WorldWideScience

Sample records for archaeo-eukaryotic gins proteins

  1. Structures to complement the archaeo-eukaryotic primases catalytic cycle description: What's next?

    Directory of Open Access Journals (Sweden)

    Julien Boudet

    2015-01-01

    Primase activity has been studied in the last decades but the detailed molecular steps explaining some unique features remain unclear. High-resolution structures of free and bound primases domains have brought significant insights in the understanding of the primase reaction cycle. Here, we give a short review of the structural work conducted in the field of archaeo-eukaryotic primases and we underline the missing “pictures” of the active forms of the enzyme which are of major interest. We organized our analysis with respect to the progression through the catalytic pathway.

  2. SOURCE ASSESSMENT: COTTON GINS

    Science.gov (United States)

    This report describes a study of air pollutants from cotton gins. Cotton gins separate cotton fibers from cottonseed and trash. During the 1976 crop year, 2.6 x 10 to the 6th power metric tons of lint cotton were ginned. Particulates composed of cotton dust, cotton lint, fine-lea...

  3. Evaluation of cotton genotypes for ginning energy and ginning rate

    Science.gov (United States)

    Reducing ginning energy use through cultivar improvement could reduce ginning and energy cost. The objective of this study was to detect genetic variability for ginning energy and ginning rate. Thirty four conventional and twelve transgenic genotypes were evaluated in 2008 and 2009 for ginning energ...

  4. Energy from cotton gin waste

    Energy Technology Data Exchange (ETDEWEB)

    Goodin, P.L.

    1977-04-01

    The US Cotton Ginning Research Laboratory installed a small, multi-chamber incinerator to study its ability to convert cotton gin waste into useable on-site energy. The incinerator operates on a controlled or starved air principle with a maximum capacity of 350-400 lbs of trash/hr. Tests indicate that 31.4% of the heat from combustion of the gin trash can be recovered and efficiently delivered to the seed-cotton drying system.

  5. Predicting Fiber Quality After Commercial Ginning Based on Fiber Obtained with Laboratory-Scale Gin Stands

    Science.gov (United States)

    It is often useful, especially in research, to measure properties of cotton lint ginned from small seed cotton samples with small laboratory scale gin stands and use the results to estimate properties of lint after commercial ginning, but these gin stands differ from commercial gins which brings int...

  6. A Combined Computational and Experimental Study on the Structure-Regulation Relationships of Putative Mammalian DNA Replication Initiator GINS

    Institute of Scientific and Technical Information of China (English)

    Reiko Hayashi; Takako Arauchi; Moe Tategu; Yuya Goto; Kenichi Yoshida

    2006-01-01

    GINS, a heterotetramer of SLD5, PSF1, PSF2, and PSF3 proteins, is an emerging chromatin factor recognized to be involved in the initiation and elongation step of DNA replication. Although the yeast and Xenopus GINS genes are well documented, their orthologous genes in higher eukaryotes are not fully characterized.In this study, we report the genomic structure and transcriptional regulation of mammalian GINS genes. Serum stimulation increased the GINS Mrna levels in human cells. Reporter gene assay using putative GINS promoter sequences revealed that the expression of mammalian GINS is regulated by 17β-Estradiolstimulated estrogen receptor α, and human PSF3 acts as a gene responsive to transcription factor E2F1. The goal of this study is to present the current data so as to encourage further work in the field of GINS gene regulation and functions in mammalian cells.

  7. Cotton gin electrical energy use trends and 2009 audit results

    Science.gov (United States)

    Cotton gin energy costs have risen more than other operating costs. Energy audits were conducted in twenty US cotton gins representing a range of capacities in six states. The average participating saw gin used 39.5 kWh to process a bale. The average roller gin used 62.6 kWh. Gins have become la...

  8. Postnatal maturation of somatostatin-expressing inhibitory cells in the somatosensory cortex of GIN mice

    Directory of Open Access Journals (Sweden)

    Erika E. Fanselow

    2012-05-01

    Full Text Available Postnatal inhibitory neuron development affects mammalian brain function, and failure of this maturation process may underlie pathological conditions such as epilepsy, schizophrenia and depression. Furthermore, understanding how physiological properties of inhibitory neurons change throughout development is critical to understanding the role(s these cells play in cortical processing. One subset of inhibitory neurons that may be affected during postnatal development is somatostatin-expressing cells. A subset of these cells is labeled with green-fluorescent protein (GFP in a line of mice known as the GIN line. Here, we studied how intrinsic electrophysiological properties of these cells changed in the somatosensory cortex of GIN mice between postnatal ages P11 to P32+. GIN cells were targeted for whole-cell current clamp recordings and ranges of positive and negative current steps were presented to each cell. The results showed that as the neocortical circuitry matured during this critical time period, multiple intrinsic and firing properties of GIN inhibitory neurons, as well as those of excitatory (regular-spiking [RS] cells, were altered. Furthermore, these changes were such that the output of GIN cells, but not RS cells, increased over this developmental period. We quantified changes in excitability by examining the input-output relationship of both GIN and RS cells. We found that the firing frequency of GIN cells increased with age, while the rheobase current remained constant across development. This created a multiplicative increase in the input-output relationship in the GIN cells, leading to increases in gain with age. The input-output relationship of the RS cells, on the other hand, showed primarily an additive shift with age, but no substantial change in gain. These results suggest that as the neocortex matures, inhibition coming from GIN cells may become more influential in the circuit and play a greater role in the modulation of

  9. Electricity use patterns in cotton gins

    Science.gov (United States)

    Energy costs are the second largest source of variable costs for cotton gins, with electricity accounting for 18% of variable costs. Energy use has typically not been a major consideration in gin design and previous studies of energy use have utilized instantaneous readings or aggregated season-lon...

  10. Energy usage for cotton ginning in Australia

    Energy Technology Data Exchange (ETDEWEB)

    Ismail, S.A. [MARA Univ. of Technology, Shah Alam (Malaysia). Faculty of Applied Sciences; Southern Queensland Univ., Toowoomba, QLD (Australia). National Centre for Engineering in Agriculture; Chen, G.; Baillie, C.; Symes, T. [Southern Queensland Univ., Toowoomba, QLD (Australia). National Centre for Engineering in Agriculture

    2010-07-01

    This paper reported on a study that evaluated the energy consumption of cotton gins used in Australia. The average electricity use is 52.3 kWh per bale. In practicality, the electricity consumption for different gins is correlated linearly with the bale numbers produced. The cost of electricity is therefore important in cotton ginning operations. The power factor in all the gins monitored in this study was greater than 0.85. The study showed that the use of gas dryers was highly influenced by the cotton moisture and regulated drying temperature. In general, electricity and gas consumption comprised 61 and 39 per cent of total energy use respectively. The study showed that 60.38 kg of carbon dioxide are emitted for ginning each bale of cotton. This paper described a newly developed method for monitoring the energy performance in cotton gins. Detailed monitoring and analysis carried out at 2 gin sites revealed that electricity consumption is not influenced much by changes in trash content in the module, degree of moisture and lint quality. However, the cotton variety influences the energy consumption. Cotton handling constituted nearly 50 per cent of the power used in both gins.

  11. Levels and chemical composition of cotton gin dust.

    Science.gov (United States)

    Wesley, R A; Wall, J H

    1978-12-01

    Dust levels were determined in the three principal work areas of five high-capacity, saw-type cotton gins processing spindle-picked cotton. Dust levels measured by the vertical elutriator, OSHA personal and stationary personal samplers averaged 0.66, 0.96 and 0.87 mg/m3, respectively. Gross chemical analyses of dust samples collected indicated that the composit0n of the dust was highly variable and different for the principal work areas within each gin -- 15 to 53% ash, 2 to 5% moisture, 8 to 18% protein, 19 to 55% cellulose and 8 to 16% water-extractable constituents. Major elements were silicon, potassium, aluminum, calcium and magnesium. PMID:742599

  12. Cotton gin trash: can it be safely utilized

    Energy Technology Data Exchange (ETDEWEB)

    Parnell, C.B.; Emino, E.R.; Grubaugh, E.K.

    1980-08-01

    Ginning creates lots of gin trash with subsequent disposal problems. The Texas A and M University Agricultural Engineering Dept. is conducting a systems engineering study of three utilization alternatives, composting, fuel, and cattlefeed, funded by the National Science Foundation. Arsenic contamination is a major constraint in utilizing cotton gin trash - arsenic acid is used to desiccate the cotton plant before harvesting. Data from growth trials of 12 species of vegetable and ornamental plants grown on composted cotton gin trash are presented. (Refs. 2).

  13. PARTICULATE EMISSION PROFILE OF A COTTON GIN

    Science.gov (United States)

    PARTICULATE MATTER (PM) IS ONE OF SIX CRITERIA POLLUTANTS REGULATED BY THE ENVIRONMENTAL PROTECTION AGENCY (EPA) WITH NATIONAL AMBIENT AIR QUALITY STANDARDS (NAAQS). IN GENERAL, PM IS THE ONLY AIR POLLUTANT OF CONCERN EMITTED FROM COTTON GINS. THE EPA HAS NAAQS FOR PM10 (PARTICLES WITH AN AERODYNA...

  14. Impacts of Ginning Treatments on Spinning Preparation

    Science.gov (United States)

    Throughout the production and manufacturing chain, cotton fibers undergo a succession of mechanical processing stages with varying degrees of aggressiveness. Some of the processes that are most decisive to the cotton's ultimate use-value and processing performance start at the gin and continue throu...

  15. Process steam production from cotton gin trash

    Energy Technology Data Exchange (ETDEWEB)

    LePori, W.A.; Carney, D.B.; Lalk, T.R.; Anthony, R.G.

    1981-01-01

    A steam producing system based on fluidized-bed gasification of biomass materials is discussed. Limited experimental results are discussed and show that steam has been produced at rates of 334.3 kg/hr. (737 lbs/hr.) with 2.8 kg of stream produced for each kilogram of cotton gin trash (2.8 lb/lb.). ref.

  16. Tracking Seed Coat Fragments in Cotton Ginning

    Science.gov (United States)

    High seed coat fragment (SCF) content in cotton bales causes processing problems in textile plants. This experiment was designed to determine the origin of SCF by tracking their occurrence through a conventional sequence of gin machinery. After the lint cleaner, lint contained an average of 12.25 ...

  17. Changes in cotton gin energy consumption apportioned by ten functions

    Science.gov (United States)

    The public is concerned about air quality and sustainability. Cotton producers, gin owners and plant managers are concerned about rising energy prices. Both have an interest in cotton gin energy consumption trends. Changes in cotton gins’ energy consumption over the past fifty years, a period of ...

  18. Use of cotton gin trash and compatibilizers in polyethylene composites

    Science.gov (United States)

    The ginning of cotton produces 15-42% of foreign materials, called “cotton gin trash”, including cotton burr, stems, leaf fragment, and dirt. In this work we examined the mechanical properties of composites of low density polyethylene (LDPE) and cotton burr. The burr was ground into powder, and se...

  19. Characterization of cotton gin particulate matter emissions-database development

    Science.gov (United States)

    In 2006, EPA implemented a more rigorous standard for PM2.5 in 2006 and all the cotton gins are or will be impacted by this standard. The primary issues associated with implementing this standard are: 1) very limited cotton gin PM2.5 data are available; 2) sampler errors, recent research indicates t...

  20. Composition and ethanol production potential of cotton gin residues.

    Science.gov (United States)

    Agblevor, Foster A; Batz, Sandra; Trumbo, Jessica

    2003-01-01

    Cotton gin residue (CGR) collected from five cotton gins was fractionated and characterized for summative composition. The major fractions of the CGR varied widely between cotton gins and consisted of clean lint (5-12%),hulls (16-48%), seeds (6-24%), motes (16-24%), and leaves (14-30%). The summative composition varied within and between cotton gins and consisted of ash (7.9-14.6%), acid-insoluble material (18-26%), xylan (4-15%),and cellulose (20-38%). Overlimed steam-exploded cotton gin waste was readily fermented to ethanol by Escherichia coli KO11. Ethanol yields were feedstock and severity dependent and ranged from 58 to 92.5% of the theoretical yields. The highest ethanol yield was 191 L (50 gal)/t, and the lowest was 120 L (32 gal)/t. PMID:12721487

  1. 29 CFR 780.805 - Ginning of “cotton.”

    Science.gov (United States)

    2010-07-01

    ... Ginning of Cotton and Processing of Sugar Beets, Sugar-Beet Molasses, Sugarcane, or Maple Sap into Sugar or Syrup; Exemption From Overtime Pay Requirements Under Section 13(b)(15) Ginning of Cotton for Market § 780.805 Ginning of “cotton.” Only the ginning of “cotton” is within the first part of...

  2. Evaluation of cotton gin byproducts as a ligno-cellulosic filler in polymer composites

    Science.gov (United States)

    The byproduct produced as a result of ginning has created disposal problems across the cottonbelt of the United States for several decades. Research has evaluated numerous potential applications for utilizing cotton gin byproducts (CGB) more commonly referred to by ginners as "gin waste" or "gin tra...

  3. Advances in cotton gin trash energy conversion

    Energy Technology Data Exchange (ETDEWEB)

    Rutherford, R.D.; Parnell, C.B.; Finch, S.F.; Siebold, W.J.

    1985-01-01

    The concept of using agricultural residues, especially cotton gin trash (CGT), as a fuel for a small cogeneration power plant based on fluidized bed gasification (FBG) requires that three problems be solved: (1) ash must be removed from the low calorific value (LCV) gas prior to combustion; (2) the high NO/sub x/ emissions associated with many biomass fuels must be significantly reduced; (3) a systems analyses of engineering/economic feasibility for potential applications must be developed. This paper addresses current research at TAMU pertaining to these problems.

  4. Gin Lane: did Hogarth know about fetal alcohol syndrome?

    Science.gov (United States)

    Abel, E L

    2001-01-01

    Medical historians have searched for evidence that the characteristics of fetal alcohol syndrome (FAS) were recognized long before its modern description in 1973. This search has often focused on the 'gin epidemic' in 18th century London, and especially William Hogarth's Gin Lane, which some authors allege reflects an awareness of the facial characteristics of the syndrome. While the 'gin epidemic' undoubtedly resulted in the increased birth of weak and sickly children, claims about Hogarth's awareness of the stigmata of the FAS are unfounded. The birth of weak and sickly children, and the high infant mortality rates associated with this period, long preceded the 'gin epidemic' and were primarily due to disease, starvation, exposure, and deliberate infanticide. PMID:11259209

  5. Integrative Functional Genomics Analysis of Sustained Polyploidy Phenotypes in Breast Cancer Cells Identifies an Oncogenic Profile for GINS2

    Directory of Open Access Journals (Sweden)

    Juha K. Rantala

    2010-11-01

    Full Text Available Aneuploidy is among the most obvious differences between normal and cancer cells. However, mechanisms contributing to development and maintenance of aneuploid cell growth are diverse and incompletely understood. Functional genomics analyses have shown that aneuploidy in cancer cells is correlated with diffuse gene expression signatures and aneuploidy can arise by a variety of mechanisms, including cytokinesis failures, DNA endoreplication, and possibly through polyploid intermediate states. To identify molecular processes contributing to development of aneuploidy, we used a cell spot microarray technique to identify genes inducing polyploidy and/or allowing maintenance of polyploid cell growth in breast cancer cells. Of 5760 human genes screened, 177 were found to induce severe DNA content alterations on prolonged transient silencing. Association with response to DNA damage stimulus and DNA repair was found to be the most enriched cellular processes among the candidate genes. Functional validation analysis of these genes highlighted GINS2 as the highest ranking candidate inducing polyploidy, accumulation of endogenous DNA damage, and impairing cell proliferation on inhibition. The cell growth inhibition and induction of polyploidy by suppression of GINS2 was verified in a panel of breast cancer cell lines. Bioinformatic analysis of published gene expression and DNA copy number studies of clinical breast tumors suggested GINS2 to be associated with the aggressive characteristics of a subgroup of breast cancers in vivo. In addition, nuclear GINS2 protein levels distinguished actively proliferating cancer cells suggesting potential use of GINS2 staining as a biomarker of cell proliferation as well as a potential therapeutic target.

  6. Feasibility Study of a Multiproduct Biorefinery in West Texas From Using Cotton Gin Waste

    OpenAIRE

    Tangaoui, Abbes; Michael, Farmer

    2014-01-01

    This research is a feasibility study of a multiproduct Biorefinery from using cotton gin waste in West Texas. This region is traditionally known by its important production of upland cotton and where there is an important concentration of gin mills. An important and cheap quantity of cotton gin waste results from the ginning process could be transformed from a liability with respect to environment to a valuable feedstock to produce a portfolio of bio-products in small and distributed biorefin...

  7. Systems simulation of cotton gin waste as a supplemental fuel in a coal powered generating plant

    Energy Technology Data Exchange (ETDEWEB)

    Parnell, C.B. (Texas A and M Univ., College Station); Grubaugh, E.K.; Johnston, M.T.; Ladd, K.L.

    1981-01-01

    A systems simulation model of gin trash use at a Lamb County, Texas, power plant was developed. The model is being used to study gin trash supply, both quantity and transportation, fixed and variable cost, and economic benefit/costs of gin trash utilization. Preliminary results indicate the positive feasibility of using gin trash as a supplemental fuel in a coal fired power plant. (MHR)

  8. 29 CFR 1928.57 - Guarding of farm field equipment, farmstead equipment, and cotton gins.

    Science.gov (United States)

    2010-07-01

    ... cotton gins. 1928.57 Section 1928.57 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY..., farmstead equipment, and cotton gins. (a) General—(1) Purpose. The purpose of this section is to provide for... equipment, farmstead equipment, and cotton gins used in any agricultural operation. (2) Scope. Paragraph...

  9. Textile processing improvements due to high speed roller ginning of upland cotton

    Science.gov (United States)

    Selective breeding has improved upland cotton fiber properties. Processing capacities of new high-speed roller ginning technology approach that of saw ginning. Spinning mills are interested in mill performance data comparing new upland cultivars processed by both saw and roller ginning. Four dive...

  10. Characterization of cotton gin total particulate matter emissions based on EPA stack sampling methodologies

    Science.gov (United States)

    A project to characterize cotton gin emissions in terms of stack sampling was conducted during the 2008 through 2011 ginning seasons. The impetus behind the project was the urgent need to collect additional cotton gin emissions data to address current regulatory issues. EPA AP-42 emission factors ar...

  11. Semana de ginástica: um olhar superador

    Directory of Open Access Journals (Sweden)

    2006-11-01

    Full Text Available Este texto relata a experiência vivenciada na disciplina Ginástica I, do curso de Educação Física, UFG/CAC, com o objetivo de problematizar o desenvolvimento histórico da ginástica em suas muitas variações na atualidade e verificar as possibilidades de sua utilização no espaço escolar a partir da construção coletiva, em uma perspectiva crítico-superadora. PALAVRAS-CHAVE: Ginástica - Educação Física Escolar A week of Gymnastics I was held in order to discuss the historical background of Gymnastics, its great number os varieties, and to check the possibilities of use of the space school as far as a critical perspective is concerned. KEY WORD: Gymnastics – Scholar Physical Education.

  12. Boll weevil (Coleoptera: Curculionidae) survival through cotton gin trash fans.

    Science.gov (United States)

    Sappington, Thomas W; Brashears, Alan D; Parajulee, Megha N; Carroll, Stanley C; Arnold, Mark D; Baker, Roy V

    2004-10-01

    There is concern that cotton gins may serve as loci for reintroduction of boll weevils, Anthonomus grandis grandis Boheman, to eradicated or suppressed zones when processing weevil-infested cotton from neighboring zones. Previous work has shown that virtually all weevils entering the gin in the seed cotton will be removed before they reach the gin stand. Those not killed by the seed cotton cleaning machinery will be shunted alive into the trash fraction, which passes through a centrifugal trash fan before exiting the gin. The objective of this study was to determine survival potential of boll weevils passed through a trash fan. Marked adult weevils were distributed in gin trash and fed through a 82.6-cm (32.5-in.) diameter centrifugal fan operated across a range of fan-tip speeds. A small number of boll weevils were recovered alive immediately after passage through the fan, but all were severely injured and did not survive 24 h. In another experiment, green bolls infested with both adult- and larval-stage weevils were fed through the fan. Several teneral adults survived 24 h, and there was no evidence that fan-tip speed affected either initial survival of weevils, or the number of unbroken boll locks that could harbor an infesting weevil. Thus, designating a minimum fan-tip speed for ensuring complete kill is not possible for the boll weevil. Experiments suggest that a device installed in a gin that partially crushes or cracks bolls open before entering a trash fan will increase mortality, possibly enough that further precautions would be unnecessary. PMID:15568350

  13. Removal of plastic sheet material with normal cotton ginning equipment

    Science.gov (United States)

    US cotton is known to be relatively free of contamination but occasionally pieces of sheet plastic are found in cotton bales produced in the US. To better understand how ginning equipment handles pieces of sheet plastic 5 types of plastic commonly found in US seed cotton fields or used in handling ...

  14. Effecting Affection: The Corporeal Ethics of Gins and Arakawa

    Science.gov (United States)

    Bearn, Gordon C. F.

    2010-01-01

    This paper argues for the educational relevance of the apparently unbelievable project of the architects Arakawa and Gins to design houses that would grant their inhabitants immortality. First, the author demonstrates that, broadly conceived, this is a familiar philosophical project, perhaps "the" philosophical project. He then produces a reading…

  15. A longitudinal study of pulmonary function in cotton gin workers in the San Joaquin Valley.

    Science.gov (United States)

    Larson, R K; Barman, M L

    1989-10-01

    In a previous study we found no significant effects of acute exposure to the cotton gin environment on FEV1 in San Joaquin Valley gin workers compared with concurrent control subjects, nor was there an excess of obstructive lung disease among the same gin workers. The present study looked at the mean annual decline in FEV1, FEV1/FVC, and FEF25-75% in San Joaquin Valley cotton gin workers vs concurrent control subjects over four years. The FEV1 of gin workers completing all four years of the study declined 27.3 ml vs 35.5 ml in control subjects (p = 0.37); FEV1/FVC declined 0.21 percent in gin workers and 0.23 percent in control subjects (p = 0.86); FEF25-75% declined 0.058 L/s in gin workers and 0.066 L/s in control subjects (p = 0.68). Also, the mean annual rate of change of FEV1 was less among the gin workers who did not complete all four years than the gin workers completing all four years. The presence of "byssinosis" symptoms did not significantly influence the results. This prospective, longitudinal study failed to find any detrimental effect of the cotton gin environment on the rate of decline of FEV1, FEV1/FVC, and FEF25-75%. This result was independent of "byssinosis" symptoms and the effect of "dropouts." PMID:2791678

  16. POTENTIAL IMPLICATIONS OF PRODUCTION VARIABILITY ON AGRIBUSINESS: THE CASE OF COTTON GINNING IN MISSISSIPPI

    OpenAIRE

    Boyd, Shawn; Hudson, Darren

    1999-01-01

    Cotton ginning represents an agribusiness that is heavily dependent on production agriculture. Recent changes in farm legislation and other government policies may have a long run impact on the variability of cotton production. This paper examines the potential impacts of increased production variability on the cotton ginning industry in Mississippi. A programming model is used to derive the optimal structure of the ginning industry under certainty. Potential implications of production variab...

  17. Effect of GINS2 on Proliferation and Apoptosis in Leukemic Cell Line

    OpenAIRE

    Zhang, Xi; Zhong, Liang; Bei-zhong LIU; Gao, Yan-Jun; Gao, Yuan-Mei; Hu, Xiu-Xiu

    2013-01-01

    Although previous researches have demonstrated that GINS2 express abundantly and abnormally in many malignant solid tumors, such as breast cancer, melanoma and hepatic carcinoma. However, the role and precise molecular mechanism in acute promyelocytic leukemia (APL) are rarely reported. In this current study, we investigated the possible effect and particular mechanism of GINS2 in occurrence and development of APL. We synthesized interference plasmid targeted GINS2 successfully in vitro and a...

  18. Steam Explosion Pretreatment of Cotton Gin Waste for Fuel Ethanol Production

    OpenAIRE

    Jeoh, Tina

    1998-01-01

    Steam Explosion Pretreatment of Cotton Gin Waste for Ethanol Production By Tina Jeoh Foster A. Agblevor, Chair Biological Systems Engineering ABSTRACT The current research investigates the utilization of cotton gin waste as a feedstock to produce a value-added product - fuel ethanol. Cotton gin waste consists of pieces of burs, stems, motes (immature seeds) and cotton fiber, and is considered to be a lignocellulosic material. The three main chemical constituents are ce...

  19. GINS: a new tool for VLBI Geodesy and Astrometry

    CERN Document Server

    Bourda, G; Biancale, R

    2008-01-01

    In the framework of the "Groupe de Recherches de G\\'eod\\'esie Spatiale" (GRGS), a rigorous combination of the data from five space geodetic techniques (VLBI, GPS, SLR, LLR and DORIS) is routinely applied to simultaneously determine a Terrestrial Reference Frame (TRF) and Earth Orientation Parameters (EOP). This analysis is conducted with the software package GINS which has the capability to process data from all five techniques together. Such a combination at the observation level should ultimately facilitate fine geophysical studies of the global Earth system. In this project, Bordeaux Observatory is in charge of the VLBI data analysis, while satellite geodetic data are processed by other groups. In this paper, we present (i) details about the VLBI analysis undertaken with GINS, and (ii) the results obtained for the EOP during the period 2005-2006. We also compare this EOP solution with the IVS (International VLBI Service for geodesy and astrometry) analysis coordinator combined results. The agreement is at ...

  20. Seasonal Change of Steric Sea Level in the GIN Seas

    Institute of Scientific and Technical Information of China (English)

    LI Lei; WANG Huijuan; SUN Ruili

    2011-01-01

    The Greenland Sea, Iceland Sea, and Norwegian Sea (GIN seas) form the main channel connecting the Arctic Ocean with other Oceans, where significant water and energy exchange take place, and play an important role in global climate change. In this study steric sea level, associated with temperature and salinity, in the GIN seas is examined based on analysis of the monthly temperature and salinity fields from Polar science center Hydrographic Climatology (PHC3.0). A method proposed by Tabata et al. is used to calculate steric sea level, in which, steric sea level change due to thermal expansion and haline contraction is termed as the thermosteric component (TC) and the halosteric component (SC), recpectively. Total steric sea level (TSSL) change is the sum of TC and SC. The study shows that SC is making more contributions than TC to the seasonal change of TSSL in the Greenland Sea, whereas TC contributes more in the Norwegian and the Iceland Seas. Annual variation of TSSL is larger than 50ram over most regions of the GIN Seas, and can be larger than 200mm at some locations such as 308mm at 76.5°N, 12.5°E and 246mm at 77.50N, 17.5°W.

  1. Energy generation from cotton gin trash: an economic analysis

    Energy Technology Data Exchange (ETDEWEB)

    Lacewell, R.D.; Taylor, C.R.; Hiler, E.A.

    1981-01-01

    This study consists of economic analyses of electric power generation and low-Btu (British thermal unit) gas generation from cotton gin trash. Both analyses consider the use of a large gin, sized at 40,000 bales per year. A fluidized-bed combustor is used to produce the low Btu gas and in conjunction with a boiler and turbine to produce electricity. For this case study, the consideration of economic feasibility involves the saving of the cost of energy not purchased, the sale of surplus electricity, and the saving of the cost of gin trash disposal eliminated; all are results of on-site energy generation. Electricity requirements will be satisfied, and waste heat will be used for cotton drying. The savings that would result from these two measures total about $126,000 (based on a 300,000 Btu per bale requirement for cotton drying with natural gas priced at $2.50 per thousand cubic feet and electricity priced at 4 cents per kWh). (MCW)

  2. Battery condenser system total particulate emission factors and rates for cotton gins

    Science.gov (United States)

    This manuscript is part of a series of manuscripts that characterize cotton gin emissions from the standpoint of stack sampling. The impetus behind this project was the urgent need to collect additional cotton gin emissions data to address current regulatory issues. A key component of this study was...

  3. Battery condenser system PM10 emission factors and rates for cotton gins

    Science.gov (United States)

    This manuscript is part of a series of manuscripts that to characterize cotton gin emissions from the standpoint of stack sampling. The impetus behind this project was the urgent need to collect additional cotton gin emissions data to address current regulatory issues. A key component of this study ...

  4. Fiber and yarn properties from high-speed roller ginning of upland cotton

    Science.gov (United States)

    Selective breeding has improved upland cotton fiber properties. New high-speed roller ginning technology has advanced to the point that processing capacities have approached that of saw ginning. Producers seeking a better price for their upland cotton are interested in fiber property and textile m...

  5. 29 CFR 780.803 - Basic conditions of exemption; first part, ginning of cotton.

    Science.gov (United States)

    2010-07-01

    ... cotton. 780.803 Section 780.803 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION... FAIR LABOR STANDARDS ACT Employment in Ginning of Cotton and Processing of Sugar Beets, Sugar-Beet... Section 13(b)(15) Introductory § 780.803 Basic conditions of exemption; first part, ginning of...

  6. 1st stage mote system total particulate emission factors and rates for cotton gins

    Science.gov (United States)

    This manuscript is part of a series of manuscripts that characterize cotton gin emissions from the standpoint of stack sampling. The impetus behind this project was the urgent need to collect additional cotton gin emissions data to address current regulatory issues. A key component of this study was...

  7. Combined mote system total particulate emission factors and rates for cotton gins

    Science.gov (United States)

    This manuscript is part of a series of manuscripts that characterize cotton gin emissions from the standpoint of stack sampling. The impetus behind this project was the urgent need to collect additional cotton gin emissions data to address current regulatory issues. A key component of this study was...

  8. Overflow system PM10 emission factors and rates for cotton gins

    Science.gov (United States)

    This manuscript is part of a series of manuscripts that characterize cotton gin emissions from the standpoint of stack sampling. The impetus behind this project was the urgent need to collect additional cotton gin emissions data to address current regulatory issues. A key component of this study was...

  9. Battery condenser system total particulate emission factors and rates for cotton gins: Method 17

    Science.gov (United States)

    This manuscript is part of a series of manuscripts that characterize cotton gin emissions from the standpoint of stack sampling. The impetus behind this project was the urgent need to collect additional cotton gin emissions data to address current regulatory issues. A key component of this study was...

  10. Mote cleaner system total particulate emission factors and rates for cotton gins: Method 17

    Science.gov (United States)

    This manuscript is part of a series of manuscripts that characterize cotton gin emissions from the standpoint of stack sampling. The impetus behind this project was the urgent need to collect additional cotton gin emissions data to address current regulatory issues. A key component of this study was...

  11. 1st stage lint cleaning system PM10 emission factors and rates for cotton gins

    Science.gov (United States)

    This manuscript is part of a series of manuscripts that characterize cotton gin emissions from the standpoint of stack sampling. The impetus behind this project was the urgent need to collect additional cotton gin emissions data to address current regulatory issues. A key component of this study was...

  12. Mote trash system total particulate emission factors and rates for cotton gins

    Science.gov (United States)

    This manuscript is part of a series of manuscripts that characterize cotton gin emissions from the standpoint of stack sampling. The impetus behind this project was the urgent need to collect additional cotton gin emissions data to address current regulatory issues. A key component of this study was...

  13. Study of respiratory effect of short- and long-term cotton gin exposure.

    Science.gov (United States)

    Larson, R K; Barman, M L; Smith, D W; Nicol, L

    1981-04-01

    No excess of obstructive airway disease was found in a group of 265 cotton gin workers when compared with other San Joaquin Valley agricultural workers. After an average of eight weeks' employment in San Joaquin Valley cotton gins, 125 workers showed no appreciable deterioration of pulmonary function compared with pre-employment measurements. In studies of pulmonary function during a workshift, cotton gin workers showed slightly greater mean decrements than control agricultural workers. These differences did not reach a level of statistical significance and were lower than those usually found in byssinosis. The unusual temporal pattern of employment in cotton gins in California precludes a simple approach to diagnosis by symptoms. No correlation was found in this study between symptoms of byssinosis and objective decrements in FEV1. The questionnaire as proposed by the Cotton Dust Standard was found to be of no value in detecting reactors in this study of gin workers. PMID:7471886

  14. Calculation of pesticide degradation in decaying cotton gin trash.

    Science.gov (United States)

    Crossan, Angus N; Kennedy, Ivan R

    2008-10-01

    Pesticide residues were measured in stockpiled cotton gin trash (CGT) over a 2-year period. Samples were analysed by GC/MS/MS and interpretation of the results was aided by the presence of DDE residues, remnant from prior DDT use. Fourteen pesticide residues from current agricultural practice were detected in CGT. Several of these, including indoxacarb, profenofos, chlorpyrifos, propargite, bifenthrin, ethion and cyhalothrin, were more persistent than expected on the basis of published data for soil dissipation. The results showed a complex pattern of pesticide residue decay over time because of the simultaneous decomposition of the CGT matrix. PMID:18651089

  15. Papel de ginA y ginB en la movilidad de la isla genómica GInt

    OpenAIRE

    Echeverría Ancín, Myriam

    2014-01-01

    La transferencia horizontal de genes, mediada por elementos genéticos móviles tales como las islas genómicas, es uno de los principales mecanismos de generación de variabilidad genética en bacterias, permitiendo su adaptación a nuevos nichos ecológicos. En el grupo de Patología Vegetal de la UPNA se ha descrito, en especies de Pseudomonas, una nueva familia de islas genómicas, denominadas GInt. Éstas se caracterizan por contener en su extremo 5’ el operón gin, constituido ...

  16. Work health and safety in cotton ginning industry: a survey of practices in australia

    International Nuclear Information System (INIS)

    This survey focuses on the WH and S (Work Health and Safety) practices in Australia and relates them with those in Pakistan. It also highlights the planned areas of work required on WH and S in cotton ginning industry of Pakistan. This article is one a series of research studies that will inform a broader approach development. The aim of the survey was to design a standardized health and safety Act for cotton ginning industry of Pakistan and to help ginners meet their due industry obligations under the model WH and S Act. The first component of the research study survey was to review the relevant Australian work and safety model as this provides a framework to protect the health, safety and welfare of all employees at work and of other people who might be affected by the job. The second aspect of the research study survey concerned site visits to cotton gins with the support of Australian Centre for Agricultural Health and Safety, Moree, NSW. During these visits the existing ginning process in terms of WH and S were reviewed. Informal interviews were also conducted with Gin Managers and Ginning Experts regarding WH and S in the Australian cotton ginning industry. (author)

  17. Cotton gin trash incinerator-air heat project. Consultant report (final)

    Energy Technology Data Exchange (ETDEWEB)

    1980-05-01

    The California Energy Commission has funded the final phase of a four year project resulting in development of a successful system for burning cotton gin trash as a fuel providing the heat for ginning. The incinerator - air heater system installed in Corcoran, California operates continuously throughout the ginning season. Trash feeding and burning rate is automatically controlled from the combustion temperature, hot air temperature is controlled by the drying needs, and ashes are automatically removed from the system and pneumatically conveyed to the disposal site. The system complies with state and county air pollution codes by means of baghouse collectors. Savings in fossil fuel and trash disposal costs have demonstrated the equipment system is feasible for a four year payback at large, well utilized gins.

  18. The logic of DNA replication in double-stranded DNA viruses: insights from global analysis of viral genomes

    OpenAIRE

    Kazlauskas, Darius; Krupovic, Mart; Venclovas, Česlovas

    2016-01-01

    Genomic DNA replication is a complex process that involves multiple proteins. Cellular DNA replication systems are broadly classified into only two types, bacterial and archaeo-eukaryotic. In contrast, double-stranded (ds) DNA viruses feature a much broader diversity of DNA replication machineries. Viruses differ greatly in both completeness and composition of their sets of DNA replication proteins. In this study, we explored whether there are common patterns underlying this extreme diversity...

  19. Boll weevil (Coleoptera: Curculionidae) survival through the seed cotton cleaning process in the cotton gin.

    Science.gov (United States)

    Sappington, Thomas W; Brashears, Alan D; Parajulee, Megha N; Carroll, Stanley C; Arnold, Mark D; Baker, Roy V

    2004-08-01

    There is concern that gins located in boll weevil, Anthonomus grandis grandis Boheman, eradication zones may become points of reintroduction when they process cotton grown in a neighboring infested area. We estimated boll weevil survival through two typical machine sequences used in commercial cotton gins to clean and dry the seed cotton in advance of the gin stand, as well as separately through two incline cylinder cleaners or one or two tower dryers operating at different temperatures. Large numbers of laboratory-reared adult boll weevils were marked with fluorescent powder, fed into the test system, and recovered with the assistance of blacklights. We found no evidence of survival through the seed cotton cleaning systems even when the dryers were not heated, or when passed separately through the two incline cleaners alone. Upper confidence limits (95%) were calculated for the observed zero recoveries based on sample size and the binomial distribution, and these represent the statistical worst-case (i.e., highest) survival potential. Survival through heated tower dryers declined rapidly to zero at higher temperatures, especially when two dryers were running. Although we conclude that the potential for survival of weevils in the seed cotton to the gin stand is zero or close to zero, a small percentage of live weevils was recovered in the green boll/rock trap, which may represent the greatest threat of reintroduction at the gin. Escape of live weevils with the gin trash is also possible, and studies addressing this issue will be presented elsewhere. PMID:15384344

  20. The logic of DNA replication in double-stranded DNA viruses: insights from global analysis of viral genomes.

    Science.gov (United States)

    Kazlauskas, Darius; Krupovic, Mart; Venclovas, Česlovas

    2016-06-01

    Genomic DNA replication is a complex process that involves multiple proteins. Cellular DNA replication systems are broadly classified into only two types, bacterial and archaeo-eukaryotic. In contrast, double-stranded (ds) DNA viruses feature a much broader diversity of DNA replication machineries. Viruses differ greatly in both completeness and composition of their sets of DNA replication proteins. In this study, we explored whether there are common patterns underlying this extreme diversity. We identified and analyzed all major functional groups of DNA replication proteins in all available proteomes of dsDNA viruses. Our results show that some proteins are common to viruses infecting all domains of life and likely represent components of the ancestral core set. These include B-family polymerases, SF3 helicases, archaeo-eukaryotic primases, clamps and clamp loaders of the archaeo-eukaryotic type, RNase H and ATP-dependent DNA ligases. We also discovered a clear correlation between genome size and self-sufficiency of viral DNA replication, the unanticipated dominance of replicative helicases and pervasive functional associations among certain groups of DNA replication proteins. Altogether, our results provide a comprehensive view on the diversity and evolution of replication systems in the DNA virome and uncover fundamental principles underlying the orchestration of viral DNA replication. PMID:27112572

  1. Ecological study of the larger black flour beetle in cotton gin trash.

    Science.gov (United States)

    Nansen, Christian; James, Jacob; Bowling, David; Parajulee, Megha N; Porter, Patrick

    2008-12-01

    The larger black flour beetle Cynaeus angustus (Leconte) thrives in cotton gin trash piles on the Southern High Plains of Texas and sometimes becomes a nuisance after invading public and private structures. For better understanding of the basic larger black flour beetle ecology in gin trash piles, we conducted a series of laboratory and semirealistic field trials. We showed (1) in naturally infested gin trash piles, that similar trap captures were obtained in three cardinal directions; (2) in a laboratory study, late-instar larvae stayed longer in larval stage in moist soil compared with drier soil; (3) in both horizontal and vertical choice experiments, late instars preferred soil with low moisture content; and (4) specifically larger black flour beetle adults, but most larvae as well, responded negatively to high moisture content in gin trash. The results presented are consistent with reports of larger black flour beetle living in decaying yucca palms in deserts and suggest that maintaining gin trash piles with high moisture content may be an important component in an integrated control strategy. PMID:19161678

  2. Battery condenser system PM10 emission factors and rates for cotton gins: Method 201A PM10 sizing cyclones

    Science.gov (United States)

    This manuscript is part of a series of manuscripts that to characterize cotton gin emissions from the standpoint of stack sampling. The impetus behind this project was the urgent need to collect additional cotton gin emissions data to address current regulatory issues. A key component of this study ...

  3. Preliminary evaluation of feeder and lint slide moisture addition on ginning, fiber quality, and textile processing of western cotton

    Science.gov (United States)

    The objective of this study was to evaluate the effects of moisture addition at the gin stand feeder conditioning hopper and/or the battery condenser slide on gin performance and Western cotton fiber quality and textile processing. The test treatments included no moisture addition, feeder hopper hum...

  4. 1st stage seed-cotton cleaning system PM10 emission factors and rates for cotton gins

    Science.gov (United States)

    This manuscript is part of a series of manuscripts that characterize cotton gin emissions from the standpoint of stack sampling. The impetus behind this project was the urgent need to collect additional cotton gin emissions data to address current regulatory issues. A key component of this study was...

  5. Second stage mote system PM10 emission factors and rates for cotton gins: Method 201A PM10 sizing cyclone

    Science.gov (United States)

    This manuscript is part of a series of manuscripts that characterize cotton gin emissions from the standpoint of stack sampling. The impetus behind this project was the urgent need to collect additional cotton gin emissions data to address current regulatory issues. A key component of this study was...

  6. Theoretical bases of rotation dynamics of raw materials poller with s ratify consideration for saw gin processing of cotton

    International Nuclear Information System (INIS)

    In this paper is examined motion of raw materials rollers on the base of a stratify models. Foe every layers of the rollers are determined dynamical influences for saw gin processing of cotton. It is noticed that in the gin processing of cotton the second layer of cotton roller plagues an important role

  7. Unloading system PM10 emission factors and rates for cotton gins: Method 201A PM10 sizing cyclones

    Science.gov (United States)

    This manuscript is part of a series of manuscripts that characterize cotton gin emissions from the standpoint of stack sampling. The impetus behind this project was the urgent need to collect additional cotton gin emissions data to address current regulatory issues. A key component of this study was...

  8. Second stage seed-cotton cleaning system total particulate emission factors and rates for cotton gins: Method 17

    Science.gov (United States)

    This manuscript is part of a series of manuscripts that characterize cotton gin emissions from the standpoint of stack sampling. The impetus behind this project was the urgent need to collect additional cotton gin emissions data to address current regulatory issues. A key component of this study was...

  9. Tarptautinių santykių disciplinos raida ir ketvirtieji tarpparadigminiai ginčai

    OpenAIRE

    Karpavičiūtė, Ieva

    2009-01-01

    Tarptautinių santykių (TS) disciplinos plėtotę lemia tam tikros teorinės, metodologinės, epistemologinės bei ontologinės mados bei ginčų tarp dominuojančių teorijų bei teorinių prieigų etapai. Tarpparadigminių ginčų (angl. inter-paradigm debate) raidoje ir formavosi tarptautinių santykių disciplina. Galima teigti, jog šie ginčai įvertina disciplinos raidą, tam tikra prasme įprasmina discipliną ir formuoja tolesnes jos plėtotės gaires. Tarptautinių santykių (TS) disciplina (iki šiol) plėtojosi...

  10. Ginásio Clube Português (GCP) : measuring customer satisfaction in services industry

    OpenAIRE

    Alves, Guilherme Rito

    2014-01-01

    The objective of this thesis is to measure and analyze the customer satisfaction level in Ginásio Clube Português, by understanding the key determinants and consequences of customer satisfaction. After an exponential growth both in revenues and in number of clients between 1998 and 2011, Ginásio Clube Português is losing competitive edge due to the increasing competition in the high-end and low-cost markets as well as due to the effects of the economic downturn. Aiming to en...

  11. Residues of toxaphene, DEF, and paraquat in plant parts and gin waste from a treated cotton field.

    Science.gov (United States)

    Seiber, J N; Winterlin, W L; McChesney, M M

    1979-01-01

    The origin and fate of the gin waste residues of three chemicals--toxaphene, DEF, and paraquat--used frequently in cotton production in California were studied. Residues were determined for foliage and bolls in the live plants, for lint and seed in harvested seed cotton, and for gin waste and its lint and non-lint components, following commercial treatments to the cotton crop. Gin waste residues were followed during five months of open storage to ascertain dissipation rates in a typical waste sample. Relatively high residues of each of the three chemicals persisted at harvest, during storage prior to ginning, and in stored gin waste. The major proportion of gin waste residue was associated with the non-lint components--leaf parts, burrs, stems and other foreign matter. Average stored gin residues in the lint and non-lint components were 13 and 60, 11 and 58, and 5 and 10 ppm for toxaphene, DEF, and paraquat, respectively, during the open storage period. PMID:539830

  12. Field trial of diatomaceous earth in cotton gin trash against the larger black flour beetle, Cynaeus angustus (Coleoptera: Tenebrionidae).

    Science.gov (United States)

    McIntyre, N E; Porter, P

    2004-04-01

    The larger black flour beetle, Cynaeus angustus (LeConte) (Coleoptera: Tenebrionidae), is an agricultural and home nuisance pest in North America. In the Southern High Plains of Texas, the larger black flour beetle is associated with cotton gin trash, by-products of cotton ginning that are field stored in large piles for economic reasons. Larger black flour beetle overwinter in gin trash piles but may disperse by the millions in summer and autumn, entering houses as far as 2 km away where they cause distress to homeowners. Because > 1.2 billion kg of gin trash is produced annually in Texas alone, the potential consequences of the larger black flour beetle are enormous. We conducted a field experiment that evaluated the efficacy of diatomaceous earth (DE) on the abundance of the larger black flour beetle in gin trash. There were no significant differences in numbers of larger black flour beetle among treatments and controls (mean number of adults summed over time: controls = 115.41, layered treatment = 87.60, top and bottom treatment = 96.50, bottom treatment = 115.16). There were sufficient numbers of beetles in treated piles to still pose a potential home nuisance problem, likely because the moisture content of field-stored gin trash is too high for DE to work effectively. Therefore, treating cotton gin trash with diatomaceous earth will probably be unable to prevent home infestations of larger black flour beetle. Location within a gin trash pile and season influenced pest numbers, which has implications for long-term field storage of cotton gin trash. PMID:15154486

  13. Battery condenser system PM2.5 emission factors and rates for cotton gins

    Science.gov (United States)

    This manuscript is part of a series of manuscripts that detail a project to characterize cotton gin emissions from the standpoint of stack and ambient sampling. The impetus behind the project was the 2006 EPA implementation of a more stringent standard for particulate matter less than or equal to 2....

