hepatocellular carcinoma, hepatic infarction, nodular regenerative hyperplasia, and hepatic cyst. Background liver was normal in 33, cirrhotic in 10, fatty in 3, and siderotic in 2 children. Most FNH, hemangiomas, and regenerative nodules showed characteristic MRI features, while metastases were variable in signal pattern. Conclusion: Many commonly seen multifocal liver lesions in children have characteristic MRI features. MRI can help to arrive at reasonable differential diagnoses for multifocal liver lesions in children and guide further investigation and management.

  5. Infiltrating/sealing proximal caries lesions

    DEFF Research Database (Denmark)

    Martignon, S; Ekstrand, K R; Gomez, J;

    2012-01-01

    significant differences in lesion progression between infiltration and placebo (P = 0.0012) and between sealing and placebo (P = 0.0269). The study showed that infiltration and sealing are significantly better than placebo treatment for controlling caries progression on proximal lesions. No significant...... difference was seen between infiltration and sealing (ClinicalTrials.gov number NCT01417832)....

  6. Principal component analysis of psoriasis lesions images

    DEFF Research Database (Denmark)

    Maletti, Gabriela Mariel; Ersbøll, Bjarne Kjær

    2003-01-01

    A set of RGB images of psoriasis lesions is used. By visual examination of these images, there seem to be no common pattern that could be used to find and align the lesions within and between sessions. It is expected that the principal components of the original images could be useful during future...

  7. Taxon (Viridiplantae) - PGDBj - Ortholog DB | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available Artio About This Database Database Description Download License Update History of This Database Site Policy | Contact Us Taxon (Viridiplantae) - PGDBj - Ortholog DB | LSDB Archive ...

  8. Taxon (Cyanobacteria) - PGDBj - Ortholog DB | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available Artio About This Database Database Description Download License Update History of This Database Site Policy | Contact Us Taxon (Cyanobacteria) - PGDBj - Ortholog DB | LSDB Archive ...

  9. Shoichi Sakata: His life and physics. Collections of materials in Sakata Memorial Archival Library

    International Nuclear Information System (INIS)

    Shoichi Sakata and his Nagoya School made a lot of important achievements at the predawn of the particle physics revolution. The “two-meson” theory (introduction of the second generation leptons), the “C-meson theory” (a theory which inspired Tomonaga's renormalization theory), the “Sakata model” (a precursor to the quark model), and the “Maki-Nakagawa-Sakata” theory on the neutrino mixings are among them. These outputs are now regarded as essential ingredients in modern particle physics. Sakata also took his leadership in setting up democratic administration system in his theoretical particle physics group (E-ken). It was this democratic atmosphere in which many excellent physicists were brought up as Sakata's diciples. In this talk, I introduce Sakata and his achievements in physics, showing various materials archived in the Sakata Memorial Archival Library (SMAL), an archival repository of primary material showing Sakata's activities. These SMAL documents vividly show Sakata's way of thinking in his approach to the new physics. (author)

  10. Cystic ovarian lesions in SSFP diffusion imaging

    International Nuclear Information System (INIS)

    MR assessments of ovarian cystic lesions are usually based on morphological features, signal intensities and enhancement with contrast media. This study was performed to evaluate the usefulness of the steady-state free precession (SSFP) diffusion imaging of cystic ovarian lesions for analyzing cystic contents. Sixty-one ovarian cystic lesions in 37 patients were examined. The diffusion-related coefficient (DRC) and the ratio of the relative apparent diffusion coefficient of the lesion to that of subcutaneous fat tissue (rADCL/rADCF) were calculated from SSFP diffusion images. The DRCs and the rADCL /rADCF ratios in endometrial cysts and in the fatty parts of dermoid cysts were significantly lower than in other cystic tumors. SSFP diffusion imaging can be included in clinical practice to analyze ovarian cystic lesions within a short scan time; the DRC and the rADCL /rADCF ratio are useful for evaluating cystic contents. (author)

  11. List of Climatological Records - National Archives

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — State-by-state listing of weather records housed in the National Archives as of 1942. The original manuscript was published as one publication, but for ease of use...