  14. Battery condenser system particulate emission factors for cotton gins: Particle size distribution characteristics

    Science.gov (United States)

    This report is part of a project to characterize cotton gin emissions from the standpoint of total particulate stack sampling and particle size analyses. In 2013, the Environmental Protection Agency (EPA) published a more stringent standard for particulate matter with nominal diameter less than or e...

  15. Detection of plastic and oily contamination in seed cotton at the gin using infra-red

    Science.gov (United States)

    Plastic and oily foreign material in bales of cotton lint poses problems to spinning and textile mills in the form of decreased productivity and products with inferior quality. Detecting and removing this plastic and oily foreign material at the gin is a long term goal of the cotton industry. In t...

  16. Generalized INverse imaging (GIN): ultrafast fMRI with physiological noise correction.

    Science.gov (United States)

    Boyacioğlu, Rasim; Barth, Markus

    2013-10-01

    An ultrafast functional magnetic resonance imaging (fMRI) technique, called generalized inverse imaging (GIN), is proposed, which combines inverse imaging with a phase constraint-leading to a less underdetermined reconstruction-and physiological noise correction. A single 3D echo planar imaging (EPI) prescan is sufficient to obtain the necessary coil sensitivity information and reference images that are used to reconstruct standard images, so that standard analysis methods are applicable. A moving dots stimulus paradigm was chosen to assess the performance of GIN. We find that the spatial localization of activation for GIN is comparable to an EPI protocol and that maximum z-scores increase significantly. The high temporal resolution of GIN (50 ms) and the acquisition of the phase information enable unaliased sampling and regression of physiological signals. Using the phase time courses obtained from the 32 channels of the receiver coils as nuisance regressors in a general linear model results in significant improvement of the functional activation, rendering the acquisition of external physiological signals unnecessary. The proposed physiological noise correction can in principle be used for other fMRI protocols, such as simultaneous multislice acquisitions, which acquire the phase information sufficiently fast and sample physiological signals unaliased. PMID:23097342

  17. Development of cotton gin PM10 emission factors for EPA’s AP-42

    Science.gov (United States)

    The Compilation of Air Pollution Emission Factors (AP-42) emission factors are assigned ratings, from A (Excellent) to E (Poor), based on the quality of data used to develop them. All current PM10 cotton gin emission factors received quality ratings of D or lower. In an effort to improve these ratin...

  18. Characterization of cotton gin particulate matter emissions - Final year of field work

    Science.gov (United States)

    Due to EPA’s implementation of more stringent standards for particulate matter (PM) with an effective diameter less than 2.5 microns (PM2.5), the cotton ginners’ associations across the cotton belt agreed that there is an urgent need to collect gin emission data. The primary issues surrounding PM re...

  19. 29 CFR 780.807 - Cotton must be ginned “for market.”

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Cotton must be ginned âfor market.â 780.807 Section 780.807 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR STATEMENTS OF GENERAL POLICY OR INTERPRETATION NOT DIRECTLY RELATED TO REGULATIONS EXEMPTIONS APPLICABLE TO AGRICULTURE, PROCESSING OF...

  20. Mote robber system PM2.5 emission factors and rates for cotton gins

    Science.gov (United States)

    This manuscript is part of a series of manuscripts that detail a project to characterize cotton gin emissions from the standpoint of stack and ambient sampling. The impetus behind the project was the 2006 EPA implementation of a more stringent standard for particulate matter less than or equal to 2....

  1. The Effects of Three Module Types on Cotton Ginning and Fiber Quality

    Science.gov (United States)

    Traditionally seed cotton has been stored in modules from the time it was harvested until it was ginned. These modules have been formed using additional equipment and operators. In an effort to improve the efficiency of cotton production by reducing the number of operators and equipment, two newer...

  2. Biobased composition boards made from cotton gin and guayule watse: Select physical and mechanical properties

    Science.gov (United States)

    Vast quantities of cotton gin byproducts (CGB) are being produced annually. Similarly, guayule wastes after rubber latex production (guayule bagasse) is expected to increase as this industry begins to expand. Use of these waste materials into value-added products can help the economics of the crops,...

  3. An investigation of RSN frequency spectra using ultra-fast generalized inverse imaging (GIN

    Directory of Open Access Journals (Sweden)

    Rasim eBoyacioglu

    2013-04-01

    Full Text Available With the advancements in MRI hardware, pulse sequences and reconstruction techniques, many low TR sequences are becoming more and more popular within the fMRI community. In this study, we have investigated the spectral characteristics of resting state networks (RSNs with a newly introduced ultra fast fMRI technique, called Generalized Inverse Imaging (GIN. The high temporal resolution of GIN (TR=50 ms enables to sample cardiac signals without aliasing into a separate frequency band from the BOLD fluctuations. Respiration related signal changes are, on the other hand, removed from the data without the need for external physiological recordings. We have observed that the variance over the subjects is higher than the variance over RSNs.

  4. Strengthening of innovation activity at the cotton ginning industry in Uzbekistan

    Directory of Open Access Journals (Sweden)

    Muzaffarkhodja Tillyakhodjaev

    2010-02-01

    Full Text Available Modernization of the companies engaged to primary cotton manufacturing represents some example of consequential innovative activities. Rapid growth of cotton ginning industry provides substantial positive influence on efficient operations of other adjacent industries of the national economy in Uzbekistan. The paper suggests ways to strenthen innovation activity in the industry to provide increase its competiveness and develop export capaity of economy in general.

  5. A MARKOV CHAIN ANALYSIS OF STRUCTURAL CHANGES IN THE TEXAS HIGH PLAINS COTTON GINNING INDUSTRY

    OpenAIRE

    Ethridge, Don E.; Roy, Sujit K.; Myers, David W.

    1985-01-01

    Markov chain analysis of changes in the number and size of cotton gin firms in West Texas was conducted assuming stationary and non-stationary transition probabilities. Projections of industry structure were made to 1999 with stationary probability assumptions and six sets of assumed conditions for labor and energy costs and technological change in the non-stationary transition model. Results indicate a continued decline in number of firms, but labor, energy, and technology conditions alter t...

  6. Victory Gin Lane. Starvation and Beverages in Orwell’s Nineteen Eighty-Four

    Directory of Open Access Journals (Sweden)

    Paolo Caponi

    2015-05-01

    Full Text Available Gin is an ubiquitous presence in the domestic and urban scenery of Nineteen Eighty-Four (1949. For a population mercilessly hungered, it represents a handy and cheap commodity item providing a fluid opportunity for social aggregation. Victory Gin, served “in handless chine mugs” (53, is part of the workers’ staple diet at the Ministry of Truth, and is sold “at ten cents the large nip” from the small bar (actually, “a mere hole in the wall”, 51 in the canteen; served with cloves, it is the “speciality” (79 of that disreputable place which is the Chestnut Tree Café, where Winston Smith once spotted three fallen-out-of-favor members of the Inner Party – Jones, Aaronson and Rutherford – drink it silently after their release from Oceania prison camps (79. As is typical of the fate of spirits in literature, gin also serves as self-medication and can fuel a kind of inner escapism. It is to make the world “look more cheerful” that Winston gulps it down “like a dose of medicine”, and only after the “shock” of swallowing it can he squeeze himself into his alcove and begin his diary (7; gin clears out Winston’s stomach (53, and is the ultima ratio against that prescient “dull ache” in his belly (105; 106 that originates after bumping into “the girl with dark hair” (later: Julia one evening outside Mr. Charrington’s shop.

  7. Sister Chromatid Exchange Frequency in Lymphocytes Cultured from Cotton Gin Workers

    OpenAIRE

    ATMACA, Münevver; BAĞCI, Hüseyin; AÇIKBAŞ, İbrahim; GÜMÜŞ, Dilihan; DÜZCAN, Füsun

    2004-01-01

    Genetic biomonitoring of human populations exposed to potential mutagens/carcinogens can be performed using different genetic markers. Sister chromatid exchange (SCE) is one of the most extensively used markers of the early biological effects of DNA damaging agents. In order to assess the genotoxicity associated with exposure to cotton dust, we determined SCE frequency in peripheral blood lymphocytes cultured from 20 cotton gin workers and 20 controls. Student’s-t test indicated an ...

  8. Modeling and Production of Bioethanol from Mixtures of Cotton Gin Waste and Recycled Paper Sludge

    OpenAIRE

    Shen, Jiacheng

    2008-01-01

    In this study, the hydrolytic kinetics of mixtures of cotton gin waste (CGW) and recycled paper sludge (RPS) at various initial enzyme concentrations of Spezyme AO3117 and Novozymes NS50052 was investigated. The experiments showed that the concentrations of reducing sugars and the conversions of the mixtures increased with increasing initial enzyme concentration. The reducing sugar concentration and conversion of the mixture of 75% CGW and 25% RPS were higher than those of the mixture of 80% ...

  9. GINS: a multi-GNSS software to track small geodetic signals

    Science.gov (United States)

    Perosanz, F.; Loyer, S.; Marty, J.; Fund, F.; Portier, L.; Bracher, G.; Mercier, F.; Capdeville, H.; Lemoine, J.; Biancale, R.

    2011-12-01

    GINS is a scientific tool which is being developed by the Centre National d'Etudes Spatiales (CNES) and Groupe de Recherches de Géodésie Spatiale (GRGS) for more than 40 years for geodetic applications like global gravity field modeling and reference frame realization. Most recent developments include zero-difference GPS phase ambiguity resolution capability which offers the unique opportunity to track an isolated GNSS receiver using a "Precise Point Positioning" (PPP) approach with a centimeter level accuracy. In addition and in preparation to the Galileo system deployment, the capability to process GIOVE data has been implemented. GINS is also daily operated by CNES and Collecte Localisation Satellite (CLS) to deliver precise GPS and GLONASS orbit and clock products to the International GNSS Service (IGS) as an Analysis Center. The GINS multi-GNSS capabilities will be illustrated through various high accuracy applications like GPS, GIOVE and GLONASS satellites orbit determination and multi-GNSS high-rate PPP for loading or tectonic displacements detection.

  10. Ethanol production from cotton gin trash using optimised dilute acid pretreatment and whole slurry fermentation processes.

    Science.gov (United States)

    McIntosh, S; Vancov, T; Palmer, J; Morris, S

    2014-12-01

    Cotton ginning trash (CGT) collected from Australian cotton gins was evaluated for bioethanol production. CGT composition varied between ginning operations and contained high levels of extractives (26-28%), acid-insoluble material (17-22%) and holocellulose (42-50%). Pretreatment conditions of time (4-20 min), temperature (160-220 °C) and sulfuric acid concentration (0-2%) were optimised using a central composite design. Response surface modelling revealed that CGT fibre pretreated at 180 °C in 0.8% H2SO4 for 12 min was optimal for maximising enzymatic glucose recoveries and achieved yields of 89% theoretical, whilst the total accumulated levels of furans and acetic acid remained relatively low at <1 and 2 g/L respectively. Response surface modelling also estimated maximum xylose recovery in pretreated liquors (87% theoretical) under the set conditions of 150 °C in 1.9% H2SO4 for 23.8 min. Yeast fermentations yielded high ethanol titres of 85%, 88% and 70% theoretical from glucose generated from: (a) enzymatic hydrolysis of washed pretreated fibres, (b) enzymatic hydrolysis of whole pretreated slurries and (c) simultaneous saccharification fermentations, respectively. PMID:25280112

  11. Significance of p53-binding protein 1 nuclear foci in uterine cervical lesions: endogenous DNA double strand breaks and genomic instability during carcinogenesis

    OpenAIRE

    Matsuda, Katsuya; Miura, Shiro; Kurashige, Tomomi; Suzuki, Keiji; Kondo, Hisayoshi; Ihara, Makoto; Nakajima, Hisayoshi; Masuzaki, Hideaki; Nakashima, Masahiro

    2011-01-01

    Aims A defective DNA damage response can result in genomic instability (GIN) and lead to transformation to cancer. As p53-binding protein 1 (53BP1) localizes at the sites of DNA double strand breaks (DSBs) and rapidly forms nuclear foci (NF), the presence of 53BP1 NF can be considered to be an indicator of endogenous DSBs reflecting GIN. Our aim was to analyse the presence of DSBs by immunofluorescence for 53BP1 expression in a series of cervical lesions, to evaluate the significance of GIN d...

  12. Third stage seed-cotton cleaning system PM10 emission factors and rates for cotton gins: Method 201A PM10 sizing cyclones

    Science.gov (United States)

    This manuscript is part of a series of manuscripts that characterize cotton gin emissions from the standpoint of stack sampling. The impetus behind this project was the urgent need to collect additional cotton gin emissions data to address current regulatory issues. A key component of this study was...

  13. A preliminary study on gram-negative bacteria (GNB) and their endotoxins in a gin house in India.

    Science.gov (United States)

    Doctor, P B; Bhagia, L J; Derasari, A Y; Vyas, J B; Amin, R J; Ghosh, S K

    2006-12-01

    The presence of byssinosis, an occupational disease found among cotton mill workers, has been well documented in different parts of the world. The disease develops due to exposure to environmental cotton dust. Evidence suggests that the causative agent for the disease is gram-negative bacteria (GNB) and their endotoxins present on the cotton fibers. An investigation was carried out in a gin house in western India. Environmental dust samples were collected by vertical elutriator (VE). Airborne dust concentrations were very high in the working environment: 2.11 mg/m3 in ginning and 0.95 mg/m3 in the press department (p Enterobacter agglomerans were the dominant bacterial flora. Results indicate that gin workers are occupationally exposed to airborne GNB and endotoxins, and require masks. PMID:17133691

  14. Biological control agent of larger black flour beetles (Coleoptera: Tenebrionidae): a nuisance pest developing in cotton gin trash piles.

    Science.gov (United States)

    Nansen, Christian; Stokes, Bryan; James, Jacob; Porter, Patrick; Shields, Eilson J; Wheeler, Terry; Meikle, William G

    2013-04-01

    The larger black flour beetles, Cynaeus angustus (LeConte) (Coleoptera: Tenebrionidae), feeds on saprophytic fungi found in gin trash piles and occasionally becomes a nuisance pest in adjacent homes and businesses. The potential of Steinernema carpocapsae 'NY 001,' as a potential control agent of larger black flour beetle under experimental conditions was examined with particular reference to the importance of soil moisture content. Without prospects of insecticides being labeled for control of larger black flour beetle in gin trash, the data presented here support further research into applications of entomopathogenic nematodes underneath gin trash piles as a way to minimize risk of larger black flour beetle populations causing nuisance to nearby homes and businesses. PMID:23786050

  15. Potential for escape of live boll weevils (Coleoptera: Curculionidae) into cottonseed, motes, and cleaned lint at the cotton gin.

    Science.gov (United States)

    Sappington, Thomas W; Brashears, Alan D; Parajulee, Megha N; Carroll, Stanley C; Arnold, Mark D; Baker, Roy V

    2004-12-01

    Reintroductions of the boll weevil, Anthonomus grandis grandis Boheman, into areas of the United States where it has been eradicated or suppressed are very expensive to mitigate. There is concern that a cotton gin in an eradication zone may serve as a site of boll weevil reintroductions when processing cotton harvested in a neighboring infested zone. Similarly, there is a question whether weevil-free areas can safely import gin products, such as cottonseed and baled lint, from infested areas without risking an introduction. Many countries require fumigation of imported U.S. cotton bales to protect against boll weevil introductions, costing the U.S. cotton industry millions of dollars annually. In previously reported experiments, we quantified the potential for boll weevils to survive passage through precleaning machinery in the gin. In this study, we quantified survival potential of boll weevils passing through the gin stand and segregating into the cottonseed, mote, or lint fractions. We also examined boll weevil survival when passed with ginned lint through a lint cleaner. We present a flow chart of experimentally determined survival potentials of boll weevils passing through the various subprocesses of the gin, from which one can calculate the risk of a live boll weevil reaching any point in the process. Our data show that there is virtually no chance of a boll weevil being segregated alive into the cottonseed or of one surviving in the lint to approach the bale press. Therefore, quarantine or fumigation of cottonseed and cotton bales to guard against boll weevil introductions is unnecessary. PMID:15666727

  16. Bulímicas: elas vão à academia de ginástica?

    Directory of Open Access Journals (Sweden)

    Andréia Weis

    2013-09-01

    Full Text Available O objetivo da pesquisa foi determinar a prevalência de mulheres com sintomas de bulimia nervosa frequentadoras de academia de ginástica e verificar, dentre as praticantes que apresentam traços bulímicos, qual a frequência de utilização do exercício físico como forma compensatória. Participaram do estudo 197 mulheres matriculadas em academias de ginástica da cidade de Marechal Cândido Rondon - PR (28,7±9,9 anos. Para avaliar o quadro de bulimia utilizou-se o Teste de Investigação Bulímica de Edingurgh (BITE e uma anamnese estruturada pelos pesquisadores para atender interesses do estudo. Na análise dos dados foi utilizada a estatística descritiva e a frequência amostral pelo programa estatístico SPSS for Windows 11.5. A prevalência de sintomas de bulimia foi de 3%. A prevalência de traços bulímicos foi de 11,2%. Dos indivíduos que apresentaram traços bulímicos, 59,1% afirmaram praticar exercício físico após episódios de alimentação exagerada. Estes resultados podem indicar que esse comportamento compensatório através da prática de exercício físico pode levar as mulheres a procurar as academias de ginástica.

  17. Ginés Pérez y su O Crux

    Directory of Open Access Journals (Sweden)

    Climent, José

    2002-12-01

    Full Text Available The exact names attributed to Ginés Pérez were never at all clear. His first appointment to the Cathedral in Valencia complicated matters even more when he was referred to with the Christian name of what appeared to be "Juan", which only added to the confusion as it lead us to believe that he was the only candidate to apply for that position. Today, however, we now know his true and full names: he was called Ginés Pérez de la Parra. We also know, for the first time, the exact date of his death. The quality of his compositions not only contributed to their popularity but gave rise to the works of other composers being attributed to him. The authorship of the majority of his compositions are considered anonymous, though they can be located in diverse archives. Even so, we cannot find a single copy of the O Crux attributed to his name, despite the numerous copies and their variants that abound in Region of Valencia.El nombre de Ginés Pérez nunca ha tenido la claridad de debía. Su primer nombramiento en la catedral de Valencia ya lo confunde añadiéndole el “Juan” lo que ya siembra confusión, además de sugerirnos que, posiblemente, fue llamado para ocupar el puesto sin oposición. Hoy conocemos toda su filiación: Ginés Pérez de la Parra, así como la fecha de su muerte, totalmente equivocada hasta ahora. La valía de sus composiciones motivó, además de la difusión de su obra, la atribución de composiciones de otros autores. La mayor parte de sus composiciones constan como "anónimos", si bien pueden encontrarse en distintos archivos. Del presente O crux, sin embargo, no hemos podido encontrar ninguna copia con su nombre, pese a las múltiples copias, con sus variantes, existentes en la Comunidad Valenciana.

  18. Topping cogeneration feasibility study for the Central Valley Cooperative, Inc. cotton gin in Hanford, California

    Energy Technology Data Exchange (ETDEWEB)

    Moreno, F.E.

    1980-08-01

    To define baseline operation, a detail measurement program was conducted to determine the detail character of electrical and thermal energy consumption in the gin. Much of the air moving equipment was found to be operating at low efficiencies. A conservation plan was developed, and energy consumption and energy costs were forecast for the future. Fuel supply alternatives were examined as were several prime mover engine technologies. Environmental and regulatory constraints were examined, and all systems examined were subjected to an economic analysis. Key results are discussed.

  19. Valstybė kaip ginčo šalis tarptautiniame komerciniame arbitraže

    OpenAIRE

    Petkutė, Jurgita

    2007-01-01

    Šiame magistro baigiamajame darbe analizuojamos valstybės kaip ginčo šalies tarptautiniame komerciniame arbitraže lemiamos teorinės ir praktinės problemos tiriant tarptautinio komercinio arbitražo, arbitražo šalių bei valstybės kaip ginčo šalies tarptautiniame komerciniame arbitraže sampratas. Taip pat analizuojamas galimas įpareigojimų sukūrimas, arbitražinio susitarimo nesudariusioms šalims, valstybės imuniteto tarptautiniame komerciniame arbitraže klausimai bei kiti arbitražo proceso, kuom...

  20. The GIN legal problems of multi-parties at the drill site

    International Nuclear Information System (INIS)

    The presence of multiple parties working at a drilling site complicates the application of the environmental laws, rules and regulations. A critical decision prior to any physical activities needs to be made as to which person (i.e., company, partnership) will be charged with the obligation of being the designated Generator of hazardous waste for that site. This critical decision is dictated by the refusal of the EPA to assign more than one EPA Generator Identification Number (GIN) to a single drilling site. The decision as to which member of the multiple parties presence at the drill site will obtain the GIN has liability ramifications when a mistake is made in the cleanup of spilled hazardous waste or hazardous substances; an improper situation arises as to the transportation, storage, treatment and disposal of hazardous waste; the waste is improperly classified, or the biennial reporting of hazardous waste activities does not occur. Liability issues arise that go far beyond the ordinary contractual disputes seen in the past arising from drilling activities, with liability in some situations well in excess of any damage claims normally allowed under common law or statutory law in the State of Texas for non-environmental disputes. This paper reviews the liabilities and responsibilities of oil and gas drillers under the Resource Conservation and Recovery Act and the Comprehensive Environmental Response, Compensation and Liability Act

  1. Potential for transport of boll weevils (Coleoptera: Curculionidae) to the cotton gin within cotton modules.

    Science.gov (United States)

    Sappington, Thomas W; Brashears, Alan D; Parajulee, Megha N; Carroll, Stanley C; Arnold, Mark D; Norman, John W; Knutson, Allen E

    2004-06-01

    There is concern that cotton gins located in boll weevil, Anthonomus grandis grandis Boheman, eradication zones serving customers in adjacent infested zones may serve as a site for boll weevil reintroductions if weevils are transported alive inside cotton modules. We surveyed fields in three distinct areas of Texas and found that weevils can be present in large numbers in cotton fields that have been defoliated and desiccated in preparation for harvest, both as free adults and as immatures inside unopened bolls. Harvested cotton taken from module builders indicated that approximately = 100-3700 adult boll weevils were packed inside modules constructed at the sampled fields. Marked weevils were forced through a laboratory field cleaner (bur extractor) commonly mounted on stripper-harvesters, and 14% were recovered alive in the seed cotton fraction and lived at least to 24 h. Survival of weevils placed inside modules declined over time up to 7 d, but the magnitude of the decline varied with experimental conditions. In one experiment, 91% of the weevils survived to 7 d, whereas under harsher environmental conditions, only 11% survived that long. Together, our results indicate that when cotton is harvested in an infested area, boll weevils likely will be packed alive into cotton modules, and many will still be alive by the time the module is fed into the gin, at least up to 7 d after the module's construction. PMID:15279274

  2. 2nd stage lint cleaning system PM2.5 emission factors and rates for cotton gins

    Science.gov (United States)

    This manuscript is part of a series of manuscripts that detail a project to characterize cotton gin emissions from the standpoint of stack and ambient sampling. The impetus behind the project was the 2006 EPA implementation of a more stringent standard for particulate matter less than or equal to 2....

  3. Eli Whitney's Patent for the Cotton Gin. The Constitution Community: Revolution and the New Nation (1754-1820s).

    Science.gov (United States)

    Schur, Joan Brodsky

    This lesson focuses on the power of the U.S. Congress to pass laws related to issuing patents. Using Eli Whitney's 1812 Congressional petition to extend the patent on his cotton gin as an example, the lesson correlates to the National History Standards and the National Standards for Civics and Government. It contains two primary source documents,…

  4. Genetic analysis for some ginning and fiber characteristics in upland cotton

    International Nuclear Information System (INIS)

    Four varieties viz., Chandi-95, CIM-448, NIAB-Karishma and NIAB-78 were crossed in complete diallel fashion(4 x 4) to determine gene action for ginning out turn percentage (GOT), staple length, micronaire value and lint index. Results demonstrated that GOT percentage was controlled by complete dominance whereas, staple length, micronaire value and lint index were conditioned by partial dominance type of gene action. Chandi-95 had maximum dominant genes for staple length, micronaire value and lint index, while NIAB-78 had maximum dominant genes for GOT % and lint index. The variety NIAB-Karishma recorded the highest array means for GOT % and micronaire values followed by Chandi-95 and NIAB-78 for staple length and lint index, respectively. Whereas, cross combination NIAB-Karishma x NIAB-78 manifested highest values within array means for GOT %, micronaire value and lint index indicating good potential for the improvement of these characters. (author)

  5. Sorption and desorption of endosulfan sulfate and diuron to composted cotton gin trash.

    Science.gov (United States)

    Burns, Mitchell; Crossan, Angus N; Kennedy, Ivan R; Rose, Michael T

    2008-07-01

    This paper investigates the potential use of composted cotton gin trash (CCGT) as a pesticide sorption medium in remediation of contaminated tailwater. CCGT was found to contain a large organic matter fraction (25.22%). Sorption of endosulfan sulfate and diuron, using the batch equilibrium method, was rapid but not limited for the range of applied concentrations, with diuron failing to reach equilibrium after two days. The partition K d and organic carbon partition K(OC) coefficients determined diuron ( Kd = 78; K(OC) = 526) and endosulfan sulfate ( Kd = 1500; K(OC) = 10,111) to reside in the solid phase. Limited desorption of diuron and higher range concentrations of endosulfan sulfate (50-100 microg L(-1)) were quantified. Sorption and desorption resulted from hydrophobic and hydrophilic interactions with the humic components of the compost. CCGT was concluded to have a superior sorption capacity to other sorbents reported in the literature, an assessment that requires field substantiation. PMID:18543928

  6. Determinação de padrões de desistência em ginásios

    OpenAIRE

    Pinheiro, Paulo; Cavique, Luís

    2015-01-01

    O problema da retenção e das causas que levam à desistência da frequência do ginásio é uma questão que os ginásios e academias de fitness tentam há muito entender e consequentemente evitar. Tendo em atenção que a indústria do Fitness tem apostado na instalação massificada de sistemas avançados de Customer Relationship Management (CRM) existem atualmente bases de dados com dados históricos de grande valia. Este projeto tem por objetivo aplicar técnicas de classificação a estas bases de dados d...

  7. Processing cotton gin trash to enhance in vitro dry matter digestibility in reduced time.

    Science.gov (United States)

    Pordesimo, Lester O; Ray, Samuel J; Buschermohle, Michael J; Waller, John C; Wilkerson, John B

    2005-01-01

    Cotton gin trash (CGT) in the raw form is poorly digested by ruminants due to lignocellulosic complexes. These structures must be broken down before adequate digestion can occur. This may be performed by physical and/or chemical means. Two methods for improving digestibility are particle size reduction and/or treatment with sodium hydroxide (NaOH). To evaluate the effectiveness of each method, three experiments were performed in which different CGT types were tested. Each type represented trash from a particular cleaning stage in the cotton ginning process. First, each type was ground with a knife-type grinding mill using screen sizes 0.5, 1.0, and 2.0 mm. For the second experiment, particle size was held constant at 2 mm, and all CGT types were treated with 4% and 6% NaOH (w/w) at room temperature. An agitation cycle of 5 min on and 10 min off was used, with the total mixing time being 4 h. Lastly, particle size and NaOH concentration were held constant, and treatments were performed at room temperature, 40 degrees C, and 50 degrees C. The total mixing times were 2 and 3 h for 50 and 40 degrees C, respectively. For all experiments two subsamples of each treatment were tested for in vitro dry matter digestibility (IVDMD). From grinding alone, digestibility increased as particle size decreased. Grinding to 0.5 mm resulted in an average IVDMD of 47.8% while grinding to 2.0 mm resulted in an average IVDMD of only 33.8%. Digestibility also improved with a greater NaOH concentration. An average in vitro digestibility of 70.5% was achieved with 6% NaOH (w/w) treatment, essentially doubling that of the raw CGT. Increasing the reaction temperature did not result in increased digestibility because the mixture dried out, with a consequent reduction in chemical distribution and uniformity in heat transfer. There are still chemical residues in the CGT, and elimination/reduction of these is an issue that needs to be addressed in further research. PMID:15364079

  8. Use of cotton gin trash to enhance denitrification in restored forested wetlands

    Science.gov (United States)

    Ullah, S.; Faulkner, S.P.

    2006-01-01

    Lower Mississippi Valley (LMV) has lost about 80% bottomland hardwood forests, mainly to agriculture. This landscape scale alteration of the LMV resulted in the loss of nitrate (NO3) removal capacity of the valley, contributing to nitrogen (N)-enhanced eutrophication and potentially hypoxia in the northern Gulf of Mexico. Restoration of hardwood forests in the LMV is a highly recommended practice to reduce NO3 load of the Mississippi River. However, restored bottomland forests take decades to develop characteristic ecological functions including denitrifier activity. One way to enhance denitrifier activity in restored wetland forests is to amend the soils with an available carbon (C) source. This research investigated the effects of cotton gin trash (CGT) amendment on denitrification rate and N2O:N2 emission ratio from a restored bottomland forest soils and compared it to those from an adjacent unamended natural forest soils. CGT amendment increased denitrification rates in the restored forest soils to the level of the natural forest soils. N2O:N2 emission ratios from the restored and natural forest soils were highly variable and were not significantly different from each other. These findings suggest that restoration of bottomland hardwood forests in the LMV will require organic carbon amendment to achieve enhanced denitrifier activity for NO3 removal while the restored forest is developing into a mature state over time. ?? 2006 Elsevier B.V. All rights reserved.

  9. Comparison of a novel distillation method versus a traditional distillation method in a model gin system using liquid/liquid extraction.

    Science.gov (United States)

    Greer, Derek; Pfahl, Les; Rieck, Jim; Daniels, Tim; Garza, Oscar

    2008-10-01

    This research studied a novel form of distillation (high vacuum distillation) as a method for preserving volatile aroma chemicals important to the organoleptic attributes of a four botanical model gin as well as the degradation products generated during the heating required in traditional methods of gin distillation. A 2 (5) factorial experiment was conducted in a partially confounded incomplete block design and analyzed using the PROC MIXED procedure from SAS. A model gin was made of dried juniper berries (Juniperus communis), coriander seed (Coriandrum sativum), angelica root (Angelica archangelica), and dry lemon peel (Citrus limonum). This was distilled on a traditional still utilizing atmospheric pressure and a heating mantel to initiate phase separation as well as a novel still (high vacuum) utilizing high vacuum pressures below 0.1 mmHg and temperatures below -15 degrees C to initiate phase separation. The degradation products (alpha-pinene, alpha-phellandrene, E-caryophyllene, and beta-myrcene) were present at greater levels (approximately 10 times) in the traditional still-made gin as compared to the novel gin. PMID:18771269

  10. Ethanol production of semi-simultaneous saccharification and fermentation from mixture of cotton gin waste and recycled paper sludge

    OpenAIRE

    Shen, Jiacheng; Agblevor, Foster A.

    2010-01-01

    Ethanol production from the steam-exploded mixture of 75% cotton gin waste and 25% recycled paper sludge in various conditions was investigated by semi-simultaneous saccharification and fermentation (SSSF) consisting of a pre-hydrolysis and a simultaneous saccharification and fermentation (SSF). Four cases were studied: 24-h pre-hydrolysis + 48-h SSF (SSSF 24), 12-h pre-hydrolysis + 60-h SSF (SSSF 12), 72-h SSF, and 48-h hydrolysis + 24-h fermentation (SHF). The ethanol concentration, yield, ...

  11. Gasification of oak sawdust, mesquite, corn stover, and cotton gin trash in a countercurrent fluidized bed pilot reactor

    Energy Technology Data Exchange (ETDEWEB)

    Beck, S.R.; Wang, M.J.; Hightower, J.A.

    1981-01-01

    The Synthesis Gas From Manure (SGFM) process was designed to convert cattle feedlot manure to ammonia synthesis gas. Current work is aimed at using any biomass feedstock to produce either medium-Btu gas or chemical feedstocks. This paper presents a comparison of the experimental results compiled on gasification of oak sawdust, corn stover, mesquite, and cotton gin trash in the SGFM pilot plant. A weighted comparison of the product gas, hydrocarbon, and hydrogen yields, gas quality, calorific value of product gas, percentage conversion of raw feed heating value to gas heating value, and operability of each feed indicated the oak sawdust was the best feedstock.

  12. Battery condenser system PM2.5 emission factors and rates for cotton gins: Method 201A combination PM10 and PM2.5 sizing cyclones

    Science.gov (United States)

    This report is part of a project to characterize cotton gin emissions from the standpoint of stack sampling. In 2006, EPA finalized and published a more stringent standard for particulate matter with nominal diameter less than or equal to 2.5 µm (PM2.5). This created an urgent need to collect additi...

  13. Mote cleaner system PM2.5 emission factors and rates for cotton gins: Method 201A combination PM10 and PM2.5 sizing cyclones

    Science.gov (United States)

    This report is part of a project to characterize cotton gin emissions from the standpoint of stack sampling. In 2006, EPA finalized and published a more stringent standard for particulate matter with nominal diameter less than or equal to 2.5 µm (PM2.5). This created an urgent need to collect additi...

  14. First stage mote system PM2.5 emission factors and rates for cotton gins: Method 201A combination PM10 and PM2.5 sizing cyclones

    Science.gov (United States)

    This report is part of a project to characterize cotton gin emissions using stack sampling. In 2006, the Environmental Protection Agency (EPA) finalized and published a more stringent standard for particulate matter with nominal diameter less than or equal to 2.5 µm (PM2.5). This created an urgent n...

  15. Cyclone robber system PM2.5 emission factors and rates for cotton gins: Method 201A combination PM10 and PM2.5 sizing cyclones

    Science.gov (United States)

    This report is part of a project to characterize cotton gin emissions from the standpoint of stack sampling. In 2006, EPA finalized and published a more stringent standard for particulate matter with nominal diameter less than or equal to 2.5 µm (PM2.5). This created an urgent need to collect additi...

  16. Master trash system PM2.5 emission factors and rates for cotton gins: Method 201A combination PM10 and PM2.5 sizing cyclones

    Science.gov (United States)

    This report is part of a project to characterize cotton gin emissions from the standpoint of stack sampling. In 2006, the Environmental Protection Agency (EPA) finalized and published a more stringent standard for particulate matter with nominal diameter less than or equal to 2.5 µm (PM2.5). This cr...

  17. Gasification of oak sawdust, mesquite, corn stover and cotton gin trash in a countercurrent fluidized bed pilot reactor

    Energy Technology Data Exchange (ETDEWEB)

    Beck, S.R.; Wang, M.J.; Hightower, J.A.

    1981-01-01

    The Synthesis Gas From Manure (SGFM) process was designed to convert cattle feedlot manure to ammonia synthesis gas. Current work is aimed at using any biomass feedstock to produce either medium-Btu gas or chemical feedstocks. This paper presents a comparison of the experimental results compiled on gasification of oak sawdust, corn stover, mesquite, and cotton gin treash in the SGFM pilot plant. The SGFM process is based on a countercurrent, fluidized bed reactor. In this system, biomass is fed to the top of the reactor resulting in the fresh feed being partially dried by direct contact with hot product gas prior to entering the reaction zone. A weighted comparison of the product gas, hydrocarbon, and hydrogen yields, gas quality, calorific value of product gas, percentage conversion of raw feed heating value to gas heating value, and operability of each feed indicated that oak sawdust was the best feedstock. (Refs. 7).

  18. Pressure Compensated Design of Ginned Cotton Tripper%皮棉卸料器的压力补偿设计

    Institute of Scientific and Technical Information of China (English)

    孙居彦

    2009-01-01

    通过理论分析和试验研究,给出了卸料器迎风面压力分布的一般分析方法,推导出了压力补偿计算公式,为设计改进卸料器结构、改善皮棉清理质量、提高机械性能提供了理论指导,具有重要的实际意义.%General analysis method of pressure distribution facing the wind in trippers was given by theoretical analysis and experimental study. At the same time the formula was inferred out to calculate pressure compensated. The study had an important significance that can provide theory guides for designing tripper structure, improve the quality of clearing ginned cotton, enhance mechanical performance of trippers and provide important practical significance.

  19. Evaluation of ligninolytic enzymes, ultrasonication and liquid hot water as pretreatments for bioethanol production from cotton gin trash.

    Science.gov (United States)

    Plácido, Jersson; Imam, Tahmina; Capareda, Sergio

    2013-07-01

    Cotton gin trash (CGT) is a ubiquitous cotton-production-waste resource which can be used for ethanol production. In this research, seven combinations of three pretreatments; ultrasonication, liquid hot water and ligninolytic enzymes were evaluated on CGT to select the best pretreatments combination that increased the cellulose conversion and the ethanol yield in the saccharification and fermentation processes, respectively. The structural changes in the cellulose, hemicellulose and lignin from CGT were followed using FT-IR after each pretreatment. All the pretreatment combinations modified the CGT's structure and composition compared with the unpretreated CGT, and the majority of them improved release of sugars originally present in the CGT. The best results were achieved by the sequential combination of ultrasonication, hot water, and ligninolytic enzymes with an improvement of 10% in the ethanol yield and cellulose conversion compared to the other pretreatments. These results are a contribution to develop a feasible bioethanol production from CGT. PMID:23665215

  20. Conversion of cotton plant and cotton gin residues to fuels by the extruder-feeder liquefaction process

    Energy Technology Data Exchange (ETDEWEB)

    White, D.H. [Arizona Univ., Tucson, AZ (United States). Dept. of Chemical and Environmental Engineering; Coates, W.E. [Arizona Univ., Tucson, AZ (United States). Bioresources Research Facility; Wolf, D. [Ben-Gurion Univ. of the Negev, Beersheba (Israel). Dept. of Chemical Engineering

    1996-04-01

    Cotton is planted on a large scale in the USA, and is a major crop in Arizona. A large amount of cotton plant residue and cotton gin waste is produced annually, and these present a disposal problem. This material is comprised of cotton stalks, along with the upper portion of the taproot, and cotton gin trash. Cotton plant residues are a greater problem in the warmer regions of the USA as they serve as an over-wintering site for insect pests, and thus must be destroyed. Presently they are buried. Most field operations used to bury the residue are high energy consumers, and tend to destroy soil structure, thereby increasing the potential for erosion. This burial process is considered to be detrimental to the soil. One option to change the negative value of this biomass to a positive one is to harvest the cotton plants and combine them with other cotton wastes to produce a feedstock for liquefaction purposes. A process for harvesting and transporting the roots and stalks is being developed at the University of Arizona. In this paper we propose a combined harvesting/liquefaction system. This system would harvest and liquefy cotton wastes into oil and densified solid fuels with higher economic values. The extruder-feeder liquefaction process was developed at the University of Arizona in the 1980s under the sponsorship of the U.S. Department of Energy, with the goal to convert wood to a clean, 16000 btu/lb liquid fuel. The process has been redirected to other organic wastes using additional processing to yield ``value-added`` byproducts. Cotton wastes are good candidates for this process. By combining the harvesting and fuel processing operations, a negative value biomass would become a positive value biomass by (a) solving a disposal problem, and (b) producing high value fuels. (Author)

  1. Effects of Pyrolysis Temperature on Product Yields and Energy Recovery from Co-Feeding of Cotton Gin Trash, Cow Manure, and Microalgae: A Simulation Study

    OpenAIRE

    Hanif, Muhammad Usman; Capareda, Sergio C.; Iqbal, Hamid; Arazo, Renato Ortiz; Baig, Muhammad Anwar

    2016-01-01

    The intensive search of new and cleaner energy catches interest in recent years due to huge consumption of fossil fuels coupled with the challenge of energy and environmental sustainability. Production of renewable and environmentally benign energy from locally available raw materials is coming in the frontline. In this work, conversion of the combined biomass (cotton gin trash, cow manure, and Microalgae [Nannochloropsis oculata]) through batch pyrolysis has been investigated. The effect of ...

  2. Production cross sections and isomeric ratios for sup(110m)In/sup(110g)In formed in Cd (d,xn) reactions

    International Nuclear Information System (INIS)

    Excitation functions and isomeric cross sections ratios have been measured for the 110Cd (d,2n) and 111Cd (d,3n) reactions in which the isomeric pair sup(110m)In/sup(110g)In is produced. Activation method was employed and the irradiations were performed at the synchrocyclotron of the Comision Nacional de Energia Atomica, Argentina, with an incident energy of 27.MeV. (author)

  3. Educação física/ginástica : uma associação com raízes no tempo

    OpenAIRE

    Faustino, António

    1995-01-01

    Procede-se proceder ao enquadramento da Educação Física no Sistema Educativo português. Para o efeito através duma consulta bibliográfica a diferentes fontes são indicados alguns factos que contribuiram para a associação entre Educação Física e Ginástica, enquanto disciplina escolar, a qual tem perdurado no tempo.

  4. X-ray repair cross-complementing gene 1 Arg399GIn polymorphism and glioma risk among Asians A meta-analysis based on 2326 cases and 3610 controls

    Institute of Scientific and Technical Information of China (English)

    Liang Zhang; Zhiqun Qiu; Jiaohua Luo; Weiqun Shu

    2012-01-01

    OBJECTIVE:Previous reports have demonstrated that X-ray repair cross-complementing gene 1 (XRCC1) Arg399GIn polymorphism is a possible risk factor for several cancers.Published data on the association of XRCC1Arg399GIn polymorphism with glioma susceptibility have generated conflicting results.This study is designed to precisely estimate the relationship.DATA RETRIEVAL:A computer-based online retrieval of Medline,EMBASE,OVID,Sciencedirect,and Chinese National Knowledge Infrastructure was performed to search papers regarding association of XRCC1 Arg399GIn polymorphisms with glioma published up to April 2012.SELECTION CRITERIA:Two investigators selected data independently.Meta analysis was then performed for the selected studies using STATA 11.0 software after strict selection.Heterogeneity test,sensitivity analysis and publication bias assessments were then conducted.MAIN OUTCOME MEASURES:Association of XRCC1 Arg399GIn polymorphism with glioma risk.RESULTS:A total of nine case-controlled studies comprising 2 326 cases and 3 610 controls were selected for final analysis.The overall data failed to indicate a significant association of XRCC1 Arg399GIn polymorphism with glioma risk (GIn/GIn vs.Arg/Arg:odds ratio (OR) =1.11; 95% confidence interval (Cl) =0.94-1.31; dominant model:OR =1.06; 95%Cl=0.95-1.18; recessive model:OR =1.04; 95%Cl=0.81-1.34).However,subgroup analysis regarding ethnicity showed an increased risk among Asians (GIn/GIn vs.Arg/Arg:OR =1.70; 95%Cl=1.17-2.46; dominant model:OR =1.40; 95%Cl=1.10-1.78; recessive model:OR =1.46; 95%Cl =1.04-2.05) but not Caucasians or mixed ethnicities.CONCLUSION:XRCC1 Arg399GIn polymorphism might modify the susceptibility to glioma among Asians but not Caucasians.Further large and well-designed studies are needed to confirm this conclusion.

  5. A ginástica artística masculina (GAM de alto rendimento: observando a cultura de treinamento desde dentro.

    Directory of Open Access Journals (Sweden)

    Marco Antonio Coelho Bortoleto

    2007-03-01

    Full Text Available Este artigo apresenta um estudo etnográfico realizado no Ginásio de treinamento de Ginástica Artística Masculina do Centro de Alto Rendimento de Sant Cugat del Vallès (Barcelona - Espanha. O objetivo principal desta pesquisa consistiu em desvelar as características principais da cultura de treinamento de uma sala de alto rendimento a partir de uma incursão de campo (de um ano e meio de duração orientada pelos fundamentos teóricos da antropologia simbólica e dentro do marco metodológico da etnografia. Neste artigo destacamos o contexto institucional, alguns condicionantes temporais da preparação dos ginastas, aspectos da estrutura social do grupo, além de indicadores do universo simbólico que caracteriza a atividade no interior da sala. Entre as observações mais relevantes podemos destacar o Ginásio como uma microcultura caracterizada por várias cerimônias rituais, onde os técnicos têm o poder da palavra e os ginastas se limitam a escutar e intervir quando são solicitados (obedecer. Desta forma o funcionamento da sala se fundamenta no respeito à hierarquia de mandos e no cumprimento da programação das atividades e das regras.

  6. Efeito do treinamento proprioceptivo no equilíbrio de atletas de ginástica rítmica

    Directory of Open Access Journals (Sweden)

    Marianne Lamb

    2014-10-01

    Full Text Available INTRODUÇÃO: A ginástica rítmica (GR é uma modalidade esportiva que combina arte a gestos biomecânicos de alta complexidade, que requer alto nível de desenvolvimento de qualidades físicas como: agilidade, flexibilidade, força, impulsão e destreza. Nessa modalidade, estudos comprovam que as lesões mais frequentes ocorrem nas articulações do joelho e tornozelo e, em alguns casos, nas extremidades do punho, sendo os entorses as mais registradas, principalmente em atletas de nível de competição. Diante disso, a propriocepção e o controle muscular possuem papel fundamental na estabilidade articular dinâmica, já que após lesões ortopédicas algumas características sensório-motoras são alteradas e devem ser o foco de programas de reabilitação para que se obtenha melhor retorno às atividades como antes da lesão. OBJETIVO: Avaliar o efeito do treinamento proprioceptivo sobre o equilíbrio postural de atletas de ginástica rítmica, a partir da utilização da plataforma de força. MÉTODOS: Foi realizado um treinamento proprioceptivo no período de 2 meses, subdividido em três fases, com progressão da complexidade dos exercícios a cada fase de treinamento. RESULTADOS: Podemos observar que houve uma melhora significativa dos resultados da última fase do treinamento, quando foram utilizados exercícios de maior complexidade e agilidade, de acordo com o protocolo. CONCLUSÃO: Por se tratarem de atletas de GR de alto desempenho e apresentarem predomínio de atividades em apoio unipodal, os protocolos de propriocepção devem ser mais intensos, gerando um maior nível de perturbações e desequilíbrios posturais.

  7. Ethanol production of semi-simultaneous saccharification and fermentation from mixture of cotton gin waste and recycled paper sludge.

    Science.gov (United States)

    Shen, Jiacheng; Agblevor, Foster A

    2011-01-01

    Ethanol production from the steam-exploded mixture of 75% cotton gin waste and 25% recycled paper sludge in various conditions was investigated by semi-simultaneous saccharification and fermentation (SSSF) consisting of a pre-hydrolysis and a simultaneous saccharification and fermentation (SSF). Four cases were studied: 24-h pre-hydrolysis + 48-h SSF (SSSF 24), 12-h pre-hydrolysis + 60-h SSF (SSSF 12), 72-h SSF, and 48-h hydrolysis + 24-h fermentation (SHF). The ethanol concentration, yield, and productivity of SSSF 24 were higher than those of the other operations. A model of SSF was used to simulate the data for four components in SSF. The analysis of the reaction rates of cellobiose, glucose, cell, and ethanol using the model and the parameters from the experiments showed that there was a transition point of the rate-controlling step at which the cell growth control in the initial 2 h was changed to the cellobiose reaction control in later period during ethanol production of SSF from the mixture. PMID:20559849

  8. Activated carbons from flax shive and cotton gin waste as environmental adsorbents for the chlorinated hydrocarbon trichloroethylene.

    Science.gov (United States)

    Klasson, K Thomas; Wartelle, Lynda H; Lima, Isabel M; Marshall, Wayne E; Akin, Danny E

    2009-11-01

    Agricultural by-products represent a considerable quantity of harvested commodity crops. The use of by-products as precursors for the production of widely used adsorbents, such as activated carbons, may impart a value-added component of the overall biomass harvested. Our objective in this paper is to show that flax shive and cotton gin waste can serve as a precursor for activated carbon that can be used for adsorption of trichloroethylene (TCE) from both the liquid and gas phases. Testing was conducted on carbon activated with phosphoric acid or steam. The results show that activated carbon made from flax shive performed better than select commercial activated carbons, especially at higher TCE concentrations. The activation method employed had little effect on TCE adsorption in gas or vapor phase studies but liquid phase studies suggested that steam activation is slightly better than phosphoric acid activation. As expected, the capacity for the activated carbons depended on the fluid phase equilibrium concentration. At a fluid concentration of 2 mg of TCE/L of fluid, the capacity of the steam activated carbon made from flax shive was similar at 64 and 80 mg TCE/g of carbon for the vapor and liquid phases, respectively. Preliminary cost estimates suggest that the production costs of such carbons are $1.50 to $8.90 per kg, depending on activation method and precursor material; steam activation was significantly less expensive than phosphoric acid activation. PMID:19540755

  9. Ginčo sprendimo organų jurisdikcija pagal 1982 m. Jungtinių Tautų Jūrų Teisės Konvenciją

    OpenAIRE

    Matiukas, Marius

    2007-01-01

    Šiame darbe yra analizuojama ginčo sprendimo organų jurisdikcija pagal 1982 m. JT Jūrų Teisės Konvenciją. Ši Konvencija nustato planetos jūrų ir vandenynų naudojimo teisinį rėžimą. Todėl, siekiant suderinti valstybių interesus ir pasiekti kiek įmanomą platesni Konvencijos pripažinimą, Konvencijos nuostatos dėl ginčo sprendimo procedūrų suteikia valstybėms laisvę rinktis pageidaujamas ginčo sprendinio procedūras ir platų spektrą pasirinkimo galimybių. Tačiau dėl šios aplinkybės Konvencijos nuo...

  10. Prediction of Ungauged River Basin for Hydro Power Potential and Flood Risk Mitigation; a Case Study at Gin River, Sri Lanka

    Science.gov (United States)

    Ratnayake, A. S.

    2011-12-01

    The most of the primary civilizations of the world emerged in or near river valleys or floodplains. The river channels and floodplains are single hydrologic and geomorphic system. The failure to appreciate the integral connection between floodplains and channel underlies many socioeconomic and environmental problems in river management today. However it is a difficult task of collecting reliable field hydrological data. Under such situations either synthetic or statistically generated data were used for hydraulic engineering designing and flood modeling. The fundamentals of precipitation-runoff relationship through synthetic unit hydrograph for Gin River basin were prepared using the method of the Flood Studies Report of the National Environmental Research Council, United Kingdom (1975). The Triangular Irregular Network model was constructed using Geographic Information System (GIS) to determine hazard prone zones. The 1:10,000 and 1:50,000 topography maps and field excursions were also used for initial site selection of mini-hydro power units and determine flooding area. The turbines output power generations were calculated using the parameters of net head and efficiency of turbine. The peak discharge achieves within 4.74 hours from the onset of the rainstorm and 11.95 hours time takes to reach its normal discharge conditions of Gin River basin. Stream frequency of Gin River is 4.56 (Junctions/ km2) while the channel slope is 7.90 (m/km). The regional coefficient on the catchment is 0.00296. Higher stream frequency and gentle channel slope were recognized as the flood triggering factors of Gin River basin and other parameters such as basins catchment area, main stream length, standard average annual rainfall and soil do not show any significant variations with other catchments of Sri Lanka. The flood management process, including control of flood disaster, prepared for a flood, and minimize it impacts are complicated in human population encroached and modified

  11. Ginástica artística competitiva e a filosofia dos técnicos Competitive artistic gymnastics and coaches' philosophy

    OpenAIRE

    Myrian Nunomura; Mauricio Santos Oliveira; Odilon José Roble; Michele Carbinatto

    2012-01-01

    O presente estudo é um recorte do projeto original intitulado "Diagnóstico do Processo de Formação Esportiva da Ginástica Artística no Brasil". Um dos temas de análise foi a filosofia de trabalho dos técnicos que atuam nas categorias de base e preparam os potenciais ginastas para as seleções nacionais. Entrevistamos 46 técnicos de 29 instituições esportivas do Brasil. Para a coleta dos dados utilizamos a entrevista semiestruturada e, para o tratamento dos dados, a análise de conteúdo proposta...

  12. Distúrbios de atitudes alimentares e distorção da imagem corporal no contexto competitivo da ginástica rítmica Eating disorders and body image distortion in the rhythmic gymnastics competitive context

    OpenAIRE

    José Luiz Lopes Vieira; Helenice Zotto Amorim; Lenamar Fiorese Vieira; Adolpho Cardoso Amorim; Priscila Garcia Marques da Rocha

    2009-01-01

    OBJETIVO: Investigar a presença e a relação entre comportamentos sugestivos de transtornos de conduta alimentar e distorção da imagem corporal de atletas de ginástica rítmica participantes do contexto esportivo competitivo. MÉTODOS: Participaram do estudo 48 atletas de ginástica rítmica, das categorias: infantil, juvenil e adulta e 48 estudantes do ensino fundamental e médio (controle). Para a identificação da presença de transtornos de conduta alimentar utilizou-se o Teste de Atitudes Alimen...

  13. Second-stage mote system PM2.5 emission factors and rates for cotton gins: Method 201A combination PM10 and PM2.5 sizing cyclones

    Science.gov (United States)

    This report is part of a project to characterize cotton gin emissions from the standpoint of stack sampling. In 2006, the Environmental Protection Agencey (EPA) finalized and published a more stringent standard for particulate matter with nominal diameter less than or equal to 2.5 µm (PM2.5). This c...

  14. Third stage seed-cotton cleaning system PM2.5 emission factors and rates for cotton gins: Method 201A combination PM10 and PM2.5 sizing cyclones

    Science.gov (United States)

    This manuscript is part of a series of manuscripts that detail a project to characterize cotton gin emissions from the standpoint of stack and ambient sampling. The impetus behind the project was the 2006 EPA implementation of a more stringent standard for particulate matter less than or equal to 2....

  15. A medida da gordura: O interno e o íntimo na academia de ginástica

    Directory of Open Access Journals (Sweden)

    Carlos Emanuel Sautchuk

    2007-04-01

    Full Text Available A partir de pesquisa etnográfica e bibliográfica, o presente artigo trata da gordura nas academias de ginástica, enfocando questões relativas ao corpo e à pessoa. A análise da avaliação corporal evidencia os termos de uma produção científica que elabora o corpo como um metabolismo caracterizado pelo risco e pela maleabilidade. São os conteúdos corporais que estão em jogo, de modo que o ideal estético não é a magreza, mas a "definição" do corpo, fruto da sobreposição da gordura pelo músculo. A busca da saúde caracteriza-se pela gerência constante do risco inerente ao balanço destes componentes. Beleza e saúde são formas de cuidar de si - imperativo caro ao individualismo contemporâneo - através do manejo dos conteúdos corporais. Assim, a avaliação corporal delineia os elementos internos e os aspectos da intimidade, e dota as práticas corporais da capacidade de empreender um engajamento entre eles.Based on both ethnographic and bibliographic research, the present article examines the subject of fat in gymnastic academies, focusing on issues relating to the body and the person. An analysis of body evaluation evinces the terms of a scientific production that configures the body as a metabolism subject to risk and malleability. What is at stake are body contents, where the aesthetic ideal is not thinness, but the ‘toning’ of the body, the result of replacing fat with muscle mass. The search for beauty involves constant management of the risk inherent in balancing these components. Beauty and health are forms of self-care - an imperative central to contemporary individualism - through the management of body contents. Thus, body evaluation delineates internal elements and aspects of intimacy, and endows bodily practices with the capacity to stimulate an interaction between them.

  16. Teste GIN: detecção de gap em crianças com desvio fonológico Noise test: gap detection in children with phonological deviation

    Directory of Open Access Journals (Sweden)

    Elaine Feltre Assis

    2012-01-01

    Full Text Available OBJETIVO: investigar a resolução temporal: detecção de gaps em crianças com desvios fonológicos por meio do teste GIN e relacionar o grau do desvio fonológico com desempenho no teste GIN. MÉTODO: 6 indivíduos, de ambos os gêneros, 5 meninos e 1 menina, com idade entre 10 e 11 anos, com diagnóstico de desvio fonológico, em atendimento na clínica-escola do curso de Fonoaudiologia da FEAD de Belo Horizonte/MG, todos com ausência de perda auditiva e problemas neurológicos e/ou cognitivos. Os participantes foram submetidos ao Teste GIN, em intensidade de 50dB acima do limiar. RESULTADOS: das 06 crianças avaliadas, 5 (83,33% encontram-se alteradas e apenas 1 (16,67% obteve valores dentro do padrão de normalidade. Apesar da pequena amostra, viu-se que 83,33% das crianças com desvio fonológico tiveram limiares do GIN aquém do esperado para faixa etária. Porém não foi possível estabelecer uma relação direta entre grau de classificação do desvio fonológico e o baixo desempenho obtido no teste GIN, no qual apenas 1 criança com desvio médio moderado apresentou pior desempenho no teste GIN. CONCLUSÃO: crianças com desvio fonológico podem apresentar alteração no processamento temporal.PURPOSE: to investigate the temporal resolution, as for: gaps detection in children with phonological deviation through noise test and related with the degree of phonological performance in noise test. METHOD: 6 patients of both genders, five boys and one girl, aged between 10 and 11 year-old with phonological disorder' diagnosis in attendance at the school clinic of the Speech Therapy course (FEAD Belo Horizonte / MG, all with no hearing loss and no neurological and / or cognitive problems. The subjects underwent the GIN test at intensity of 50dB above the threshold. RESULTS: from the 6 evaluated children, 5 (83.33% had abnormal responses at gin test and only one (16.67% had values within the normal range. Despite the small sample, it was

  17. Teste GIN: detecção de gap em crianças com desvio fonológico Noise test: gap detection in children with phonological deviation

    Directory of Open Access Journals (Sweden)

    Elaine Feltre Assis

    2013-02-01

    Full Text Available OBJETIVO: investigar a resolução temporal: detecção de gaps em crianças com desvios fonológicos por meio do teste GIN e relacionar o grau do desvio fonológico com desempenho no teste GIN. MÉTODO: 6 indivíduos, de ambos os gêneros, 5 meninos e 1 menina, com idade entre 10 e 11 anos, com diagnóstico de desvio fonológico, em atendimento na clínica-escola do curso de Fonoaudiologia da FEAD de Belo Horizonte/MG, todos com ausência de perda auditiva e problemas neurológicos e/ou cognitivos. Os participantes foram submetidos ao Teste GIN, em intensidade de 50dB acima do limiar. RESULTADOS: das 06 crianças avaliadas, 5 (83,33% encontram-se alteradas e apenas 1 (16,67% obteve valores dentro do padrão de normalidade. Apesar da pequena amostra, viu-se que 83,33% das crianças com desvio fonológico tiveram limiares do GIN aquém do esperado para faixa etária. Porém não foi possível estabelecer uma relação direta entre grau de classificação do desvio fonológico e o baixo desempenho obtido no teste GIN, no qual apenas 1 criança com desvio médio moderado apresentou pior desempenho no teste GIN. CONCLUSÃO: crianças com desvio fonológico podem apresentar alteração no processamento temporal.PURPOSE: to investigate the temporal resolution, as for: gaps detection in children with phonological deviation through noise test and related with the degree of phonological performance in noise test. METHOD: 6 patients of both genders, five boys and one girl, aged between 10 and 11 year-old with phonological disorder' diagnosis in attendance at the school clinic of the Speech Therapy course (FEAD Belo Horizonte / MG, all with no hearing loss and no neurological and / or cognitive problems. The subjects underwent the GIN test at intensity of 50dB above the threshold. RESULTS: from the 6 evaluated children, 5 (83.33% had abnormal responses at gin test and only one (16.67% had values within the normal range. Despite the small sample, it was

  18. Avaliação da qualidade de vida em funcionários praticantes de ginástica holística em empresa

    OpenAIRE

    Fernanda Fonseca dos Santos Lopes; Zelia Zilda Lourenço de Camargo Bittencourt

    2012-01-01

    Introdução: A qualidade de vida na empresa é um importante recurso de promoção de saúde, e pode ser desenvolvida a partir da pratica de atividades físicas. O exercício físico é uma forma de lazer e de restaurar a saúde dos efeitos da rotina estressante do trabalho, proporcionando condições de melhor desempenho e produtividade. A Ginástica Holística atua através da sensibilização e da tomada de consciência, de modo a levar o sujeito a uma melhor utilização do seu potencial perceptivo, sensoria...

  19. Interação entre leptina, ginástica artística, puberdade e exercício em atletas do sexo feminino

    OpenAIRE

    Tatiana de Barros Meira; Myrian Nunomura

    2010-01-01

    Há evidências de que as atletas de ginástica artística (GA) apresentam desregulações no sistema reprodutório em relação à média populacional. A interação entre alguns fatores pode explicar esse fato: genética, estresse do exercício, baixa porcentagem de gordura corporal, má nutrição e ação da leptina. Por meio de uma revisão de literatura, discutimos resultados de pesquisas que relacionam a ação do hormônio leptina e desregulações no sistema reprodutório durante a puberdade em atletas de GA d...

  20. Leyendo el sur. A propósito del libro Cantes al Amorsillega de Ginés Liébana

    Directory of Open Access Journals (Sweden)

    Bartolomé Delgado Cerrillo

    2011-06-01

    Full Text Available A través de los poemas del libro Cantes al Amorsillega de Ginés Liébana, haremos un recorrido por las principales coplas del cante flamenco, incidiendo en la personal interpretación que nos da el autor y aportando su relación con la significación de las formas poéticas y las imágenes con que las ilustra. Este libro es valioso para ser integrado en la educación reglada como producto cultural. Y es valioso no solo como portador de contenidos antropológicos, sociológicos, coreográficos, musicales, poéticos e históricos, sino también como compendio de los estereotipos culturales que caracterizan la identidad cultural andaluza.

  1. Avaliação nutricional e antropométrica de praticantes de exercício físico em ginásio

    OpenAIRE

    Dias, Rita Margarida Rodrigues

    2014-01-01

    A preocupação acrescida com a condição e aparência física, refletem-se em cuidados com o estado de saúde e bem-estar e são, nos últimos anos, responsáveis pela expansão dos ginásios e health clubs.Mas, atividade física e a alimentação estão intimamente ligadas, tanto no que respeita à estética como também, com maiores preocupações, no que respeita à saúde. Daí que as duas vertentes estejam ligadas à imagem de pessoas saudáveis e vigorosas. Na verdade, a capacidade de rendimento do organism...

  2. Relationship between external stink bug (Hemiptera: Pentatomidae) boll-feeding symptoms and internal boll damage with respect to cotton lint gin-out and fiber quality.

    Science.gov (United States)

    Blinka, Eric L; Herbert, Ames; Malone, Sean; Van Duyn, John W; Roberts, Phillip; Bradley, J R; Bacheler, Jack S

    2010-12-01

    Cotton, Gossypium hirsutum L., bolls from 17 field locations in northeastern North Carolina and southeastern Virginia, having 20% or greater internal boll damage, were studied to determine the relationship between external feeding symptoms and internal damage caused by stink bug (Hemiptera: Pentatomidae) feeding. In 2006 and 2007, two cohorts of 100 bolls each were sampled at all field locations. The first cohort was removed as bolls reached approximately quarter size in diameter (2.4 cm). External and internal symptoms of stink bug feeding were assessed and tabulated. Concurrent to when the first cohort was collected, a second cohort of quarter-size-diameter bolls was identified, tagged, examined in situ for external feeding symptoms (sunken lesions), and harvested at the black seed coat stage. Harvested bolls were assessed for internal damage and locks were categorized (undamaged, minor damage, or major damage), dried, and ginned. Lint samples from each damage category were submitted for high volume instrument and advanced fiber information system quality analyses. Significant, moderately strong Pearson correlation coefficients existed between number of external stink bug feeding lesions and internal damage. Pearson correlation of total external lesions with total internal damage was stronger than any correlation among the other single components compared. Predictability plots indicated a rapid increase in relationship strength when relating external stink bug lesions to internal damage as the number of external lesions increased. Approximately 90% predictability of internal damage was achieved with four (2006) or six (2007) external lesions per boll. Gin-turnout and fiber quality decreased with increasing intensity of internal stink bug damage. PMID:21309249

  3. Ginástica geral na escola: uma proposta metodológica General gymnastics at school: A methodological propositon Gimnasia general en la escuela: Una propuesta metodológica

    Directory of Open Access Journals (Sweden)

    2006-11-01

    Full Text Available Este trabalho tem por objetivo discutir a Ginástica como conteúdo da Educação Física escolar, por meio da Ginástica geral como proposta metodológica. Tal proposta tem como perspectiva a integração das diversas manifestações gímnicas e os outros componentes da cultura corporal, sendo sua principal característica a ausência da competição. PALAVRAS-CHAVE: ginástica – ginástica geral – educação física escolar. This study aims at discussing gym classes as a part of school physical education, using General Gymnastics as a methodological approach. Such an approach has the perspective of integrating the several gymnastic manifestations to the other components of body culture, with the lack of competition as its main feature. KEY WORDS: gym – general gymnastics – physical education in schools. Este trabajo tiene por objetivo discutir la Gimnasia como contenido de la Educación Física escolar, por medio de la Gimnasia general como propuesta metodológica. Tal propuesta tiene como perspectiva la integración de diversas manifestaciones gímnicas y los otros componentes de la cultura corporal, siendo su principal característica la ausencia de la competencia. PALABRAS-CLAVE: gimnasia – gimnasia general – educación física escolar.

  4. El Manuscrito Cerramientos y trazas de montea de Ginés Martínez de Aranda

    Directory of Open Access Journals (Sweden)

    Calvo López, José

    2009-03-01

    Full Text Available Ginés Martínez de Aranda, master mason in the cathedrals of Cádiz and Santiago de Compostela during the late 16th century, wrote a manuscript, Cerramientos y trazas de montea, concerning geometrical problems in stone construction. This article deals with the copy of Cerramientos in the Servicio Histórico Militar (Madrid, its copyist, dating, the existence of an earlier version and whether or not Aranda intended to publish it. Also examined are the connections between Cerramientos and other Spanish stonecutting texts of the period, such as those by Alonso de Vandelvira, Cristóbal de Rojas, Alonso de Guardia or Juan de Portor y Castro. Finally, an assessment is made of Martínez de Aranda’s original contributions to European stonecutting literatura.

    El arquitecto y cantero baezano Ginés Martínez de Aranda, que trabajó a finales del siglo XVI y ejerció la maestría de las catedrales de Cádiz y Santiago de Compostela, compuso un manuscrito llamado Cerramientos y trazas de montea, que trata de los problemas geométricos de la construcción pétrea. El artículo analiza la copia del manuscrito conservada en el Servicio Histórico Militar de Madrid, la identidad del copista, la fecha de la primera redacción de la obra y la de la copia conservada, y el destino de la obra; a continuación, se estudia la relación del manuscrito con otras obras españolas de cantería, en especial las de Alonso de Vandelvira, Cristóbal de Rojas, Alonso de Guardia y Juan de Portor y Castro, para finalizar tratando diversas aportaciones originales de Aranda a la literatura europea de la cantería.

  5. A postura de atletas de ginástica rítmica: análise através da fotometria

    Directory of Open Access Journals (Sweden)

    Luciana Rocco Bosso

    2012-10-01

    Full Text Available A postura apresenta relação com o tipo de modalidade esportiva praticada, acompanhada de características próprias. Por isso, este trabalho teve como objetivo verificar a postura e suas possíveis alterações em atletas de ginástica rítmica. Trata-se de um estudo de fotometria - fotografias retiradas de pontos específicos demarcados no corpo da atleta, sendo analisados pelo software de avaliação postural (SAPO. Participaram do estudo 27 indivíduos do sexo feminino, entre sete e 15 anos, atletas de uma equipe GR de Maringá, PR. Foram verificadas alterações em todas as atletas, sendo que algumas mostraram-se maiores, que podem ser justificadas pelos aspectos característicos da modalidade, e necessitam de novas análises. Portanto, a avaliação postural das atletas de GR torna-se importante como medida profilática para identificar os possíveis desalinhamentos posturais.

  6. Interação entre leptina, ginástica artística, puberdade e exercício em atletas do sexo feminino

    Directory of Open Access Journals (Sweden)

    Tatiana de Barros Meira

    2010-09-01

    Full Text Available Há evidências de que as atletas de ginástica artística (GA apresentam desregulações no sistema reprodutório em relação à média populacional. A interação entre alguns fatores pode explicar esse fato: genética, estresse do exercício, baixa porcentagem de gordura corporal, má nutrição e ação da leptina. Por meio de uma revisão de literatura, discutimos resultados de pesquisas que relacionam a ação do hormônio leptina e desregulações no sistema reprodutório durante a puberdade em atletas de GA do sexo feminino. Podemos afirmar que existe uma interação entre a seleção natural na modalidade, a baixa ingestão calórica e o estresse do treinamento, que ocasionaria a diminuição de leptina plasmática e causaria desregulações no sistema reprodutório durante a puberdade.

  7. Epifisiólise proximal do úmero em atleta de ginástica olímpica Proximal humeral epiphysiolysis in a gymnast

    Directory of Open Access Journals (Sweden)

    Benno Ejnisman

    2007-01-01

    Full Text Available CONTEXTO: Existem diversas causas de dor no ombro do atleta. Estruturas como tendões e ligamentos são freqüentemente acometidas por lesões. No atleta jovem com esqueleto imaturo, as afecções ósseas devem ser lembradas como possíveis causas de dor. RELATO DE CASO: Os autores relatam a ocorrência da epifisiólise proximal do úmero em um atleta de ginástica olímpica e discutem a literatura a respeito do assunto. CONCLUSÃO: A lesão da placa fisária proximal do úmero em atletas é pouco freqüente. O diagnóstico precoce e correto tratamento evitam que ocorra deformidades severas e déficits funcionais.CONTEXT: There are different causes for shoulder pain in athletes. Structures such as tendons and ligaments are frequently affected by injuries. In young athletes with immature skull, bone injuries must be ruled as a cause of pain. CASE REPORT: The authors present a case of proximal humeral epiphysiolysis in a gymnast and review literature addressing this topic. CONCLUSION: Injuries on proximal humeral physeal plates of athletes are uncommon. The early diagnosis and correct treatment can avoid deformity and functional deficits.

  8. Effects of Pyrolysis Temperature on Product Yields and Energy Recovery from Co-Feeding of Cotton Gin Trash, Cow Manure, and Microalgae: A Simulation Study

    Science.gov (United States)

    Hanif, Muhammad Usman; Capareda, Sergio C.; Iqbal, Hamid; Arazo, Renato Ortiz; Baig, Muhammad Anwar

    2016-01-01

    The intensive search of new and cleaner energy catches interest in recent years due to huge consumption of fossil fuels coupled with the challenge of energy and environmental sustainability. Production of renewable and environmentally benign energy from locally available raw materials is coming in the frontline. In this work, conversion of the combined biomass (cotton gin trash, cow manure, and Microalgae [Nannochloropsis oculata]) through batch pyrolysis has been investigated. The effect of temperature to the production of energy fuels such as bio-oil, char, and biogas have been simulated considering the yield and energy content as responses. Result of the investigation generally revealed that the proportions of the different biomass did not significantly affect the product yield and energy recovery. Significant effect of temperature is evident in the simulation result of energy recovery whereby maximum conversion was achieved at 400°C for char (91 wt%), 600°C for syngas (22 wt%), and 551°C for bio-oil (48 wt%). Overall energy conversion efficiency of 75.5% was obtained at 589°C in which 15.6 MJ/kg of mixed biomass will be elevated to pyrolysis products. PMID:27043929

  9. Effects of Pyrolysis Temperature on Product Yields and Energy Recovery from Co-Feeding of Cotton Gin Trash, Cow Manure, and Microalgae: A Simulation Study.

    Directory of Open Access Journals (Sweden)

    Muhammad Usman Hanif

    Full Text Available The intensive search of new and cleaner energy catches interest in recent years due to huge consumption of fossil fuels coupled with the challenge of energy and environmental sustainability. Production of renewable and environmentally benign energy from locally available raw materials is coming in the frontline. In this work, conversion of the combined biomass (cotton gin trash, cow manure, and Microalgae [Nannochloropsis oculata] through batch pyrolysis has been investigated. The effect of temperature to the production of energy fuels such as bio-oil, char, and biogas have been simulated considering the yield and energy content as responses. Result of the investigation generally revealed that the proportions of the different biomass did not significantly affect the product yield and energy recovery. Significant effect of temperature is evident in the simulation result of energy recovery whereby maximum conversion was achieved at 400°C for char (91 wt%, 600°C for syngas (22 wt%, and 551°C for bio-oil (48 wt%. Overall energy conversion efficiency of 75.5% was obtained at 589°C in which 15.6 MJ/kg of mixed biomass will be elevated to pyrolysis products.

  10. Effects of Pyrolysis Temperature on Product Yields and Energy Recovery from Co-Feeding of Cotton Gin Trash, Cow Manure, and Microalgae: A Simulation Study.

    Science.gov (United States)

    Hanif, Muhammad Usman; Capareda, Sergio C; Iqbal, Hamid; Arazo, Renato Ortiz; Baig, Muhammad Anwar

    2016-01-01

    The intensive search of new and cleaner energy catches interest in recent years due to huge consumption of fossil fuels coupled with the challenge of energy and environmental sustainability. Production of renewable and environmentally benign energy from locally available raw materials is coming in the frontline. In this work, conversion of the combined biomass (cotton gin trash, cow manure, and Microalgae [Nannochloropsis oculata]) through batch pyrolysis has been investigated. The effect of temperature to the production of energy fuels such as bio-oil, char, and biogas have been simulated considering the yield and energy content as responses. Result of the investigation generally revealed that the proportions of the different biomass did not significantly affect the product yield and energy recovery. Significant effect of temperature is evident in the simulation result of energy recovery whereby maximum conversion was achieved at 400°C for char (91 wt%), 600°C for syngas (22 wt%), and 551°C for bio-oil (48 wt%). Overall energy conversion efficiency of 75.5% was obtained at 589°C in which 15.6 MJ/kg of mixed biomass will be elevated to pyrolysis products. PMID:27043929

  11. Influência do tipo de colheita e de beneficiamento, na qualidade da fibra e do fio de algodão Effects of harvesting practices and gin machinery on the technological properties of cotton fibers and yarn

    Directory of Open Access Journals (Sweden)

    Carlos A. M. Ferraz

    1977-01-01

    Full Text Available São relatados e discutidos os efeitos de colheita manual e mecânica na qualidade da fibra e do fio do algodão e a influência do beneficiamento em máquinas descaroçadoras de rolo e de serras, sendo esta última equipada para pré e pós-limpeza do algodão, especial para beneficiamento de algodão colhido mecanicamente. Os ensaios foram conduzidos no ano de 1970/71, em Araras e Paranapanema. A colheita mecânica não afetou a qualidade da fibra ou do fio, sendo inclusive superior à manual para comprimento de fibra, em Paranapanema, e para micronaire, em Araras. O beneficiamento em máquinas descaroçadoras de serras prejudicou sempre a qualidade da fibra e do fio. A característica de resistência da fibra medida pelo aparelho Pressley não foi afetada.Effects of harvesting practices and gin machinery on the properties of cotton fibers and yarn were studied for three commercial varieties: IAC 13-1, IAC RM3, and IAC RM4 SM5. There was no difference in the majority of technological properties, between hand-picked cotton and machine-picked cotton. However, machine-picked cotton had better fiber length in Paranapanema-SP and better Micronaire in Araras-SP. Roller gin was better than saw gin for all technological cotton fiber properties and yarn, independent of harvesting processes.

  12. Metodologia do ensino de ginástica: novos olhares, novas perspectivas Gym teaching methodology: new approaches, new perspectives Metodología de enseñanza de la gimnasia: Nuevos horizontes, nuevas perspectivas

    Directory of Open Access Journals (Sweden)

    2006-11-01

    Full Text Available Este artigo busca sistematizar uma proposta metodológica para o ensino da Ginástica escolar e comunitária, que vem sendo construída a partir de experiências realizadas junto aos projetos de ensino, pesquisa e extensão vinculados ao Grupo de Estudo, Pesquisa e Experimentação em Ginástica(GEPEGIN, da Faculdade de Educação Física da UFG. A proposta indica alguns princípios, conteúdos e estratégias de ação que possam contribuir para o processo de formação humana crítica, na tentativa de apontar uma nova perspectiva para o ensino, a prática e o conhecimento da Ginástica. PALAVRAS-CHAVE: metodologia da ginástica – formação humana – linguagem corporal. This article aims at systematizing a methodological approach for the teaching of gym in schools and communities, which is being built from the experiences held with teaching, research, and extension (community-bound projects linked to GEPEGIN - the Study, Research, and Gym Experimentation Group, from the Physical Education Department at UFG - the Federal University of Goias. This approach indicates some principles, contents, and strategies for action that might contribute to the process of human education in a critical way, in an attempt to point towards a new perspective for the teaching, the practice, and the knowledge of Gymnastics. KEY-WORDS: gymnastics methodology – human education – body language. Este artículo busca sistematizar una propuesta metodológica para la enseñanza de la Gimnasia escolar y comunitaria, que viene siendo construida a partir de experiencias realizadas junto a los proyectos de enseñanza, pesquisa y extensión vinculados al Grupo de Estudio, Pesquisa y Experimentación en Gimnasia (GEPEGIN, de la Facultad de Educación Física de la UFG. La propuesta indica algunos principios, contenidos y estrategias de acción que puedan contribuir para el proceso de formación humana crítica, intenta señalar una nueva perspectiva para la ense

  13. Linguagens do corpo: dimensões expressivas e possibilidades educativas da ginástica e da dança Body languages: expressive dimensions and educational possibilities for gymnastics and dance

    OpenAIRE

    Lívia Tenorio Brasileiro; Luciana Pedrosa Marcassa

    2008-01-01

    O presente texto busca refletir sobre a dança e a ginástica como duas manifestações culturais que, entre outras, constituem o universo das linguagens do corpo, analisando os sentidos e os significados contidos em suas dimensões expressivas e apontando algumas orientações pedagógicas, particularmente para o campo da educação física.The present text is aimed at stimulating a reflection on dance and gymnastics as two different cultural manifestations that, like others, belong to the universe of ...

  14. Ginástica artística competitiva e a filosofia dos técnicos Competitive artistic gymnastics and coaches' philosophy

    Directory of Open Access Journals (Sweden)

    Myrian Nunomura

    2012-12-01

    Full Text Available O presente estudo é um recorte do projeto original intitulado "Diagnóstico do Processo de Formação Esportiva da Ginástica Artística no Brasil". Um dos temas de análise foi a filosofia de trabalho dos técnicos que atuam nas categorias de base e preparam os potenciais ginastas para as seleções nacionais. Entrevistamos 46 técnicos de 29 instituições esportivas do Brasil. Para a coleta dos dados utilizamos a entrevista semiestruturada e, para o tratamento dos dados, a análise de conteúdo proposta por Bardin (2010. Constatamos que a base filosófica ainda é inconsistente e que, em muitas instituições, esta se confunde com os próprios objetivos do programa de treinamento ou simplesmente inexiste. O fato merece considerações e criticas, mas sabemos que a filosofia não é desenvolvida durante os cursos de formação dos técnicos.The current study is a piece from the original project entitled "Diagnosis of the Artistic Gymnastics Development Program in Brazil". Among others issues, the coaching philosophy of coaches who are developing gymnasts that may be representative of the national team was a matter of analysis. We interviewed 46 coaches from 29 sports institutions in Brazil. As data collection we used a semi-structured interview and for data treatment we adopted the content analysis method of Bardin (2010. We have found out that there is an inconsistent philosophical basis, and in many institutions this has been mixed up with the objectives of the training program or just doesn't exist. This fact needs consideration and criticism, but we know that the coaching philosophy is not developed during the coaching education courses.

  15. Caracterização postural da jovem praticante de ginástica olímpica Postural characterization of young participants in Olympic gymnastics

    Directory of Open Access Journals (Sweden)

    MMB Guimarães

    2007-06-01

    Full Text Available OBJETIVO: Identificar as alterações posturais em crianças praticantes de ginástica olímpica, com idade entre 8 e 12 anos. MÉTODOS: Foram avaliadas 84 estudantes, 38 praticantes de ginástica olímpica e 46 não praticantes, com idade entre 8 e 12 anos. Foram realizadas fotografias de cada criança nos planos frontal anterior e posterior e plano sagital. As fotos foram analisadas através do software Corel Draw, v. 11.0, utilizando as ferramentas linhas-guia e dimensão (dimensão angular, dimensão vertical e dimensão horizontal, visando determinar os parâmetros das 19 variáveis qualitativas e 5 variáveis quantitativas. RESULTADOS: Ao comparar os sujeitos do grupo teste (GT com os sujeitos do grupo controle (GC, observa-se diferença estatisticamente significante nas variáveis rotação medial de fêmur (GC 56,52%; GT 39,47%, antepulsão de pelve (GC 43,48%; GT 76,32% e rotação de tronco (GC 67,39%; GT 23,68%. Observa-se também diferença significante em relação às medidas de valgo de joelho (GC 4,06 ± 2,32 cm; GT 3,14 ± 1,49cm, desnível de pelve (GC 0,69 ± 0,39 cm; GT 0,53 ± 0,33cm e ângulo tíbio-társico (GC 86,93 ± 2,90 cm; GT 87,11 ± 4,17 cm. CONCLUSÃO: Ao analisar os resultados, nota-se uma tendência ao melhor alinhamento dos membros inferiores no grupo teste quando comparado ao grupo controle. Há um aumento da inclinação pélvica anterior e uma tendência ao aumento da hiperlordose lombar no grupo teste, fatores que podem predispor a praticante de ginástica olímpica a um desalinhamento sobre as estruturas esqueléticas, levando a quadros dolorosos, limitando a sua vida esportiva.OBJECTIVE: To identify the postural alterations among children aged 8 to 12 years who perform Olympic gymnastics. METHOD: Eighty-four students aged 8 to 12 years were assessed: 38 who were participating in Olympic gymnastics and 46 who were not. Each child was photographed in the anterior and posterior frontal planes and in the

  16. Avaliação do estado nutricional de atletas de ginástica olímpica do Rio de Janeiro e São Paulo Nutritional status evaluation of olympic gymnastics athletes from Rio de Janeiro and São Paulo, Brazil

    Directory of Open Access Journals (Sweden)

    Beatriz Gonçalves RIBEIRO

    2002-08-01

    Full Text Available Com o objetivo de avaliar o estado nutricional de atletas de ginástica olímpica, do sexo feminino, foram estudadas 46 ginastas, de 11 a 14 anos, pertencentes a clubes e academias das cidades do Rio de Janeiro e São Paulo. O estudo antropométrico envolveu medidas de massa corporal, estatura, dobras cutâneas e perímetros. Observou-se diferença significativa para as dobras cutâneas tricipital, suprailíaca, da coxa e da panturrilha e para o percentual de gordura (pThe purpose of this study was to evaluate the nutritional status of 46 female olympic gymnastics athletes, aged 11 to 14 years old, attending private gymnastics clubs of the cities of Rio de Janeiro and São Paulo. The anthropometric assessment involved measurements of height, body mass, skinfold thickness and circumferences. Significant difference was observed for the triceps, suprailiac, mid thigh and medial calf skinfolds and for the percentage of body fat (p<0.05. For the assessment of dietary intake a 24-hour recall and a 3-day self-register were used. The energy consumption and the percentage of carbohydrates (50% to 58% in the diet were low and the protein ingestion (1.5 to 1.7 g/kg of body weight was appropriate, according to values proposed for athletes. Vitamin intake was satisfactory, except for folic acid of gymnasts from Rio de Janeiro. From the minerals assessed, the intake of calcium, magnesium, zinc and iron was inadequate. No clinical signs of iron deficiency were observed.

  17. Coupling of size-exclusion chromatography to liquid chromatography/mass spectrometry for determination of trace levels of thifensulfuron-methyl and tribenuron-methyl in cottonseed and cotton gin trash.

    Science.gov (United States)

    Stry, J J; Amoo, J S; George, S W; Hamilton-Johnson, T; Stetser, E

    2000-01-01

    Size-exclusion chromatography (SEC) was coupled to reversed-phase liquid chromatography/mass spectrometry for the determination of thifensulfuron-methyl and tribenuron-methyl in cottonseed and cotton gin trash. The limit of quantitation was 20 parts per billion (ppb), and the limit of detection was 6 ppb. The analytes were extracted by homogenization in a buffer solution. The extracts underwent a solvent exchange into methanol and were injected onto an SEC column. As the analytes eluted from the SEC column, the eluate was diverted onto a reversed-phase column for additional separation of the analytes and their detection via mass spectrometry. This method is unique because the samples are not cleaned up before analysis, the analytes are injected in methanol, and the entire analysis is completed in 30 min. Average recoveries and standard deviations for thifensulfuronmethyl and tribenuron-methyl in cotton gin trash were 91 +/- 6% and 88 +/- 5%, respectively. Average recoveries and standard deviations for thifensulfuron-methyl and tribenuron-methyl in cottonseed were 91 +/- 11% and 99 +/- 12%, respectively. This is an effective method for the detection and determination of thifensulfuron-methyl and tribenuron-methyl in cotton. PMID:10868588

  18. Cotton-gin automation by using adaptive fuzzy immune PID controller%基于自适应模糊免疫PID的轧花自动控制系统

    Institute of Scientific and Technical Information of China (English)

    董全成; 冯显英

    2013-01-01

    轧花自动控制是棉花加工过程自动化的重要环节,对棉花加工质量、产量等有着重要影响。以轧花机喂花辊的转速作为控制量,在含潮率、籽棉等级等因素发生变化时,通过调节喂花辊转速,来实时控制喂花量大小,以保持合适的籽棉卷的密度,来达到轧花自动控制的目的。根据轧花工艺特点,用模糊控制、免疫控制与传统PID控制相结合,设计了自适应模糊免疫PID控制系统来控制喂花辊的转速,通过实时修正PID参数来保持控制系统的稳定性。用Matlab对自适应模糊免疫PID、模糊免疫PID和自适应模糊PID 3种控制系统进行了仿真比较分析,同时对基于自适应模糊免疫PID控制的轧花实时运行数据进行了分析,仿真及运行结果表明所设计控制系统在轧花自动控制中是有效和可行的,其在稳定性、鲁棒性上比其他2种智能控制系统性能优越。该控制方法为轧花自动控制提供了一种新的控制策略。%The cotton-gin automation is an important component in the cotton production process and also can affect cotton production quality, output, and profit etc. If keeping a constant seed cotton feed rate, a jam would appeared likely between the rotary knife and ribs of the cotton-gin stand when the moisture regain or seed cotton grade changed. In this paper, the automatic control system was designed that monitored and adjusted the seed cotton feed rate to produce a pre-selected load level on the cotton-gin stand rotary knife while automatically compensating for differences in the seed cotton such as trash and moisture regain content. In this automatic control system, an electrical transducer that is part of the automatic control system measured the input signal from a motor driving the rotary knife, and then proportionately converted and sent this signal as a direct current to the PLC by the AD module. Then the PLC sent the numerical signal to

  19. Impacto do beneficiamento sobre o número de neps e quantidade de impurezas da fibra do algodão Ginning impact on the number of neps and amount of cotton fiber contaminants

    Directory of Open Access Journals (Sweden)

    Odilon R. R. F. da Silva

    2010-01-01

    Full Text Available Objetivou-se, neste trabalho, estudar o efeito do beneficiamento sobre o conteúdo de impurezas, pó e o número de neps na pluma, em 12 algodoeiras do Estado de Mato Grosso. O experimento consistiu de uma combinação fatorial de cinco etapas de beneficiamento do algodão em 12 algodoeiras em delineamento inteiramente casualizado com quatro repetições. Amostras de algodão foram coletadas nas seguintes etapas: a no desmanche do fardão; b antes do descaroçamento; c logo após o descaroçamento; d na bica, sem o uso do limpador tipo serrilha; e na bica, após a limpeza da pluma, utilizando-se o limpador tipo serrilha. Em todas as etapas se retiraram quatro amostras padrão de pluma com massa de 350 g a fim de serem analisadas mediante o instrumento AFIS (Advanced Fiber Information System para determinação do conteúdo de impurezas e poeira e o número de neps da fibra. Os resultados indicam que os processos de prelimpeza do algodão em caroço e limpeza da pluma reduzem o conteúdo de impurezas e da poeira do algodão enquanto, juntamente com o descaroçamento, esses processos aumentaram o número de neps da fibra do algodão. A utilização do limpador de pluma tipo serrilha com manta contínua aumenta a eficiência de limpeza da pluma, porém ocasiona incrementos significativos no número de neps.The purpose of this work was to study the ginning effect on the amount of cotton contaminants, dust and neps in cotton fiber, in 12 industries in the Mato Grosso State. The experiment consisted of a factorial combination over five stages of ginning and 12 cotton industries using a randomized design with four replications. Some samples of cotton were collected in the following phases: a in the bale dismantling; b before the ginning; c right after ginning; d into the covered lint slide not using the saw lint cleaner; and e into the covered lint slide, after cleaning process using the saw lint cleaner system. Over all stages four standard samples of

  20. Linguagens do corpo: dimensões expressivas e possibilidades educativas da ginástica e da dança Body languages: expressive dimensions and educational possibilities for gymnastics and dance

    Directory of Open Access Journals (Sweden)

    Lívia Tenorio Brasileiro

    2008-12-01

    Full Text Available O presente texto busca refletir sobre a dança e a ginástica como duas manifestações culturais que, entre outras, constituem o universo das linguagens do corpo, analisando os sentidos e os significados contidos em suas dimensões expressivas e apontando algumas orientações pedagógicas, particularmente para o campo da educação física.The present text is aimed at stimulating a reflection on dance and gymnastics as two different cultural manifestations that, like others, belong to the universe of the body languages. The authors analyze the senses and meanings in the expressive dimension of dance and gymnastics and point to some pedagogical orientations, especially useful to the field of Physical Education.

  1. Detecção e seleção de talentos na ginástica artística feminina: a perspectiva dos técnicos brasileiros

    Directory of Open Access Journals (Sweden)

    Myrian Nunomura

    2014-04-01

    Full Text Available Este artigo tem por objetivo apresentar e discutir a detecção e a seleção de talentos na Ginástica Artística Feminina com enfoque para os aspectos que norteiam as condutas dos técnicos brasileiros. Entrevistamos 34 técnicos de 29 instituições distribuídas no Brasil. Observamos que os meios utilizados para detectar e selecionar os talentos na modalidade privilegiam a idade de ingresso, as características antropométricas e os testes físico-motores. Porém, sabemos que os determinantes do sucesso no esporte são multifatoriais e, por vezes, as avaliações transversais utilizadas não contemplam todos os fatores que contribuem para a obtenção de bons resultados no alto rendimento.

  2. Effects of a compost made from the solid by-product ("alperujo") of the two-phase centrifugation system for olive oil extraction and cotton gin waste on growth and nutrient content of ryegrass (Lolium perenne L.).