  12. Archiving Online Do-It-Yourself Culture

    DEFF Research Database (Denmark)

    Roued-Cunliffe, Henriette

    This paper presents the argument that it is important to consider how information collected, created and shared by DIY culture online (using the case study of refashioning) can be archived and disseminated in future....

  13. River Forecasting Center Quantitative Precipitation Estimate Archive

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Radar indicated-rain gage verified and corrected hourly precipitation estimate on a corrected ~4km HRAP grid. This archive contains hourly estimates of...

  14. Organization Descriptions from the National Archives Catalog

    Data.gov (United States)

    National Archives and Records Administration — The Organization Authority Files data set contains a highly detailed presentation of the evolution of names and administrative histories of Federal and non-Federal...

  15. EPICS data archiver at SSRF beamlines

    International Nuclear Information System (INIS)

    The control system of SSRF (Shanghai Synchrotron Radiation Facility) is based on EPICS (Experimental Physics and Industrial Control System). Operation data storage for synchrotron radiation facility is important for its status monitoring and analysis. At SSRF, operation data used to be index files recorded by traditional EPICS Channel Archiver. Nevertheless, index files are not suitable for long-term maintenance and difficult for data analysis. Now, RDB Channel Archiver and MySQL are used for SSRF beamline operation data archiving, so as to promote the data storage reliability and usability. By applying a new uploading mechanism to RDB Channel Archiver, its writing performance is improved. A web-based GUI (Graphics User Interface) is also developed to make it easier to access database. (authors)

  16. Precursor solitons in a flowing complex plasma

    Science.gov (United States)

    Bandyopadhyay, Pintu; Jaiswal, Surabhi; Sen, Abhijit

    2015-11-01

    We report the first experimental observation of precursor solitons in a flowing dusty plasma. The nonlinear solitary dust acoustic waves (DAWs) are excited by a supersonic mass flow of the dust particles passing over an electrostatic potential hill. In a frame where the fluid is stationary and the hill is moving the solitons propagate in the upstream direction while wake structures consisting of linear DAWs are seen to propagate in the downstream direction. The experiments have been carried out in a U-shaped Dusty Plasma Experimental (DPEx) device where kaolin particles are immersed in a DC discharge argon plasma to form the dusty plasma and a floating wire mounted on the cathode creates a potential hill. The dust flow is induced by sudden changes in the hill height and the solitary structures are seen only for supersonic flows and up to an upper limit of the flow. A theoretical model description of the phenomenon will be provided and some practical implications of such precursor excitations for a charged object moving in a plasma will be discussed.

  17. Solar-cycle precursors and predictions

    CERN Document Server

    Jiang, Jie

    2013-01-01

    The sunspot number data during the past 400 years indicates that both the profile and the amplitude of the solar cycle have large variations. Some precursors of the solar cycle were identified aiming to predict the solar cycle. The polar field and the geomagnetic index are two precursors which are received the most attention. The geomagnetic variations during the solar minima are potentially caused by the solar polar field by the connection of the solar open flux. The robust prediction skill of the polar field indicates that the memory of the dynamo process is less than 11 yrs within the framework of the Babcock-Leighton flux transport dynamo. One possible reason to get the short magnetic memory is the high magnetic diffusivity in the convective zone. Our recent studies show that the radial downward pumping is another possible reason. Based upon the mechanism, we well simulate the cycle irregularities during RGO time period. This opens the possibility to set up a standard dynamo based model to predict the sol...