    Science.gov (United States)

    Alburquerque, J A; Gonzálvez, J; García, D; Cegarra, J

    2007-03-01

    A pot experiment was conducted on a low-fertility calcareous soil in order to evaluate the effect on ryegrass growth and nutrient uptake of an organic fertiliser obtained by composting "alperujo" and cotton gin waste. Compost, alone and combined with nitrogen fertilisation, was added to the soil at three rates and three harvests were obtained. The compost application enhanced plant growth in the first and third harvest. However, the additional nitrogen fertilisation clearly improved soil productivity due to the scarce availability of this nutrient in the compost. Also, a general increase in the plant contents of phosphorus and potassium in the first two harvests was recorded, whereas treatments with the maximum compost rate showed the highest plant content of copper in the last two harvests. Decreases in calcium in the last two harvests, in magnesium in all of them and in iron and manganese in the last harvest were also observed. PMID:16762544

  3. Nos rastros da memória de um "Mestre de Ginástica" In the wake of the memory of a "Master of Gymnastics"

    Directory of Open Access Journals (Sweden)

    Janice Zarpellon Mazo

    2010-12-01

    Full Text Available A trajetória de vida de Georg Black, considerado o precursor da Educação Física e dos Esportes no Estado do Rio Grande do Sul, foi marcada por muitas realizações. Por sua relevante contribuição na propagação da ginástica alemã nos clubes esportivos e nas escolas da comunidade alemã de Porto Alegre e São Leopoldo por mais de 30 anos (1905-1937 é apontado por autores (Daudt, 1952; Hofmeister, 1987 como sendo o "Pai da Educação Física no Rio Grande do Sul". Seu nome é lembrado em alguns lugares da cidade de Porto Alegre: Centro Comunitário Georg Black (CEGEB, Grupo de Escoteiros Georg Black e SOGIPA. O objetivo central do presente estudo foi reconstituir a história de vida de Georg Black no cenário da educação física e esportes do Rio Grande do Sul. Para tanto, as fontes consultadas e submetidas à análise documental foram os livros comemorativos da SOGIPA, Atlas do Esporte no Brasil e no Rio Grande do Sul, jornal da Turnerbund, entre outras fontes impressas. A pesquisa revelou que Georg Black, se inseriu de forma ampla no cenário esportivo, especialmente porto-alegrense, contribuindo para a emergência e difusão de práticas corporais e esportivas diversificadas.The trajectory of life of Georg Black, considered the precursor of the Physical Education and the Sports in the state of the Rio Grande Do Sul, was marked by many accomplishments. For its excellent contribution in the propagation of the german gymnastics in the sporting clubs and the schools of the german community of Porto Alegre and São Leopoldo for more than 30 years (1905-1937, some authors (Daudt, 1952; Hofmeister, 1987 it to it mentions as being the "Father of the Physical Education in the Rio Grande Do Sul". Its name is remembered in some places in the city of Porto Alegre: Communitarian center Georg Black (CEGEB, Group of Escoteiros Georg Black and in some sectors of the SOGIPA. In this way, the central objective of the present study was to reconstitute

  4. Prática da ginástica laboral por trabalhadores das indústrias do Rio Grande do Sul, Brasil Stretching programs among industrial workers from the state of Rio Grande do Sul, Brazil

    Directory of Open Access Journals (Sweden)

    Luana Callegaro Rossato

    2013-03-01

    Full Text Available O presente estudo identificou a prevalência e os fatores associados à prática de ginástica laboral por trabalhadores da indústria no Estado do Rio Grande do Sul, Brasil. Realizou-se análise secundária dos dados de um estudo de delineamento transversal, com amostra probabilística de 2.265 trabalhadores, de ambos os sexos. O instrumento de pesquisa foi o questionário autoadministrado "Estilo de vida e hábitos de lazer dos trabalhadores das indústrias brasileiras", previamente validado. A variável dependente foi a prática de ginástica laboral, definida pela resposta positiva à questão: "Você participa do programa de ginástica na empresa (ginástica laboral?". Foram coletadas informações demográficas, socioeconômicas, comportamentais e relacionadas à saúde, como potenciais fatores associados. Na análise de dados, empregou-se o teste Qui-quadrado de Pearson e o modelo de regressão de Poisson com variância robusta, nas análises bruta e ajustada, respectivamente. A prática de ginástica laboral foi referida por 40,3% dos respondentes (IC95%: 38,2; 42,3, sendo mais prevalente nos trabalhadores do sexo feminino, com maiores níveis de escolaridade, naqueles mais ativos no lazer e que relatavam menores intensidades de esforço no trabalho. Não se observou associação da variável dependente com idade, estado civil, renda familiar bruta, tabagismo, autopercepção de saúde e autopercepção do nível de estresse. Programas de ginástica laboral devem desenvolver estratégias de promoção da saúde que priorizem subgrupos de trabalhadores menos envolvidos, em especial, indivíduos do sexo masculino e com menor escolaridade. Desse modo, será possível reduzir as disparidades, beneficiando trabalhadores, independentemente de suas características sociodemográficas, a melhores condições saúde e bem-estar no ambiente das indústrias.We evaluated the prevalence and factors associated with participation on stretching programs

  5. Study on Relationships of Yield、Ginning Outturn and Temperature in Different Stages of Cotton%棉花不同阶段温度与产量和衣分的相关性研究

    Institute of Scientific and Technical Information of China (English)

    李春平; 赵萍; 刘忠山; 张大伟; 刘素娟; 徐建辉

    2014-01-01

    The author planted two cotton varieties in the same place from 2006 to 201 2,in order to study on the relationships of monthly mean temperature,the average temperature of ten days,ten days average lowest temperature,the average highest temperature and raw cotton yield,ginned cotton yield and ginning outturn . The results showed that,the raw cotton yield was negative significantly or very significantly correlated with the average highest temperature of mid-June,the average tempera-ture of July,the average temperature of earlier ten days of July and later ten days of July,the average highest temperature of early July and the average highest temperature of mid-July,It was positive significantly or very significantly correlated with the average temperature of late June ,the average lowest temperature of late June,the average highest temperature of late June,the average highest temperature of late July,the average temperature of August,the average lowest temperature of early August,the average temperature of mid-August and the average highest temperature of mid-August . ginned cotton yield was positive significantly or very significantly correlated with the average temperature of late June,the average lowest temperature of late June,the average highest temperature of late June,the average highest temperature of late July,the average highest tem-perature of mid-August and the average highest temperature of mid-August . It was negative significantly or very significantly correlated with the average temperature of early July,the average temperature of late July,the average highest temperature of mid-July . Ginning outturn was positively significantly or very significantly correlated with the average highest temperature of late-July and the average highest temperature of early August . Relationships between temperature and yield,ginning outturn were highly consistent in most of the projects,but the correlations in some projects were significantly different .%2006~2012年

  6. 棉花不同阶段温度与产量和衣分的相关性研究%Study on Relationships of Yield、Ginning Outturn and Temperature in Different Stages of Cotton

    Institute of Scientific and Technical Information of China (English)

    李春平; 赵萍; 刘忠山; 张大伟; 刘素娟; 徐建辉

    2014-01-01

    The author planted two cotton varieties in the same place from 2006 to 201 2,in order to study on the relationships of monthly mean temperature,the average temperature of ten days,ten days average lowest temperature,the average highest temperature and raw cotton yield,ginned cotton yield and ginning outturn . The results showed that,the raw cotton yield was negative significantly or very significantly correlated with the average highest temperature of mid-June,the average tempera-ture of July,the average temperature of earlier ten days of July and later ten days of July,the average highest temperature of early July and the average highest temperature of mid-July,It was positive significantly or very significantly correlated with the average temperature of late June ,the average lowest temperature of late June,the average highest temperature of late June,the average highest temperature of late July,the average temperature of August,the average lowest temperature of early August,the average temperature of mid-August and the average highest temperature of mid-August . ginned cotton yield was positive significantly or very significantly correlated with the average temperature of late June,the average lowest temperature of late June,the average highest temperature of late June,the average highest temperature of late July,the average highest tem-perature of mid-August and the average highest temperature of mid-August . It was negative significantly or very significantly correlated with the average temperature of early July,the average temperature of late July,the average highest temperature of mid-July . Ginning outturn was positively significantly or very significantly correlated with the average highest temperature of late-July and the average highest temperature of early August . Relationships between temperature and yield,ginning outturn were highly consistent in most of the projects,but the correlations in some projects were significantly different .%2006~2012年

  7. Lesões desportivas na ginástica artística: estudo a partir de morbidade referida Sports injuries in artistic gymnastics: a study from referred morbidity

    Directory of Open Access Journals (Sweden)

    Rosangela Akemi Hoshi

    2008-10-01

    Full Text Available INTRODUÇÃO: Os níveis de exigência biomecânica devidos ao alto grau de dificuldade na realização de gestos fazem da ginástica artística (GA uma modalidade com elevado risco de lesões. Assim, é necessário que os aspectos a elas relacionados sejam controlados. OBJETIVO: Analisar a ocorrência de lesões na Ginástica Artística, associando-as a fatores de risco específicos da modalidade e do atleta, a partir de inquérito de morbidade referida. MÉTODOS: Foram entrevistados 54 ginastas, recrutados ao acaso, classificados segundo o nível competitivo em duas categorias: regional e nacional. Utilizou-se o inquérito de morbidade referida (IMR com a finalidade de reunir dados sobre a natureza da lesão, região corporal e aparelho ginástico. Os dados foram organizados e apresentados sob a forma de distribuição de freqüências e as variáveis, analisadas segundo nível de associação a partir do teste de Goodman para contrastes entre populações multinomiais, considerando significante o valor P INTRODUCTION: The levels of biomechanical demands due to the high level of difficulty in the gestures accomplishment make Artistic Gymnastics (AG a modality with high risk of injuries. Thus, it is necessary that the aspects concerned with them are controlled. OBJECTIVE: To analyze the occurrence of injuries in artistic gymnastics, associating them with specific risk factors of the modality and of the athlete from reported morbidity survey. METHODS: 54 gymnasts randomly recruited have been interviewed and classified according to their competitive level into two categories: regional and national. The reported morbidity questionnaire (RMQ was used with the purpose to collect data on the injury's nature, body region and gymnastic apparatus. Data were organized and presented under frequency distribution and analyzed variables. The variables were analyzed according to their level of association from the Goodmann's test for contrasts between

  8. Centro de excelência e ginástica artística feminina: a perspectiva dos técnicos brasileiros Centre of excellence for women artistic gymnastics: the Brazilian coaches' perspective

    Directory of Open Access Journals (Sweden)

    Myrian Nunomura

    2012-06-01

    Full Text Available Durante o período de 2001-2008, a Confederação Brasileira de Ginástica implementou o sistema de seleção permanente concentrada no Centro de Treinamento (CT de Curitiba. Através de um formato semelhante às escolas-internato esportivas da antiga União Soviética, as ginastas passaram a treinar juntas sob o comando de um renomado técnico estrangeiro. Este artigo visa apresentar e discutir o contexto deste CT e o sistema de seleção permanente da ginástica artística feminina (GAF brasileira, a partir da opinião dos técnicos que desenvolvem a modalidade no país. Procedemos a um estudo de campo e entrevistamos 34 treinadores de 29 instituições. Dentre os aspectos positivos da seleção permanente, os sujeitos relacionaram principalmente a infraestrutura disponível às ginastas. Sobre os aspectos negativos, foram citados problemas relacionados ao rigor do treinamento, à polarização e a consequente monopolização das atletas, o que revela que, provavelmente, não houve uma adaptação do modelo soviético às características da GAF desenvolvida no Brasil.During the period of 2001 and 2008, the Brazilian Gymnastics Confederation implemented the gymnasts training boarding center system at the Curitiba Training Center (TC. Using the former Soviet Union model of sports boarding schools, the Brazilian gymnasts started to train together under the supervision of a technical team led by a renowned foreign coach. This article aims to discuss the context of the TC and the system of centralized preparation of the Brazilian women artistic gymnastics (WAG showing the point of view of the coaches. We conducted a field survey and we interviewed 34 coaches of 29 sport institutions. Among the positive aspects, the coaches reported about the better infrastructure available to the gymnasts. The negative aspects refer to the problems regarding rigorous training, the polarization and the consequent monopolization of athletes showing lack of

  9. Distúrbios de atitudes alimentares e distorção da imagem corporal no contexto competitivo da ginástica rítmica Eating disorders and body image distortion in the rhythmic gymnastics competitive context

    Directory of Open Access Journals (Sweden)

    José Luiz Lopes Vieira

    2009-12-01

    Full Text Available OBJETIVO: Investigar a presença e a relação entre comportamentos sugestivos de transtornos de conduta alimentar e distorção da imagem corporal de atletas de ginástica rítmica participantes do contexto esportivo competitivo. MÉTODOS: Participaram do estudo 48 atletas de ginástica rítmica, das categorias: infantil, juvenil e adulta e 48 estudantes do ensino fundamental e médio (controle. Para a identificação da presença de transtornos de conduta alimentar utilizou-se o Teste de Atitudes Alimentares (EAT-26 e, para determinar a insatisfação com a imagem corporal, o Body Shape Questionnaire (BSQ. Para a análise estatística utilizou-se o teste de Kruskal-Wallis (p OBJECTIVE: The aim of this study was to investigate the presence and relationship between eating behavior disorders and body image distortion in rhythmic gymnastics' athletes who participate in a competitive sports context. METHODS: 48 rhythmic gymnastics athletes from the junior and senior categories and 48 elementary and high school students (control group participated in the study. For the identification of eating behavior disorder the Eating Attitude Test (EAT-26 was used and to determine body image dissatisfaction the Body Shape Questionnaire (BSQ. For statistic analysis the Kruskall-Wallis test (p<0.05 and Spearman Correlation were used. RESULTS: there were not statistical differences between the gymnastics group and the students group for eating behavior disorder; a significant correlation was noticed between eating behavior disorder and body image distortion for the athletes from younger junior (10-12 years old and older junior (12-14 years old sport categories. Descriptive analysis revealed that 27.2% (4 gymnastics/10-12 years old; 20.0% (4 gymnasts/13-14 years old presented suggestive behavior of eating disorder. Two gymnasts aged 10-12 years old (10.0%, five gymnasts aged 13-14 years old (15.0% and five 15 years old gymnasts (100% presented body image distortion

  10. Desenvolvimento e avaliação de um descaroçador e prensa enfardadeira itinerantes para o beneficiamento do algodão Development of a mobile gin and baler press for cotton

    Directory of Open Access Journals (Sweden)

    Jeane F. Jerônimo

    2013-03-01

    Full Text Available Novas tecnologias vêm sendo incorporadas ao sistema produtivo da cotonicultura brasileira, visando verticalizar a produção por meio do beneficiamento do algodão em caroço possibilitando, aos produtores ou associações, a agregação de valor à sua produção. Objetivou-se então, com o presente trabalho, desenvolver e avaliar um equipamento de beneficiamento composto de descaroçador e prensa enfardadeira itinerantes. O descaroçador se compõe de: limpador, cilindro de serras, cilindro de escovas, condensador e rolo. A prensa enfardadeira é constituída de chapas de prensagem, cilindros hidráulicos, bomba hidráulica, válvula de controle de acionamento, dispositivos de filtragem do óleo hidráulico e manômetro. Esses equipamentos são montados sobre um reboque composto por chassi de cantoneiras em U, quatro rodas de aro 13, pontas de eixo, dois feixes de cinco molas, lastro em chapa de ferro e sistema de frenagem. Na avaliação e validação do conjunto pelos cotonicultores, este conjunto recebeu o conceito "muito bom" quanto ao rendimento do descaroçador, o peso do fardo e em relação à qualidade da fibra obtida. A qualidade da fibra obtida com o conjunto descaroçador e prensa enfardadeira atendeu aos padrões da indústria têxtil.New technologies have been incorporated into the Brazilian cotton production system, in order to verticalize the production through processing, allowing the producers or associations to add value to their production. Thus, the present study aimed to develop and evaluate processing equipment composed of mobile gin and baler press. The ginner consists of cleaner, saw cylinder, cylinder brushes, condenser and coil. The baler press is constituted of pressing sheets, hydraulic cylinders, hydraulic pump, control valve actuation, devices for filtering hydraulic oil and manometer. These devices are mounted on a trailer chassis composed of U-shaped angle iron chassis, four wheels (rim 13, shaft ends, two

  11. As possibilidades da ginástica na sua relação com o lazer e com a sociedade Possibilities of gymnastics in its relation with leisure and society Las posibilidades de la gimnasia en su relación con el ocio y con la sociedad

    Directory of Open Access Journals (Sweden)

    2006-11-01

    Full Text Available Este trabalho apresenta discussão preliminar, tendo como foco as possibilidades da ginástica como vivência no lazer e sua relação com a sociedade e aborda, também, a forma como a ginástica conquistou o espaço das academias, expandindo-se enquanto produto de consumo. O texto aponta a necessidade de se buscar uma excitação agradável na ginástica, necessária para que ela se torne prazerosa, alegre, localizando nela o componente lúdico. Assim, espera-se facilitar a inserção da ginástica no campo do lazer, embora a ludicidade não seja o seu único componente. PALAVRAS-CHAVE: ginástica – lazer – sociedade This research work presents a preliminary discussion focussing on the possibilites of gymnastics as a leisure experience and its relation to society. It also addresses the way through which gymnastics has gained ground in gyms, expanding as a consumption product. This text points to the need of searching for a pleasant excitemente in gymnastics, which is necessary for it to be pleasing and fun, by locating the playful component in it. As such, this text hopes to aid in the implementation of gymnastics in the field of leisure, although playfulness is not its only component. KEYWORDS: gymnastics – leisure – society Este trabajo presenta discusión preliminar, teniendo como foco las posibilidades de la gimnasia como vivencia en el ocio y su relación con la sociedad y aborda, también, la forma como la gimnasia conquistó el espacio de las academias, expandiéndose como producto de consumo. El texto señala la necesidad de buscar una excitación agradable en la gimnasia, necesaria para que ella se torne placentera, alegre, localizando en ella el componente lúdico. Así, se espera facilitar la inserción de la gimnasia en el campo del ocio, aunque la ludicidad no sea su único componente. PALABRAS-CLAVE: gimnasia – ocio – sociedad

  12. Influência do Código de Pontuação no treino da Ginástica Artística Masculina Influence of code of points in men’s gymnastics training

    Directory of Open Access Journals (Sweden)

    Paulo Carrara

    2011-12-01

    Full Text Available O objetivo deste estudo é verificar a influência das novas regras do Código de Pontuação na sistematização do treino da Ginástica Artística Masculina. Para compreender estas alterações, oito treinadores de seleções nacionais, de Portugal e Brasil, foram entrevistados, sobre como essas regras influenciam o treino. Foi utilizada a análise de conteúdo para avaliar os comentários. Os treinadores esclareceram que as novas regras implicaram em mudanças na estrutura das séries e manifestaram novas tendências na sistematização do treino.The aim of this study is to verify the influence of Code of Points new rules on the systematization of Men’s Artistic Gymnastics training. To understand these alterations, eight coaches of Portugal and Brazil national teams were questioned about how these rules affects the training. For the comments, a content analysis was run. The coaches mentioned that the new rules imply changes in routines composition and noticed new tendencies in training systematization.

  13. Protein Foods

    Science.gov (United States)

    ... Text Size: A A A Listen En Español Protein Foods Foods high in protein such as fish, ... the vegetarian proteins, whether they have carbohydrate. Best Protein Choices The best choices are: Plant-based proteins ...

  14. Protein-protein interactions

    DEFF Research Database (Denmark)

    Byron, Olwyn; Vestergaard, Bente

    2015-01-01

    Responsive formation of protein:protein interaction (PPI) upon diverse stimuli is a fundament of cellular function. As a consequence, PPIs are complex, adaptive entities, and exist in structurally heterogeneous interplays defined by the energetic states of the free and complexed protomers. The...

  15. Desenvolvimento e validação de um novo sistema de seleção de talentos para a ginástica olímpica feminina: a Bateria PDGO Development and validation of a new system for talent selection in female artistic gymnastics: the PDGO Battery

    OpenAIRE

    Patrícia Arruda de Albuquerque; Paulo de Tarso Veras Farinatti

    2007-01-01

    A ginástica olímpica (GO) envolve atividades motoras que exigem capacidades específicas. Todavia, há carência de testes para detectar o potencial para o desempenho na GO em idades precoces. Este estudo descreve e apresenta evidências da validade de uma bateria de testes para a seleção de talentos para GO feminina. Inicialmente, foram levantadas as atividades que vêm sendo aplicadas por especialistas em GO, na literatura e por consulta através de questionários. A partir das 30 atividades menci...

  16. Caracterização dos níveis de pressão sonora em academias de ginástica e queixas apresentadas por seus professores Characterization of sound pressure levels in fitness centers and complaints from instructors

    Directory of Open Access Journals (Sweden)

    Adriana B. M. de Lacerda

    2001-09-01

    Full Text Available Objetivo: Este estudo objetiva identificar as queixas auditivas e orgânicas dos professores de ginástica e avaliar os níveis de pressão sonora (NPS produzidos nas aulas de ginástica com música. A medição dos NPS foi realizada seguindo as condições sugeridas pela Associação Brasileira de Normas Técnicas (ABNT, na Norma 10151. Forma de estudo: Prospectivo clínico randomizado. Material e método: 32 professores de ginástica responderam a um questionário com questões referentes às queixas relacionadas aos NPS. Resultados: As queixas mais freqüentes foram: zumbidos (24%, sensação de ouvido tampado (15% e baixa concentração (15%. As modalidades de ginástica nas quais foi realizada a avaliação dos níveis de pressão sonora foram: Step, Body Pump e Aerofitness. Conclusão: Os resultados desta avaliação revelaram intensidades que variaram de 73,9 a 94,2 dBA e sugerem presença de elevados níveis de pressão sonora em 66% das aulas avaliadas.Aim: The present study aims at identifying auditory and health complaints of fitness instructors in fitness centers in Curitiba, and to evaluate the sound pressure levels (SPL produced in fitness classes. SPL measurements were made following ABNT recommendations (Brazilian Technical Norms and Regulations Association - Norm 10151 and revealed levels that ranged from 73.9 to 94.2 dBA. Study design: Prospective clinical randomized. Material and method: 32 fitness instructors answered a questionnaire about their most frequent complaints related to SPL. Results: The most frequent complaints were: tinnitus (24%; ear fullness (15% and poor concentration (15%. The classes in which sound pressure levels were investigated were: Step, Body Pump and Aerofitness. Conclusion: The results of the present research suggested the presence of high sound pressure levels in 66% of the evaluated classes.

  17. Confiabilidade intra e interexaminadores da fotogrametria na classificação do grau de lipodistrofia ginóide em mulheres assintomáticas Intra and inter-examiner reliability of photogrammetry in the classification of the degree of gynoid lypodystrophy in asymptomatic women

    OpenAIRE

    Ana Maria da Silva Mendonça; Michelle de Pádua; Ana Paula Ribeiro; Giovana Barbosa Milani; Sílvia Maria Amado João

    2009-01-01

    A lipodistrofia ginóide (celulite) é uma afecção dermatológica comum entre as mulheres. Uma de suas formas de avaliação é a inspeção visual por meio da fotogrametria. Entretanto, não foram encontrados estudos que verifiquem a repetibilidade e reprodutibilidade dessa avaliação. O objetivo deste estudo foi verificar a confiabilidade intra e interexaminadores da avaliação da celulite por meio da fotogrametria. Foram fotografadas e avaliadas as regiões glúteas de 50 mulheres (26,14±4,45 anos). A ...

  18. : Protein flexibility

    OpenAIRE

    Bornot, Aurélie; Offmann, Bernard; De Brevern, Alexandre

    2007-01-01

    Protein structures and protein structural models are great tools to reach protein function and provide very relevant information for drug design. Nevertheless, protein structures are not rigid entities. Cutting-edge bioinformatics methods tend to take into account the flexibility of these macromolecules. We present new approaches used to define protein structure flexibility.

  19. Total protein

    Science.gov (United States)

    The total protein test measures the total amount of two classes of proteins found in the fluid portion of your ... nutritional problems, kidney disease or liver disease . If total protein is abnormal, you will need to have more ...

  20. Prevalência do uso e conhecimento de esteroides anabolizantes androgênicos por estudantes e professores de educação física que atuam em academias de ginástica

    Directory of Open Access Journals (Sweden)

    Odilon Salim Costa Abrahin

    2013-02-01

    Full Text Available INTRODUÇÃO: Os esteroides anabólicos androgênicos (EAA são substâncias, quimicamente semelhantes à testosterona, utilizadas para o tratamento/controle de diversas doenças. Contudo, tais substâncias estão sendo empregadas de forma não terapêutica e indiscriminada com finalidades de melhora da performance esportiva e principalmente estética. OBJETIVO: analisar a prevalência do uso e o conhecimento de EAA por estudantes e professores de educação física que atuam em academias de ginástica de Belém, PA. Utilizou-se para a coleta de dados um questionário fechado e anônimo, aplicado a 117 pesquisados. A comparação da prevalência do uso e o grau de conhecimento dos pesquisados sobre EAA foi realizada através de estatística não paramétrica, prova de X² (Qui-quadrado, considerando o intervalo de confiança de 95% e p < 0,05. A média de idade dos participantes da pesquisa foi de 28,0 ± 6,3 anos e a prevalência do uso de EAA foi de 31,6% do total de sujeitos pesquisados. A prevalência maior foi entre os profissionais especialistas (39,3%, tendo como principal motivação para o uso de EAA a estética com 75,6%. Em relação ao conhecimento, verificou-se que as drogas classificadas como EAA foram: Durateston®, Deca-Durabolin®, oxandrolona/Winstrol®. Entretanto, estes profissionais confundiram-se ao apontar outras substâncias como sendo EAA, entre elas: hormônio do crescimento e óleos localizados. Entre os efeitos colaterais, os mais citados foram: acne, engrossamento da voz e agressividade; contudo, efeitos colaterais mais prejudiciais como câncer e aromatização foram menos assinalados. RESULTADOS: Demonstraram que a prevalência de uso de EAA foi significativa (p < 0,03 entre os estudantes e professores de educação física que atuam em academias de Belém, PA, revelando assim prováveis desconhecimentos destes sobre alguns dos efeitos colaterais, podendo implicar no uso indiscriminado destas drogas.

  1. Uma análise exploratória do processo de orçamento de capital em empresas algodoeiras A qualitative analysis of the capital budgeting process in cotton ginning companies

    Directory of Open Access Journals (Sweden)

    Afonso Carneiro Lima

    2013-06-01

    targeted towards attempting to ensure satisfactory operating results in the short term. Hence, most of the gins investigated seem to be more susceptible to the uncertainties of the environment in which they operate since there is a limited consideration of the possibilities that investments might bring to them, as well as an inherent risk management approach; behavioral aspects such latency were verified in investment decisions performed by the managers interviewed.

  2. Interfacial Protein-Protein Associations

    OpenAIRE

    Langdon, Blake B.; Kastantin, Mark; Walder, Robert; Schwartz, Daniel K.

    2013-01-01

    While traditional models of protein adsorption focus primarily on direct protein-surface interactions, recent findings suggest that protein-protein interactions may play a central role. Using high-throughput intermolecular resonance energy transfer (RET) tracking, we directly observed dynamic, protein-protein associations of bovine serum albumin on poly(ethylene glycol) modified surfaces. The associations were heterogeneous and reversible, and associating molecules resided on the surface for ...

  3. Yeast Interacting Proteins Database: YML034W, YDR489W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available Psf3p), which is localized to DNA replication origins and implicated in assembly of the DNA replication mac...it of the GINS complex (Sld5p, Psf1p, Psf2p, Psf3p), which is localized to DNA replication origins and impli

  4. STATISTICAL PROPERTIES OF LONG-RANGE CONTACTS IN GLOBULAR PROTEINS

    Institute of Scientific and Technical Information of China (English)

    Xiang-hong Wang; Jian-hong Ke; Mang-xiao Hu

    2004-01-01

    The analysis of residue-residue contacts in protein structures can shed some light on our understanding of the folding and stability of proteins. In this paper, we study the statistical properties of long-range and short-range residueresidue contacts of 91 globular proteins using CSU software and analyze the importance of long-range contacts in globular protein structure. There are many short-range and long-range contacts in globular proteins, and it is found that the average number of long-range contacts per residue is 5.63 and the percentage of residue-residue contacts which are involved in longrange ones is 59.4%. In more detail, the distribution of long-range contacts in different residue intervals is investigated and it is found that the residues occurring in the interval range of 4-10 residues apart in the sequence contribute more long-range contacts to the stability of globular protein. The number of long-range contacts per residue, which is a measure of ability to form residue-residue contacts, is also calculated for 20 different amino acid residues. It is shown that hydrophobic residues (including Leu, Val, Ile, Met, Phc, Tyr, Cys and Trp) having a large number of long-range contacts easily form long-range contacts, while the hydrophilic amino acids (including Ala, Gly, Thr, His, Glu, Gin, Asp, Asn, Lys, Ser, Arg, and Pro) form long-range contacts with more difficulty. The relationship between the Fauchere-Pliska hydrophobicity scale (FPH) and the number of short-range and long-range contacts per residue for 20 amino acid residues is also studied. An approximately linear relationship between the Fauchere-Pliska hydrophobicity scale (FPH) and the number of long-range contacts per residue CL is found and can be expressed as CiL= a + b x FPHwhere a = 5.04 and b = 1.23. These results can help us to understand the role of residue-residue contacts in globular protein structure.

  5. Total protein

    Science.gov (United States)

    ... page: //medlineplus.gov/ency/article/003483.htm Total protein To use the sharing features on this page, please enable JavaScript. The total protein test measures the total amount of two classes ...

  6. Caracterização morfológica e funcional das ginastas de artística feminina com idades compreendidas entre os cinco e os doze anos de idade: Estudo realizado com ginastas de alta competição da Associação de Ginástica do Norte

    OpenAIRE

    Machado, Sandra Cristina de Oliveira

    2005-01-01

    Ginástica é o desporto olímpico caracterizado pela prática sistemática de um conjunto de exercícios físicos em aparelhos como, mesa de saltos, paralelas assimétricas, trave olímpica e solo. Os movimentos dos ginastas são extremamente elegantes e demonstram força, agilidade, flexibilidade, coordenação, equilíbrio e controlo do corpo. Os objectivos do nosso estudo são quantificar as variações anuais num grupo de ginastas de competição, e determinar a estabilidade inter-etária de alguns traço...

  7. Análise comparativa do equilíbrio unipodal de atletas de ginástica rítmica Comparative analysis of one-foot balance in rhythmic gymnastics athletes

    Directory of Open Access Journals (Sweden)

    Leonardo Shigaki

    2013-04-01

    Full Text Available INTRODUÇÃO: A ginástica rítmica (GR requer alto nível de qualidade física; assim, o bom desempenho é dependente da força e resistência muscular, coordenação motora e equilíbrio postural. OBJETIVO: Desenvolver uma análise comparativa do equilíbrio unipodal de atletas de GR. MÉTODOS: Foram avaliadas dez atletas de GR, do sexo feminino, por meio de uma plataforma de força em apoio unipodal e testes funcionais de equilíbrio (Side Hop Test e Figure of Eight Hop Teste. Para a plataforma, os parâmetros do Centro de Pressão (COP nas direções anteroposterior e mediolateral foram utilizados para análise, enquanto para os testes funcionais, o tempo-segundos de performance. RESULTADOS: Diferença significativa (p = 0,01 foi encontrada entre os membros inferiores no parâmetro de frequência média na direção mediolateral, no qual o membro inferior não dominante apresentou maior estabilidade postural do que o dominante. Para os testes funcionais não houve diferença significativa entre os membros. CONCLUSÃO: A diferença encontrada no controle do equilíbrio na direção mediolateral pode estar relacionada às diferenças nas ações musculares da região do quadril, na qual durante a prática do esporte para estabilização, manutenção do tronco e execução de manobras com os membros inferiores estão presentes. Estes resultados indicam a necessidade de um programa de reequilíbrio e estabilização pélvica para as atletas analisadas no intuito de preservar a simetria muscular dos membros para o bom desempenho esportivo.INTRODUCTION: Rhythmic gymnastics requires a high level of physical quality; therefore, good performance depends on muscular strength and endurance, motor coordination and postural balance. OBJECTIVE: To develop a comparative analysis of postural balance in rhythmic gymnasts. METHODS: 10 female rhythmic gymnasts were evaluated by a force platform on one foot and balance functional tests (Side Hop Test and

  8. Protein Structure

    Science.gov (United States)

    Asmus, Elaine Garbarino

    2007-01-01

    Individual students model specific amino acids and then, through dehydration synthesis, a class of students models a protein. The students clearly learn amino acid structure, primary, secondary, tertiary, and quaternary structure in proteins and the nature of the bonds maintaining a protein's shape. This activity is fun, concrete, inexpensive and…

  9. Ginástica como atividade motivacional

    Directory of Open Access Journals (Sweden)

    Jaqueline Batista de Oliveira Costa

    2009-12-01

    Full Text Available This study analyzed whether the activities of occupational gymnastic promote the satisfaction of the worker, generate motivational stimuli for carrying out their tasks, induce sentiments of welfare and good interpersonal relationships at work and within the family. The group sharing this research was composed of a population of 24 women and 20 men aged 20 to 51 years, who practice occupational gymnastics on the premises of a factory in the city of Presidente Prudente, five times a week, from Mondays to Fridays, during the morning and afternoon. The instrument of data collection was a questionnaire containing nine questions that aimed to identify the level of satisfaction, motivation and welfare of workers in the context of work and family. The inquiry proved that the occupational gymnastics is capable to improve the satisfaction of the worker with his task, since it causes happier and reduce body pains. The subjects declared that the practice of occupational gymnastics raises the will to share the domestic tasks, improve the disposition to the family leisure and causes a substantial change in the mood. The study showed, ultimately, that the workers became more eager with their bodies and with their personal health conditions.

  10. USING CYCLONES EFFECTIVELY AT COTTON GINS

    Science.gov (United States)

    Cyclones are the most common type of emissions control device used in agricultural processing operations. Cyclones are efficient, reliable, low-cost, and require little maintenance. When used properly, cyclones effectively separate particulate matter from air streams, allowing compliance with state ...

  11. Gin pole in / Jaanika Käst

    Index Scriptorium Estoniae

    Käst, Jaanika

    2008-01-01

    Projektist, mille eesmärgiks sai alaealiste kuritegelikule teele sattumise ennetamine, teadvustades alkoholi, tubakat, narkootikume ja kooli eiramist kui enesehävituslikku riski ning ohtu sattuda kuritegelikule teele

  12. Tau protein

    DEFF Research Database (Denmark)

    Frederiksen, Jette Lautrup Battistini; Kristensen, Kim; Bahl, Jmc;

    2011-01-01

    Background: Tau protein has been proposed as biomarker of axonal damage leading to irreversible neurological impairment in MS. CSF concentrations may be useful when determining risk of progression from ON to MS. Objective: To investigate the association between tau protein concentration and 14...... the Department of Neurology of Glostrup Hospital, University of Copenhagen, Denmark, were included. CSF samples were analysed for tau protein and 14-3-3 protein, and clinical and paraclinical information was obtained from medical records. Results: The study shows a significantly increased...... concentration of tau protein in CSF from patients with relapsing-remitting MS and patients monosymptomatic at onset who progressed to MS, but interestingly no increased tau protein concentration in monosymptomatic ON. The concentration of tau protein was significantly correlated to Expanded Disability Status...

  13. Protein politics

    OpenAIRE

    Vijver, Marike

    2005-01-01

    This study is part of the program of the interdisciplinary research group Profetas (protein foods, environment, technology and society). Profetas consists of technological, environmental and socio-economic research projects on protein food systems which result in the development of scenarios and strategies for guiding a shift towards a more plant protein based diet. The different research projects focus on the goal of identifying viable options for a more sustainable food system. Profetas aro...

  14. Principles of protein-protein interactions.

    OpenAIRE

    Jones, S; Thornton, J. M.

    1996-01-01

    This review examines protein complexes in the Brookhaven Protein Databank to gain a better understanding of the principles governing the interactions involved in protein-protein recognition. The factors that influence the formation of protein-protein complexes are explored in four different types of protein-protein complexes--homodimeric proteins, heterodimeric proteins, enzyme-inhibitor complexes, and antibody-protein complexes. The comparison between the complexes highlights differences tha...

  15. Reproductive biology in monoecious and gynoecious cucumber cultivars as a result of IBA application Biologia reprodutiva de cultivares monóicas e ginóicas de pepino em função do uso de AIB

    Directory of Open Access Journals (Sweden)

    Valdir Diola

    2008-03-01

    concentration.A compreensão da biologia reprodutiva e da regulação da expressão sexual das flores do pepineiro (Cucumis sativus pode facilitar o manejo do cultivo e melhorar a produção e a qualidade dos frutos. O objetivo do presente estudo foi avaliar a resposta fisiológica dos verticilos florais à aplicação de AIB em pepino. O experimento foi conduzido em casa-de-vegetação, em blocos casualizados, com os tratamentos dispostos em fatorial 5 x 2 (AIB nas concentrações de 0, 50, 100, 200 e 500 ìmol, para as cultivares Wisconsin MR28, ginóica, e Caipira, monóica. Foram utilizadas quatro repetições, com quatro plantas por parcela. A cultivar Wisconsin MR28 produziu em média 7.636 grãos de pólen (GP por flor, com resposta linear positiva ao aumento nas concentrações de AIB. Já na cultivar Caipira (5.160 GP, todas as concentrações de AIB interferiram negativamente na produção de GP. As cultivares não diferiram entre si e em ambas houve efeito linear positivo da concentração de AIB sobre a viabilidade dos GP (germinação média in vitro de 75,4 e 79,9% para as cultivares Wisconsin MR28 e Caipira, respectivamente. As cultivares Wisconsin MR28 e Caipira apresentaram em média 71,6 e 70,6 sementes por fruto respectivamente, respondendo com aumento no número de sementes e melhoria do aspecto do fruto ao incremento da concentração de AIB. A relação de flores masculinas:femininas diferiu significativamente entre cultivares (4,2:1 e 3,5:1 respectivamente para as cultivares Wisconsin MR28 e Caipira e foi afetada de forma distinta nas duas cultivares pelas concentrações de AIB: concentrações próximas de 100 µmol aumentaram o número de flores masculinas na cultivar Caipira e reduziram na cultivar Wisconsin MR28. A quantidade de flores femininas foi semelhante entre as cultivares e relativamente constante na cultivar Caipira nas diferentes concentrações de AIB. Já na cultivar Wisconsin MR 28, houve aumento do número de flores femininas em fun

  16. Protein-Protein Interaction Databases

    DEFF Research Database (Denmark)

    Szklarczyk, Damian; Jensen, Lars Juhl

    2015-01-01

    of research are explored. Here we present an overview of the most widely used protein-protein interaction databases and the methods they employ to gather, combine, and predict interactions. We also point out the trade-off between comprehensiveness and accuracy and the main pitfall scientists have to be aware...

  17. Whey Protein

    Science.gov (United States)

    ... quality of life in people with mitochondrial diseases. Ovarian cysts (Polycystic ovarian syndrome). Early research suggests that taking ... weight, fat mass, and cholesterol in people with ovarian cysts. However, whey protein does not improve blood sugar ...

  18. Ginástica rítmica – análise dos fatores competitivos motivadores e estressantes da Seleção Brasileira Juvenil =Rhythmical gymnastics – analysis of competitive, motivating and stress factors of the teenager Brazilian National Football Team

    Directory of Open Access Journals (Sweden)

    Lenamar Fiorese Vieira

    2005-07-01

    Full Text Available Este estudo objetivou investigar a trajetória de desenvolvimento das atletas de ginástica rítmica da Seleção Brasileira Juvenil, com foco na identificação dos fatores competitivos (motivadores e estressantes que ocorrem em diferentes fases da carreira esportiva. A população alvo foi de dez atletas. Como instrumentos de medida foramutilizados o Teste de Carga Psíquica de Frester e entrevista semi-estruturada. Para análise utilizou-se estatística descritiva e a análise de conteúdo do tipo categorial. Os resultados demonstraram que na ginástica rítmica o processo de especialização motora das atletas inicia aos 12 anos; os fatores motivadores evidenciados foram o gosto pelo esporte e ser o favorito; os fatores estressantes foram ser prejudicado pelos juizes e falta de tempo para divertimento.Concluindo em uma análise geral, as atletas perceberam o contexto esportivo competitivo como mais estressante do que motivador; esta afirmação acentuou-se a partir da fase de prática motora em que o estresse competitivo para o rendimento se intensificou.This study aimed to investigate the developmental trajectory of the Brazilian Rhythmic Gymnastics Youth Team, focusing on the identification of competitive factors (motivator and stressful thatoccurs in different sport’s career phases. The sample was composed ten athletes. As measure instruments were used the Frester’s Test Psychic Load and a semi-structured interview. The data were analyzed through the descriptive statistics and categorical type of content’s analysis. The results demonstrated that in the rhythmic gymnastics the process of the athletes’ motor specialization begins at 12 years; the motivator factors evidenced were fun for sport and being the favorite; the stressful factors were being harmed by the judges and not time for fun. Concluding in a general analysis the athletes perceived the competitive sporting context as more stressful than motivator; this affirmation

  19. Yeast Interacting Proteins Database: YJL072C, YDR489W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available alized to DNA replication origins and implicated in assembly of the DNA replication machinery Rows with this...f2p, Psf3p), which is localized to DNA replication origins and implicated in asse...the GINS complex (Sld5p, Psf1p, Psf2p, Psf3p), which is localized to DNA replication origins...sf3p), which is localized to DNA replication origins and implicated in assembly of the DNA replication machi

  20. Yeast Interacting Proteins Database: YDR013W, YDR489W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available alized to DNA replication origins and implicated in assembly of the DNA replication machinery Rows with this...f2p, Psf3p), which is localized to DNA replication origins and implicated in asse... the GINS complex (Sld5p, Psf1p, Psf2p, Psf3p), which is localized to DNA replication origins...Psf3p), which is localized to DNA replication origins and implicated in assembly of the DNA replication mach

  1. Protein Crystallization

    Science.gov (United States)

    Chernov, Alexander A.

    2005-01-01

    Nucleation, growth and perfection of protein crystals will be overviewed along with crystal mechanical properties. The knowledge is based on experiments using optical and force crystals behave similar to inorganic crystals, though with a difference in orders of magnitude in growing parameters. For example, the low incorporation rate of large biomolecules requires up to 100 times larger supersaturation to grow protein, rather than inorganic crystals. Nucleation is often poorly reproducible, partly because of turbulence accompanying the mixing of precipitant with protein solution. Light scattering reveals fluctuations of molecular cluster size, its growth, surface energies and increased clustering as protein ages. Growth most often occurs layer-by-layer resulting in faceted crystals. New molecular layer on crystal face is terminated by a step where molecular incorporation occurs. Quantitative data on the incorporation rate will be discussed. Rounded crystals with molecularly disordered interfaces will be explained. Defects in crystals compromise the x-ray diffraction resolution crucially needed to find the 3D atomic structure of biomolecules. The defects are immobile so that birth defects stay forever. All lattice defects known for inorganics are revealed in protein crystals. Contribution of molecular conformations to lattice disorder is important, but not studied. This contribution may be enhanced by stress field from other defects. Homologous impurities (e.g., dimers, acetylated molecules) are trapped more willingly by a growing crystal than foreign protein impurities. The trapped impurities induce internal stress eliminated in crystals exceeding a critical size (part of mni for ferritin, lysozyme). Lesser impurities are trapped from stagnant, as compared to the flowing, solution. Freezing may induce much more defects unless quickly amorphysizing intracrystalline water.

  2. Arabinogalactan proteins

    DEFF Research Database (Denmark)

    Knoch, Eva; Dilokpimol, Adiphol; Geshi, Naomi

    2014-01-01

    Arabinogalactan proteins (AGPs) are a highly diverse class of cell surface proteoglycans that are commonly found in most plant species. AGPs play important roles in many cellular processes during plant development, such as reproduction, cell proliferation, pattern formation and growth, and in plant...

  3. Prediction of Protein-Protein Interactions Related to Protein Complexes Based on Protein Interaction Networks

    OpenAIRE

    Peng Liu; Lei Yang; Daming Shi; Xianglong Tang

    2015-01-01

    A method for predicting protein-protein interactions based on detected protein complexes is proposed to repair deficient interactions derived from high-throughput biological experiments. Protein complexes are pruned and decomposed into small parts based on the adaptive k-cores method to predict protein-protein interactions associated with the complexes. The proposed method is adaptive to protein complexes with different structure, number, and size of nodes in a protein-protein interaction net...

  4. Grafting of protein-protein binding sites

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    A strategy for grafting protein-protein binding sites is described. Firstly, key interaction residues at the interface of ligand protein to be grafted are identified and suitable positions in scaffold protein for grafting these key residues are sought. Secondly, the scaffold proteins are superposed onto the ligand protein based on the corresponding Ca and Cb atoms. The complementarity between the scaffold protein and the receptor protein is evaluated and only matches with high score are accepted. The relative position between scaffold and receptor proteins is adjusted so that the interface has a reasonable packing density. Then the scaffold protein is mutated to corresponding residues in ligand protein at each candidate position. And the residues having bad steric contacts with the receptor proteins, or buried charged residues not involved in the formation of any salt bridge are mutated. Finally, the mutated scaffold protein in complex with receptor protein is co-minimized by Charmm. In addition, we deduce a scoring function to evaluate the affinity between mutated scaffold protein and receptor protein by statistical analysis of rigid binding data sets.

  5. Detecting overlapping protein complexes in protein-protein interaction networks

    OpenAIRE

    Nepusz, Tamás; Yu, Haiyuan; Paccanaro, Alberto

    2012-01-01

    We introduce clustering with overlapping neighborhood expansion (ClusterONE), a method for detecting potentially overlapping protein complexes from protein-protein interaction data. ClusterONE-derived complexes for several yeast data sets showed better correspondence with reference complexes in the Munich Information Center for Protein Sequence (MIPS) catalog and complexes derived from the Saccharomyces Genome Database (SGD) than the results of seven popular methods. The results also showed a...

  6. EDITORIAL: Precision proteins Precision proteins

    Science.gov (United States)

    Demming, Anna

    2010-06-01

    Since the birth of modern day medicine, during the times of Hippocrates in ancient Greece, the profession has developed from the rudimentary classification of disease into a rigorous science with an inspiring capability to treat and cure. Scientific methodology has distilled clinical diagnostic tools from the early arts of prognosis, which used to rely as much on revelation and prophecy, as intuition and judgement [1]. Over the past decade, research into the interactions between proteins and nanosystems has provided some ingenious and apt techniques for delving into the intricacies of anatomical systems. In vivo biosensing has emerged as a vibrant field of research, as much of medical diagnosis relies on the detection of substances or an imbalance in the chemicals in the body. The inherent properties of nanoscale structures, such as cantilevers, make them well suited to biosensing applications that demand the detection of molecules at very low concentrations. Measurable deflections in cantilevers functionalised with antibodies provide quantitative indicators of the presence of specific antigens when the two react. Such developments have roused mounting interest in the interactions of proteins with nanostructures, such as carbon nanotubes [3], which have demonstrated great potential as generic biomarkers. Plasmonic properties are also being exploited in sensing applications, such as the molecular sentinel recently devised by researchers in the US. The device uses the plasmonic properties of a silver nanoparticle linked to a Raman labelled hairpin DNA probe to signal changes in the probe geometry resulting from interactions with substances in the environment. Success stories so far include the detection of two specific genes associated with breast cancer [4]. A greater understanding of how RNA interference regulates gene expression has highlighted the potential of using this natural process as another agent for combating disease in personalized medicine. However, the

  7. Protein Crystal Based Nanomaterials

    Science.gov (United States)

    Bell, Jeffrey A.; VanRoey, Patrick

    2001-01-01

    This is the final report on a NASA Grant. It concerns a description of work done, which includes: (1) Protein crystals cross-linked to form fibers; (2) Engineering of protein to favor crystallization; (3) Better knowledge-based potentials for protein-protein contacts; (4) Simulation of protein crystallization.

  8. Shotgun protein sequencing.

    Energy Technology Data Exchange (ETDEWEB)

    Faulon, Jean-Loup Michel; Heffelfinger, Grant S.

    2009-06-01

    A novel experimental and computational technique based on multiple enzymatic digestion of a protein or protein mixture that reconstructs protein sequences from sequences of overlapping peptides is described in this SAND report. This approach, analogous to shotgun sequencing of DNA, is to be used to sequence alternative spliced proteins, to identify post-translational modifications, and to sequence genetically engineered proteins.

  9. Protein-protein complexation in bioluminescence

    OpenAIRE

    Titushin, Maxim S.; Feng, Yingang; Lee, John; Vysotski, Eugene S.; Liu, Zhi-jie

    2011-01-01

    In this review we summarize the progress made towards understanding the role of protein-protein interactions in the function of various bioluminescence systems of marine organisms, including bacteria, jellyfish and soft corals, with particular focus on methodology used to detect and characterize these interactions. In some bioluminescence systems, protein-protein interactions involve an “accessory protein” whereby a stored substrate is efficiently delivered to the bioluminescent enzyme lucife...

  10. Protein folding, protein homeostasis, and cancer

    Institute of Scientific and Technical Information of China (English)

    John H. Van Drie

    2011-01-01

    Proteins fold into their functional 3-dimensional structures from a linear amino acid sequence. In vitro this process is spontaneous; while in vivo it is orchestrated by a specialized set of proteins, called chaperones. Protein folding is an ongoing cellular process, as cellular proteins constantly undergo synthesis and degradation. Here emerging links between this process and cancer are reviewed. This perspective both yields insights into the current struggle to develop novel cancer chemotherapeutics and has implications for future chemotherapy discovery.

  11. Protein-Protein Interaction Analysis by Docking

    OpenAIRE

    Stephan Ederer; Florian Fink; Wolfram Gronwald

    2009-01-01

    Based on a protein-protein docking approach we have developed a procedure to verify or falsify protein-protein interactions that were proposed by other methods such as yeast-2-hybrid assays. Our method currently utilizes intermolecular energies but can be expanded to incorporate additional terms such as amino acid based pair-potentials. We show some early results that demonstrate the general applicability of our approach.

  12. Protein-losing enteropathy

    Science.gov (United States)

    ... this page: //medlineplus.gov/ency/article/007338.htm Protein-losing enteropathy To use the sharing features on this page, please enable JavaScript. Protein-losing enteropathy is an abnormal loss of protein ...

  13. Protein and Heart Health

    Science.gov (United States)

    ... Recognition & Awards Healthy Workplace Food and Beverage Toolkit Protein and Heart Health Updated:May 5,2015 Protein ... said. What’s the harm in getting too much protein? The main problem is that often the extra ...

  14. SPIDer: Saccharomyces protein-protein interaction database

    Directory of Open Access Journals (Sweden)

    Li Zhenbo

    2006-12-01

    Full Text Available Abstract Background Since proteins perform their functions by interacting with one another and with other biomolecules, reconstructing a map of the protein-protein interactions of a cell, experimentally or computationally, is an important first step toward understanding cellular function and machinery of a proteome. Solely derived from the Gene Ontology (GO, we have defined an effective method of reconstructing a yeast protein interaction network by measuring relative specificity similarity (RSS between two GO terms. Description Based on the RSS method, here, we introduce a predicted Saccharomyces protein-protein interaction database called SPIDer. It houses a gold standard positive dataset (GSP with high confidence level that covered 79.2% of the high-quality interaction dataset. Our predicted protein-protein interaction network reconstructed from the GSPs consists of 92 257 interactions among 3600 proteins, and forms 23 connected components. It also provides general links to connect predicted protein-protein interactions with three other databases, DIP, BIND and MIPS. An Internet-based interface provides users with fast and convenient access to protein-protein interactions based on various search features (searching by protein information, GO term information or sequence similarity. In addition, the RSS value of two GO terms in the same ontology, and the inter-member interactions in a list of proteins of interest or in a protein complex could be retrieved. Furthermore, the database presents a user-friendly graphical interface which is created dynamically for visualizing an interaction sub-network. The database is accessible at http://cmb.bnu.edu.cn/SPIDer/index.html. Conclusion SPIDer is a public database server for protein-protein interactions based on the yeast genome. It provides a variety of search options and graphical visualization of an interaction network. In particular, it will be very useful for the study of inter-member interactions

  15. PIC: Protein Interactions Calculator

    OpenAIRE

    Tina, KG; Bhadra, R.; Srinivasan, N.

    2007-01-01

    Interactions within a protein structure and interactions between proteins in an assembly are essential considerations in understanding molecular basis of stability and functions of proteins and their complexes. There are several weak and strong interactions that render stability to a protein structure or an assembly. Protein Interactions Calculator (PIC) is a server which, given the coordinate set of 3D structure of a protein or an assembly, computes various interactions such as disulphide bo...

  16. Estado emocional de alunos da primeira série de um Grupo Escolar - Ginásio da cidade de São Paulo, Brasil: problemática de saúde pública? Emotional disturbances of 1st grade school children: a Public Health Problem?

    Directory of Open Access Journals (Sweden)

    Helena Savastano

    1977-12-01

    Full Text Available Estudou-se uma amostra representativa de alunos da 1.ª série de um Grupo Escolar-Ginásio da rede estadual da cidade de São Paulo, com o objetivo de compreender a dinâmica emocional dessas crianças. Os alunos foram estratificados em fracos e não fracos quanto à aprendizagem e disciplinamento. Utilizou-se o teste de apercepção temática de Bellak e Bellak e os resultados demonstraram, que 43% das crianças não estão emocionalmente ajustadas para enfrentar o ambiente escolar, onde a figura do adulto (professor é visualizada como agressiva e os castigos são vistos, pelas crianças, como ameaçadores; os alunos fracos revelaram maior atraso no desenvolvimento psicossocial em relação aos não fracos. Estes dados, possivelmente, esclarecem parte das dificuldades de adaptação dessas crianças �� situação escolar e sugerem: 1º maior atenção dos técnicos de educação, de saúde e áreas correlatas, para esses problemas; 2º maiores conhecimentos pelos educadores, dos aspectos do desenvolvimento psicossocial da criança.Psychological and epidemiological aspects of emotional dynamics of children enroled in the first grade of a state school of the city of São Paulo, Brazil, were studied based on results of Children's Tematic Test (CAT, of Bellak and Bellak. The mentioned test showed that the group is made up of emotionally immature children, lacking affection, especially those considered of low learning capacity. The figure of the adult, as seen by the students, is inadequate, punitive, indiferent and agressive. The results suggest that teachers should have a greater understanding reference to such problems and should give attention to these students, thus leading to the conclusion that first grade classes should not have so many students. The results also suggest that parents should have more knowledge and understanding as regards child development from conception, as well as better family struture as to more adequate

  17. Ginástica rítmica: análise dos fatores competitivos motivadores e estressantes da Seleção Brasileira Juvenil - DOI: 10.4025/actascihealthsci.v27i2.1419 Rhythmical gymnastics: analysis of competitive, motivating and stress factors of the teenager Brazilian National Football Team - DOI: 10.4025/actascihealthsci.v27i2.1419

    Directory of Open Access Journals (Sweden)

    Marise Botti

    2005-03-01

    Full Text Available Este estudo objetivou investigar a trajetória de desenvolvimento das atletas de ginástica rítmica da Seleção Brasileira Juvenil, com foco na identificação dos fatores competitivos (motivadores e estressantes que ocorrem em diferentes fases da carreira esportiva. A população alvo foi de dez atletas. Como instrumentos de medida foram utilizados o Teste de Carga Psíquica de Frester e entrevista semi-estruturada. Para análise utilizou-se estatística descritiva e a análise de conteúdo do tipo categorial. Os resultados demonstraram que na ginástica rítmica o processo de especialização motora das atletas inicia aos 12 anos; os fatores motivadores evidenciados foram o gosto pelo esporte e ser o favorito; os fatores estressantes foram ser prejudicado pelos juizes e falta de tempo para divertimento. Concluindo em uma análise geral, as atletas perceberam o contexto esportivo competitivo como mais estressante do que motivador; esta afirmação acentuou-se a partir da fase de prática motora em que o estresse competitivo para o rendimento se intensificouThis study aimed to investigate the developmental trajectory of the Brazilian Rhythmic Gymnastics Youth Team, focusing on the identification of competitive factors (motivator and stressful that occurs in different sport’s career phases. The sample was composed ten athletes. As measure instruments were used the Frester’s Test Psychic Load and a semi-structured interview. The data were analyzed through the descriptive statistics and categorical type of content’s analysis. The results demonstrated that in the rhythmic gymnastics the process of the athletes’ motor specialization begins at 12 years; the motivator factors evidenced were fun for sport and being the favorite; the stressful factors were being harmed by the judges and not time for fun. Concluding in a general analysis the athletes perceived the competitive sporting context as more stressful than motivator; this affirmation

  18. Drugging Membrane Protein Interactions.

    Science.gov (United States)

    Yin, Hang; Flynn, Aaron D

    2016-07-11

    The majority of therapeutics target membrane proteins, accessible on the surface of cells, to alter cellular signaling. Cells use membrane proteins to transduce signals into cells, transport ions and molecules, bind cells to a surface or substrate, and catalyze reactions. Newly devised technologies allow us to drug conventionally "undruggable" regions of membrane proteins, enabling modulation of protein-protein, protein-lipid, and protein-nucleic acid interactions. In this review, we survey the state of the art of high-throughput screening and rational design in drug discovery, and we evaluate the advances in biological understanding and technological capacity that will drive pharmacotherapy forward against unorthodox membrane protein targets. PMID:26863923

  19. PREFACE: Protein protein interactions: principles and predictions

    Science.gov (United States)

    Nussinov, Ruth; Tsai, Chung-Jung

    2005-06-01

    Proteins are the `workhorses' of the cell. Their roles span functions as diverse as being molecular machines and signalling. They carry out catalytic reactions, transport, form viral capsids, traverse membranes and form regulated channels, transmit information from DNA to RNA, making possible the synthesis of new proteins, and they are responsible for the degradation of unnecessary proteins and nucleic acids. They are the vehicles of the immune response and are responsible for viral entry into the cell. Given their importance, considerable effort has been centered on the prediction of protein function. A prime way to do this is through identification of binding partners. If the function of at least one of the components with which the protein interacts is known, that should let us assign its function(s) and the pathway(s) in which it plays a role. This holds since the vast majority of their chores in the living cell involve protein-protein interactions. Hence, through the intricate network of these interactions we can map cellular pathways, their interconnectivities and their dynamic regulation. Their identification is at the heart of functional genomics; their prediction is crucial for drug discovery. Knowledge of the pathway, its topology, length, and dynamics may provide useful information for forecasting side effects. The goal of predicting protein-protein interactions is daunting. Some associations are obligatory, others are continuously forming and dissociating. In principle, from the physical standpoint, any two proteins can interact, but under what conditions and at which strength? The principles of protein-protein interactions are general: the non-covalent interactions of two proteins are largely the outcome of the hydrophobic effect, which drives the interactions. In addition, hydrogen bonds and electrostatic interactions play important roles. Thus, many of the interactions observed in vitro are the outcome of experimental overexpression. Protein disorder

  20. Protein sequence comparison and protein evolution

    Energy Technology Data Exchange (ETDEWEB)

    Pearson, W.R. [Univ. of Virginia, Charlottesville, VA (United States). Dept. of Biochemistry

    1995-12-31

    This tutorial was one of eight tutorials selected to be presented at the Third International Conference on Intelligent Systems for Molecular Biology which was held in the United Kingdom from July 16 to 19, 1995. This tutorial examines how the information conserved during the evolution of a protein molecule can be used to infer reliably homology, and thus a shared proteinfold and possibly a shared active site or function. The authors start by reviewing a geological/evolutionary time scale. Next they look at the evolution of several protein families. During the tutorial, these families will be used to demonstrate that homologous protein ancestry can be inferred with confidence. They also examine different modes of protein evolution and consider some hypotheses that have been presented to explain the very earliest events in protein evolution. The next part of the tutorial will examine the technical aspects of protein sequence comparison. Both optimal and heuristic algorithms and their associated parameters that are used to characterize protein sequence similarities are discussed. Perhaps more importantly, they survey the statistics of local similarity scores, and how these statistics can both be used to improve the selectivity of a search and to evaluate the significance of a match. They them examine distantly related members of three protein families, the serine proteases, the glutathione transferases, and the G-protein-coupled receptors (GCRs). Finally, the discuss how sequence similarity can be used to examine internal repeated or mosaic structures in proteins.

  1. Prediction of Protein-Protein Interactions Using Protein Signature Profiling

    Institute of Scientific and Technical Information of China (English)

    Mahmood; A.; Mahdavi; Yen-Han; Lin

    2007-01-01

    Protein domains are conserved and functionally independent structures that play an important role in interactions among related proteins. Domain-domain inter- actions have been recently used to predict protein-protein interactions (PPI). In general, the interaction probability of a pair of domains is scored using a trained scoring function. Satisfying a threshold, the protein pairs carrying those domains are regarded as "interacting". In this study, the signature contents of proteins were utilized to predict PPI pairs in Saccharomyces cerevisiae, Caenorhabditis ele- gans, and Homo sapiens. Similarity between protein signature patterns was scored and PPI predictions were drawn based on the binary similarity scoring function. Results show that the true positive rate of prediction by the proposed approach is approximately 32% higher than that using the maximum likelihood estimation method when compared with a test set, resulting in 22% increase in the area un- der the receiver operating characteristic (ROC) curve. When proteins containing one or two signatures were removed, the sensitivity of the predicted PPI pairs in- creased significantly. The predicted PPI pairs are on average 11 times more likely to interact than the random selection at a confidence level of 0.95, and on aver- age 4 times better than those predicted by either phylogenetic profiling or gene expression profiling.

  2. Urine Protein and Urine Protein to Creatinine Ratio

    Science.gov (United States)

    ... limited. Home Visit Global Sites Search Help? Urine Protein and Urine Protein to Creatinine Ratio Share this page: Was this page helpful? Also known as: 24-Hour Urine Protein; Urine Total Protein; Urine Protein to Creatinine Ratio; ...

  3. Protein- protein interaction detection system using fluorescent protein microdomains

    Science.gov (United States)

    Waldo, Geoffrey S.; Cabantous, Stephanie

    2010-02-23

    The invention provides a protein labeling and interaction detection system based on engineered fragments of fluorescent and chromophoric proteins that require fused interacting polypeptides to drive the association of the fragments, and further are soluble and stable, and do not change the solubility of polypeptides to which they are fused. In one embodiment, a test protein X is fused to a sixteen amino acid fragment of GFP (.beta.-strand 10, amino acids 198-214), engineered to not perturb fusion protein solubility. A second test protein Y is fused to a sixteen amino acid fragment of GFP (.beta.-strand 11, amino acids 215-230), engineered to not perturb fusion protein solubility. When X and Y interact, they bring the GFP strands into proximity, and are detected by complementation with a third GFP fragment consisting of GFP amino acids 1-198 (strands 1-9). When GFP strands 10 and 11 are held together by interaction of protein X and Y, they spontaneous association with GFP strands 1-9, resulting in structural complementation, folding, and concomitant GFP fluorescence.

  4. InterProScan Result: FS871231 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS871231 FS871231_4_ORF2 6E31C3F25D2F3525 PANTHER PTHR12772 DNA REPLICATION COMPLEX... GINS PROTEIN PSF2 1.5e-61 T IPR007257 GINS complex, subunit Psf2 Cellular Component: nucleus (GO:0005634)|Biological Process: DNA replication (GO:0006260) ...

  5. InterProScan Result: BY944713 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BY944713 BY944713_4_ORF1 04B2570889809851 PANTHER PTHR12772 DNA REPLICATION COMPLEX... GINS PROTEIN PSF2 2.3e-05 T IPR007257 GINS complex, subunit Psf2 Cellular Component: nucleus (GO:0005634)|Biological Process: DNA replication (GO:0006260) ...

  6. InterProScan Result: FS852910 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS852910 FS852910_1_ORF2 6E31C3F25D2F3525 PANTHER PTHR12772 DNA REPLICATION COMPLEX... GINS PROTEIN PSF2 1.5e-61 T IPR007257 GINS complex, subunit Psf2 Cellular Component: nucleus (GO:0005634)|Biological Process: DNA replication (GO:0006260) ...

  7. IGSF9 Family Proteins

    DEFF Research Database (Denmark)

    Hansen, Maria; Walmod, Peter Schledermann

    2013-01-01

    The Drosophila protein Turtle and the vertebrate proteins immunoglobulin superfamily (IgSF), member 9 (IGSF9/Dasm1) and IGSF9B are members of an evolutionarily ancient protein family. A bioinformatics analysis of the protein family revealed that invertebrates contain only a single IGSF9 family gene......, whereas vertebrates contain two to four genes. In cnidarians, the gene appears to encode a secreted protein, but transmembrane isoforms of the protein have also evolved, and in many species, alternative splicing facilitates the expression of both transmembrane and secreted isoforms. In most species, the...... longest isoforms of the proteins have the same general organization as the neural cell adhesion molecule family of cell adhesion molecule proteins, and like this family of proteins, IGSF9 family members are expressed in the nervous system. A review of the literature revealed that Drosophila Turtle...

  8. Surface Mediated Protein Disaggregation

    Science.gov (United States)

    Radhakrishna, Mithun; Kumar, Sanat K.

    2014-03-01

    Preventing protein aggregation is of both biological and industrial importance. Biologically these aggregates are known to cause amyloid type diseases like Alzheimer's and Parkinson's disease. Protein aggregation leads to reduced activity of the enzymes in industrial applications. Inter-protein interactions between the hydrophobic residues of the protein are known to be the major driving force for protein aggregation. In the current paper we show how surface chemistry and curvature can be tuned to mitigate these inter-protein interactions. Our results calculated in the framework of the Hydrophobic-Polar (HP) lattice model show that, inter-protein interactions can be drastically reduced by increasing the surface hydrophobicity to a critical value corresponding to the adsorption transition of the protein. At this value of surface hydrophobicity, proteins lose inter-protein contacts to gain surface contacts and thus the surface helps in reducing the inter-protein interactions. Further, we show that the adsorption of the proteins inside hydrophobic pores of optimal sizes are most efficient both in reducing inter-protein contacts and simultaneously retaining most of the native-contacts due to strong protein-surface interactions coupled with stabilization due to the confinement. Department of Energy (Grant No DE-FG02-11ER46811).

  9. Discover protein sequence signatures from protein-protein interaction data

    Directory of Open Access Journals (Sweden)

    Haasl Ryan J

    2005-11-01

    Full Text Available Abstract Background The development of high-throughput technologies such as yeast two-hybrid systems and mass spectrometry technologies has made it possible to generate large protein-protein interaction (PPI datasets. Mining these datasets for underlying biological knowledge has, however, remained a challenge. Results A total of 3108 sequence signatures were found, each of which was shared by a set of guest proteins interacting with one of 944 host proteins in Saccharomyces cerevisiae genome. Approximately 94% of these sequence signatures matched entries in InterPro member databases. We identified 84 distinct sequence signatures from the remaining 172 unknown signatures. The signature sharing information was then applied in predicting sub-cellular localization of yeast proteins and the novel signatures were used in identifying possible interacting sites. Conclusion We reported a method of PPI data mining that facilitated the discovery of novel sequence signatures using a large PPI dataset from S. cerevisiae genome as input. The fact that 94% of discovered signatures were known validated the ability of the approach to identify large numbers of signatures from PPI data. The significance of these discovered signatures was demonstrated by their application in predicting sub-cellular localizations and identifying potential interaction binding sites of yeast proteins.

  10. Polymer Directed Protein Assemblies

    Directory of Open Access Journals (Sweden)

    Patrick van Rijn

    2013-05-01

    Full Text Available Protein aggregation and protein self-assembly is an important occurrence in natural systems, and is in some form or other dictated by biopolymers. Very obvious influences of biopolymers on protein assemblies are, e.g., virus particles. Viruses are a multi-protein assembly of which the morphology is dictated by poly-nucleotides namely RNA or DNA. This “biopolymer” directs the proteins and imposes limitations on the structure like the length or diameter of the particle. Not only do these bionanoparticles use polymer-directed self-assembly, also processes like amyloid formation are in a way a result of directed protein assembly by partial unfolded/misfolded biopolymers namely, polypeptides. The combination of proteins and synthetic polymers, inspired by the natural processes, are therefore regarded as a highly promising area of research. Directed protein assembly is versatile with respect to the possible interactions which brings together the protein and polymer, e.g., electrostatic, v.d. Waals forces or covalent conjugation, and possible combinations are numerous due to the large amounts of different polymers and proteins available. The protein-polymer interacting behavior and overall morphology is envisioned to aid in clarifying protein-protein interactions and are thought to entail some interesting new functions and properties which will ultimately lead to novel bio-hybrid materials.

  11. Protein Dynamics in an RNA Binding Protein

    Science.gov (United States)

    Hall, Kathleen

    2006-03-01

    Using ^15N NMR relaxation measurements, analyzed with the Lipari-Szabo formalism, we have found that the human U1A RNA binding protein has ps-ns motions in those loops that make contact with RNA. Specific mutations can alter the extent and pattern of motions, and those proteins inevitably lose RNA binding affinity. Proteins with enhanced mobility of loops and termini presumably lose affinity due to increased conformational sampling by those parts of the protein that interact directly with RNA. There is an entropic penalty associated with locking down those elements upon RNA binding, in addition to a loss of binding efficiency caused by the increased number of conformations adopted by the protein. However, in addition to local conformational heterogeneity, analysis of molecular dynamics trajectories by Reorientational Eigenmode Dynamics reveals that loops of the wild type protein undergo correlated motions that link distal sites across the binding surface. Mutations that disrupt correlated motions result in weaker RNA binding, implying that there is a network of interactions across the surface of the protein. (KBH was a Postdoctoral Fellow with Al Redfield from 1985-1990). This work was supported by the NIH (to KBH) and NSF (SAS).

  12. Anisotropic Contributions to Protein-Protein Interactions.

    Science.gov (United States)

    Quang, Leigh J; Sandler, Stanley I; Lenhoff, Abraham M

    2014-02-11

    The anisotropy of shape and functionality of proteins complicates the prediction of protein-protein interactions. We examine the distribution of electrostatic and nonelectrostatic contributions to these interactions for two globular proteins, lysozyme and chymosin B, which differ in molecular weight by about a factor of 2. The interaction trends for these proteins are computed in terms of contributions to the osmotic second virial coefficient that are evaluated using atomistic models of the proteins. Our emphasis is on identifying the orientational configurations that contribute most strongly to the overall interactions due to high-complementarity interactions, and on calculating the effect of ionic strength on such interactions. The results emphasize the quantitative importance of several features of protein interactions, notably that despite differences in their frequency of occurrence, configurations differing appreciably in interaction energy can contribute meaningfully to overall interactions. However, relatively small effects due to charge anisotropy or specific hydration can affect the overall interaction significantly only if they contribute to strongly attractive configurations. The results emphasize the necessity of accounting for detailed anisotropy to capture actual experimental trends, and the sensitivity of even very detailed atomistic models to subtle solution contributions. PMID:26580057

  13. Protein Data Bank (PDB)

    Data.gov (United States)

    U.S. Department of Health & Human Services — The Protein Data Bank (PDB) archive is the single worldwide repository of information about the 3D structures of large biological molecules, including proteins and...

  14. [Protein-losing enteropathy].

    Science.gov (United States)

    Amiot, A

    2015-07-01

    Protein-losing enteropathy is a rare syndrome of gastrointestinal protein loss. The primary causes can be classified into lymphatic leakage due to increased interstitial pressure and increased leakage of protein-rich fluids due to erosive or non-erosive gastrointestinal disorders. The diagnosis of protein-losing enteropathy should be considered in patients with chronic diarrhea and peripheral oedema. The diagnosis of protein-losing enteropathy is most commonly based on the determination of fecal alpha-1 antitrypsin clearance. Most protein-losing enteropathy cases are the result of either lymphatic obstruction or a variety of gastrointestinal disorders and cardiac diseases, while primary intestinal lymphangiectasia (Waldmann's disease) is less common. Treatment of protein-losing enteropathy targets the underlying disease but also includes dietary modification, such as high-protein and low-fat diet along with medium-chain triglyceride supplementation. PMID:25618488

  15. Protein (Cyanobacteria): 360792 [

    Lifescience Database Archive (English)

    Full Text Available YP_007146453.1 1117:17211 1161:2741 1162:3098 56106:1490 142864:1490 56107:1490 putative stress ... protein (general stress ... protein 26) Cylindrospermum stagnale PCC 7417 MTTS ...

  16. Hydrodynamic effects in proteins

    Science.gov (United States)

    Szymczak, Piotr; Cieplak, Marek

    2011-01-01

    Experimental and numerical results pertaining to flow-induced effects in proteins are reviewed. Special emphasis is placed on shear-induced unfolding and on the role of solvent mediated hydrodynamic interactions in the conformational transitions in proteins.

  17. Hydrodynamic effects in proteins

    Energy Technology Data Exchange (ETDEWEB)

    Szymczak, Piotr [Institute of Theoretical Physics, Faculty of Physics, University of Warsaw, Hoza 69, 00-681 Warsaw (Poland); Cieplak, Marek, E-mail: piotr.szymczak@fuw.edu.pl [Institute of Physics, Polish Academy of Sciences, Aleja Lotnikow 32/46, 02-668 Warsaw (Poland)

    2011-01-26

    Experimental and numerical results pertaining to flow-induced effects in proteins are reviewed. Special emphasis is placed on shear-induced unfolding and on the role of solvent mediated hydrodynamic interactions in the conformational transitions in proteins. (topical review)

  18. Protein electrophoresis - serum

    Science.gov (United States)

    ... this page: //medlineplus.gov/ency/article/003540.htm Protein electrophoresis - serum To use the sharing features on ... JavaScript. This lab test measures the types of protein in the fluid (serum) part of a blood ...

  19. Protein: CAD [Trypanosomes Database

    Lifescience Database Archive (English)

    Full Text Available CAD carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotaseCAD trifunct ... ional protein carbamoylphosphate synthetase 2/aspartate transcarb ... amylase/dihydroorotasemultifunctional protein ... CAD H.sapiens 47458828 18105007 790 P27708 CAD_(ge ...

  20. Learning about Proteins

    Science.gov (United States)

    ... need from peanuts alone, but if you have peanut butter on whole-grain bread, you're set. Likewise, ... protein in a day: 2 tablespoons (15 milliliters) peanut butter (7 grams protein) 1 cup (240 milliliters) low- ...

  1. Confiabilidade intra e interexaminadores da fotogrametria na classificação do grau de lipodistrofia ginóide em mulheres assintomáticas Intra and inter-examiner reliability of photogrammetry in the classification of the degree of gynoid lypodystrophy in asymptomatic women

    Directory of Open Access Journals (Sweden)

    Ana Maria da Silva Mendonça

    2009-06-01

    Full Text Available A lipodistrofia ginóide (celulite é uma afecção dermatológica comum entre as mulheres. Uma de suas formas de avaliação é a inspeção visual por meio da fotogrametria. Entretanto, não foram encontrados estudos que verifiquem a repetibilidade e reprodutibilidade dessa avaliação. O objetivo deste estudo foi verificar a confiabilidade intra e interexaminadores da avaliação da celulite por meio da fotogrametria. Foram fotografadas e avaliadas as regiões glúteas de 50 mulheres (26,14±4,45 anos. A reprodutibilidade foi testada pela avaliação da mesma fotografia por dois examinadores em duas ocasiões diferentes, com intervalo de um ano; a repetibilidade por um mesmo examinador, com intervalo de uma semana. Os dados foram analisados estatisticamente e utilizado o índice Kappa ponderado. Os resultados indicaram substancial correlação (κ=0,70 entre os avaliadores para o grau de celulite no glúteo superior e moderada correlação (κ=0,50 para o grau de celulite no glúteo inferior. Nas análises de repetibilidade, os dados demonstraram excelente correlação (κ=0,81 para o grau de celulite no glúteo superior e substancial correlação (κ=0,75 para os graus no glúteo inferior. O método proposto para qualificação dos diferentes graus de celulite pela fotogrametria apresentou confiabilidade aceitável intra e interexaminadores para a maioria das regiões avaliadas, com exceção da região do glúteo inferior.Gynoid lypodystrophy (cellulitis is a common condition among women. One of its forms of evaluation is the visual inspection by photogrammetry. However, no studies could be found in literature on the repeatability and reproducibility of such evaluation. The purpose of this study was to assess reliability intra and inter-examiner of cellulitis evaluation by photogrammetry. The gluteal regions of 50 women (mean age 26.14±4.45 years were photographed and evaluated. Reproducibility was tested by evaluation of the same

  2. A influência do ciclo menstrual na flexibilidade em praticantes de ginástica de academia La influencia del ciclo menstrual sobre la flexibilidad en practicantes de gimnasia de academia The influence of the menstrual cycle on the flexibility in practitioners of gymnastics at fitness centers

    Directory of Open Access Journals (Sweden)

    Solange Mattos Melegario

    2006-06-01

    Full Text Available Este estudo teve por objetivo investigar se existem diferenças no grau de flexibilidade nas fases do ciclo menstrual de mulheres adultas jovens praticantes de ginástica de academia. A amostra intencional foi composta de 20 mulheres, com idade de 18 a 35 anos (25,8 ± 6,06, com o ciclo menstrual regular (28 até 32 dias e que não faziam uso de anticoncepcional oral. Dados referentes ao ciclo menstrual e atividade física habitual foram obtidos através da aplicação de um questionário. A flexibilidade foi aferida através da goniometria, utilizando-se oito movimentos, em três fases do ciclo menstrual. Os sujeitos foram submetidos a um teste hormonal, em que foram verificadas as taxas de estrona, estradiol e progesterona. O tratamento estatístico foi feito através de análise descritiva e inferencial (teste de Kolmogorov-Smirnov e ANOVA. Os resultados encontrados demonstraram que não houve diferença significativa (p Este estudio ha tenido por objetivo investigar si existen diferencias en el grado de flexibilidad en las fases del ciclo menstrual de mujeres adultas jóvenes practicantes de gimnasia de academia. La muestra intencional fue compuesta de 20 mujeres, con edades entre 18 a 35 años (25,8 ± 6,06, con ciclo menstrual regular (28 a 32 días y que no hacían uso de anticonceptivo oral. Datos referentes al ciclo menstrual y actividad física habitual fueron obtenidos a través de una encuesta. La flexibilidad fue medida a través de la goniometría, utilizándose ocho movimientos, en tres fases del ciclo menstrual. Los individuos fueron sometidos a un test hormonal, en donde se verificaron la tasa de estrona, estradiol y progesterona. El tratamiento estadístico fue hecho a través del análisis descriptivo y de inferencia (test de Kolmogorov-Smirnov y ANOVA. Los resultados encontrados mostraron que no hubo diferencia significativa (p This study aims to verify if there are differences in the degree of flexibility in the phases of

  3. Novas Tecnologias e Novas Formas de Organização do Trabalho do Professor nas Academias de Ginástica New Technologies and New Ways of Organizing the Work of the Teacher at Sports Centers Nuevas Tecnologías y Nuevas Formas en Organizacion de Trabajo de Profesor en Gimnasios de Gimnasia

    Directory of Open Access Journals (Sweden)

    2007-09-01

    Full Text Available A partir de um estudo de caso realizado em uma grande academia de Goiânia, trago este recorte com o objetivo de compreender como as transformações tecnológicas nas academias de ginástica têm influenciado a organização do trabalho neste espaço. A pesquisa foi desenvolvida no primeiro semestre de 2004. Para coleta de dados foram realizadas entrevistas semi-estruturadas com professores da academia pesquisada. A academia escolhida, cujo nome fictício será Academia X, foi a que representa o que há e mais avançado nesse ramo de atividade em Goiânia. Assim, poderão ser apontadas algumas tendências para as demais academias de acordo com os resultados obtidos. Isso só é possível porque a tendência das academias menos desenvolvidas é acompanhar as mais desenvolvidas. PALAVRAS-CHAVE: academia – tecnologia – trabalho. Based on a case study undertaken in a large gym in the city of Goiânia, Brazil, I present this paper that aims at understanding how technological changes in gyms have infl uenced the organization of work in such spaces. This research was developed in the first quarter of 2004. Semi-structured interviews with teachers from the investigated gym were done for data collection. The chosen gym, herein renamed as Academia X, was the one that had the most advanced technology available for this business sector in the city of Goiânia. The achieved results may point to future trends for the other gyms. This is only possible because lesser developed gyms tend to match their more developed counterparts. KEYWORDS: gym – technology – work. A partir de un estudio de caso realizado en una gran academia de la ciudad de Goiânia, traigo este resumen con el objetivo de compreender cómo las transformaciones tecnológicas en las academias de gimnasia han infl uenciado la organización del trabajo en este espacio. La investigación fue desarrollada en el primer semestre de 2004. Para adquirir datos fueron realizadas entrevistas semi

  4. Prevalência do uso e conhecimento de esteroides anabolizantes androgênicos por estudantes e professores de educação física que atuam em academias de ginástica Prevalence of the use of anabolic androgenic steroids by physical education students and teachers who work in health clubs

    Directory of Open Access Journals (Sweden)

    Odilon Salim Costa Abrahin

    2013-02-01

    Full Text Available INTRODUÇÃO: Os esteroides anabólicos androgênicos (EAA são substâncias, quimicamente semelhantes à testosterona, utilizadas para o tratamento/controle de diversas doenças. Contudo, tais substâncias estão sendo empregadas de forma não terapêutica e indiscriminada com finalidades de melhora da performance esportiva e principalmente estética. OBJETIVO: analisar a prevalência do uso e o conhecimento de EAA por estudantes e professores de educação física que atuam em academias de ginástica de Belém, PA. Utilizou-se para a coleta de dados um questionário fechado e anônimo, aplicado a 117 pesquisados. A comparação da prevalência do uso e o grau de conhecimento dos pesquisados sobre EAA foi realizada através de estatística não paramétrica, prova de X² (Qui-quadrado, considerando o intervalo de confiança de 95% e p Anabolic androgenic steroids (AAS are chemically similar to testosterone, used for the treatment/control of various diseases. However, these substances are being used in non-therapeutic and indiscriminate purposes to improve sports performance and mainly esthetics. This study aimed to analyze the prevalence of AAS use and information of undergraduates and physical education teachers working in fitness centers in Belém-PA. A closed anonymous questionnaire was applied to 117 volunteers as an instrument. Comparison of the prevalence of use and degree of information of the respondents about AAS was performed using statistical non-parametric test X² (chi-square, considering the range of 95%, significant when p<0.05. The average age of the participants was 28.0 ± 6.3 years and the prevalence of AAS use was of 31.6%. The highest prevalence found was among specialist professionals (39.3%, the main motivation for the use of AAS was 75.6% to esthetics. Regarding the information, it was found that the drugs were classified as AAS: Durateston, Deca-Durabolin, Oxandrolona/Winstrol. However, these professionals took other

  5. Electrophoretic Separation of Proteins

    OpenAIRE

    Chakavarti, Bulbul; Chakavarti, Deb

    2008-01-01

    Electrophoresis is used to separate complex mixtures of proteins (e.g., from cells, subcellular fractions, column fractions, or immunoprecipitates), to investigate subunit compositions, and to verify homogeneity of protein samples. It can also serve to purify proteins for use in further applications. In polyacrylamide gel electrophoresis, proteins migrate in response to an electrical field through pores in a polyacrylamide gel matrix; pore size decreases with increasing acrylamide concentrati...

  6. Measuring leaf material in ginned cotton from surface images

    Science.gov (United States)

    Taylor, Robert A.

    1995-01-01

    Digitized images from black and white video cameras are being used to measure the area and numbers of leaf particles in cotton after lint cleaning. The method is now used to provide trash grades for 16 - 18 million bales of cotton prepared for market each year. Small samples are compressed against a glass window and illuminated with two small incandescent lamps for imaging. Leaf area readings are automatically adjusted for differences in lint greyness. The accuracy of this method compares well with gravimetric measurements of non-lint content.

  7. CHARACTERIZATION OF COTTON GIN PARTICULATE MATTER EMISSIONS – FIRST YEAR

    Science.gov (United States)

    Due to EPA’s implementation of more stringent standards for particulate matter with an effective diameter less than 2.5 microns, the cotton ginners’ associations across the cotton belt, including the National, Texas, Southern, Southeastern, and California associations, agreed that there is an urgent...

  8. Uncertainty analys for cotton gin PM10 emissions

    Science.gov (United States)

    Due to EPA’s implementation of more stringent standards for particulate matter (PM) with an effective diameter less than 2.5 microns (PM2.5) and the limited availability of PM2.5 emissions data, the cotton ginners’ associations across the cotton belt agreed that there is an urgent need to collect gi...

  9. 'But Yet and Still the Cotton Gin Kept on Working...'

    Science.gov (United States)

    Walker, Alice

    1983-01-01

    Describes the work of Friends of the Children of Mississippi, a Head Start program which began in the late 1960s and for which the author was hired to develop Black history materials for teacher training. Presents excerpts from the autobiographies of several Black women trainees in the program. (GC)

  10. Simulations of protein folding

    International Nuclear Information System (INIS)

    We have developed a simple, phenomenological, Monte-Carlo code that predicts the three-dimensional structure of globular proteins from the DNA sequences that define them. We have applied this code to two small proteins, the villin headpiece (1VII) and colel rop (1ROP). Our code folds both proteins to within 5 A rms of their native structures

  11. Destabilized bioluminescent proteins

    Science.gov (United States)

    Allen, Michael S.; Rakesh, Gupta; Gary, Sayler S.

    2007-07-31

    Purified nucleic acids, vectors and cells containing a gene cassette encoding at least one modified bioluminescent protein, wherein the modification includes the addition of a peptide sequence. The duration of bioluminescence emitted by the modified bioluminescent protein is shorter than the duration of bioluminescence emitted by an unmodified form of the bioluminescent protein.

  12. Protein domain prediction

    NARCIS (Netherlands)

    Ingolfsson, Helgi; Yona, Golan

    2008-01-01

    Domains are considered to be the building blocks of protein structures. A protein can contain a single domain or multiple domains, each one typically associated with a specific function. The combination of domains determines the function of the protein, its subcellular localization and the interacti

  13. CSF total protein

    Science.gov (United States)

    CSF total protein is a test to determine the amount of protein in your spinal fluid, also called cerebrospinal fluid (CSF). ... The normal protein range varies from lab to lab, but is typically about 15 to 60 mg/dL. Note: mg/dL = ...

  14. Modeling Protein Domain Function

    Science.gov (United States)

    Baker, William P.; Jones, Carleton "Buck"; Hull, Elizabeth

    2007-01-01

    This simple but effective laboratory exercise helps students understand the concept of protein domain function. They use foam beads, Styrofoam craft balls, and pipe cleaners to explore how domains within protein active sites interact to form a functional protein. The activity allows students to gain content mastery and an understanding of the…

  15. Protein - Which is Best?

    Science.gov (United States)

    Hoffman, Jay R; Falvo, Michael J

    2004-09-01

    Protein intake that exceeds the recommended daily allowance is widely accepted for both endurance and power athletes. However, considering the variety of proteins that are available much less is known concerning the benefits of consuming one protein versus another. The purpose of this paper is to identify and analyze key factors in order to make responsible recommendations to both the general and athletic populations. Evaluation of a protein is fundamental in determining its appropriateness in the human diet. Proteins that are of inferior content and digestibility are important to recognize and restrict or limit in the diet. Similarly, such knowledge will provide an ability to identify proteins that provide the greatest benefit and should be consumed. The various techniques utilized to rate protein will be discussed. Traditionally, sources of dietary protein are seen as either being of animal or vegetable origin. Animal sources provide a complete source of protein (i.e. containing all essential amino acids), whereas vegetable sources generally lack one or more of the essential amino acids. Animal sources of dietary protein, despite providing a complete protein and numerous vitamins and minerals, have some health professionals concerned about the amount of saturated fat common in these foods compared to vegetable sources. The advent of processing techniques has shifted some of this attention and ignited the sports supplement marketplace with derivative products such as whey, casein and soy. Individually, these products vary in quality and applicability to certain populations. The benefits that these particular proteins possess are discussed. In addition, the impact that elevated protein consumption has on health and safety issues (i.e. bone health, renal function) are also reviewed. Key PointsHigher protein needs are seen in athletic populations.Animal proteins is an important source of protein, however potential health concerns do exist from a diet of protein

  16. Highly thermostable fluorescent proteins

    Science.gov (United States)

    Bradbury, Andrew M.; Waldo, Geoffrey S.; Kiss, Csaba

    2011-03-22

    Thermostable fluorescent proteins (TSFPs), methods for generating these and other stability-enhanced proteins, polynucleotides encoding such proteins, and assays and method for using the TSFPs and TSFP-encoding nucleic acid molecules are provided. The TSFPs of the invention show extremely enhanced levels of stability and thermotolerance. In one case, for example, a TSFP of the invention is so stable it can be heated to 99.degree. C. for short periods of time without denaturing, and retains 85% of its fluorescence when heated to 80.degree. C. for several minutes. The invention also provides a method for generating stability-enhanced variants of a protein, including but not limited to fluorescent proteins.

  17. Protein hydration and dynamics

    International Nuclear Information System (INIS)

    Inelastic neutron scattering can measure the protein thermal fluctuations under the physiological aqueous environment, especially it is powerful to observe the low-energy protein dynamics in THz region, which are revealed theoretically to be coupled with solvations. Neutron enables the selective observation of protein and hydration water by deuteration. The complementary analysis with molecular dynamics simulation is also effective for the study of protein hydration. Some examples of the application toward the understanding of molecular basis of protein functions will be introduced. (author)

  18. Protein crystallization with paper

    Science.gov (United States)

    Matsuoka, Miki; Kakinouchi, Keisuke; Adachi, Hiroaki; Maruyama, Mihoko; Sugiyama, Shigeru; Sano, Satoshi; Yoshikawa, Hiroshi Y.; Takahashi, Yoshinori; Yoshimura, Masashi; Matsumura, Hiroyoshi; Murakami, Satoshi; Inoue, Tsuyoshi; Mori, Yusuke; Takano, Kazufumi

    2016-05-01

    We developed a new protein crystallization method that incorporates paper. A small piece of paper, such as facial tissue or KimWipes, was added to a drop of protein solution in the traditional sitting drop vapor diffusion technique, and protein crystals grew by incorporating paper. By this method, we achieved the growth of protein crystals with reducing osmotic shock. Because the technique is very simple and the materials are easy to obtain, this method will come into wide use for protein crystallization. In the future, it could be applied to nanoliter-scale crystallization screening on a paper sheet such as in inkjet printing.

  19. Protein and vegetarian diets.

    Science.gov (United States)

    Marsh, Kate A; Munn, Elizabeth A; Baines, Surinder K

    2013-08-19

    A vegetarian diet can easily meet human dietary protein requirements as long as energy needs are met and a variety of foods are eaten. Vegetarians should obtain protein from a variety of plant sources, including legumes, soy products, grains, nuts and seeds. Eggs and dairy products also provide protein for those following a lacto-ovo-vegetarian diet. There is no need to consciously combine different plant proteins at each meal as long as a variety of foods are eaten from day to day, because the human body maintains a pool of amino acids which can be used to complement dietary protein. The consumption of plant proteins rather than animal proteins by vegetarians may contribute to their reduced risk of chronic diseases such as diabetes and heart disease. PMID:25369930

  20. Protein kinesis: The dynamics of protein trafficking and stability

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-12-31

    The purpose of this conference is to provide a multidisciplinary forum for exchange of state-of-the-art information on protein kinesis. This volume contains abstracts of papers in the following areas: protein folding and modification in the endoplasmic reticulum; protein trafficking; protein translocation and folding; protein degradation; polarity; nuclear trafficking; membrane dynamics; and protein import into organelles.

  1. Protein Electrophoresis/Immunofixation Electrophoresis

    Science.gov (United States)

    ... be limited. Home Visit Global Sites Search Help? Protein Electrophoresis Immunofixation Electrophoresis Share this page: Was this page helpful? Also known as: Serum Protein Electrophoresis; Protein ELP; SPE; SPEP; Urine Protein Electrophoresis; ...

  2. Protein: FEB6 [TP Atlas

    Lifescience Database Archive (English)

    Full Text Available FEB6 Photoresponse regulatory proteins HD1 SE1 Zinc finger protein HD1 Protein CONSTANS-like, Pr ... otein HEADING DATE 1, Protein PHOTOPERIOD SENSITIVITY ... 1 39947 Oryza sativa subsp. japonica 4340746 Q9FDX ...

  3. Identifying novel protein phenotype annotations by hybridizing protein-protein interactions and protein sequence similarities.