  18. Risk Management in Libraries, Archives and Museums

    OpenAIRE

    Kuzucuoglu, Alpaslan Hamdi

    2014-01-01

    Libraries, archives and museums around the globe are exposed to risks stemming from environmental conditions and human-driven potential hazards. Since an emergency/disaster immediately breaks out, the four key principles of disaster management, namely preparedness, damage reduction, intervention and improvement, should strictly be defined proactively, planned and necessary measures should be taken beforehand. In a well set-up Library, Archive ( information and documentation center...

  19. Language archiving technology at the MPI

    OpenAIRE

    Ringersma, J.; Trilsbeek, P.; Wittenburg, P.

    2007-01-01

    The repository of the MPI contains different types of linguistic material: the DOBES endangered languages archive, the ESF second learner corpus, the Dutch Spoken National Corpus, MPI's gesture corpora, MPI acquisition corpora and MPI language documentations of the language and cognition research group. The archive covers more than 200.000 objects, mostly organized in sessions that are described with the IMDI-based metadata descriptions. Mostly, these sessions contain digitized audio/video si...

  20. The NDLTD's Role in Archiving ETDs

    OpenAIRE

    McMillan, Gail

    2003-01-01

    It's about time the NDLTD did something really significant for the membership. Of course, this is to say it's about time we did something for ourselves such as collaborating to ensure the long-term preservation and archiving of each other's ETDs. This presentation will outline the broad considerations for archiving ETDs as well as the necessary actions that the NDLTD Executive and Steering Committees should initiate on our behalf. Audience participation will also be a component of this presen...

  1. Archival Literacy Competencies for Undergraduate History Majors

    OpenAIRE

    Weiner, Sharon A.; Morris, Sammie L.; Mykytiuk, Lawrence J.

    2015-01-01

    Undergraduate history majors need to know how to conduct archival research. This paper describes the second phase of a project to identify “archival literacy” competencies. Faculty, archivists, and librarians from baccalaureate, masters, and doctoral/research institutions commented on a draft list. This resulted in competencies in six major categories: accurately conceive of primary sources; locate primary sources; use a research question, evidence, and argumentation to advance a thesis; obta...

  2. Craftsmen in the Linear B Archives

    DEFF Research Database (Denmark)

    Nosch, Marie-Louise Bech

    1997-01-01

    Creftsmen in the Lienar B archives receive many types of remuneration. It is demonstrated that they cannot accumulate several types of remuneration. it is also demonstrated that certain crafts are connected to certin types of remuneration.  ......Creftsmen in the Lienar B archives receive many types of remuneration. It is demonstrated that they cannot accumulate several types of remuneration. it is also demonstrated that certain crafts are connected to certin types of remuneration.  ...

  3. Digitization of the Arcetri Solar Photographic Archive

    Science.gov (United States)

    Marchei, E.; Ermolli, I.; Centrone, M.; Giorgi, F.; Perna, C.

    The solar tower of the Arcetri Astrophysical Observatory produced synoptic observations of the solar atmosphere from 1925 to 1974. The photographic archive contains about 13000 plates of full-disk Ca II K and H_alpha spectroheliograms acquired during about 5000 observing days. The program to digitize and distribute the images of this archive started at the Rome Astronomical Observatory by CVS (Centre for Study the Variability of the Sun) on 2004 and is now complete. We hereby summarize the digitization work.

  4. The LAMOST Data Archive and Data Release

    CERN Document Server

    He, Boliang; Cui, Chenzhou; Li, Shanshan; Li, Changhua; Mi, Linying

    2016-01-01

    The Large sky Area Multi-Object Fiber Spectroscopic Telescope (LAMOST) is the largest optical telescope in China. In last four years, the LAMOST telescope has published four editions data (pilot data release, data release 1, data release 2 and data release 3). To archive and release these data (raw data, catalog, spectrum etc), we have set up a data cycle management system, including the transfer of data, archiving, backup. And through the evolution of four software versions, mature established data release system.

  5. Introducing the Portuguese web archive initiative

    OpenAIRE

    Gomes, Daniel; Nogueira, André; Miranda, João; Costa, Miguel

    2009-01-01

    This paper introduces the Portuguese Web Archive initiative, presenting its main objectives and work in progress. Term search over web archives collections is a desirable feature that raises new challenges. It is discussed how the terms index size could be reduced without significantly decreasing the quality of search results. The results obtained from the first performed crawl show that the Portuguese web is composed approximately at least by 54 million contents that cor...

  6. Precursor Mediated Synthesis of Nanostructured Silicas: From Precursor-Surfactant Ion Pairs to Structured Materials

    Directory of Open Access Journals (Sweden)

    Peter Hesemann

    2014-04-01

    Full Text Available The synthesis of nanostructured anionic-surfactant-templated mesoporous silica (AMS recently appeared as a new strategy for the formation of nanostructured silica based materials. This method is based on the use of anionic surfactants together with a co-structure-directing agent (CSDA, mostly a silylated ammonium precursor. The presence of this CSDA is necessary in order to create ionic interactions between template and silica forming phases and to ensure sufficient affinity between the two phases. This synthetic strategy was for the first time applied in view of the synthesis of surface functionalized silica bearing ammonium groups and was then extended on the formation of materials functionalized with anionic carboxylate and bifunctional amine-carboxylate groups. In the field of silica hybrid materials, the “anionic templating” strategy has recently been applied for the synthesis of silica hybrid materials from cationic precursors. Starting from di- or oligosilylated imidazolium and ammonium precursors, only template directed hydrolysis-polycondensation reactions involving complementary anionic surfactants allowed accessing structured ionosilica hybrid materials. The mechanistic particularity of this approach resides in the formation of precursor-surfactant ion pairs in the hydrolysis-polycondensation mixture. This review gives a systematic overview over the various types of materials accessed from this cooperative ionic templating approach and highlights the high potential of this original strategy for the formation of nanostructured silica based materials which appears as a complementary strategy to conventional soft templating approaches.

  7. Software Architecture of the Spitzer Archive Interface

    Science.gov (United States)

    Chavez, J.; Wu, X.; Roby, W.; Hoac, A.; Goldina, T.; Hartley, B.

    2007-10-01

    The Spitzer Science Center (SSC) provides a set of user tools to support search and retrieval of Spitzer Archive (SA) data via the Internet. This presentation describes the software architecture and design principles that support the Archive Interface subsystem of the SA (Handley 2007). The Archive Interface is an extension of the core components of the Uplink subsystem and provides a set web services to allow open access to the SA data set. Web services technology provides a basis for searching the archive and retrieving data products. The archive interface provides three modes of access: a rich client, a Web browser, and scripts (via Web services). The rich client allows the user to perform complex queries and submit requests for data that are asynchronously down-loaded to the local workstation. Asynchronous down-load is a critical feature given the large volume of a typical data set (on the order of 40~GB). For basic queries and retrieval of data the Web browser interface is provided. For advanced users, scripting languages with web services capabilities (i.e. Perl) can used to query and down-load data from the SA. The archive interface subsystem is the primary means for searching and retrieving data from the SA and is critical to the success of the Spitzer Space Telescope.

  8. Bosniak classification of renal cystic lesions according to multidetector computed tomography findings; Classificacao de Bosniak das lesoes cisticas renais segundo achados na tomografia computadorizada multidetectores

    Energy Technology Data Exchange (ETDEWEB)

    Miranda, Christiana Maia Nobre Rocha de; Padilha, Igor Gomes; Farias, Lucas de Padua Gomes de; Rocha, Milzi Sarmento da, E-mail: maiachristiana@globo.com [Universidade Federal de Alagoas (UFAL), Maceio, AL (Brazil); Maranhao, Carol Pontes de Miranda; Santos, Carla Jotta Justo dos [Clinica de Medicina Nuclear e Radiologia de Maceio (MedRadiUS), Maceio, AL (Brazil)