    Science.gov (United States)

    Chen, Lei; Zhang, Yu-Hang; Huang, Tao; Cai, Yu-Dong

    2016-04-01

    Studies of protein phenotypes represent a central challenge of modern genetics in the post-genome era because effective and accurate investigation of protein phenotypes is one of the most critical procedures to identify functional biological processes in microscale, which involves the analysis of multifactorial traits and has greatly contributed to the development of modern biology in the post genome era. Therefore, we have developed a novel computational method that identifies novel proteins associated with certain phenotypes in yeast based on the protein-protein interaction network. Unlike some existing network-based computational methods that identify the phenotype of a query protein based on its direct neighbors in the local network, the proposed method identifies novel candidate proteins for a certain phenotype by considering all annotated proteins with this phenotype on the global network using a shortest path (SP) algorithm. The identified proteins are further filtered using both a permutation test and their interactions and sequence similarities to annotated proteins. We compared our method with another widely used method called random walk with restart (RWR). The biological functions of proteins for each phenotype identified by our SP method and the RWR method were analyzed and compared. The results confirmed a large proportion of our novel protein phenotype annotation, and the RWR method showed a higher false positive rate than the SP method. Our method is equally effective for the prediction of proteins involving in all the eleven clustered yeast phenotypes with a quite low false positive rate. Considering the universality and generalizability of our supporting materials and computing strategies, our method can further be applied to study other organisms and the new functions we predicted can provide pertinent instructions for the further experimental verifications. PMID:26728152

  4. Sensitizing properties of proteins

    DEFF Research Database (Denmark)

    Poulsen, Lars K.; Ladics, Gregory S; McClain, Scott;

    2014-01-01

    The scope of allergy risk is diverse considering the myriad ways in which protein allergenicity is affected by physiochemical characteristics of proteins. The complexity created by the matrices of foods and the variability of the human immune system add additional challenges to understanding the...... relationship between sensitization potential and allergy disease. To address these and other issues, an April 2012 international symposium was held in Prague, Czech Republic, to review and discuss the state-of-the-science of sensitizing properties of protein allergens. The symposium, organized by the Protein...... scientists from academia, government, and industry participated in the symposium. Experts provided overviews on known mechanisms by which proteins in food may cause sensitization, discussed experimental models to predict protein sensitizing potential, and explored whether such experimental techniques may be...

  5. NMR of unfolded proteins

    Indian Academy of Sciences (India)

    Amarnath Chtterjee; Ashutosh Kumar; Jeetender Chugh; Sudha Srivastava; Neel S Bhavesh; Ramakrishna V Hosur

    2005-01-01

    In the post-genomic era, as more and more genome sequences are becoming known and hectic efforts are underway to decode the information content in them, it is becoming increasingly evident that flexibility in proteins plays a crucial role in many of the biological functions. Many proteins have intrinsic disorder either wholly or in specific regions. It appears that this disorder may be important for regulatory functions of the proteins, on the one hand, and may help in directing the folding process to reach the compact native state, on the other. Nuclear magnetic resonance (NMR) has over the last two decades emerged as the sole, most powerful technique to help characterize these disordered protein systems. In this review, we first discuss the significance of disorder in proteins and then describe the recent developments in NMR methods for their characterization. A brief description of the results obtained on several disordered proteins is presented at the end.

  6. Computational Protein Design

    DEFF Research Database (Denmark)

    Johansson, Kristoffer Enøe

    to a central method that enables new developments. For example, novel enzymes with functions not found in natural proteins have been de novo designed to give enough activity for experimental optimization. This thesis presents the current state-of-the-art within computational design methods together......Proteins are the major functional group of molecules in biology. The impact of protein science on medicine and chemical productions is rapidly increasing. However, the greatest potential remains to be realized. The fi eld of protein design has advanced computational modeling from a tool of support...... with a novel method based on probability theory. With the aim of assembling a complete pipeline for protein design, this work touches upon several aspects of protein design. The presented work is the computational half of a design project where the other half is dedicated to the experimental part of...

  7. Protein Models Comparator

    CERN Document Server

    Widera, Paweł

    2011-01-01

    The process of comparison of computer generated protein structural models is an important element of protein structure prediction. It has many uses including model quality evaluation, selection of the final models from a large set of candidates or optimisation of parameters of energy functions used in template free modelling and refinement. Although many protein comparison methods are available online on numerous web servers, their ability to handle a large scale model comparison is often very limited. Most of the servers offer only a single pairwise structural comparison, and they usually do not provide a model-specific comparison with a fixed alignment between the models. To bridge the gap between the protein and model structure comparison we have developed the Protein Models Comparator (pm-cmp). To be able to deliver the scalability on demand and handle large comparison experiments the pm-cmp was implemented "in the cloud". Protein Models Comparator is a scalable web application for a fast distributed comp...

  8. Protein oxidation and peroxidation.

    Science.gov (United States)

    Davies, Michael J

    2016-04-01

    Proteins are major targets for radicals and two-electron oxidants in biological systems due to their abundance and high rate constants for reaction. With highly reactive radicals damage occurs at multiple side-chain and backbone sites. Less reactive species show greater selectivity with regard to the residues targeted and their spatial location. Modification can result in increased side-chain hydrophilicity, side-chain and backbone fragmentation, aggregation via covalent cross-linking or hydrophobic interactions, protein unfolding and altered conformation, altered interactions with biological partners and modified turnover. In the presence of O2, high yields of peroxyl radicals and peroxides (protein peroxidation) are formed; the latter account for up to 70% of the initial oxidant flux. Protein peroxides can oxidize both proteins and other targets. One-electron reduction results in additional radicals and chain reactions with alcohols and carbonyls as major products; the latter are commonly used markers of protein damage. Direct oxidation of cysteine (and less commonly) methionine residues is a major reaction; this is typically faster than with H2O2, and results in altered protein activity and function. Unlike H2O2, which is rapidly removed by protective enzymes, protein peroxides are only slowly removed, and catabolism is a major fate. Although turnover of modified proteins by proteasomal and lysosomal enzymes, and other proteases (e.g. mitochondrial Lon), can be efficient, protein hydroperoxides inhibit these pathways and this may contribute to the accumulation of modified proteins in cells. Available evidence supports an association between protein oxidation and multiple human pathologies, but whether this link is causal remains to be established. PMID:27026395

  9. Proteins at interfaces

    OpenAIRE

    Evers, Florian

    2011-01-01

    Protein adsorption is a fundamental and ubiquitous phenomenon, which has severe implications in the fields of biomaterials as well as bio- and nanotechnology, e.g., in drug delivery, biofouling, the biocompatibility of implants, food chemistry, and biosensors. Therefore, the mechanisms of protein adsorption and controlling the interfacial affinity of proteins have become intriguing and interdisciplinary research topics. In this work, X-ray and neutron reflectometry are the main...

  10. Protein-surfactant interactions

    OpenAIRE

    Valstar, Ank

    2000-01-01

    Protein-surfactant interactions in aqueous media have been investigated. The globular proteins lysozyme and bovine serum albumin (BSA) served as model proteins. Several ionic and non-ionic surfactants were used. Fluorescence probe measurements showed that at low sodium dodecyl sulfate (SDS) concentration (< 0.1 M) one micelle-like SDS cluster is bound to lysozyme. From dynamic light scattering (DLS) results it was observed that lysozyme in the complex does not correspond to the fully unfol...

  11. Pressure cryocooling protein crystals

    Science.gov (United States)

    Kim, Chae Un; Gruner, Sol M.

    2011-10-04

    Preparation of cryocooled protein crystal is provided by use of helium pressurizing and cryocooling to obtain cryocooled protein crystal allowing collection of high resolution data and by heavier noble gas (krypton or xenon) binding followed by helium pressurizing and cryocooling to obtain cryocooled protein crystal for collection of high resolution data and SAD phasing simultaneously. The helium pressurizing is carried out on crystal coated to prevent dehydration or on crystal grown in aqueous solution in a capillary.

  12. Biofilm Matrix Proteins

    OpenAIRE

    Fong, Jiunn N. C.; Yildiz, Fitnat H.

    2015-01-01

    Proteinaceous components of the biofilm matrix include secreted extracellular proteins, cell surface adhesins and protein subunits of cell appendages such as flagella and pili. Biofilm matrix proteins play diverse roles in biofilm formation and dissolution. They are involved in attaching cells to surfaces, stabilizing the biofilm matrix via interactions with exopolysaccharide and nucleic acid components, developing three-dimensional biofilm architectures, and dissolving biofilm matrix via enz...

  13. Ribosome-inactivating proteins

    OpenAIRE

    Walsh, Matthew J; Dodd, Jennifer E; Hautbergue, Guillaume M.

    2013-01-01

    Ribosome-inactivating proteins (RIPs) were first isolated over a century ago and have been shown to be catalytic toxins that irreversibly inactivate protein synthesis. Elucidation of atomic structures and molecular mechanism has revealed these proteins to be a diverse group subdivided into two classes. RIPs have been shown to exhibit RNA N-glycosidase activity and depurinate the 28S rRNA of the eukaryotic 60S ribosomal subunit. In this review, we compare archetypal RIP family members with oth...

  14. Trisulfides in Proteins

    DEFF Research Database (Denmark)

    Nielsen, Rasmus W.; Tachibana, Christine; Hansen, Niels Erik;

    2011-01-01

    post-translational modification, and the number of proteins in which a trisulfide has been unambiguously identified is small. Nevertheless, we believe that its prevalence may be underestimated, particularly with the increasing evidence for significant pools of sulfides in living tissues and their...... possible roles in cellular metabolism. This review focuses on examples of proteins that are known to contain a trisulfide bridge, and gives an overview of the chemistry of trisulfide formation, and the methods by which it is detected in proteins....

  15. Staining Proteins in Gels

    OpenAIRE

    Gallagher, Sean; Chakavarti, Deb

    2008-01-01

    Following separation by electrophoretic methods, proteins in a gel can be detected by several staining methods. This unit describes protocols for detecting proteins by four popular methods. Coomassie blue staining is an easy and rapid method. Silver staining, while more time consuming, is considerably more sensitive and can thus be used to detect smaller amounts of protein. Fluorescent staining is a popular alternative to traditional staining procedures, mainly because it is more sensitive th...

  16. Acanthamoeba castellanii STAT protein.

    Science.gov (United States)

    Kicinska, Anna; Leluk, Jacek; Jarmuszkiewicz, Wieslawa

    2014-01-01

    STAT (signal transducers and activators of transcription) proteins are one of the important mediators of phosphotyrosine-regulated signaling in metazoan cells. We described the presence of STAT protein in a unicellular, free-living amoebae with a simple life cycle, Acanthamoeba castellanii. A. castellanii is the only, studied to date, Amoebozoan that does not belong to Mycetozoa but possesses STATs. A sequence of the A. castellanii STAT protein includes domains similar to those of the Dictyostelium STAT proteins: a coiled coil (characteristic for Dictyostelium STAT coiled coil), a STAT DNA-binding domain and a Src-homology domain. The search for protein sequences homologous to A. castellanii STAT revealed 17 additional sequences from lower eukaryotes. Interestingly, all of these sequences come from Amoebozoa organisms that belong to either Mycetozoa (slime molds) or Centramoebida. We showed that there are four separated clades within the slime mold STAT proteins. The A. castellanii STAT protein branches next to a group of STATc proteins from Mycetozoa. We also demonstrate that Amoebozoa form a distinct monophyletic lineage within the STAT protein world that is well separated from the other groups. PMID:25338074

  17. Acanthamoeba castellanii STAT protein.

    Directory of Open Access Journals (Sweden)

    Anna Kicinska

    Full Text Available STAT (signal transducers and activators of transcription proteins are one of the important mediators of phosphotyrosine-regulated signaling in metazoan cells. We described the presence of STAT protein in a unicellular, free-living amoebae with a simple life cycle, Acanthamoeba castellanii. A. castellanii is the only, studied to date, Amoebozoan that does not belong to Mycetozoa but possesses STATs. A sequence of the A. castellanii STAT protein includes domains similar to those of the Dictyostelium STAT proteins: a coiled coil (characteristic for Dictyostelium STAT coiled coil, a STAT DNA-binding domain and a Src-homology domain. The search for protein sequences homologous to A. castellanii STAT revealed 17 additional sequences from lower eukaryotes. Interestingly, all of these sequences come from Amoebozoa organisms that belong to either Mycetozoa (slime molds or Centramoebida. We showed that there are four separated clades within the slime mold STAT proteins. The A. castellanii STAT protein branches next to a group of STATc proteins from Mycetozoa. We also demonstrate that Amoebozoa form a distinct monophyletic lineage within the STAT protein world that is well separated from the other groups.

  18. Consensus protein design

    Science.gov (United States)

    Porebski, Benjamin T.; Buckle, Ashley M.

    2016-01-01

    A popular and successful strategy in semi-rational design of protein stability is the use of evolutionary information encapsulated in homologous protein sequences. Consensus design is based on the hypothesis that at a given position, the respective consensus amino acid contributes more than average to the stability of the protein than non-conserved amino acids. Here, we review the consensus design approach, its theoretical underpinnings, successes, limitations and challenges, as well as providing a detailed guide to its application in protein engineering. PMID:27274091

  19. Engineering therapeutic protein disaggregases

    Science.gov (United States)

    Shorter, James

    2016-01-01

    Therapeutic agents are urgently required to cure several common and fatal neurodegenerative disorders caused by protein misfolding and aggregation, including amyotrophic lateral sclerosis (ALS), Parkinson’s disease (PD), and Alzheimer’s disease (AD). Protein disaggregases that reverse protein misfolding and restore proteins to native structure, function, and localization could mitigate neurodegeneration by simultaneously reversing 1) any toxic gain of function of the misfolded form and 2) any loss of function due to misfolding. Potentiated variants of Hsp104, a hexameric AAA+ ATPase and protein disaggregase from yeast, have been engineered to robustly disaggregate misfolded proteins connected with ALS (e.g., TDP-43 and FUS) and PD (e.g., α-synuclein). However, Hsp104 has no metazoan homologue. Metazoa possess protein disaggregase systems distinct from Hsp104, including Hsp110, Hsp70, and Hsp40, as well as HtrA1, which might be harnessed to reverse deleterious protein misfolding. Nevertheless, vicissitudes of aging, environment, or genetics conspire to negate these disaggregase systems in neurodegenerative disease. Thus, engineering potentiated human protein disaggregases or isolating small-molecule enhancers of their activity could yield transformative therapeutics for ALS, PD, and AD. PMID:27255695

  20. Simulations of Protein Folding

    CERN Document Server

    Cahill, M; Cahill, K E; Cahill, Michael; Fleharty, Mark; Cahill, Kevin

    2000-01-01

    We have developed a simple, phenomenological, Monte-Carlo code that predicts the three-dimensional structure of globular proteins from the DNA sequences that define them. We have applied this code to two small proteins, the villin headpiece (1VII) and cole1 rop (1ROP). Our code folded the 36-residue villin headpiece to a mean rms distance of less than 5 A from its native structure as revealed by NMR; it folded a 56-residue fragment of the protein cole1 rop to within 11 A of its native structure. The denatured starting configurations of these two proteins were, respectively, 29 A and 55 A distant from their native structures.

  1. Ultrafiltration of pegylated proteins

    Science.gov (United States)

    Molek, Jessica R.

    There is considerable clinical interest in the use of "second-generation" therapeutics produced by conjugation of a native protein with various polymers including polyethylene glycol (PEG). PEG--protein conjugates, so-called PEGylated proteins, can exhibit enhanced stability, half-life, and bioavailability. One of the challenges in the commercial production of PEGylated proteins is the purification required to remove unreacted polymer, native protein, and in many cases PEGylated proteins with nonoptimal degrees of conjugation. The overall objective of this thesis was to examine the use of ultrafiltration for the purification of PEGylated proteins. This included: (1) analysis of size-based separation of PEGylated proteins using conventional ultrafiltration membranes, (2) use of electrically-charged membranes to exploit differences in electrostatic interactions, and (3) examination of the effects of PEGylation on protein fouling. The experimental results were analyzed using appropriate theoretical models, with the underlying physical properties of the PEGylated proteins evaluated using size exclusion chromatography, capillary electrophoresis, dynamic light scattering, and reverse phase chromatography. PEGylated proteins were produced by covalent attachment of activated PEG to a protein via primary amines on the lysine residues. A simple model was developed for the reaction kinetics, which was used to explore the effect of reaction conditions and mode of operation on the distribution of PEGylated products. The effective size of the PEGylated proteins was evaluated using size exclusion chromatography, with appropriate correlations developed for the size in terms of the molecular weight of the native protein and attached PEG. The electrophoretic mobility of the PEGylated proteins were evaluated by capillary electrophoresis with the data in good agreement with a simple model accounting for the increase in protein size and the reduction in the number of protonated amine

  2. How Many Protein-Protein Interactions Types Exist in Nature?

    OpenAIRE

    Garma, Leonardo; Mukherjee, Srayanta; Mitra, Pralay; Zhang, Yang

    2012-01-01

    Protein quaternary structure universe” refers to the ensemble of all protein-protein complexes across all organisms in nature. The number of quaternary folds thus corresponds to the number of ways proteins physically interact with other proteins. This study focuses on answering two basic questions: Whether the number of protein-protein interactions is limited and, if yes, how many different quaternary folds exist in nature. By all-to-all sequence and structure comparisons, we grouped the pro...

  3. How Many Protein-Protein Interactions Types Exist in Nature?

    OpenAIRE

    Leonardo Garma; Srayanta Mukherjee; Pralay Mitra; Yang Zhang

    2012-01-01

    "Protein quaternary structure universe" refers to the ensemble of all protein-protein complexes across all organisms in nature. The number of quaternary folds thus corresponds to the number of ways proteins physically interact with other proteins. This study focuses on answering two basic questions: Whether the number of protein-protein interactions is limited and, if yes, how many different quaternary folds exist in nature. By all-to-all sequence and structure comparisons, we grouped the pro...

  4. Melanin Biosynthesis Inhibition Effects of Ginsenoside Rb2 Isolated from Panax ginseng Berry.

    Science.gov (United States)

    Lee, Dae Young; Jeong, Yong Tae; Jeong, Sang Chul; Lee, Mi Kyoung; Min, Jin Woo; Lee, Jae Won; Kim, Geum Soog; Lee, Seung Eun; Ahn, Young Sup; Kang, Hee Cheol; Kim, Jin Hee

    2015-12-28

    Ginsenoside Rb2 (Gin-Rb2) was purified from the fruit extract of Panax ginseng. Its chemical structure was measured by spectroscopic analysis, including HR-FAB-MS, (1)H-NMR, and IR spectroscopy. Gin-Rb2 decreased potent melanogenesis in melan-a cells, with 23.4% at 80 μM without cytotoxicity. Gin-Rb2 also decreased tyrosinase and MITF protein expression in melan-a cells. Furthermore, Gin-Rb2 presented inhibition of the body pigmentation in the zebrafish in vivo system and reduced melanin contents and tyrosinase activity. These results show that Gin-Rb2 isolated from P. ginseng may be an effective skin-whitening agent via the in vitro and in vivo systems. PMID:26437949

  5. Protein (Cyanobacteria): 286011 [

    Lifescience Database Archive (English)

    Full Text Available YP_007057271.1 1117:4890 1161:684 1185:224 373984:129 373994:129 histidine kinase,PAS ... domain-con ... taining protein,PAS ... domain-containing protein,histidine kinase,GAF dom ...

  6. Protein (Viridiplantae): 357488463 [

    Lifescience Database Archive (English)

    Full Text Available XP_003614519.1 33090:2423 35493:1202 131221:1202 3193:1202 58023:2056 78536:1595 58024:1595 3398 ... 938 3814:1938 163742:3028 3877:3028 3880:3028 Cyst nematode ... resistance protein-like protein Medicago truncatul ...

  7. Poxviral Ankyrin Proteins

    Directory of Open Access Journals (Sweden)

    Michael H. Herbert

    2015-02-01

    Full Text Available Multiple repeats of the ankyrin motif (ANK are ubiquitous throughout the kingdoms of life but are absent from most viruses. The main exception to this is the poxvirus family, and specifically the chordopoxviruses, with ANK repeat proteins present in all but three species from separate genera. The poxviral ANK repeat proteins belong to distinct orthologue groups spread over different species, and align well with the phylogeny of their genera. This distribution throughout the chordopoxviruses indicates these proteins were present in an ancestral vertebrate poxvirus, and have since undergone numerous duplication events. Most poxviral ANK repeat proteins contain an unusual topology of multiple ANK motifs starting at the N-terminus with a C-terminal poxviral homologue of the cellular F-box enabling interaction with the cellular SCF ubiquitin ligase complex. The subtle variations between ANK repeat proteins of individual poxviruses suggest an array of different substrates may be bound by these protein-protein interaction domains and, via the F-box, potentially directed to cellular ubiquitination pathways and possible degradation. Known interaction partners of several of these proteins indicate that the NF-κB coordinated anti-viral response is a key target, whilst some poxviral ANK repeat domains also have an F-box independent affect on viral host-range.

  8. Protein (Viridiplantae): 186478918 [

    Lifescience Database Archive (English)

    Full Text Available NP_001117362.1 33090:264 35493:490 131221:490 3193:490 58023:763 78536:5554 58024:5554 3398:5554 ... 88 3699:588 3700:588 980083:588 3701:588 3702:2514 StaR -like protein domain-containing protein Arabidopsis ...

  9. Protein (Viridiplantae): 145336153 [

    Lifescience Database Archive (English)

    Full Text Available NP_174031.2 33090:264 35493:490 131221:490 3193:490 58023:763 78536:5554 58024:5554 3398:5554 71 ... 88 3699:588 3700:588 980083:588 3701:588 3702:2514 StaR -like protein domain-containing protein Arabidopsis ...

  10. Protein (Viridiplantae): 186478920 [

    Lifescience Database Archive (English)

    Full Text Available NP_001117363.1 33090:264 35493:490 131221:490 3193:490 58023:763 78536:5554 58024:5554 3398:5554 ... 88 3699:588 3700:588 980083:588 3701:588 3702:2514 StaR -like protein domain-containing protein Arabidopsis ...

  11. Protein (Viridiplantae): 18396209 [

    Lifescience Database Archive (English)

    Full Text Available NP_564271.1 33090:264 35493:490 131221:490 3193:490 58023:763 78536:5554 58024:5554 3398:5554 71 ... 88 3699:588 3700:588 980083:588 3701:588 3702:2514 StaR -like protein domain-containing protein Arabidopsis ...

  12. Proteins in biomass streams

    NARCIS (Netherlands)

    Mulder, W.J.

    2010-01-01

    The focus of this study is to give an overview of traditional and new biomasses and biomass streams that contain proteins. When information was available, the differences in molecular structure and physical and chemical properties for the different proteins is given. For optimal biomass use, isolati

  13. Protein (Cyanobacteria): 187726 [

    Lifescience Database Archive (English)

    Full Text Available ZP_00515693.1 1117:3739 1118:294 263510:556 263511:556 165597:1102 Cobalamin synthesis ... protein/P ... 47K:Cobalamin synthesis ... protein/P47K Crocosphaera watsonii WH 8501 MHKIPVT ...

  14. Protein (Cyanobacteria): 187721 [

    Lifescience Database Archive (English)

    Full Text Available ZP_00515086.1 1117:3739 1118:294 263510:556 263511:556 165597:1102 Cobalamin synthesis ... protein/P ... 47K:Cobalamin synthesis ... protein/P47K Crocosphaera watsonii WH 8501 MSGINQQ ...

  15. Protein (Cyanobacteria): 187724 [

    Lifescience Database Archive (English)

    Full Text Available ZP_00514782.1 1117:3739 1118:294 263510:556 263511:556 165597:1102 Cobalamin synthesis ... protein/P ... 47K:Cobalamin synthesis ... protein/P47K Crocosphaera watsonii WH 8501 MQIVDKK ...

  16. Protein (Cyanobacteria): 187722 [

    Lifescience Database Archive (English)

    Full Text Available ZP_00515750.1 1117:3739 1118:294 263510:556 263511:556 165597:1102 Cobalamin synthesis ... protein/P ... 47K:Cobalamin synthesis ... protein/P47K Crocosphaera watsonii WH 8501 MTPLNFN ...

  17. Protein (Cyanobacteria): 187723 [

    Lifescience Database Archive (English)

    Full Text Available ZP_00515087.1 1117:3739 1118:294 263510:556 263511:556 165597:1102 Cobalamin synthesis ... protein/P ... 47K:Cobalamin synthesis ... protein/P47K Crocosphaera watsonii WH 8501 MTRLDFN ...

  18. Protein (Viridiplantae): 15240110 [

    Lifescience Database Archive (English)

    Full Text Available NP_201488.1 33090:325 35493:1944 131221:1944 3193:1944 58023:3713 78536:2650 58024:2650 3398:265 ... :1852 LOB domain-containing protein 36 (ASYMMETRIC LEAVES ... 2-like protein 1) Arabidopsis thaliana MASSSSPCAAC ...

  19. Protein (Viridiplantae): 357505877 [

    Lifescience Database Archive (English)

    Full Text Available XP_003623227.1 33090:2309 35493:2314 131221:2314 3193:2314 58023:1780 78536:1486 58024:1486 3398 ... 163742:9849 3877:9849 3880:9849 Cell cycle control crn ... (Crooked neck) protein-like protein Medicago trunc ...

  20. Protein (Viridiplantae): 357472389 [

    Lifescience Database Archive (English)

    Full Text Available XP_003606479.1 33090:29954 35493:20452 131221:20452 3193:20452 58023:15679 78536:15788 58024:157 ... 2228 163742:12813 3877:12813 3880:12813 Defects in morphology ... protein-like protein Medicago truncatula MAETSSSNN ...

  1. Protein (Viridiplantae): 357472385 [

    Lifescience Database Archive (English)

    Full Text Available XP_003606477.1 33090:29954 35493:20452 131221:20452 3193:20452 58023:15679 78536:15788 58024:157 ... 2228 163742:12813 3877:12813 3880:12813 Defects in morphology ... protein-like protein Medicago truncatula MAETSSSNN ...

  2. Protein (Viridiplantae): 357440307 [

    Lifescience Database Archive (English)

    Full Text Available XP_003590431.1 33090:29954 35493:20452 131221:20452 3193:20452 58023:15679 78536:15788 58024:157 ... 2228 163742:12813 3877:12813 3880:12813 Defects in morphology ... protein-like protein Medicago truncatula MAGTSSKIP ...

  3. Protein (Viridiplantae): 357444551 [

    Lifescience Database Archive (English)

    Full Text Available XP_003592553.1 33090:29954 35493:20452 131221:20452 3193:20452 58023:15679 78536:15788 58024:157 ... 2228 163742:12813 3877:12813 3880:12813 Defects in morphology ... protein-like protein Medicago truncatula MAGTSSKIP ...

  4. C-reactive protein

    Science.gov (United States)

    C-reactive protein (CRP) is produced by the liver. The level of CRP rises when there is inflammation throughout the body. It is one of a group of proteins called "acute phase reactants" that go up in response to inflammation. ...

  5. Protein (Viridiplantae): 18414878 [

    Lifescience Database Archive (English)

    Full Text Available NP_567527.1 33090:1722 35493:20777 131221:20777 3193:20777 58023:13588 78536:13546 58024:13546 3 ... 83:5979 3701:5979 3702:6150 Tryptophan RNA-binding attenuator ... protein-like protein Arabidopsis thaliana MAAPFFST ...

  6. Protein (Viridiplantae): 238480800 [

    Lifescience Database Archive (English)

    Full Text Available NP_001154247.1 33090:1722 35493:20777 131221:20777 3193:20777 58023:13588 78536:13546 58024:1354 ... 83:5979 3701:5979 3702:6150 Tryptophan RNA-binding attenuator ... protein-like protein Arabidopsis thaliana MAAPFFST ...

  7. Protein (Viridiplantae): 238480798 [

    Lifescience Database Archive (English)

    Full Text Available NP_001154246.1 33090:1722 35493:20777 131221:20777 3193:20777 58023:13588 78536:13546 58024:1354 ... 83:5979 3701:5979 3702:6150 Tryptophan RNA-binding attenuator ... protein-like protein Arabidopsis thaliana MAAPFFST ...

  8. Protein (Cyanobacteria): 305313 [

    Lifescience Database Archive (English)

    Full Text Available ZP_09781770.1 1117:5986 1150:1684 35823:2516 376219:684 Cytochrome b6-f complex iron -sulfur subu ... nit 1 (Rieske iron -sulfur protein 1) (Plastohydroquinone:plastocyanin ... oxidoreductase iron -sulfur protein 1) (ISP 1) (RISP 1) Arthrospira sp. ...

  9. Protein Attachment on Nanodiamonds.

    Science.gov (United States)

    Lin, Chung-Lun; Lin, Cheng-Huang; Chang, Huan-Cheng; Su, Meng-Chih

    2015-07-16

    A recent advance in nanotechnology is the scale-up production of small and nonaggregated diamond nanoparticles suitable for biological applications. Using detonation nanodiamonds (NDs) with an average diameter of ∼4 nm as the adsorbents, we have studied the static attachment of three proteins (myoglobin, bovine serum albumin, and insulin) onto the nanoparticles by optical spectroscopy, mass spectrometry, and dynamic light scattering, and electrophoretic zeta potential measurements. Results show that the protein surface coverage is predominantly determined by the competition between protein-protein and protein-ND interactions, giving each protein a unique and characteristic structural configuration in its own complex. Specifically, both myoglobin and bovine serum albumin show a Langmuir-type adsorption behavior, forming 1:1 complexes at saturation, whereas insulin folds into a tightly bound multimer before adsorption. The markedly different adsorption patterns appear to be independent of the protein concentration and are closely related to the affinity of the individual proteins for the NDs. The present study provides a fundamental understanding for the use of NDs as a platform for nanomedical drug delivery. PMID:25815400

  10. Protein sequence databases.

    Science.gov (United States)

    Apweiler, Rolf; Bairoch, Amos; Wu, Cathy H

    2004-02-01

    A variety of protein sequence databases exist, ranging from simple sequence repositories, which store data with little or no manual intervention in the creation of the records, to expertly curated universal databases that cover all species and in which the original sequence data are enhanced by the manual addition of further information in each sequence record. As the focus of researchers moves from the genome to the proteins encoded by it, these databases will play an even more important role as central comprehensive resources of protein information. Several the leading protein sequence databases are discussed here, with special emphasis on the databases now provided by the Universal Protein Knowledgebase (UniProt) consortium. PMID:15036160

  11. Manipulating and Visualizing Proteins

    Energy Technology Data Exchange (ETDEWEB)

    Simon, Horst D.

    2003-12-05

    ProteinShop Gives Researchers a Hands-On Tool for Manipulating, Visualizing Protein Structures. The Human Genome Project and other biological research efforts are creating an avalanche of new data about the chemical makeup and genetic codes of living organisms. But in order to make sense of this raw data, researchers need software tools which let them explore and model data in a more intuitive fashion. With this in mind, researchers at Lawrence Berkeley National Laboratory and the University of California, Davis, have developed ProteinShop, a visualization and modeling program which allows researchers to manipulate protein structures with pinpoint control, guided in large part by their own biological and experimental instincts. Biologists have spent the last half century trying to unravel the ''protein folding problem,'' which refers to the way chains of amino acids physically fold themselves into three-dimensional proteins. This final shape, which resembles a crumpled ribbon or piece of origami, is what determines how the protein functions and translates genetic information. Understanding and modeling this geometrically complex formation is no easy matter. ProteinShop takes a given sequence of amino acids and uses visualization guides to help generate predictions about the secondary structures, identifying alpha helices and flat beta strands, and the coil regions that bind them. Once secondary structures are in place, researchers can twist and turn these pre-configurations until they come up with a number of possible tertiary structure conformations. In turn, these are fed into a computationally intensive optimization procedure that tries to find the final, three-dimensional protein structure. Most importantly, ProteinShop allows users to add human knowledge and intuition to the protein structure prediction process, thus bypassing bad configurations that would otherwise be fruitless for optimization. This saves compute cycles and accelerates

  12. MicroProteins

    DEFF Research Database (Denmark)

    Eguen, Teinai Ebimienere; Straub, Daniel; Graeff, Moritz;

    2015-01-01

    MicroProteins (miPs) are short, usually single-domain proteins that, in analogy to miRNAs, heterodimerize with their targets and exert a dominant-negative effect. Recent bioinformatic attempts to identify miPs have resulted in a list of potential miPs, many of which lack the defining...... characteristics of a miP. In this opinion article, we clearly state the characteristics of a miP as evidenced by known proteins that fit the definition; we explain why modulatory proteins misrepresented as miPs do not qualify as true miPs. We also discuss the evolutionary history of miPs, and how the miP concept...... can extend beyond transcription factors (TFs) to encompass different non-TF proteins that require dimerization for full function....

  13. Desenvolvimento e validação de um novo sistema de seleção de talentos para a ginástica olímpica feminina: a Bateria PDGO Development and validation of a new system for talent selection in female artistic gymnastics: the PDGO Battery

    Directory of Open Access Journals (Sweden)

    Patrícia Arruda de Albuquerque

    2007-06-01

    Full Text Available A ginástica olímpica (GO envolve atividades motoras que exigem capacidades específicas. Todavia, há carência de testes para detectar o potencial para o desempenho na GO em idades precoces. Este estudo descreve e apresenta evidências da validade de uma bateria de testes para a seleção de talentos para GO feminina. Inicialmente, foram levantadas as atividades que vêm sendo aplicadas por especialistas em GO, na literatura e por consulta através de questionários. A partir das 30 atividades mencionadas, foi delineada uma bateria de testes com 22 atividades, aplicada em 55 crianças de cinco a nove anos de idade. Com uso de técnicas de análise fatorial, os escores fatoriais individuais foram calculados para o primeiro fator, sendo adotados como variável independente representativa do potencial das crianças para o desempenho em GO (PDGO. Uma regressão múltipla passo a passo gerou uma equação por meio da qual o PDGO era estimado a partir de apenas oito atividades. A validade cruzada da bateria e do índice PDGO foi verificada em 16 ginastas experientes e 19 crianças de escolinha. As primeiras obtiveram médias significativamente maiores (PDGO = 85,1 que as últimas (PDGO = 54,8, indicando que a bateria discriminou bem o potencial geral para o desempenho. Confirmou-se a validade construto com base na estrutura da análise fatorial, já que as atividades agruparam-se em torno de uma única dimensão do desempenho motor. Para a fidedignidade inter e intra-observadores, obtiveram-se correlações de 0,83 a 1,00, sem diferenças entre as médias nas situações observadas. Conclui-se que a bateria de testes, além de ser de aplicação rápida, simples, de baixo custo e fácil entendimento, reveste-se de validade e reprodutibilidade, podendo ser aplicada na seleção inicial de talentos para a GO. Estudos adicionais, porém, deveriam ser conduzidos para confirmação dos presentes resultados, envolvendo amostras maiores e abordagem

  14. Relação entre os achados audiométricos e as queixas auditivas e extra-auditivas dos professores de uma academia de ginástica Relationship between audiometric findings and auditory and extra-auditory complaints of physical education teachers

    Directory of Open Access Journals (Sweden)

    Isabela Freixo Côrtes de Andrade

    2010-01-01

    Full Text Available OBJETIVOS: Estudar as queixas auditivas e extra-auditivas de professores de uma academia de ginástica expostos à música eletronicamente amplificada, descrever os achados audiométricos e investigar a influência das variáveis, tempo de profissão, carga horária de trabalho e presença de entalhe audiométrico. MÉTODOS: Inicialmente, foi realizada a medida dos níveis de pressão sonora das seis salas de aula da academia (média 101,4 dB(A. Em seguida, 32 professores foram avaliados por meio de anamnese e pesquisa dos limiares tonais por via aérea, e a presença de entalhe audiométrico foi investigada. RESULTADOS: Foi encontrada uma elevada porcentagem de professores (87,5% com exposições extra-ocupacionais. As queixas mais frequentes foram: intolerância aos sons intensos (43,8%, tontura (12,5%; irritabilidade e nervosismo (28,1%; insônia (31,3%; dor de cabeça (37,5%; zumbido (12,5%; plenitude auricular (12,5% e dificuldade de escutar às vezes (43,8%. Em relação aos achados audiométricos, 9,37% apresentaram alteração: 3,12% por perda neurossensorial bilateral e 6,25% queda nas frequências de 3000 Hz ou 4000 Hz. A frequência mais acometida pelo entalhe audiométrico foi 6000 Hz, sendo que 50% o apresentaram em, pelo menos, uma orelha. Não houve diferença estatisticamente significante na comparação entre o tempo de profissão, horas trabalhadas e queixas com os resultados do entalhe audiométrico. CONCLUSÃO: 68,75% dos professores apresentaram queixas extra-auditivas. Os resultados mostraram que apesar de ocorrer uma porcentagem pequena (9,37% de perda auditiva na população estudada, já existe na metade dos professores entalhe audiométrico em pelo menos uma orelha.PURPOSE: To study auditory and extra-auditory complaints of physical education teachers exposed to electronically amplified music, to describe their audiometric findings, and to investigate the importance of the variables time of profession, work-journey, and

  15. The centrality of cancer proteins in human protein-protein interaction network: a revisit.

    Science.gov (United States)

    Xiong, Wei; Xie, Luyu; Zhou, Shuigeng; Liu, Hui; Guan, Jihong

    2014-01-01

    Topological analysis of protein-protein interaction (PPI) networks has been widely applied to the investigation on cancer mechanisms. However, there is still a debate on whether cancer proteins exhibit more topological centrality compared to the other proteins in the human PPI network. To resolve this debate, we first identified four sets of human proteins, and then mapped these proteins into the yeast PPI network by homologous genes. Finally, we compared these proteins' properties in human and yeast PPI networks. Experiments over two real datasets demonstrated that cancer proteins tend to have higher degree and smaller clustering coefficient than non-cancer proteins. Experimental results also validated that cancer proteins have larger betweenness centrality compared to the other proteins on the STRING dataset. However, on the BioGRID dataset, the average betweenness centrality of cancer proteins is larger than that of disease and control proteins, but smaller than that of essential proteins. PMID:24878726

  16. Protein oxidation in aquatic foods

    DEFF Research Database (Denmark)

    Baron, Caroline P.

    2014-01-01

    The chapter discusses general considerations about protein oxidation and reviews the mechanisms involved in protein oxidation and consequences of protein oxidation on fish proteins. It presents two case studies, the first deals with protein and lipid oxidation in frozen rainbow trout......, and the second with oxidation in salted herring. The mechanisms responsible for initiation of protein oxidation are unclear, but it is generally accepted that free radical species initiating lipid oxidation can also initiate protein oxidation. The chapter focuses on interaction between protein and lipid...... oxidation. The protein carbonyl group measurement is the widely used method for estimating protein oxidation in foods and has been used in fish muscle. The chapter also talks about the impact of protein oxidation on protein functionality, fish muscle texture, and food nutritional value. Protein oxidation...

  17. An Algorithm for Finding Functional Modules and Protein Complexes in Protein-Protein Interaction Networks

    OpenAIRE

    Guangyu Cui; Yu Chen; De-Shuang Huang; Kyungsook Han

    2008-01-01

    Biological processes are often performed by a group of proteins rather than by individual proteins, and proteins in a same biological group form a densely connected subgraph in a protein-protein interaction network. Therefore, finding a densely connected subgraph provides useful information to predict the function or protein complex of uncharacterized proteins in the highly connected subgraph. We have developed an efficient algorithm and program for finding cliques and near-cliques in a prote...

  18. Quantification of the Influence of Protein-Protein Interactions on Adsorbed Protein Structure and Bioactivity

    OpenAIRE

    Wei, Yang; Thyparambil, Aby A.; Latour, Robert A.

    2013-01-01

    While protein-surface interactions have been widely studied, relatively little is understood at this time regarding how protein-surface interaction effects are influenced by protein-protein interactions and how these effects combine with the internal stability of a protein to influence its adsorbed-state structure and bioactivity. The objectives of this study were to develop a method to study these combined effects under widely varying protein-protein interaction conditions using hen egg-whit...

  19. New approach for predicting protein-protein interactions

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    @@ Protein-protein interactions (PPIs) are of vital importance for virtually all processes of a living cell. The study of these associations of protein molecules could improve people's understanding of diseases and provide basis for therapeutic approaches.

  20. Analysis of correlations between protein complex and protein-protein interaction and mRNA expression

    Institute of Scientific and Technical Information of China (English)

    CAI Lun; XUE Hong; LU Hongchao; ZHAO Yi; ZHU Xiaopeng; BU Dongbo; LING Lunjiang; CHEN Runsheng

    2003-01-01

    Protein-protein interaction is a physical interaction of two proteins in living cells. In budding yeast Saccharomyces cerevisiae, large-scale protein-protein interaction data have been obtained through high-throughput yeast two-hybrid systems (Y2H) and protein complex purification techniques based on mass-spectrometry. Here, we collect 11855 interactions between total 2617 proteins. Through seriate genome-wide mRNA expression data, similarity between two genes could be measured. Protein complex data can also be obtained publicly and can be translated to pair relationship that any two proteins can only exist in the same complex or not. Analysis of protein complex data, protein-protein interaction data and mRNA expression data can elucidate correlations between them. The results show that proteins that have interactions or similar expression patterns have a higher possibility to be in the same protein complex than randomized selected proteins, and proteins which have interactions and similar expression patterns are even more possible to exist in the same protein complex. The work indicates that comprehensive integration and analysis of public large-scale bioinformatical data, such as protein complex data, protein-protein interaction data and mRNA expression data, may help to uncover their relationships and common biological information underlying these data. The strategies described here may help to integrate and analyze other functional genomic and proteomic data, such as gene expression profiling, protein-localization mapping and large-scale phenotypic data, both in yeast and in other organisms.

  1. Piezoelectric allostery of protein.

    Science.gov (United States)

    Ohnuki, Jun; Sato, Takato; Takano, Mitsunori

    2016-07-01

    Allostery is indispensable for a protein to work, where a locally applied stimulus is transmitted to a distant part of the molecule. While the allostery due to chemical stimuli such as ligand binding has long been studied, the growing interest in mechanobiology prompts the study of the mechanically stimulated allostery, the physical mechanism of which has not been established. By molecular dynamics simulation of a motor protein myosin, we found that a locally applied mechanical stimulus induces electrostatic potential change at distant regions, just like the piezoelectricity. This novel allosteric mechanism, "piezoelectric allostery", should be of particularly high value for mechanosensor/transducer proteins. PMID:27575163

  2. Alpha Shapes and Proteins

    DEFF Research Database (Denmark)

    Winter, Pawel; Sterner, Henrik; Sterner, Peter

    We provide a unified description of (weighted) alpha shapes, beta shapes and the corresponding simplicialcomplexes. We discuss their applicability to various protein-related problems. We also discuss filtrations of alpha shapes and touch upon related persistence issues.We claim that the full...... potential of alpha-shapes and related geometrical constructs in protein-related problems yet remains to be realized and verified. We suggest parallel algorithms for (weighted) alpha shapes, and we argue that future use of filtrations and kinetic variants for larger proteins will need such implementation....

  3. Protein crystallography prescreen kit

    Science.gov (United States)

    Segelke, Brent W.; Krupka, Heike I.; Rupp, Bernhard

    2005-07-12

    A kit for prescreening protein concentration for crystallization includes a multiplicity of vials, a multiplicity of pre-selected reagents, and a multiplicity of sample plates. The reagents and a corresponding multiplicity of samples of the protein in solutions of varying concentrations are placed on sample plates. The sample plates containing the reagents and samples are incubated. After incubation the sample plates are examined to determine which of the sample concentrations are too low and which the sample concentrations are too high. The sample concentrations that are optimal for protein crystallization are selected and used.

  4. Human Protein Z.

    OpenAIRE

    Broze, G J; Miletich, J P

    1984-01-01

    Protein Z was purified from human plasma by a four-step procedure which included barium citrate adsorption, ammonium sulfate fractionation, DEAE-Sepharose chromatography, and blue agarose chromatography with a yield of 20%. It is a 62,000 mol wt protein with an extinction coefficient of 12.0. The concentration of Protein Z in pooled, citrated plasma is 2.2 micrograms/ml and its half-life in patients starting warfarin anticoagulation therapy is estimated to be less than 2.5 d. The NH2-terminal...

  5. Evolution of proteins.

    Science.gov (United States)

    Dayhoff, M. O.

    1971-01-01

    The amino acid sequences of proteins from living organisms are dealt with. The structure of proteins is first discussed; the variation in this structure from one biological group to another is illustrated by the first halves of the sequences of cytochrome c, and a phylogenetic tree is derived from the cytochrome c data. The relative geological times associated with the events of this tree are discussed. Errors which occur in the duplication of cells during the evolutionary process are examined. Particular attention is given to evolution of mutant proteins, globins, ferredoxin, and transfer ribonucleic acids (tRNA's). Finally, a general outline of biological evolution is presented.

  6. The characterisation and prediction of protein-protein interfaces.

    OpenAIRE

    Kabir, T.

    2004-01-01

    Understanding how proteins interact with each other is of fundamental importance and is one of the most important goals of molecular biology. In order to study the characteristics of protein-protein interaction sites datasets of non-homologous protein-complexes have been compiled. These datasets include 142 obligate homocomplexes, 20 obligate hetero-complexes, 20 enzyme-inhibitor complexes, 15 antibody-antigen complexes, and 10 signaling complexes. Overall, the protein-protein interfaces of o...

  7. Whey Protein- The Role of Protein Supplementation in Resistance Training

    OpenAIRE

    Zimmer, Raymond

    2005-01-01

    Adequate protein intake is an important concern for many athletes who are undergoing strength-training programs. Many athletes choose to take a protein supplement, such as whey protein, in order to help them build lean muscle mass more efficiently. But the benefit of very high levels of dietary protein in resistance training remains questionable. This paper examines the effectiveness of whey protein, and other forms of protein supplements, in helping athletes augment their muscle mass. A comp...