    2014-03-15

    Renal cystic lesions are usually diagnosed in the radiologists' practice and therefore their characterization is crucial to determine the clinical approach to be adopted and prognosis. The Bosniak classification based on computed tomography findings has allowed for standardization and categorization of lesions in increasing order of malignancy (I, II, IIF, III and IV) in a simple and accurate way. The present iconographic essay developed with multidetector computed tomography images of selected cases from the archives of the authors' institution, is aimed at describing imaging findings that can help in the diagnosis of renal cysts. (author)

  9. Nora's lesion, a distinct radiological entity?

    International Nuclear Information System (INIS)

    To describe the radiological findings of ''Bizarre parosteal osteochondromatous proliferation''(BPOP) - otherwise known as Nora's lesion, to describe the natural evolution of BPOP and to assess radiologically if BPOP is indeed part of a spectrum of reactive lesions including florid reactive periostitis and turret exostosis. Four experienced musculoskeletal radiologists studied plain radiographs and other imaging documents of histologically-proven Nora's lesions, looking for soft-tissue changes, periosteal reaction/calcification and calcified/ossified pseudotumours, and compared those findings with findings on pathology reviewed by a peer group of pathologists. Twenty-four Nora's lesions originating from a series of 200 consecutive, histologically-verified bone (pseudo)tumours of the hand, seen by the ''Netherlands Committee on Bone Tumours'' for review and second opinion. Nora's lesions have a recognised presentation on radiographs without specific MR characteristics. Natural evolution could be assessed retrospectively in four cases. Recurrent lesions were seen in seven cases and are difficult to differentiate from primary Lesions. (orig.)

  10. MRI examination on microcalcification lesions on mammography

    International Nuclear Information System (INIS)

    With a recent increase of patients who are pointed out microcalcification on mammography (MMG) but otherwise normal, we have increasingly difficulties in making diagnosis. In this paper we examined magnetic resonance imaging (MRI) findings and diagnosis of microcalcification lesions. Out of consecutive patients who visited our hospital for close exploration of calcification on MMG from July 2006 to March 2009, 124 patients who were performed MRI were enrolled in this study. The morphology and enhancement kinetics of their lesions visualized by MRI were classified with reference to the breast imaging reporting and data system (BIRADS)-MRI and were compared with outcomes of histological diagnoses. As a result, all lesions in which no abnormal enhancement was seen on MRI were benign. Malignant lesions accounted for about 80.0% in mass patterns, and about more than half in non-mass like enhancement. About 30% of the lesions were malignant in the Focus/Foci pattern which designates lesions with the size of less than 5 mm. MRI is capable of predicting whether the microcalcification lesion is malignant or benign in some degree in patients with positive findings, and we can omit Stereotactic Mammotome biopsy (ST-MTB) in those with negative findings. Accordingly MRI is considered to be an extremely useful modality. (author)

  11. Sport lesions caused by athletics practice

    Directory of Open Access Journals (Sweden)

    José Ernandes Feitoza

    2008-06-01

    Full Text Available Being a highly physical demanding sports, athletics depends on efficient training to overcome all physical demands without lesions. The aim of the present study was to analyze the types of lesions and their causes. The sample was constituted by forty-three athletes, sixteen males and twenty-seven females, 23.2 years of average age. A questionnaire containing five open questions and five closed questions was used as an instrument to determine the major lesions caused by athletics practice. The results showed that 84% of the athletes had already had some kind of lesions: 77% of which occurred during training and 23% during contest. The most frequent lesions were distension, tendinitis, twisting, contraction and inflammation. Legs were the most affected parts: 85% for jumpers, 85% for runners and 60% for throwers. When the lesions occurred, 76% of the jumpers, 84% of the runners and 85% of the throwers had no other health problem, but 52.7% of the athletes were in a state of anxiety before the contest and 13.8% had difficulties in concentrating on the contest. As for treatment 55.5% went to see a physiotherapist, and 16.6% went to see the medical doctor and the physiotherapist. The consequences of the lesions for the athletes’ performance were the following: 75% missed important contest events and 70% missed training for several months while they recuperated from their lesions. The results led to the conclusion that the best means to prevent lesions is to use adequate sites and equipments, efficient and individualized training coached by qualified specialists.

  12. MALDI imaging mass spectrometry for in situ proteomic analysis of preneoplastic lesions in pancreatic cancer.

    Directory of Open Access Journals (Sweden)

    Barbara M Grüner

    Full Text Available The identification of new biomarkers for preneoplastic pancreatic lesions (PanINs, IPMNs and early pancreatic ductal adenocarcinoma (PDAC is crucial due to the diseases high mortality rate upon late detection. To address this task we used the novel technique of matrix-assisted laser desorption/ionization (MALDI imaging mass spectrometry (IMS on genetically engineered mouse models (GEM of pancreatic cancer. Various GEM were analyzed with MALDI IMS to investigate the peptide/protein-expression pattern of precursor lesions in comparison to normal pancreas and PDAC with cellular resolution. Statistical analysis revealed several discriminative m/z-species between normal and diseased tissue. Intraepithelial neoplasia (PanIN and intraductal papillary mucinous neoplasm (IPMN could be distinguished from normal pancreatic tissue and PDAC by 26 significant m/z-species. Among these m/z-species, we identified Albumin and Thymosin-beta 4 by liquid chromatography and tandem mass spectrometry (LC-MS/MS, which were further validated by immunohistochemistry, western blot, quantitative RT-PCR and ELISA in both murine and human tissue. Thymosin-beta 4 was found significantly increased in sera of mice with PanIN lesions. Upregulated PanIN expression of Albumin was accompanied by increased expression of liver-restricted genes suggesting a hepatic transdifferentiation program of preneoplastic cells. In conclusion we show that GEM of endogenous PDAC are a suitable model system for MALDI-IMS and subsequent LC-MS/MS analysis, allowing in situ analysis of small precursor lesions and identification of differentially expressed peptides and proteins.

  13. Update History of This Database - D-HaploDB | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us D-HaploDB Update History...his Database Database Description Download License Update History of This Databas...e Site Policy | Contact Us Update History of This Database - D-HaploDB | LSDB Archive ...

  14. Update History of This Database - RMG | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us RMG Update History...omla SEF URLs by Artio About This Database Database Description Download License Update History of This Data...base Site Policy | Contact Us Update History of This Database - RMG | LSDB Archive ...

  15. Update History of This Database - KAIKOcDNA | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us KAIKOcDNA Update History...base Database Description Download License Update History of This Database Site Policy | Contact Us Update History of This Database - KAIKOcDNA | LSDB Archive ...

  16. Update History of This Database - AcEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us AcEST Update History...iew/acest/ ) is released. Joomla SEF URLs by Artio About This Database Database Description Download License Update History... of This Database Site Policy | Contact Us Update History of This Database - AcEST | LSDB Archive ...

  17. Update History of This Database - DMPD | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us DMPD Update History...Download License Update History of This Database Site Policy | Contact Us Update History of This Database - DMPD | LSDB Archive ... ...) is released. Joomla SEF URLs by Artio About This Database Database Description

  18. Update History of This Database - DGBY | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us DGBY Update History...tory of This Database Site Policy | Contact Us Update History of This Database - DGBY | LSDB Archive ... ...yakudachi/yeast/index.html ) is opened. Joomla SEF URLs by Artio About This Database Database Description Download License Update His

  19. Update History of This Database - GenLibi | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us GenLibi Update History...base Database Description Download License Update History of This Database Site P...olicy | Contact Us Update History of This Database - GenLibi | LSDB Archive ...

  20. Update History of This Database - AT Atlas | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us AT Atlas Update History...base Description Download License Update History of This Database Site Policy | Contact Us Update History of This Database - AT Atlas | LSDB Archive ...