  8. Protein-protein interaction databases: keeping up with growing interactomes

    OpenAIRE

    Lehne Benjamin; Schlitt Thomas

    2009-01-01

    Abstract Over the past few years, the number of known protein-protein interactions has increased substantially. To make this information more readily available, a number of publicly available databases have set out to collect and store protein-protein interaction data. Protein-protein interactions have been retrieved from six major databases, integrated and the results compared. The six databases (the Biological General Repository for Interaction Datasets [BioGRID], the Molecular INTeraction ...

  9. The effect of protein-protein and protein-membrane interactions on membrane fouling in ultrafiltration

    NARCIS (Netherlands)

    Huisman, I.H.; Prádanos, P.; Hernández, A.

    2000-01-01

    It was studied how protein-protein and protein-membrane interactions influence the filtration performance during the ultrafiltration of protein solutions over polymeric membranes. This was done by measuring flux, streaming potential, and protein transmission during filtration of bovine serum albumin

  10. Polymers for Protein Conjugation

    Directory of Open Access Journals (Sweden)

    Gianfranco Pasut

    2014-01-01

    Full Text Available Polyethylene glycol (PEG at the moment is considered the leading polymer for protein conjugation in view of its unique properties, as well as to its low toxicity in humans, qualities which have been confirmed by its extensive use in clinical practice. Other polymers that are safe, biodegradable and custom-designed have, nevertheless, also been investigated as potential candidates for protein conjugation. This review will focus on natural polymers and synthetic linear polymers that have been used for protein delivery and the results associated with their use. Genetic fusion approaches for the preparation of protein-polypeptide conjugates will be also reviewed and compared with the best known chemical conjugation ones.

  11. Protein (Cyanobacteria): 292092 [

    Lifescience Database Archive (English)

    Full Text Available ZP_11392515.1 1117:5087 1150:2441 44887:135 864702:135 PAS ... domain type 3-containing protein,PAS ... STISDITSQKRTEAALQRSTARYENLASNIPGMIYQVVLETNGHFRFAYASPAS REIFGLEPEQLMKSAALGMTVIHPDDVVSFRQSIAQSAKTLQTQLGKLPK ...

  12. Protein turnover in sheep

    International Nuclear Information System (INIS)

    Considerable advances have been made in the knowledge of the mechanisms and control of synthesis and degradation of proteins in animal tissues during the last decade. Most of the work on the measurement of synthetic and degradative rates of the mixed protein fraction from tissues has been conducted in the rat. There have, unfortunately, been few publications describing results of protein turnover studies with ruminants. Consideration is given here to the techniques used to measure protein turnover, and some of the results obtained, particularly with sheep, are summarized. No attempt has been made to discuss directly the situation in parasitized animals; rather the aim is to provide background information which complements other work dealing with the effects of parasites on the nitrogen metabolism of ruminants. (author)

  13. Engineered Proteins for Bioelectrochemistry

    Science.gov (United States)

    Akram, Muhammad Safwan; Rehman, Jawad Ur; Hall, Elizabeth A. H.

    2014-06-01

    It is only in the past two decades that excellent protein engineering tools have begun to meet parallel advances in materials chemistry, nanofabrication, and electronics. This is revealing scenarios from which synthetic enzymes can emerge, which were previously impossible, as well as interfaces with novel electrode materials. That means the control of the protein structure, electron transport pathway, and electrode surface can usher us into a new era of bioelectrochemistry. This article reviews the principle of electron transfer (ET) and considers how its application at the electrode, within the protein, and at a redox group is directing key advances in the understanding of protein structure to create systems that exhibit better efficiency and unique bioelectrochemistry.

  14. Protein (Viridiplantae): 308813231 [

    Lifescience Database Archive (English)

    Full Text Available XP_003083922.1 33090:9527 3041:5078 1035538:3664 13792:3664 70447:4128 70448:5494 Protein requir ... ed for actin cytoskeleton organization ... and cell cycle progression (ISS) Ostreococcus taur ...

  15. Protein (Viridiplantae): 308808566 [

    Lifescience Database Archive (English)

    Full Text Available XP_003081593.1 33090:6182 3041:4098 1035538:2508 13792:2508 70447:3211 70448:4097 Mitochondrial ... inheritance and actin cytoskeleton organization ... protein (ISS) Ostreococcus tauri MPPKKPPPPPPDAKSYP ...

  16. The Pentapeptide Repeat Proteins

    Energy Technology Data Exchange (ETDEWEB)

    Vetting,M.; Hegde, S.; Fajardo, J.; Fiser, A.; Roderick, S.; Takiff, H.; Blanchard, J.

    2006-01-01

    The Pentapeptide Repeat Protein (PRP) family has over 500 members in the prokaryotic and eukaryotic kingdoms. These proteins are composed of, or contain domains composed of, tandemly repeated amino acid sequences with a consensus sequence of [S, T,A, V][D, N][L, F]-[S, T,R][G]. The biochemical function of the vast majority of PRP family members is unknown. The three-dimensional structure of the first member of the PRP family was determined for the fluoroquinolone resistance protein (MfpA) from Mycobacterium tuberculosis. The structure revealed that the pentapeptide repeats encode the folding of a novel right-handed quadrilateral {beta}-helix. MfpA binds to DNA gyrase and inhibits its activity. The rod-shaped, dimeric protein exhibits remarkable size, shape and electrostatic similarity to DNA.

  17. Protein (Viridiplantae): 255084748 [

    Lifescience Database Archive (English)

    Full Text Available XP_002504805.1 33090:7862 3041:6362 1035538:5159 13792:5159 38832:5340 296587:5427 DUF1244/molyb ... denum cofactor synthesis ... fusion protein Micromonas sp. RCC299 MASTRTEIEAYAF ...

  18. Protein (Viridiplantae): 303283029 [

    Lifescience Database Archive (English)

    Full Text Available XP_003060806.1 33090:7862 3041:6362 1035538:5159 13792:5159 38832:5340 38833:5093 564608:5093 mo ... lybdenum cofactor synthesis ... protein Micromonas pusilla CCMP1545 MVDAQTTEKIEAYA ...

  19. Protein (Viridiplantae): 308812183 [

    Lifescience Database Archive (English)

    Full Text Available XP_003083399.1 33090:12970 3041:5897 1035538:4613 13792:4613 70447:1628 70448:5196 Glycosylphosp ... hatidylinositol anchor synthesis ... protein (ISS) Ostreococcus tauri MSARRASFQSRFNDSSQ ...

  20. Protein (Viridiplantae): 308810647 [

    Lifescience Database Archive (English)

    Full Text Available XP_003082632.1 33090:15674 3041:5296 1035538:3911 13792:3911 70447:3635 70448:4717 senescence-in ... ducible chloroplast stay-green ... protein (ISS) Ostreococcus tauri MDRATTSSRASTARTFH ...

  1. Protein (Viridiplantae): 308811905 [

    Lifescience Database Archive (English)

    Full Text Available XP_003083260.1 33090:255 3041:4962 1035538:3528 13792:3528 70447:3840 70448:5111 T08009 probable ... ribosomal protein L5-green ... alga (ISS) Ostreococcus tauri MGKRRQKRKSQSVAKTTAYQ ...

  2. Protein (Cyanobacteria): 28423 [

    Lifescience Database Archive (English)

    Full Text Available ZP_10226597.1 1117:517 1118:7626 1125:2051 1160279:627 Type 4 prepilin-like proteins leader ... pept ... ide-processing enzyme (Includes: Leader ... peptidase ; N-methyltransferase) Microcystis sp. T ...

  3. Protein (Cyanobacteria): 360784 [

    Lifescience Database Archive (English)

    Full Text Available YP_007097029.1 1117:17211 1118:17546 217161:1718 1173032:1718 1173020:1718 putative stress ... prote ... in (general stress ... protein 26) Chamaesiphon minutus PCC 6605 MANATENQ ...

  4. Protein (Cyanobacteria): 392180 [

    Lifescience Database Archive (English)

    Full Text Available ZP_07113914.1 1117:24513 1150:7038 1158:3915 272129:3709 Bifunctional protein birA (Includes: Biotin ... otin operon repressor; Biotin --(acetyl-CoA-carboxylase) synthetase (Biotin --prot ...

  5. Interactive protein manipulation

    Energy Technology Data Exchange (ETDEWEB)

    SNCrivelli@lbl.gov

    2003-07-01

    We describe an interactive visualization and modeling program for the creation of protein structures ''from scratch''. The input to our program is an amino acid sequence -decoded from a gene- and a sequence of predicted secondary structure types for each amino acid-provided by external structure prediction programs. Our program can be used in the set-up phase of a protein structure prediction process; the structures created with it serve as input for a subsequent global internal energy minimization, or another method of protein structure prediction. Our program supports basic visualization methods for protein structures, interactive manipulation based on inverse kinematics, and visualization guides to aid a user in creating ''good'' initial structures.

  6. Protein (Viridiplantae): 308811366 [

    Lifescience Database Archive (English)

    Full Text Available XP_003082991.1 33090:1951 3041:1340 1035538:592 13792:592 70447:610 70448:205 Transporter, ABC s ... uperfamily (Breast cancer ... resistance protein) (ISS), partial Ostreococcus ta ...

  7. Protein (Viridiplantae): 308810513 [

    Lifescience Database Archive (English)

    Full Text Available XP_003082565.1 33090:8864 3041:8803 1035538:7822 13792:7822 70447:3615 70448:4680 Predicted memb ... rane protein (associated with esophageal cancer ... in humans) (ISS) Ostreococcus tauri MTSSRKLCAFVRDA ...

  8. Protein (Viridiplantae): 308804289 [

    Lifescience Database Archive (English)

    Full Text Available XP_003079457.1 33090:1951 3041:1340 1035538:592 13792:592 70447:610 70448:205 Transporter, ABC s ... uperfamily (Breast cancer ... resistance protein) (ISS) Ostreococcus tauri MASRV ...

  9. Untying knots in proteins.

    Science.gov (United States)

    Sułkowska, Joanna I; Sułkowski, Piotr; Szymczak, Piotr; Cieplak, Marek

    2010-10-13

    A shoelace can be readily untied by pulling its ends rather than its loops. Attempting to untie a native knot in a protein can also succeed or fail depending on where one pulls. However, thermal fluctuations induced by the surrounding water affect conformations stochastically and may add to the uncertainty of the outcome. When the protein is pulled by the termini, the knot can only get tightened, and any attempt at untying results in failure. We show that, by pulling specific amino acids, one may easily retract a terminal segment of the backbone from the knotting loop and untangle the knot. At still other amino acids, the outcome of pulling can go either way. We study the dependence of the untying probability on the way the protein is grasped, the pulling speed, and the temperature. Elucidation of the mechanisms underlying this dependence is critical for a successful experimental realization of protein knot untying. PMID:20857930

  10. Protein (Viridiplantae): 308806666 [

    Lifescience Database Archive (English)

    Full Text Available XP_003080644.1 33090:21099 3041:5360 1035538:3986 13792:3986 70447:3049 70448:3532 COG3310: Unch ... aracterized protein conserved in bacteria ... (ISS) Ostreococcus tauri MRRTCASRNLARSPVAARERCRQMV ...

  11. Protein (Viridiplantae): 308803575 [

    Lifescience Database Archive (English)

    Full Text Available XP_003079100.1 33090:20519 3041:4460 1035538:2940 13792:2940 70447:2035 70448:2555 COG4399: Unch ... aracterized protein conserved in bacteria ... (ISS) Ostreococcus tauri MKALQRLVLRGSTDGVRPACERAMA ...

  12. Protein (Viridiplantae): 308804123 [

    Lifescience Database Archive (English)

    Full Text Available XP_003079374.1 33090:20519 3041:4460 1035538:2940 13792:2940 70447:2035 70448:2555 COG4399: Unch ... aracterized protein conserved in bacteria ... (ISS) Ostreococcus tauri MDSLATSRRRRLARAGAAIATALAL ...

  13. Protein (Viridiplantae): 255077633 [

    Lifescience Database Archive (English)

    Full Text Available XP_002502450.1 33090:20956 3041:5145 1035538:3740 13792:3740 38832:3722 296587:3525 isocitrate d ... ehydrogenase (NADP+), bacteria -like protein Micromonas sp. RCC299 MAAASAGGKIQAAPM ...

  14. Protein (Cyanobacteria): 228257 [

    Lifescience Database Archive (English)

    Full Text Available ZP_09784859.1 1117:4333 1150:1533 35823:3512 376219:3411 Protein ushA precursor (Includes: UDP-sugar ... ugar hydrolase (UDP-sugar ... pyrophosphatase) (UDP-sugar ... diphosphatase); 5'-nuc ...

  15. Protein folding and cosmology

    CERN Document Server

    González-Diáz, P F

    1997-01-01

    Protein denaturing induced by supercooling is interpreted as a process where some or all internal symmetries of the native protein are spontaneously broken. Hence, the free-energy potential corresponding to a folding-funnel landscape becomes temperature-dependent and describes a phase transition. The idea that deformed vortices could be produced in the transition induced by temperature quenching, from native proteins to unfolded conformations is discussed in terms of the Zurek mechanism that implements the analogy between vortices, created in the laboratory at low energy, and the cosmic strings which are thought to have been left after symmetry breaking phase transitions in the early universe. An experiment is proposed to test the above idea which generalizes the cosmological analogy to also encompass biological systems and push a step ahead the view that protein folding is a biological equivalent of the big bang.

  16. Protein (Viridiplantae): 308804764 [

    Lifescience Database Archive (English)

    Full Text Available XP_003079694.1 33090:24290 3041:9393 1035538:8433 13792:8433 70447:5209 70448:2928 probable memb ... rane protein YCR013c-yeast ... (ISS) Ostreococcus tauri MQLREVKERLRAYFSSSAATPGRTR ...

  17. Protein (Cyanobacteria): 338848 [

    Lifescience Database Archive (English)

    Full Text Available YP_007172477.1 1117:11758 1118:7408 13034:1671 292566:1671 13035:1671 cell envelope-related func ... tion transcriptional attenuator ... common domain protein Dactylococcopsis salina PCC ...

  18. Electron transfer in proteins

    DEFF Research Database (Denmark)

    Farver, O; Pecht, I

    1991-01-01

    Electron migration between and within proteins is one of the most prevalent forms of biological energy conversion processes. Electron transfer reactions take place between active centers such as transition metal ions or organic cofactors over considerable distances at fast rates and with remarkable...... specificity. The electron transfer is attained through weak electronic interaction between the active sites, so that considerable research efforts are centered on resolving the factors that control the rates of long-distance electron transfer reactions in proteins. These factors include (in addition to the......-containing proteins. These proteins serve almost exclusively in electron transfer reactions, and as it turns out, their metal coordination sites are endowed with properties uniquely optimized for their function....

  19. Protein Colloidal Aggregation Project

    Science.gov (United States)

    Oliva-Buisson, Yvette J. (Compiler)

    2014-01-01

    To investigate the pathways and kinetics of protein aggregation to allow accurate predictive modeling of the process and evaluation of potential inhibitors to prevalent diseases including cataract formation, chronic traumatic encephalopathy, Alzheimer's Disease, Parkinson's Disease and others.

  20. Interactive protein manipulation

    International Nuclear Information System (INIS)

    We describe an interactive visualization and modeling program for the creation of protein structures ''from scratch''. The input to our program is an amino acid sequence -decoded from a gene- and a sequence of predicted secondary structure types for each amino acid-provided by external structure prediction programs. Our program can be used in the set-up phase of a protein structure prediction process; the structures created with it serve as input for a subsequent global internal energy minimization, or another method of protein structure prediction. Our program supports basic visualization methods for protein structures, interactive manipulation based on inverse kinematics, and visualization guides to aid a user in creating ''good'' initial structures

  1. Egg protein hydrolysates

    NARCIS (Netherlands)

    Amerongen, van A.; Beelen, M.J.C.; Wolbers, L.A.M.; Gilst, van W.H.; Buikema, J.H.; Nelissen, J.W.P.M.

    2009-01-01

    The present invention provides egg-protein hydrolysates with DPP-IV inhibitory activity which are particularly suited for the treatment of diabetes. Particularly advantageous is to use hydrolysate of lysozyme for the treatment of diabetes.

  2. Bence-Jones protein - quantitative

    Science.gov (United States)

    Immunoglobulin light chains - urine; Urine Bence-Jones protein ... Bence-Jones proteins are a part of regular antibodies called light chains. These proteins are not normally in urine. Sometimes, when ...

  3. The Malignant Protein Puzzle.

    Science.gov (United States)

    Walker, Lary C; Jucker, Mathias

    2016-01-01

    When most people hear the words malignant and brain, cancer immediately comes to mind. But our authors argue that proteins can be malignant too, and can spread harmfully through the brain in neurodegenerative diseases that include Alzheimer's, Parkinson's, CTE, and ALS. Studying how proteins such as PrP, amyloid beta, tau, and others aggregate and spread, and kill brain cells, represents a crucial new frontier in neuroscience. PMID:27408676

  4. Fish protein hydrolysates

    Energy Technology Data Exchange (ETDEWEB)

    Mackie, I.M.

    1982-01-01

    Proteolytic enzymes now available in commercial quantities can be used to liquefy the fish and fish waste presently considered suitable for conversion to fish meal. The products obtained are readily dispersed or dissolved in water and have a high nutritional value. They have been satisfactorily used as substitutes for milk proteins in milk replacers for young animals. Further research is necessary on means of controlling the degree of hydrolysis to give protein preparations with acceptable functional properties as human food supplements. (Refs. 21).

  5. Recombinant Collagenlike Proteins

    Science.gov (United States)

    Fertala, Andzej

    2007-01-01

    A group of collagenlike recombinant proteins containing high densities of biologically active sites has been invented. The method used to express these proteins is similar to a method of expressing recombinant procollagens and collagens described in U. S. Patent 5,593,859, "Synthesis of human procollagens and collagens in recombinant DNA systems." Customized collagenous proteins are needed for biomedical applications. In particular, fibrillar collagens are attractive for production of matrices needed for tissue engineering and drug delivery. Prior to this invention, there was no way of producing customized collagenous proteins for these and other applications. Heretofore, collagenous proteins have been produced by use of such biological systems as yeasts, bacteria, and transgenic animals and plants. These products are normal collagens that can also be extracted from such sources as tendons, bones, and hides. These products cannot be made to consist only of biologically active, specific amino acid sequences that may be needed for specific applications. Prior to this invention, it had been established that fibrillar collagens consist of domains that are responsible for such processes as interaction with cells, binding of growth factors, and interaction with a number of structural proteins present in the extracellular matrix. A normal collagen consists of a sequence of domains that can be represented by a corresponding sequence of labels, e.g., D1D2D3D4. A collagenlike protein of the present invention contains regions of collagen II that contain multiples of a single domain (e.g., D1D1D1D1 or D4D4D4D4) chosen for its specific biological activity. By virtue of the multiplicity of the chosen domain, the density of sites having that specific biological activity is greater than it is in a normal collagen. A collagenlike protein according to this invention can thus be made to have properties that are necessary for tissue engineering.

  6. Untying Knots in Proteins

    OpenAIRE

    Sułkowska, Joanna I.; Sułkowski, Piotr; Szymczak, Piotr; Cieplak, Marek

    2010-01-01

    A shoelace can be readily untied by pulling its ends rather than its loops. Attempting to untie a native knot in a protein can also succeed or fail depending on where one pulls. However, thermal fluctuations induced by the surrounding water affect conformations stochastically and may add to the uncertainty of the outcome. When the protein is pulled by the termini, the knot can only get tightened, and any attempt at untying results in failure. We show that, by pulling specific amino acids, ...

  7. Digestibility of sorghum proteins.

    OpenAIRE

    Axtell, J D; Kirleis, A. W.; Hassen, M M; D'Croz Mason, N; Mertz, E T; Munck, L.

    1981-01-01

    Published information indicates that rice, maize, and wheat proteins are much more digestible in children than sorghum proteins are (66-81% compared with 46%). However, this digestibility difference cannot be demonstrated with the weanling rat, which gave digestibility values of 80% for cooked and 85% for uncooked sorghum gruels. Therefore, a search was made for a laboratory system sensitive to the digestibility differences between sorghum and other cereals. We found that porcine pepsin in vi...

  8. Identifying Unknown Proteins

    OpenAIRE

    Barker, Winona C.; Dayhoff, Margaret O.

    1983-01-01

    In this paper we discuss ways to identify a protein, both when its amino acid sequence is known and, particularly, prior to the determination of the complete sequence. If a similar sequence is in the Protein Sequence Database, an unknown may be identified on the basis of partial or ambiguous sequence data, or on the basis of amino acid composition. Identification in the early stages of structural determination can save time and scarce resources by preventing duplicate effort or by suggesting ...

  9. Proteins and their crystals

    Czech Academy of Sciences Publication Activity Database

    Kutá-Smatanová, Ivana; Hogg, T.; Hilgenfeld, R.; Grandori, R.; Carey, J.; Vácha, František; Štys, Dalibor

    2003-01-01

    Roč. 10, č. 1 (2003), s. 31-32. ISSN 1211-5894 R&D Projects: GA MŠk LN00A141; GA ČR GA206/00/D007 Institutional research plan: CEZ:AV0Z5051902; CEZ:MSM 123100001 Keywords : pokeweed antiviral protein * flavodoxin-like protein * PSII Subject RIV: EB - Genetics ; Molecular Biology

  10. Occupational protein contact dermatitis.

    Science.gov (United States)

    Barbaud, Annick; Poreaux, Claire; Penven, Emmanuelle; Waton, Julie

    2015-12-01

    Occupational contact dermatitis is generally caused by haptens but can also be induced by proteins causing mainly immunological contact urticaria (ICU); chronic hand eczema in the context of protein contact dermatitis (PCD). In a monocentric retrospective study, from our database, only 31 (0.41%) of patients with contact dermatitis had positive skin tests with proteins: 22 had occupational PCD, 3 had non-occupational PCD, 5 occupational ICU and 1 cook had a neutrophilic fixed food eruption (NFFE) due to fish. From these results and analysis of literature, the characteristics of PCD can be summarized as follows. It is a chronic eczematous dermatitis, possibly exacerbated by work, suggestive if associated with inflammatory perionyxix and immediate erythema with pruritis, to be investigated when the patient resumes work after a period of interruption. Prick tests with the suspected protein-containing material are essential, as patch tests have negative results. In case of multisensitisation revealed by prick tests, it is advisable to analyse IgE against recombinant allergens. A history of atopy, found in 56 to 68% of the patients, has to be checked for. Most of the cases are observed among food-handlers but PCD can also be due to non-edible plants, latex, hydrolysed proteins or animal proteins. Occupational exposure to proteins can thus lead to the development of ICU. Reflecting hypersensitivity to very low concentrations of allergens, investigating ICU therefore requires caution and prick tests should be performed with a diluted form of the causative protein-containing product. Causes are food, especially fruit peel, non-edible plants, cosmetic products, latex, animals. PMID:26242922

  11. Protein hydrolysates in sports nutrition

    Directory of Open Access Journals (Sweden)

    Manninen Anssi H

    2009-09-01

    Full Text Available Abstract It has been suggested that protein hydrolysates providing mainly di- and tripeptides are superior to intact (whole proteins and free amino acids in terms of skeletal muscle protein anabolism. This review provides a critical examination of protein hydrolysate studies conducted in healthy humans with special reference to sports nutrition. The effects of protein hydrolysate ingestion on blood amino acid levels, muscle protein anabolism, body composition, exercise performance and muscle glycogen resynthesis are discussed.

  12. Protein Functionality in Food Systems

    Institute of Scientific and Technical Information of China (English)

    WANG Panpan

    2010-01-01

    The structure,shape,color,smell and taste of food were decided by protein functionality.The utilization of protein will improve by changing the protein functionality.Protein functionality is also advantage to maintain and utilize the nutrition of food.This paper summarized the nature,classification,factors and prospect of protein functionality.It ccn provide a theoretical basis for application of protein in food industry.

  13. Protein Databases on the Internet

    OpenAIRE

    Xu, Dong

    2004-01-01

    Protein databases have become a crucial part of modern biology. Huge amounts of data for protein structures, functions, and particularly sequences are being generated. Searching databases is often the first step in the study of a new protein. Comparison between proteins or between protein families provides information about the relationship between proteins within a genome or across different species, and hence offers much more information than can be obtained by studying only an isolated pro...

  14. More protein in cereals?

    International Nuclear Information System (INIS)

    Ways in which the protein content of plant crops may be raised by the use of nuclear radiation are to be discussed at a symposium in Vienna in June next year, organized by the joint Food and Agriculture Organization/Agency Division of Atomic Energy in Food and Agriculture. Plant crops - especially cereal grains - are the basic food and protein source of most of the world's population, particularly in less-developed countries. But their natural protein content is low; increasing the quantity and nutritional quality of plant protein is potentially the most feasible way to combat widespread protein malnutrition. This improvement in seed stock can be achieved by plant breeding methods in which nuclear irradiation techniques are used to induce mutations in grain, and other isotopic techniques can be used to select only those mutants which have the desired properties. The scientists who attend the symposium will have an opportunity to review what mutation plant breeders have achieved, the application of nuclear techniques to screening for protein and amino-acid content and nutritional value, and isotopic methods which contribute to research in plant nutrition and physiology. (author)

  15. Stretching to Understand Proteins

    Science.gov (United States)

    Cieplak, Marek

    2007-03-01

    Mechanical stretching of single proteins has been studied experimentally for about 50 proteins yielding a variety of force patterns and values of the peak forces. We have performed a theoretical survey of 7749 proteins of known native structure and map out the landscape of possible dynamical behaviors unders stretching at constant speed. The model used is constructed based on the native geometry. It is solved by methods of molecular dynamics and validated by comparing the theoretical predictions to experimental results. We characterize the distribution of peak forces and on correlations with the system size and with the structure classification as characterized by the CATH scheme. We identify proteins with the biggest forces and show that they belong to few topology classes. We determine which protein segments act as mechanical clamps and show that, in most cases, they correspond to long stretches of parallel beta-strands, but other mechanisms are also possible. We then consider stretching by fluid flows. We show that unfolding induced by a uniform flow shows a richer behavior than that in the force clamp. The dynamics of unfolding is found to depend strongly on the selection of the amino acid, usually one of the termini, which is anchored. These features offer potentially wider diagnostic tools to investigate structure of proteins compared to experiments based on the atomic force microscopy.

  16. Inferring protein function by domain context similarities in protein-protein interaction networks

    OpenAIRE

    Sun Zhirong; Liu Ke; Chen Hu; Zhang Song

    2009-01-01

    Abstract Background Genome sequencing projects generate massive amounts of sequence data but there are still many proteins whose functions remain unknown. The availability of large scale protein-protein interaction data sets makes it possible to develop new function prediction methods based on protein-protein interaction (PPI) networks. Although several existing methods combine multiple information resources, there is no study that integrates protein domain information and PPI networks to pre...

  17. ADSORPTION OF PROTEIN ON NANOPARTICLES

    Institute of Scientific and Technical Information of China (English)

    WU Qi

    1994-01-01

    The adsorption of protein on nanoparticles was studied by using dynamic light scattering to measure the hydrodynamic size of both pure protein and nanoparticles adsorbed with different amounts of protein. The thickness of the adsorbed protein layer increases as protein concentration, but decreases as the initial size of nanoparticles. After properly scaling the thickness with the initial diameter, we are able to fit all experimental data with a single master curve. Our experimental results suggest that the adsorbed proteins form a monolayeron the nanoparticle surface and the adsorbed protein molecules are attached to the particle surface at many points through a possible hydrogen-bonding. Our results also indicate that as protein concentration increases, the overall shape of the adsorbed protein molecule continuously changes from a flat layer on the particle surface to a stretched coil extended into water. During the change, the hydrodynamic volume of the adsorbed protein increases linearly with protein concentration.

  18. Measuring protein breakdown rate in individual proteins in vivo

    DEFF Research Database (Denmark)

    Holm, Lars; Kjaer, Michael

    2010-01-01

    To outline different approaches of how protein breakdown can be quantified and to present a new approach to determine the fractional breakdown rate of individual slow turnover proteins in vivo.......To outline different approaches of how protein breakdown can be quantified and to present a new approach to determine the fractional breakdown rate of individual slow turnover proteins in vivo....

  19. Histophilus somni Surface Proteins.

    Science.gov (United States)

    Corbeil, Lynette B

    2016-01-01

    The pathogen surface is usually the first site of interaction with the host. Histophilus somni was earlier thought to only have an outer membrane on its surface. Now it is known that the surface is composed of many virulence factors, including outer membrane proteins, lipooligosaccharide or endotoxin, a fibrillar network, and an exopolysaccharide. Outer membrane blebs, endotoxin, the fibrillar network, and the exopolysaccharide are also shed from the surface. This review will focus on the surface proteins of this pathogen that may colonize the mucosal surface of ruminants as a commensal or may cause pneumonia, septicemia, myocarditis, thrombotic meningoencephalitis, arthritis, and/or abortion. The major outer membrane protein has been well studied. Since its size and epitopes vary from strain to strain, it may be useful for typing strains. Iron-regulated OMPs have also received much attention because of their role in iron uptake for in vivo growth of H. somni. Other OMPs may be protective, based on passive immunization with monospecific antibodies and active immunization experiments. The surface and shed fibrillar network has been shown to be an immunoglobulin-binding protein in that it binds bovine IgG2 by the Fc portion. Two repeat domains (DR1 and DR2) have cytotoxic Fic motifs. Vaccine studies with recombinant DR2 are promising. Studies of the bacterial genome as well as comparison of surface proteins of different strains from the various H. somni syndromes and carrier states will be discussed and have provided much insight into pathogenesis and protection. PMID:26728061

  20. Ontology integration to identify protein complex in protein interaction networks

    OpenAIRE

    Yang Zhihao; Lin Hongfei; Xu Bo

    2011-01-01

    Abstract Background Protein complexes can be identified from the protein interaction networks derived from experimental data sets. However, these analyses are challenging because of the presence of unreliable interactions and the complex connectivity of the network. The integration of protein-protein interactions with the data from other sources can be leveraged for improving the effectiveness of protein complexes detection algorithms. Methods We have developed novel semantic similarity metho...

  1. Identifying Protein-Protein Interaction Sites Using Covering Algorithm

    OpenAIRE

    Jie Song; Jiaxing Cheng; Xiuquan Du

    2009-01-01

    Identification of protein-protein interface residues is crucial for structural biology. This paper proposes a covering algorithm for predicting protein-protein interface residues with features including protein sequence profile and residue accessible area. This method adequately utilizes the characters of a covering algorithm which have simple, lower complexity and high accuracy for high dimension data. The covering algorithm can achieve a comparable performance (69.62%, Complete dataset; 60....

  2. Protein-Protein Interaction Detection: Methods and Analysis

    OpenAIRE

    V. Srinivasa Rao; Srinivas, K.; Sujini, G. N.; G. N. Sunand Kumar

    2014-01-01

    Protein-protein interaction plays key role in predicting the protein function of target protein and drug ability of molecules. The majority of genes and proteins realize resulting phenotype functions as a set of interactions. The in vitro and in vivo methods like affinity purification, Y2H (yeast 2 hybrid), TAP (tandem affinity purification), and so forth have their own limitations like cost, time, and so forth, and the resultant data sets are noisy and have more false positives to annotate t...

  3. Protein Microarray On-Demand: A Novel Protein Microarray System

    OpenAIRE

    Chatterjee, Deb K.; Sitaraman, Kalavathy; Baptista, Cassio; Hartley, James; Hill, Thomas M.; David J. Munroe

    2008-01-01

    We describe a novel, simple and low-cost protein microarray strategy wherein the microarrays are generated by printing expression ready plasmid DNAs onto slides that can be converted into protein arrays on-demand. The printed expression plasmids serve dual purposes as they not only direct the synthesis of the protein of interest; they also serve to capture the newly synthesized proteins through a high affinity DNA-protein interaction. To accomplish this we have exploited the high-affinity bin...

  4. Immunocytochemical heterogeneity of somatostatin-expressing GABAergic interneurons in layers II and III of the mouse cingulate cortex: A combined immunofluorescence/design-based stereologic study.

    Science.gov (United States)

    Riedemann, Therese; Schmitz, Christoph; Sutor, Bernd

    2016-08-01

    Many neurological diseases including major depression and schizophrenia manifest as dysfunction of the GABAergic system within the cingulate cortex. However, relatively little is known about the properties of GABAergic interneurons in the cingulate cortex. Therefore, we investigated the neurochemical properties of GABAergic interneurons in the cingulate cortex of FVB-Tg(GadGFP)45704Swn/J mice expressing green fluorescent protein (GFP) in a subset of GABAergic interneurons (GFP-expressing inhibitory interneurons [GINs]) by means of immunocytochemical and design-based stereologic techniques. We found that GINs represent around 12% of all GABAergic interneurons in the cingulate cortex. In contrast to other neocortical areas, GINs were only found in cortical layers II and III. More than 98% of GINs coexpressed the neuropeptide somatostatin (SOM), but only 50% of all SOM + neurons were GINs. By analyzing the expression of calretinin (CR), calbindin (CB), parvalbumin, and various neuropeptides, we identified several distinct GIN subgroups. In particular, we observed coexpression of SOM with CR and CB. In addition, we found neuropeptide Y expression almost exclusively in those GINs that coexpressed SOM and CR. Thus, with respect to the expression of calcium-binding proteins and neuropeptides, GINs are surprisingly heterogeneous in the mouse cingulate cortex, and the minority of GINs express only one marker protein or peptide. Furthermore, our observation of overlap between the SOM + and CR + interneuron population was in contrast to earlier findings of non-overlapping SOM + and CR + interneuron populations in the human cortex. This might indicate that findings in mouse models of neuropsychiatric diseases may not be directly transferred to human patients. J. Comp. Neurol. 524:2281-2299, 2016. © 2015 Wiley Periodicals, Inc. PMID:26669716

  5. Polarizable protein packing

    KAUST Repository

    Ng, Albert H.

    2011-01-24

    To incorporate protein polarization effects within a protein combinatorial optimization framework, we decompose the polarizable force field AMOEBA into low order terms. Including terms up to the third-order provides a fair approximation to the full energy while maintaining tractability. We represent the polarizable packing problem for protein G as a hypergraph and solve for optimal rotamers with the FASTER combinatorial optimization algorithm. These approximate energy models can be improved to high accuracy [root mean square deviation (rmsd) < 1 kJ mol -1] via ridge regression. The resulting trained approximations are used to efficiently identify new, low-energy solutions. The approach is general and should allow combinatorial optimization of other many-body problems. © 2011 Wiley Periodicals, Inc. J Comput Chem, 2011 Copyright © 2011 Wiley Periodicals, Inc.

  6. Polarizable protein packing.

    Science.gov (United States)

    Ng, Albert H; Snow, Christopher D

    2011-05-01

    To incorporate protein polarization effects within a protein combinatorial optimization framework, we decompose the polarizable force field AMOEBA into low order terms. Including terms up to the third-order provides a fair approximation to the full energy while maintaining tractability. We represent the polarizable packing problem for protein G as a hypergraph and solve for optimal rotamers with the FASTER combinatorial optimization algorithm. These approximate energy models can be improved to high accuracy [root mean square deviation (rmsd) < 1 kJ mol(-1)] via ridge regression. The resulting trained approximations are used to efficiently identify new, low-energy solutions. The approach is general and should allow combinatorial optimization of other many-body problems. PMID:21264879

  7. Electron transfer in proteins.

    Science.gov (United States)

    Gray, H B; Winkler, J R

    1996-01-01

    Electron-transfer (ET) reactions are key steps in a diverse array of biological transformations ranging from photosynthesis to aerobic respiration. A powerful theoretical formalism has been developed that describes ET rates in terms of two parameters: the nuclear reorganization energy (lambda) and the electronic-coupling strength (HAB). Studies of ET reactions in ruthenium-modified proteins have probed lambda and HAB in several metalloproteins (cytochrome c, myoglobin, azurin). This work has shown that protein reorganization energies are sensitive to the medium surrounding the redox sites and that an aqueous environment, in particular, leads to large reorganization energies. Analyses of electronic-coupling strengths suggest that the efficiency of long-range ET depends on the protein secondary structure: beta sheets appear to mediate coupling more efficiently than alpha-helical structures, and hydrogen bonds play a critical role in both. PMID:8811189

  8. Accessory Proteins at ERES

    DEFF Research Database (Denmark)

    Klinkenberg, Rafael David

    proteins. Together these components co‐operate in cargo‐selection as well as forming, loading and releasing budding vesicles from specific regions on the membrane surface of the ER. Coat components furthermore convey vesicle targeting towards the Golgi. However, not much is known about the mechanisms that...... regulate the COPII assembly at the vesicle bud site. This thesis provides the first regulatory mechanism of COPII assembly in relation to ER‐membrane lipid‐signal recognition by the accessory protein p125A (Sec23IP). The aim of the project was to characterize p125A function by dissecting two main domains...... in the protein; a putative lipid‐associating domain termed the DDHD domain that is defined by the four amino acid motif that gives the domain its name; and a ubiquitously found domain termed Sterile α‐motif (SAM), which is mostly associated with oligomerization and polymerization. We first show, that...

  9. Sound of proteins

    DEFF Research Database (Denmark)

    2007-01-01

    In my group we work with Molecular Dynamics to model several different proteins and protein systems. We submit our modelled molecules to changes in temperature, changes in solvent composition and even external pulling forces. To analyze our simulation results we have so far used visual inspection...... and statistical analysis of the resulting molecular trajectories (as everybody else!). However, recently I started assigning a particular sound frequency to each amino acid in the protein, and by setting the amplitude of each frequency according to the movement amplitude we can "hear" whenever two aminoacids....... These are early days, and it still remains to be proven that this method has any advantage over other methods, but at least it is fun to do and the harmonies produced invoke an eerie sounding futuristic landscape...

  10. Ubiquitin domain proteins in disease

    DEFF Research Database (Denmark)

    Klausen, Louise Kjær; Schulze, Andrea; Seeger, Michael;

    2007-01-01

    The human genome encodes several ubiquitin-like (UBL) domain proteins (UDPs). Members of this protein family are involved in a variety of cellular functions and many are connected to the ubiquitin proteasome system, an essential pathway for protein degradation in eukaryotic cells. Despite their...... and cancer. Publication history: Republished from Current BioData's Targeted Proteins database (TPdb; http://www.targetedproteinsdb.com)....

  11. SOY PROTEIN NANOPARTICLES AND NANOCOMPOSITES

    Science.gov (United States)

    Soy protein isolate (SPI) is obtained from soybean by removing soybean oil and soy carbohydrates. SPI contains more than 90% protein. Structurally, SPI is a globular protein and its aggregates in water consist of sphere-like protein particles. The number average aggregate size of SPI at pH=5.2 is...

  12. The Formation of Protein Structure

    DEFF Research Database (Denmark)

    Bohr, Jakob; Bohr, Henrik; Brunak, Søren

    1996-01-01

    Dynamically induced curvature owing to long-range excitations along the backbones of protein molecules with non-linear elastic properties may control the folding of proteins.......Dynamically induced curvature owing to long-range excitations along the backbones of protein molecules with non-linear elastic properties may control the folding of proteins....

  13. Vibrational spectroscopy of proteins

    International Nuclear Information System (INIS)

    Two important steps for the development of a biosensor are the immobilization of the biological component (e.g. protein) on a surface and the enhancement of the signal to improve the sensitivity of detection. To address these subjects, the present work describes Fourier transform infrared (FTIR) investigations of several proteins bound to the surface of an attenuated total reflection (ATR) crystal. Furthermore, new nanostructured surfaces for signal enhancement were developed for use in FTIR microscopy. The mitochondrial redox-protein cytochrome c oxidase (CcO) was incorporated into a protein-tethered bilayer lipid membrane (ptBLM) on an ATR crystal featuring a roughened two-layer gold surface for signal enhancement. Electrochemical excitation by periodic potential pulses at different modulation frequencies was followed by time-resolved FTIR spectroscopy. Phase sensitive detection was used for deconvolution of the IR spectra into vibrational components. A model based on protonation-dependent chemical reaction kinetics could be fitted to the time evolution of IR bands attributed to several different redox centers of the CcO. Further investigations involved the odorant binding protein 14 (OBP14) of the honey bee (Apis mellifera), which was studied using ATR-FTIR spectroscopy and circular dichroism. OBP14 was found to be thermally stable up to 45 °C, thus permitting the potential application of this protein for the fabrication of biosensors. Thermal denaturation measurements showed that odorant binding increases the thermal stability of the OBP-odorant complex. In another project, plasmonic nanostructures were fabricated that enhance the absorbance in FTIR microscopy measurements. The nanostructures are composed of an array of round-shaped insulator and gold discs on top of a continuous gold layer. Enhancement factors of up to ⁓125 could be observed with self-assembled monolayers of dodecanethiol molecules immobilized on the gold surface (author)

  14. Modeling Mercury in Proteins.

    Science.gov (United States)

    Parks, J M; Smith, J C

    2016-01-01

    Mercury (Hg) is a naturally occurring element that is released into the biosphere both by natural processes and anthropogenic activities. Although its reduced, elemental form Hg(0) is relatively nontoxic, other forms such as Hg(2+) and, in particular, its methylated form, methylmercury, are toxic, with deleterious effects on both ecosystems and humans. Microorganisms play important roles in the transformation of mercury in the environment. Inorganic Hg(2+) can be methylated by certain bacteria and archaea to form methylmercury. Conversely, bacteria also demethylate methylmercury and reduce Hg(2+) to relatively inert Hg(0). Transformations and toxicity occur as a result of mercury interacting with various proteins. Clearly, then, understanding the toxic effects of mercury and its cycling in the environment requires characterization of these interactions. Computational approaches are ideally suited to studies of mercury in proteins because they can provide a detailed molecular picture and circumvent issues associated with toxicity. Here, we describe computational methods for investigating and characterizing how mercury binds to proteins, how inter- and intraprotein transfer of mercury is orchestrated in biological systems, and how chemical reactions in proteins transform the metal. We describe quantum chemical analyses of aqueous Hg(II), which reveal critical factors that determine ligand-binding propensities. We then provide a perspective on how we used chemical reasoning to discover how microorganisms methylate mercury. We also highlight our combined computational and experimental studies of the proteins and enzymes of the mer operon, a suite of genes that confer mercury resistance in many bacteria. Lastly, we place work on mercury in proteins in the context of what is needed for a comprehensive multiscale model of environmental mercury cycling. PMID:27497164

  15. Mining protein structure data

    OpenAIRE

    Santos, José Carlos Almeida

    2006-01-01

    The principal topic of this work is the application of data mining techniques, in particular of machine learning, to the discovery of knowledge in a protein database. In the first chapter a general background is presented. Namely, in section 1.1 we overview the methodology of a Data Mining project and its main algorithms. In section 1.2 an introduction to the proteins and its supporting file formats is outlined. This chapter is concluded with section 1.3 which defines that main problem we...

  16. Protein-based ferrogels.

    Science.gov (United States)

    Mody, Puja; Hart, Cassidy; Romano, Siena; El-Magbri, Mariam; Esson, Moira M; Ibeh, Trisha; Knowlton, Elizabeth D; Zhang, Ming; Wagner, Michael J; Hartings, Matthew R

    2016-06-01

    We present a novel synthesis in which hemoglobin and Fe(2+) react, in the presence of KNO3 and KOH, to produce protein microgels that contain magnetic iron oxide nanoparticles. The synthesis results in microgels with polymer properties (denaturing and glass transition temperatures) that are consistent with the dried protein. The iron oxide nanoparticles that exhibit an average diameter of 22nm, are ferrimagnetic, and display properties consistent with Fe3O4. The multiple functional capabilities displayed by these materials: biocompatibility, magnetism, dye uptake and controlled release, and other properties archetypal of hydrogels, will make the magnetic hydrogels attractive for a number of biomedical applications. PMID:26901627

  17. Lipid-transfer proteins.

    Science.gov (United States)

    Ng, Tzi Bun; Cheung, Randy Chi Fai; Wong, Jack Ho; Ye, Xiujuan

    2012-01-01

    Lipid-transfer proteins (LTPs) are basic proteins found in abundance in higher plants. LTPs play lots of roles in plants such as participation in cutin formation, embryogenesis, defense reactions against phytopathogens, symbiosis, and the adaptation of plants to various environmental conditions. In addition, LTPs from field mustard and Chinese daffodil exhibit antiproliferative activity against human cancer cells. LTPs from chili pepper and coffee manifest inhibitory activity against fungi pathogenic to humans such as Candida species. The intent of this article is to review LTPs in the plant kingdom. PMID:23193591

  18. Chirality and Protein Folding

    OpenAIRE

    Kwiecinska, Joanna I.; Cieplak, Marek

    2004-01-01

    There are several simple criteria of folding to a native state in model proteins. One of them involves crossing of a threshold value of the RMSD distance away from the native state. Another checks whether all native contacts are established, i.e. whether the interacting amino acids come closer than some characteristic distance. We use Go-like models of proteins and show that such simple criteria may prompt one to declare folding even though fragments of the resulting conformations have a wron...

  19. Conformation Distributions in Adsorbed Proteins.

    Science.gov (United States)

    Meuse, Curtis W.; Hubbard, Joseph B.; Vrettos, John S.; Smith, Jackson R.; Cicerone, Marcus T.

    2007-03-01

    While the structural basis of protein function is well understood in the biopharmaceutical and biotechnology industries, few methods for the characterization and comparison of protein conformation distributions are available. New methods capable of measuring the stability of protein conformations and the integrity of protein-protein, protein-ligand and protein-surface interactions both in solution and on surfaces are needed to help the development of protein-based products. We are developing infrared spectroscopy methods for the characterization and comparison of molecular conformation distributions in monolayers and in solutions. We have extracted an order parameter describing the orientational and conformational variations of protein functional groups around the average molecular values from a single polarized spectrum. We will discuss the development of these methods and compare them to amide hydrogen/deuterium exchange methods for albumin in solution and on different polymer surfaces to show that our order parameter is related to protein stability.

  20. G Protein-coupled receptors

    OpenAIRE

    Ross, Elliott M.

    2014-01-01

    G protein-coupled receptors and heterotrimeric G proteins can diffuse laterally in the plasma membrane such that one receptor can catalyze the activation (GDP/GTP exchange) of multiple G proteins. In some cases, these processes are fast enough to support molecular signal amplification, where a single receptor maintains the activation of multiple G proteins at steady-state. Amplification in cells is probably highly regulated. It depends upon the identities of the G receptor and G protein - som...

  1. Protein stability, flexibility and function

    DEFF Research Database (Denmark)

    Teilum, Kaare; Olsen, Johan G; Kragelund, Birthe B

    2011-01-01

    Proteins rely on flexibility to respond to environmental changes, ligand binding and chemical modifications. Potentially, a perturbation that changes the flexibility of a protein may interfere with its function. Millions of mutations have been performed on thousands of proteins in quests for a...... data presented is it clear that there are specific sites (flexibility hotspots) in proteins that are important for both binding and stability. This article is part of a Special Issue entitled: Protein Dynamics: Experimental and Computational Approaches....

  2. Protein oxidation in aquatic foods

    DEFF Research Database (Denmark)

    Baron, Caroline P.

    oxidation. The protein carbonyl group measurement is the widely used method for estimating protein oxidation in foods and has been used in fish muscle. The chapter also talks about the impact of protein oxidation on protein functionality, fish muscle texture, and food nutritional value. Protein oxidation...... may not only induce quality losses but may be desirable in some type of foods, such as salted herring....

  3. Measuring protein breakdown in individual proteins in vivo

    DEFF Research Database (Denmark)

    Holm, Lars; Kjær, Michael

    2010-01-01

    PURPOSE OF REVIEW: To outline different approaches of how protein breakdown can be quantified and to present a new approach to determine the fractional breakdown rate of individual slow turnover proteins in vivo. RECENT FINDINGS: None of the available methods for determining protein breakdown can...... be used to determine the breakdown rate of specific proteins and, therefore, do not keep up to the preceding methodological demands in physiological research. A newly developed approach to determine the fractional breakdown rate of single proteins seems promising. Its conceptual advantage is that the...... proteins of interest are the site of measurement. Hence, the application initially demands the proteins to be labeled with stable isotopically labeled amino acids. Subsequently, the loss of label from the proteins will be dependent on the protein breakdown rate when no labeled amino acids are...

  4. Integral UBL domain proteins: a family of proteasome interacting proteins

    DEFF Research Database (Denmark)

    Hartmann-Petersen, Rasmus; Gordon, Colin

    2004-01-01

    The family of ubiquitin-like (UBL) domain proteins (UDPs) comprises a conserved group of proteins involved in a multitude of different cellular activities. However, recent studies on UBL-domain proteins indicate that these proteins appear to share a common property in their ability to interact with......-domain proteins catalyse the formation of ubiquitin-protein conjugates, whereas others appear to target ubiquitinated proteins for degradation and interact with chaperones. Hence, by binding to the 26S proteasome the UBL-domain proteins seem to tailor and direct the basic proteolytic functions of the particle to...... 26S proteasomes. The 26S proteasome is a multisubunit protease which is responsible for the majority of intracellular proteolysis in eukaryotic cells. Before degradation commences most proteins are first marked for destruction by being coupled to a chain of ubiquitin molecules. Some UBL...

  5. Interaction between plate make and protein in protein crystallisation screening.

    Directory of Open Access Journals (Sweden)

    Gordon J King

    Full Text Available BACKGROUND: Protein crystallisation screening involves the parallel testing of large numbers of candidate conditions with the aim of identifying conditions suitable as a starting point for the production of diffraction quality crystals. Generally, condition screening is performed in 96-well plates. While previous studies have examined the effects of protein construct, protein purity, or crystallisation condition ingredients on protein crystallisation, few have examined the effect of the crystallisation plate. METHODOLOGY/PRINCIPAL FINDINGS: We performed a statistically rigorous examination of protein crystallisation, and evaluated interactions between crystallisation success and plate row/column, different plates of same make, different plate makes and different proteins. From our analysis of protein crystallisation, we found a significant interaction between plate make and the specific protein being crystallised. CONCLUSIONS/SIGNIFICANCE: Protein crystal structure determination is the principal method for determining protein structure but is limited by the need to produce crystals of the protein under study. Many important proteins are difficult to crystallize, so that identification of factors that assist crystallisation could open up the structure determination of these more challenging targets. Our findings suggest that protein crystallisation success may be improved by matching a protein with its optimal plate make.

  6. HIV protein sequence hotspots for crosstalk with host hub proteins.

    Directory of Open Access Journals (Sweden)

    Mahdi Sarmady

    Full Text Available HIV proteins target host hub proteins for transient binding interactions. The presence of viral proteins in the infected cell results in out-competition of host proteins in their interaction with hub proteins, drastically affecting cell physiology. Functional genomics and interactome datasets can be used to quantify the sequence hotspots on the HIV proteome mediating interactions with host hub proteins. In this study, we used the HIV and human interactome databases to identify HIV targeted host hub proteins and their host binding partners (H2. We developed a high throughput computational procedure utilizing motif discovery algorithms on sets of protein sequences, including sequences of HIV and H2 proteins. We identified as HIV sequence hotspots those linear motifs that are highly conserved on HIV sequences and at the same time have a statistically enriched presence on the sequences of H2 proteins. The HIV protein motifs discovered in this study are expressed by subsets of H2 host proteins potentially outcompeted by HIV proteins. A large subset of these motifs is involved in cleavage, nuclear localization, phosphorylation, and transcription factor binding events. Many such motifs are clustered on an HIV sequence in the form of hotspots. The sequential positions of these hotspots are consistent with the curated literature on phenotype altering residue mutations, as well as with existing binding site data. The hotspot map produced in this study is the first global portrayal of HIV motifs involved in altering the host protein network at highly connected hub nodes.

  7. Characterization of Protein Complexes and Subcomplexes in Protein-Protein Interaction Databases

    OpenAIRE

    Nazar Zaki; Elfadil A. Mohamed; Antonio Mora

    2015-01-01

    The identification and characterization of protein complexes implicated in protein-protein interaction data are crucial to the understanding of the molecular events under normal and abnormal physiological conditions. This paper provides a novel characterization of subcomplexes in protein interaction databases, stressing definition and representation issues, quantification, biological validation, network metrics, motifs, modularity, and gene ontology (GO) terms. The paper introduces the concep...

  8. Protein Molecular Structures, Protein SubFractions, and Protein Availability Affected by Heat Processing: A Review

    Directory of Open Access Journals (Sweden)

    Peiqiang Yu

    2007-01-01

    Full Text Available The utilization and availability of protein depended on the types of protein and their specific susceptibility to enzymatic hydrolysis (inhibitory activities in the gastrointestine and was highly associated with protein molecular structures. Studying internal protein structure and protein subfraction profiles leaded to an understanding of the components that make up a whole protein. An understanding of the molecular structure of the whole protein was often vital to understanding its digestive behavior and nutritive value in animals. In this review, recently obtained information on protein molecular structural effects of heat processing was reviewed, in relation to protein characteristics affecting digestive behavior and nutrient utilization and availability. The emphasis of this review was on (1 using the newly advanced synchrotron technology (S-FTIR as a novel approach to reveal protein molecular chemistry affected by heat processing within intact plant tissues; (2 revealing the effects of heat processing on the profile changes of protein subfractions associated with digestive behaviors and kinetics manipulated by heat processing; (3 prediction of the changes of protein availability and supply after heat processing, using the advanced DVE/OEB and NRC-2001 models, and (4 obtaining information on optimal processing conditions of protein as intestinal protein source to achieve target values for potential high net absorbable protein in the small intestine. The information described in this article may give better insight in the mechanisms involved and the intrinsic protein molecular structural changes occurring upon processing.

  9. Cla4p, a Saccharomyces cerevisiae Cdc42p-activated kinase involved in cytokinesis, is activated at mitosis.

    OpenAIRE

    Benton, B K; Tinkelenberg, A; Gonzalez, I.; Cross, F R

    1997-01-01

    Yeasts have three functionally redundant G1 cyclins required for cell cycle progression through G1. Mutations in GIN4 and CLA4 were isolated in a screen for mutants that are inviable with deletions in the G1 cyclins CLN1 and CLN2. cln1 cln2 cla4 and cln1 cln2 gin4 cells arrest with a cytokinesis defect; this defect was efficiently rescued by CLN1 or CLN2 expression. GIN4 encodes a protein with strong homology to the Snflp serine/threonine kinase. Cla4p is homologous to mammalian p21-activated...

  10. Transient protein-protein interactions visualized by solution NMR.

    Science.gov (United States)

    Liu, Zhu; Gong, Zhou; Dong, Xu; Tang, Chun

    2016-01-01

    Proteins interact with each other to establish their identities in cell. The affinities for the interactions span more than ten orders of magnitude, and KD values in μM-mM regimen are considered transient and are important in cell signaling. Solution NMR including diamagnetic and paramagnetic techniques has enabled atomic-resolution depictions of transient protein-protein interactions. Diamagnetic NMR allows characterization of protein complexes with KD values up to several mM, whereas ultraweak and fleeting complexes can be modeled with the use of paramagnetic NMR especially paramagnetic relaxation enhancement (PRE). When tackling ever-larger protein complexes, PRE can be particularly useful in providing long-range intermolecular distance restraints. As NMR measurements are averaged over the ensemble of complex structures, structural information for dynamic protein-protein interactions besides the stereospecific one can often be extracted. Herein the protein interaction dynamics are exemplified by encounter complexes, alternative binding modes, and coupled binding/folding of intrinsically disordered proteins. Further integration of NMR with other biophysical techniques should allow better visualization of transient protein-protein interactions. In particular, single-molecule data may facilitate the interpretation of ensemble-averaged NMR data. Though same structures of proteins and protein complexes were found in cell as in diluted solution, we anticipate that the dynamics of transient protein protein-protein interactions be different, which awaits awaits exploration by NMR. This article is part of a Special Issue entitled: Physiological Enzymology and Protein Functions. This article is part of a Special Issue entitled: Physiological Enzymology and Protein Functions. PMID:25896389

  11. Protein (Viridiplantae): 308810769 [

    Lifescience Database Archive (English)

    Full Text Available XP_003082693.1 33090:1723 3041:2182 1035538:123 13792:123 70447:3706 70448:4753 K+-channel ERG a ... nd related proteins, contain PAS /PAC sensor domain (ISS) Ostreococcus tauri MHFNADL ...

  12. Protein (Viridiplantae): 308809165 [

    Lifescience Database Archive (English)

    Full Text Available XP_003081892.1 33090:2400 3041:801 1035538:331 13792:331 70447:681 70448:136 K+-channel ERG and ... related proteins, contain PAS /PAC sensor domain (ISS) Ostreococcus tauri MPSTAGM ...

  13. Protein (Viridiplantae): 357507515 [

    Lifescience Database Archive (English)

    Full Text Available XP_003624046.1 33090:6310 35493:7221 131221:7221 3193:7221 58023:3109 78536:1898 58024:1898 3398 ... 803:6139 3814:6139 163742:7708 3877:7708 3880:7708 Nematode ... resistance-like protein Medicago truncatula MTLPLA ...

  14. Protein (Viridiplantae): 225448363 [

    Lifescience Database Archive (English)

    Full Text Available XP_002268520.1 33090:30695 35493:21281 131221:21281 3193:21281 58023:14619 78536:14658 58024:146 ... 667:4453 3602:4453 3603:4453 29760:4453 PREDICTED: nematode ... resistance protein-like HSPRO2 isoform 1 Vitis vin ...

  15. Protein (Viridiplantae): 226529483 [

    Lifescience Database Archive (English)

    Full Text Available NP_001151109.1 33090:30695 35493:21281 131221:21281 3193:21281 58023:14619 78536:14658 58024:146 ... 0:6136 147369:6136 147429:6136 4575:6020 4577:6020 nematode -resistance protein Zea mays MATPDLSPVSPVRRDDKQCAPS ...

  16. Protein (Viridiplantae): 357125930 [

    Lifescience Database Archive (English)

    Full Text Available XP_003564642.1 33090:30695 35493:21281 131221:21281 3193:21281 58023:14619 78536:14658 58024:146 ... :4262 147385:4262 15367:4262 15368:4262 PREDICTED: nematode ... resistance protein-like HSPRO1-like Brachypodium d ...

  17. Protein (Viridiplantae): 356553794 [

    Lifescience Database Archive (English)

    Full Text Available XP_003545237.1 33090:30695 35493:21281 131221:21281 3193:21281 58023:14619 78536:14658 58024:146 ... 14:9870 163735:3769 3846:3769 3847:3769 PREDICTED: nematode ... resistance protein-like HSPRO2-like Glycine max MV ...

  18. Protein (Viridiplantae): 357492609 [

    Lifescience Database Archive (English)

    Full Text Available XP_003616593.1 33090:30695 35493:21281 131221:21281 3193:21281 58023:14619 78536:14658 58024:146 ... :9870 3814:9870 163742:15503 3877:15503 3880:15503 Nematode ... resistance HS1pro1 protein Medicago truncatula MVD ...

  19. Protein (Viridiplantae): 351726303 [

    Lifescience Database Archive (English)

    Full Text Available NP_001236610.1 33090:30695 35493:21281 131221:21281 3193:21281 58023:14619 78536:14658 58024:146 ... 803:9870 3814:9870 163735:3769 3846:3769 3847:3769 nematode ... resistance HS1pro1 protein Glycine max MVDLDWQTKMV ...

  20. Protein (Viridiplantae): 350537949 [

    Lifescience Database Archive (English)

    Full Text Available NP_001234063.1 33090:6270 35493:2337 131221:2337 3193:2337 58023:2583 78536:1868 58024:1868 3398 ... 4 424574:154 4107:154 49274:154 4081:154 root-knot nematode ... resistance protein Solanum lycopersicum MEKRKDIEEA ...

  1. Protein (Viridiplantae): 356568543 [

    Lifescience Database Archive (English)

    Full Text Available XP_003552470.1 33090:30695 35493:21281 131221:21281 3193:21281 58023:14619 78536:14658 58024:146 ... 14:9870 163735:3769 3846:3769 3847:3769 PREDICTED: nematode ... resistance protein-like HSPRO2-like Glycine max MV ...

  2. Protein (Viridiplantae): 356560204 [

    Lifescience Database Archive (English)

    Full Text Available XP_003548384.1 33090:30695 35493:21281 131221:21281 3193:21281 58023:14619 78536:14658 58024:146 ... 14:9870 163735:3769 3846:3769 3847:3769 PREDICTED: nematode ... resistance protein-like HSPRO2-like, partial Glyci ...

  3. Combinable protein crop production

    OpenAIRE

    Wright, Isobel

    2008-01-01

    This research topic review aims to summarise research knowledge and observational experience of combinable protein crop production in organic farming systems for the UK. European research on peas, faba beans and lupins is included; considering their role in the rotation, nitrogen fixation, varieties, establishment, weed control, yields, problems experienced and intercropping with cereals.

  4. Protein (Viridiplantae): 226531780 [

    Lifescience Database Archive (English)

    Full Text Available NP_001147196.1 33090:20715 35493:21884 131221:21884 3193:21884 58023:14330 78536:14347 58024:143 ... 470 4575:5441 4577:5441 deleted in split hand/splt foot ... protein 1 Zea mays MAAAPADAKAEAAKMDLLEDDDEFEEFEIDQ ...

  5. Protein (Viridiplantae): 159468784 [

    Lifescience Database Archive (English)

    Full Text Available XP_001692554.1 33090:22049 3041:6770 3166:4229 3042:4229 3051:3540 3052:3540 3055:3540 coenzyme ... ing protein, partial Chlamydomonas reinhardtii WTPEQ LYAVVSRVEDYHLFVPWCQ KSRPAAREAGDYMEAELEVGFQ LLVERYTSQ I ... YLTPGRAVRSAVPDSSLFDHLDSTWTMEPGPAPATCWLSFHVDFAFRSQ LHGYLADLFFSEVVKQ MSNAFEGRCARLYGPSS ...

  6. Protein (Viridiplantae): 18395564 [

    Lifescience Database Archive (English)

    Full Text Available NP_027545.1 33090:256 35493:21220 131221:21220 3193:21220 58023:13487 78536:13436 58024:13436 33 ... 0:5421 980083:5421 3701:5421 3702:5521 SPFH/Band 7/PHB ... domain-containing membrane-associated protein Arab ...

  7. Protein (Viridiplantae): 15239547 [

    Lifescience Database Archive (English)

    Full Text Available NP_200221.1 33090:255 35493:10960 131221:10960 3193:10960 58023:6871 78536:476 58024:476 3398:47 ... 0:2583 980083:2583 3701:2583 3702:1873 SPFH/Band 7/PHB ... domain-containing membrane-associated protein Arab ...

  8. Protein (Viridiplantae): 18417021 [

    Lifescience Database Archive (English)

    Full Text Available NP_567778.1 33090:255 35493:10960 131221:10960 3193:10960 58023:6871 78536:476 58024:476 3398:47 ... 0:2583 980083:2583 3701:2583 3702:1873 SPFH/Band 7/PHB ... domain-containing membrane-associated protein Arab ...

  9. Protein (Viridiplantae): 42571103 [

    Lifescience Database Archive (English)

    Full Text Available NP_973625.1 33090:14975 35493:14487 131221:14487 3193:14487 58023:10069 78536:8383 58024:8383 33 ... 980083:5566 3701:5566 3702:5685 protein sodium-and lithium -tolerant 1 Arabidopsis thaliana MENMYMWVFKERPENALG ...

  10. Protein (Viridiplantae): 18404463 [

    Lifescience Database Archive (English)

    Full Text Available NP_565864.1 33090:14975 35493:14487 131221:14487 3193:14487 58023:10069 78536:8383 58024:8383 33 ... 980083:5566 3701:5566 3702:5685 protein sodium-and lithium -tolerant 1 Arabidopsis thaliana MENHHPSTLLSMDSSASS ...

  11. Protein (Viridiplantae): 255590528 [

    Lifescience Database Archive (English)

    Full Text Available XP_002535292.1 33090:897 35493:1400 131221:1400 3193:1400 58023:1784 78536:1198 58024:1198 3398: ... 5629:537 235880:537 3987:537 3988:537 Protein BABY BOOM , putative Ricinus communis MKHMTRQEFVASIRRKSSGFSRG ...

  12. Protein (Viridiplantae): 226500350 [

    Lifescience Database Archive (English)

    Full Text Available NP_001147535.1 33090:897 35493:1400 131221:1400 3193:1400 58023:1784 78536:1198 58024:1198 3398: ... 7369:454 147429:454 4575:168 4577:168 protein BABY BOOM ... 1 Zea mays MASANNWLGFSLSGQDNPQPNQDSSPAAGIDISGASDFY ...

  13. Protein (Viridiplantae): 255585676 [

    Lifescience Database Archive (English)

    Full Text Available XP_002533523.1 33090:897 35493:1400 131221:1400 3193:1400 58023:1784 78536:1198 58024:1198 3398: ... 5629:537 235880:537 3987:537 3988:537 Protein BABY BOOM , putative Ricinus communis MAPATTNWLSFSLSPMEMLRSST ...

  14. Protein (Viridiplantae): 308807062 [

    Lifescience Database Archive (English)

    Full Text Available XP_003080842.1 33090:2448 3041:440 1035538:347 13792:347 70447:323 70448:86 FTSH1_SYNY3 Cell ... div ... ision protein ftsH homolog 1 dbj|BAA10230.1| cell ... division prot (ISS) Ostreococcus tauri MRAHFRASVRA ...

  15. Protein Thin Film Machines

    OpenAIRE

    Federici, Stefania; Oliviero, Giulio; Hamad-Schifferli, Kimberly; Bergese, Paolo

    2010-01-01

    We report the first example of microcantilever beams that are reversibly driven by protein thin film machines fuelled by cycling the salt concentration of the surrounding solution. We also show that upon the same salinity stimulus the drive can be completely reversed in its direction by introducing a surface coating ligand. Experimental results are throughout discussed within a general yet simple thermodynamic model.

  16. Protein (Viridiplantae): 255541926 [

    Lifescience Database Archive (English)

    Full Text Available XP_002512027.1 33090:26381 35493:16326 131221:16326 3193:16326 58023:13222 78536:13135 58024:131 ... 7:4031 235629:4031 235880:4031 3987:4031 3988:4031 Ethanol ... tolerance protein GEKO1, putative Ricinus communis ...

  17. Protein (Viridiplantae): 30693285 [

    Lifescience Database Archive (English)

    Full Text Available NP_198682.3 33090:122 35493:14455 131221:14455 3193:14455 58023:10070 78536:8442 58024:8442 3398 ... 83:3647 3701:3647 3702:3409 protein acclimation of photosynthesis ... to environment Arabidopsis thaliana MGSITVAPGTTVLF ...

  18. Protein (Viridiplantae): 334188069 [

    Lifescience Database Archive (English)

    Full Text Available NP_001190435.1 33090:122 35493:14455 131221:14455 3193:14455 58023:10070 78536:8442 58024:8442 3 ... 83:3647 3701:3647 3702:3409 protein acclimation of photosynthesis ... to environment Arabidopsis thaliana MGSITVAPGTTVLF ...

  19. Protein (Viridiplantae): 15233302 [

    Lifescience Database Archive (English)

    Full Text Available NP_191115.1 33090:10299 35493:193 131221:193 3193:193 58023:114 78536:2677 58024:2677 3398:2677 ... 083:3094 3701:3094 3702:2636 AT-hook protein of GA feedback ... 2 Arabidopsis thaliana MANPWWVGNVAIGGVESPVTSSAPSLH ...

  20. Protein (Viridiplantae): 30690333 [

    Lifescience Database Archive (English)

    Full Text Available NP_195265.2 33090:10299 35493:193 131221:193 3193:193 58023:114 78536:2677 58024:2677 3398:2677 ... 083:3094 3701:3094 3702:2636 AT-hook protein of GA feedback ... 1 Arabidopsis thaliana MSSYMHPLLGQELHLQRPEDSRTPPDQ ...

  1. Protein (Viridiplantae): 357439925 [

    Lifescience Database Archive (English)

    Full Text Available XP_003590240.1 33090:207 35493:345 131221:345 3193:345 58023:188 78536:6156 58024:6156 3398:6156 ... 249 3803:249 3814:249 163742:554 3877:554 3880:554 CRM ... domain-containing protein, putative Medicago trunc ...

  2. Protein (Viridiplantae): 15232195 [

    Lifescience Database Archive (English)

    Full Text Available NP_189392.1 33090:207 35493:345 131221:345 3193:345 58023:188 78536:6156 58024:6156 3398:6156 71 ... :2768 3701:2768 3702:2151 RNA-binding CRS1 / YhbY (CRM ) domain protein Arabidopsis thaliana MNQVFKGWSRGMS ...

  3. Protein (Viridiplantae): 357439975 [

    Lifescience Database Archive (English)

    Full Text Available XP_003590265.1 33090:207 35493:345 131221:345 3193:345 58023:188 78536:6156 58024:6156 3398:6156 ... 249 3803:249 3814:249 163742:554 3877:554 3880:554 CRM ... domain-containing protein, putative Medicago trunc ...

  4. Protein (Viridiplantae): 15226402 [

    Lifescience Database Archive (English)

    Full Text Available NP_180415.1 33090:207 35493:345 131221:345 3193:345 58023:188 78536:6156 58024:6156 3398:6156 71 ... :2768 3701:2768 3702:2151 RNA-binding CRS1 / YhbY (CRM ) domain protein Arabidopsis thaliana MAIAFARGLRKAS ...

  5. Protein (Viridiplantae): 225448146 [

    Lifescience Database Archive (English)

    Full Text Available XP_002263852.1 33090:207 35493:345 131221:345 3193:345 58023:188 78536:6156 58024:6156 3398:6156 ... :525 3603:525 29760:525 PREDICTED: uncharacterized CRM ... domain-containing protein At3g25440, chloroplastic ...

  6. Protein (Viridiplantae): 79417439 [

    Lifescience Database Archive (English)

    Full Text Available NP_189171.2 33090:207 35493:345 131221:345 3193:345 58023:188 78536:6156 58024:6156 3398:6156 71 ... 68 980083:2768 3701:2768 3702:2151 uncharacterized CRM ... domain-containing protein Arabidopsis thaliana MGF ...

  7. Protein (Viridiplantae): 145332683 [

    Lifescience Database Archive (English)

    Full Text Available NP_001078207.1 33090:207 35493:345 131221:345 3193:345 58023:188 78536:6156 58024:6156 3398:6156 ... 68 980083:2768 3701:2768 3702:2151 uncharacterized CRM ... domain-containing protein Arabidopsis thaliana MWN ...

  8. Protein (Viridiplantae): 240254502 [

    Lifescience Database Archive (English)

    Full Text Available NP_179731.4 33090:11082 35493:11019 131221:11019 3193:11019 58023:8723 78536:6595 58024:6595 339 ... :4699 3701:4699 3702:4683 RNA-binding CRS1 / YhbY (CRM ) domain protein Arabidopsis thaliana MATAKSSTLTNLI ...

  9. Protein (Viridiplantae): 42566743 [

    Lifescience Database Archive (English)

    Full Text Available NP_193043.2 33090:207 35493:345 131221:345 3193:345 58023:188 78536:6156 58024:6156 3398:6156 71 ... :2768 3701:2768 3702:2151 RNA-binding CRS1 / YhbY (CRM ) domain protein Arabidopsis thaliana MLALGYAKEIAQR ...

  10. Protein (Viridiplantae): 15229636 [

    Lifescience Database Archive (English)

    Full Text Available NP_188468.1 33090:207 35493:345 131221:345 3193:345 58023:188 78536:6156 58024:6156 3398:6156 71 ... :2768 980083:2768 3701:2768 3702:2151 CRS1 / YhbY (CRM ) domain-containing protein Arabidopsis thaliana MA ...

  11. Protein (Viridiplantae): 225444203 [

    Lifescience Database Archive (English)

    Full Text Available XP_002270373.1 33090:207 35493:345 131221:345 3193:345 58023:188 78536:6156 58024:6156 3398:6156 ... :525 3603:525 29760:525 PREDICTED: uncharacterized CRM ... domain-containing protein At3g25440, chloroplastic ...

  12. Protein (Viridiplantae): 357478871 [

    Lifescience Database Archive (English)

    Full Text Available XP_003609721.1 33090:207 35493:345 131221:345 3193:345 58023:188 78536:6156 58024:6156 3398:6156 ... 249 3803:249 3814:249 163742:554 3877:554 3880:554 CRM ... domain-containing protein, putative Medicago trunc ...

  13. Protein (Viridiplantae): 334187011 [

    Lifescience Database Archive (English)

    Full Text Available NP_194704.2 33090:207 35493:345 131221:345 3193:345 58023:188 78536:6156 58024:6156 3398:6156 71 ... :2768 980083:2768 3701:2768 3702:2151 CRS1 / YhbY (CRM ) domain-containing protein Arabidopsis thaliana MA ...

  14. Protein (Viridiplantae): 357167884 [

    Lifescience Database Archive (English)

    Full Text Available XP_003581379.1 33090:207 35493:345 131221:345 3193:345 58023:188 78536:6156 58024:6156 3398:6156 ... 6 15367:4086 15368:4086 PREDICTED: uncharacterized CRM ... domain-containing protein At3g25440, chloroplastic ...

  15. Protein (Viridiplantae): 357521229 [

    Lifescience Database Archive (English)

    Full Text Available XP_003630903.1 33090:207 35493:345 131221:345 3193:345 58023:188 78536:6156 58024:6156 3398:6156 ... 249 3803:249 3814:249 163742:554 3877:554 3880:554 CRM ... domain-containing protein, putative Medicago trunc ...

  16. Protein (Viridiplantae): 357124470 [

    Lifescience Database Archive (English)

    Full Text Available XP_003563923.1 33090:207 35493:345 131221:345 3193:345 58023:188 78536:6156 58024:6156 3398:6156 ... 6 15367:4086 15368:4086 PREDICTED: uncharacterized CRM ... domain-containing protein At3g25440, chloroplastic ...

  17. Protein (Viridiplantae): 357467665 [

    Lifescience Database Archive (English)

    Full Text Available XP_003604117.1 33090:7684 35493:9413 131221:9413 3193:9413 58023:4125 78536:6265 58024:6265 3398 ... :7265 3814:7265 163742:15887 3877:15887 3880:15887 StAR -related lipid transfer protein Medicago truncatula ...

  18. Protein (Viridiplantae): 15236909 [

    Lifescience Database Archive (English)

    Full Text Available NP_194422.1 33090:7490 35493:1858 131221:1858 3193:1858 58023:4234 78536:3190 58024:3190 3398:31 ... 22 3699:122 3700:122 980083:122 3701:122 3702:1780 StAR -related lipid-transfer protein Arabidopsis thalian ...

  19. Protein (Viridiplantae): 357464181 [

    Lifescience Database Archive (English)

    Full Text Available XP_003602372.1 33090:7684 35493:9413 131221:9413 3193:9413 58023:4125 78536:6265 58024:6265 3398 ... :7265 3814:7265 163742:15887 3877:15887 3880:15887 StAR -related lipid transfer protein Medicago truncatula ...

  20. Protein (Viridiplantae): 357464183 [

    Lifescience Database Archive (English)

    Full Text Available XP_003602373.1 33090:7684 35493:9413 131221:9413 3193:9413 58023:4125 78536:6265 58024:6265 3398 ... :7265 3814:7265 163742:15887 3877:15887 3880:15887 StAR -related lipid transfer protein Medicago truncatula ...

  1. Protein (Viridiplantae): 357467663 [

    Lifescience Database Archive (English)

    Full Text Available XP_003604116.1 33090:7684 35493:9413 131221:9413 3193:9413 58023:4125 78536:6265 58024:6265 3398 ... :7265 3814:7265 163742:15887 3877:15887 3880:15887 StAR -related lipid transfer protein Medicago truncatula ...

  2. Protein (Viridiplantae): 255568289 [

    Lifescience Database Archive (English)

    Full Text Available XP_002525119.1 33090:1951 35493:1293 131221:1293 3193:1293 58023:2877 78536:1422 58024:1422 3398 ... 977:13 235629:13 235880:13 3987:13 3988:13 Adaptin ear -binding coat-associated protein, putative Ricinus ...

  3. Protein (Viridiplantae): 18410992 [

    Lifescience Database Archive (English)

    Full Text Available NP_567071.1 33090:1951 35493:1293 131221:1293 3193:1293 58023:2877 78536:1422 58024:1422 3398:14 ... 239 3700:239 980083:239 3701:239 3702:5411 Adaptin ear -binding coat-associated protein 1 NECAP-1 Arabidop ...

  4. Protein (Viridiplantae): 255577954 [

    Lifescience Database Archive (English)

    Full Text Available XP_002529849.1 33090:1951 35493:1293 131221:1293 3193:1293 58023:2877 78536:1422 58024:1422 3398 ... 977:13 235629:13 235880:13 3987:13 3988:13 Adaptin ear -binding coat-associated protein, putative Ricinus ...

  5. Protein (Viridiplantae): 226509020 [

    Lifescience Database Archive (English)

    Full Text Available NP_001152713.1 33090:451 35493:523 131221:523 3193:523 58023:837 78536:8759 58024:8759 3398:8759 ... 147369:5146 147429:5146 4575:1047 4577:1047 MFT2 - Corn ... MFT-like protein Zea mays MARFVDPLVVGRVIGEVVDLFVPS ...

  6. Protein (Viridiplantae): 226532395 [

    Lifescience Database Archive (English)

    Full Text Available NP_001147266.1 33090:451 35493:523 131221:523 3193:523 58023:837 78536:8759 58024:8759 3398:8759 ... 147369:5146 147429:5146 4575:1047 4577:1047 MFT2 - Corn ... MFT-like protein Zea mays MARFVDPLVVGRVIGEVVDLFVPS ...

  7. Protein (Cyanobacteria): 28418 [

    Lifescience Database Archive (English)

    Full Text Available ZP_18827726.1 1117:517 1118:7626 1125:2051 1126:2469 1160281:2759 Type 4 prepilin-like proteins ... leader ... peptide-processing enzyme (Includes: Leader ... peptidase ; N-methyltransferase) Microcystis aerug ...

  8. Protein (Cyanobacteria): 28422 [

    Lifescience Database Archive (English)

    Full Text Available ZP_18817031.1 1117:517 1118:7626 1125:2051 1126:2469 1160280:2213 Type 4 prepilin-like proteins ... leader ... peptide-processing enzyme (Includes: Leader ... peptidase ; N-methyltransferase) Microcystis aerug ...

  9. Protein (Cyanobacteria): 28419 [

    Lifescience Database Archive (English)

    Full Text Available ZP_18835633.1 1117:517 1118:7626 1125:2051 1126:2469 1160283:2051 Type 4 prepilin-like proteins ... leader ... peptide-processing enzyme (Includes: Leader ... peptidase ; N-methyltransferase) Microcystis aerug ...

  10. Protein (Cyanobacteria): 28417 [

    Lifescience Database Archive (English)

    Full Text Available ZP_18822668.1 1117:517 1118:7626 1125:2051 1126:2469 1160286:2656 Type 4 prepilin-like proteins ... leader ... peptide-processing enzyme (Includes: Leader ... peptidase ; N-methyltransferase) Microcystis aerug ...

  11. Protein (Cyanobacteria): 28421 [

    Lifescience Database Archive (English)

    Full Text Available ZP_18849476.1 1117:517 1118:7626 1125:2051 1126:2469 721123:1760 Type 4 prepilin-like proteins leader ... eader peptide-processing enzyme (Includes: Leader ... peptidase ; N-methyltransferase) Microcystis aerug ...

  12. Protein (Cyanobacteria): 28415 [

    Lifescience Database Archive (English)

    Full Text Available ZP_18831825.1 1117:517 1118:7626 1125:2051 1126:2469 213618:2396 Type 4 prepilin-like proteins leader ... eader peptide-processing enzyme (Includes: Leader ... peptidase ; N-methyltransferase) Microcystis aerug ...

  13. Protein (Cyanobacteria): 28416 [

    Lifescience Database Archive (English)

    Full Text Available ZP_18841888.1 1117:517 1118:7626 1125:2051 1126:2469 1160284:2857 Type 4 prepilin-like proteins ... leader ... peptide-processing enzyme (Includes: Leader ... peptidase ; N-methyltransferase) Microcystis aerug ...

  14. Protein (Cyanobacteria): 28420 [

    Lifescience Database Archive (English)

    Full Text Available ZP_18844408.1 1117:517 1118:7626 1125:2051 1126:2469 1160285:1581 Type 4 prepilin-like proteins ... leader ... peptide-processing enzyme (Includes: Leader ... peptidase ; N-methyltransferase) Microcystis aerug ...

  15. Protein (Cyanobacteria): 28414 [

    Lifescience Database Archive (English)

    Full Text Available ZP_16388674.1 1117:517 1118:7626 1125:2051 1126:2469 1160282:309 Type 4 prepilin-like proteins leader ... eader peptide-processing enzyme (Includes: Leader ... peptidase ; N-methyltransferase) Microcystis aerug ...

  16. Protein (Viridiplantae): 359494868 [

    Lifescience Database Archive (English)

    Full Text Available XP_003634859.1 33090:7785 35493:2083 131221:2083 3193:2083 58023:1440 78536:1643 58024:1643 3398 ... 403667:299 3602:299 3603:299 29760:299 PREDICTED: influenza ... virus NS1A-binding protein homolog Vitis vinifera ...

  17. Protein (Viridiplantae): 359496826 [

    Lifescience Database Archive (English)

    Full Text Available XP_003635348.1 33090:7785 35493:2083 131221:2083 3193:2083 58023:1440 78536:1643 58024:1643 3398 ... 403667:299 3602:299 3603:299 29760:299 PREDICTED: influenza ... virus NS1A-binding protein homolog Vitis vinifera ...

  18. Protein (Viridiplantae): 255547720 [

    Lifescience Database Archive (English)

    Full Text Available XP_002514917.1 33090:975 35493:959 131221:959 3193:959 58023:1582 78536:423 58024:423 3398:423 7 ... 235629:4243 235880:4243 3987:4243 3988:4243 Small rubber ... particle protein, putative Ricinus communis METEKK ...

  19. Protein (Viridiplantae): 30697500 [

    Lifescience Database Archive (English)

    Full Text Available NP_849856.1 33090:975 35493:959 131221:959 3193:959 58023:1582 78536:423 58024:423 3398:423 7124 ... 699:3534 3700:3534 980083:3534 3701:3534 3702:3251 Rubber ... elongation factor protein (REF) Arabidopsis thalia ...

  20. Protein (Viridiplantae): 15230002 [

    Lifescience Database Archive (English)

    Full Text Available NP_187201.1 33090:975 35493:959 131221:959 3193:959 58023:1582 78536:423 58024:423 3398:423 7124 ... 699:3534 3700:3534 980083:3534 3701:3534 3702:3251 Rubber ... elongation factor protein Arabidopsis thaliana MAT ...

  1. Protein (Viridiplantae): 15220426 [

    Lifescience Database Archive (English)

    Full Text Available NP_176904.1 33090:975 35493:959 131221:959 3193:959 58023:1582 78536:423 58024:423 3398:423 7124 ... 699:3534 3700:3534 980083:3534 3701:3534 3702:3251 Rubber ... elongation factor protein (REF) Arabidopsis thalia ...

  2. Protein (Viridiplantae): 255542728 [

    Lifescience Database Archive (English)

    Full Text Available XP_002512427.1 33090:975 35493:959 131221:959 3193:959 58023:1582 78536:423 58024:423 3398:423 7 ... 7:4243 235629:4243 235880:4243 3987:4243 3988:4243 Rubber ... elongation factor protein, putative Ricinus commun ...

  3. Protein (Viridiplantae): 297841421 [

    Lifescience Database Archive (English)

    Full Text Available XP_002888592.1 33090:975 35493:959 131221:959 3193:959 58023:1582 78536:423 58024:423 3398:423 7 ... 0:3534 980083:3534 3701:3534 59689:7990 81972:7990 rubber ... elongation factor family protein Arabidopsis lyrat ...

  4. Protein (Viridiplantae): 255582180 [

    Lifescience Database Archive (English)

    Full Text Available XP_002531884.1 33090:975 35493:959 131221:959 3193:959 58023:1582 78536:423 58024:423 3398:423 7 ... 235629:4243 235880:4243 3987:4243 3988:4243 Small rubber ... particle protein, putative Ricinus communis MAESEV ...

  5. Protein (Viridiplantae): 297829074 [

    Lifescience Database Archive (English)

    Full Text Available XP_002882419.1 33090:975 35493:959 131221:959 3193:959 58023:1582 78536:423 58024:423 3398:423 7 ... 0:3534 980083:3534 3701:3534 59689:7990 81972:7990 rubber ... elongation factor family protein Arabidopsis lyrat ...

  6. Protein (Viridiplantae): 15227131 [

    Lifescience Database Archive (English)

    Full Text Available NP_182299.1 33090:975 35493:959 131221:959 3193:959 58023:1582 78536:423 58024:423 3398:423 7124 ... 699:3534 3700:3534 980083:3534 3701:3534 3702:3251 Rubber ... elongation factor protein (REF) Arabidopsis thalia ...

  7. Protein (Viridiplantae): 15219200 [

    Lifescience Database Archive (English)

    Full Text Available NP_178006.1 33090:6322 35493:2262 131221:2262 3193:2262 58023:2407 78536:1099 58024:1099 3398:10 ... 514 3702:695 D-mannose binding lectin protein with Apple -like carbohydrate-binding domain Arabidopsis thali ...

  8. Protein (Viridiplantae): 15230565 [

    Lifescience Database Archive (English)

    Full Text Available NP_190739.1 33090:6322 35493:2262 131221:2262 3193:2262 58023:2407 78536:1099 58024:1099 3398:10 ... 514 3702:895 D-mannose binding lectin protein with Apple -like carbohydrate-binding domain Arabidopsis thali ...

  9. Protein (Viridiplantae): 15219197 [

    Lifescience Database Archive (English)

    Full Text Available NP_178003.1 33090:6322 35493:2262 131221:2262 3193:2262 58023:2407 78536:1099 58024:1099 3398:10 ... 514 3702:695 D-mannose binding lectin protein with Apple -like carbohydrate-binding domain Arabidopsis thali ...

  10. Protein Requirements during Aging.

    Science.gov (United States)

    Courtney-Martin, Glenda; Ball, Ronald O; Pencharz, Paul B; Elango, Rajavel

    2016-01-01

    Protein recommendations for elderly, both men and women, are based on nitrogen balance studies. They are set at 0.66 and 0.8 g/kg/day as the estimated average requirement (EAR) and recommended dietary allowance (RDA), respectively, similar to young adults. This recommendation is based on single linear regression of available nitrogen balance data obtained at test protein intakes close to or below zero balance. Using the indicator amino acid oxidation (IAAO) method, we estimated the protein requirement in young adults and in both elderly men and women to be 0.9 and 1.2 g/kg/day as the EAR and RDA, respectively. This suggests that there is no difference in requirement on a gender basis or on a per kg body weight basis between younger and older adults. The requirement estimates however are ~40% higher than the current protein recommendations on a body weight basis. They are also 40% higher than our estimates in young men when calculated on the basis of fat free mass. Thus, current recommendations may need to be re-assessed. Potential rationale for this difference includes a decreased sensitivity to dietary amino acids and increased insulin resistance in the elderly compared with younger individuals. PMID:27529275

  11. Protein Requirements during Aging

    Directory of Open Access Journals (Sweden)

    Glenda Courtney-Martin

    2016-08-01

    Full Text Available Protein recommendations for elderly, both men and women, are based on nitrogen balance studies. They are set at 0.66 and 0.8 g/kg/day as the estimated average requirement (EAR and recommended dietary allowance (RDA, respectively, similar to young adults. This recommendation is based on single linear regression of available nitrogen balance data obtained at test protein intakes close to or below zero balance. Using the indicator amino acid oxidation (IAAO method, we estimated the protein requirement in young adults and in both elderly men and women to be 0.9 and 1.2 g/kg/day as the EAR and RDA, respectively. This suggests that there is no difference in requirement on a gender basis or on a per kg body weight basis between younger and older adults. The requirement estimates however are ~40% higher than the current protein recommendations on a body weight basis. They are also 40% higher than our estimates in young men when calculated on the basis of fat free mass. Thus, current recommendations may need to be re-assessed. Potential rationale for this difference includes a decreased sensitivity to dietary amino acids and increased insulin resistance in the elderly compared with younger individuals.

  12. Protein (Viridiplantae): 357437225 [

    Lifescience Database Archive (English)

    Full Text Available XP_003588888.1 33090:11850 35493:11195 131221:11195 3193:11195 58023:7061 78536:6038 58024:6038 ... 5 91835:7640 72025:8712 3803:8712 3814:8712 163742:12345 ... 3877:12345 ... 3880:12345 ... hypothetical protein MTR_1g0 ...

  13. Protein (Viridiplantae): 168024037 [

    Lifescience Database Archive (English)

    Full Text Available XP_001764543.1 33090:26221 35493:16132 131221:16132 3193:16132 3208:12345 ... 404260:12345 ... 3214:12345 ... 5 114656:12345 ... 3215:12345 ... 3216:12345 ... 3217:12345 ... 3218:12345 ... 145481 ... :12345 ... predicted protein Physcomitrella patens subsp. pat ...

  14. Protein (Viridiplantae): 255588560 [

    Lifescience Database Archive (English)

    Full Text Available XP_002534643.1 33090:54663 35493:45756 131221:45756 3193:45756 58023:34361 78536:34515 58024:345 ... 62 235629:11062 235880:11062 3987:11062 3988:11062 Biopolymer ... transport exbD1 protein, putative Ricinus communis ...

  15. Protein (Viridiplantae): 255588558 [

    Lifescience Database Archive (English)

    Full Text Available XP_002534642.1 33090:54662 35493:45755 131221:45755 3193:45755 58023:34360 78536:34514 58024:345 ... 61 235629:11061 235880:11061 3987:11061 3988:11061 Biopolymer ... transport exbB protein, putative Ricinus communis ...

  16. Protein (Viridiplantae): 255593120 [

    Lifescience Database Archive (English)

    Full Text Available XP_002535793.1 33090:54662 35493:45755 131221:45755 3193:45755 58023:34360 78536:34514 58024:345 ... 61 235629:11061 235880:11061 3987:11061 3988:11061 Biopolymer ... transport exbB protein, putative Ricinus communis ...

  17. Protein (Viridiplantae): 357453997 [

    Lifescience Database Archive (English)

    Full Text Available XP_003597279.1 33090:16324 35493:17354 131221:17354 3193:17354 58023:13519 78536:13471 58024:134 ... 2531 3814:12531 163742:14737 3877:14737 3880:14737 Cat ... eye syndrome critical region protein Medicago trun ...

  18. Protein (Viridiplantae): 226501984 [

    Lifescience Database Archive (English)

    Full Text Available NP_001152161.1 33090:16324 35493:17354 131221:17354 3193:17354 58023:13519 78536:13471 58024:134 ... 0:3521 147369:3521 147429:3521 4575:4966 4577:4966 cat ... eye syndrome critical region protein 5 Zea mays MR ...

  19. Protein (Viridiplantae): 15234540 [

    Lifescience Database Archive (English)

    Full Text Available NP_193892.1 33090:988 35493:13743 131221:13743 3193:13743 58023:94 78536:8446 58024:8446 3398:84 ... 699:2376 3700:2376 980083:2376 3701:2376 3702:1438 lsd ... one like 2 protein Arabidopsis thaliana MEEIQQQTQK ...

  20. Protein (Viridiplantae): 18398482 [

    Lifescience Database Archive (English)

    Full Text Available NP_564405.1 33090:988 35493:13743 131221:13743 3193:13743 58023:94 78536:8446 58024:8446 3398:84 ... 699:2376 3700:2376 980083:2376 3701:2376 3702:1438 lsd ... one like 1 protein Arabidopsis thaliana MPVPLAPYPT ...