WorldWideScience

Sample records for arca zebra comercializada

  1. [Mollusc diversity in an Arca zebra (Mollusca: Bivalvia) community, Chacopata, Sucre, Venezuela].

    Science.gov (United States)

    Prieto, A S; Ruiz, L J; García, N; Alvarez, M

    2001-06-01

    The diversity of a subtidal epifaunal mollusk community was studied from September, 1990 to September, 1991 in Chacopata, Sucre State, Venezuela. There were 40 species (24 bivalves and 16 gastropods). The diversity indexes (H' = 2.087, J' = 0.392, 1/D = 0.528) were low when compared with other tropical zones. Monthly diversity reached its maximum in September, 1990 (1.63 bits/ind.) and July, 1991 (1.60 bits/ind.); minimum diversity occurred in June, 1991 (0.52 bits/ind.). A Log series model applied to species abundance data showed a straight line with a diversity index alpha of 5.56. Of 40 species identified, the turkeywing Arca zebra was dominant (69% in number of individuals and 72% of biomass) followed by Pinctada imbricata, Modiolus squamosus, Chama macerophyla and Anadara notabilis. The predatory snails Phyllonotus pomum, Chicoreus brevifrons and Murex recurvirostris seemed to have trophic relationships with A. zebra. The total mean biomass in wet weight (469.20 +/- 263 g m-2, shell included) was high which indicates that A. zebra, a species with a rapid growth rate, occupies a central role in the assemblage as an efficient filter feeder that converts planktonic food into available biomass, supporting one of the most important fisheries in Venezuela. PMID:11935909

  2. Zebra mussel monitoring

    Energy Technology Data Exchange (ETDEWEB)

    Hennagir, T.

    1994-01-01

    In less than a decade, zebra mussels have become the latest environmental scourge to plague the North American power industry. Infestations in the Great Lakes region have already reached natural disaster proportions. The invasion shows little sign of subsiding; Michigan's inland waters are the next most likely threatened area. In the southern United States, the mussles' migration has extended about 50 miles deeper than experts had originally predicted. By the year 2000, zebra mussel monitoring and control efforts will cost business and industry $5 billion, according to the federal Aquatic Nuisance Prevention and Control Act of 1990. Estimates of more than $1 million to control mussel fouling are projected for the Great Lakes area alone. While small independent hydropower stations are not as susceptible to zebra mussles as coal or nuclear facilities, there is cause for concern. Infestations can quickly foul hydropower plant components, hampering equipment operation and reducing facility efficiency. In extreme cases, leaving the mussels unchecked can result in stoplog gate flow blockage or false water level gauge readings. Advance prevention is often an effective first-line of defense against this troublesome, rapidly spreading and extremely prolific mollusk. Mussel monitoring efforts should begin a year in advance of when zebra mussels are expected to appear in a given location. Hydropower facility components that come into contact or rely exclusively on raw water are at greatest risk, as are other external components such as embayment walls, screens, trashracks and fish ladders.

  3. A Zebra in the Classroom.

    Science.gov (United States)

    Leake, Devin; Morvillo, Nancy

    1998-01-01

    Describes the care and breeding of zebra fish, suggests various experiments and observations easily performed in a classroom setting, and provides some ideas to further student interest and exploration of these organisms. (DDR)

  4. Intracardiac thrombosis in the Cape Mountain Zebra

    Directory of Open Access Journals (Sweden)

    G.F. Bath

    1975-07-01

    Full Text Available The Cape mountain zebra (Equus zebra zebra is one of the rarest species of mammals in South Africa, and is threatened with extinction. At present there are less than 200 in existence, of which approximately 160 occur in the Mountain Zebra National Park near Cradock. Because of the rarity of the species and the undesirable concentration of the majority in an area of only 6 536 ha, a post-mortem examination is performed, if possible, on all animals to establish cause of death with the purpose of preventing large-scale mortalities. This is done even if the carcass is in a fairly advanced state of decomposition. Amongst the examinations so performed were two zebra which were believed to have died as a result of intraventricular thrombosis. The rarity of this condition and of the Cape mountain zebra makes a report on these cases necessary.

  5. Zebra: Searching for Rare Diseases

    DEFF Research Database (Denmark)

    Dragusin, Radu; Petcu, Paula; Lioma, Christina;

    2012-01-01

    disease diagnostic hypotheses in the domain of medical IR. In this work, we build upon an existing vertical medical search engine, Zebra, that is focused on rare disease diagnosis. In previous work, Zebra has been evaluated using real-life medical cases of rare and difficult diseases, and has been found...... to be a useful and competitive tool for clinicians. In this work, we extend Zebra’s functionalities to optimise the task of medical diagnosis through search as follows: we add the option of grouping retrieved documents into clusters based on disease name occurrence, and we offer a ‘disease......Task-based search addresses situations where standard off-the-shelf Information Retrieval (IR) technology may not suffice to satisfy users in their tasks. In these situations, IR systems should be tailored to the user’s task-specific needs and requirements. One such task is searching for rare...

  6. Last news on zebra pattern

    CERN Document Server

    Chernov, Gennady

    2015-01-01

    The publications of the last three years concerning to studying of the most intriguing fine structure in type IV solar radio bursts - zebra pattern (ZP), are surveyed. The main attention is paid to new observations, irrespective of whether a paper does include detailed interpretation of an event or simply reports about the beginning of operation of a new tool. The radiation mechanism of the ZP on a double plasma resonance (DPR) remains the most widespread and standard, though ten alternative mechanisms were offered. However, in a number of works difficulties with the explanation of a complex zebra are noted, especially in a combination with fiber bursts and spikes. Therefore, several papers in which the radiation mechanism of a zebra on the DPR is improved, are considered in more detail. Without positional observations we have a great opportunity to follow the dynamics of flare processes using SDO / AIA images in several EUV lines. In the discussion, the debatable questions with the comparison of mechanism on...

  7. Androgen receptor gene polymorphism in zebra species

    Directory of Open Access Journals (Sweden)

    Hideyuki Ito

    2015-09-01

    Full Text Available Androgen receptor genes (AR have been found to have associations with reproductive development, behavioral traits, and disorders in humans. However, the influence of similar genetic effects on the behavior of other animals is scarce. We examined the loci AR glutamine repeat (ARQ in 44 Grevy's zebras, 23 plains zebras, and three mountain zebras, and compared them with those of domesticated horses. We observed polymorphism among zebra species and between zebra and horse. As androgens such as testosterone influence aggressiveness, AR polymorphism among equid species may be associated with differences in levels of aggression and tameness. Our findings indicate that it would be useful to conduct further studies focusing on the potential association between AR and personality traits, and to understand domestication of equid species.

  8. Zebra Stripes through the Eyes of Their Predators, Zebras, and Humans.

    Directory of Open Access Journals (Sweden)

    Amanda D Melin

    Full Text Available The century-old idea that stripes make zebras cryptic to large carnivores has never been examined systematically. We evaluated this hypothesis by passing digital images of zebras through species-specific spatial and colour filters to simulate their appearance for the visual systems of zebras' primary predators and zebras themselves. We also measured stripe widths and luminance contrast to estimate the maximum distances from which lions, spotted hyaenas, and zebras can resolve stripes. We found that beyond ca. 50 m (daylight and 30 m (twilight zebra stripes are difficult for the estimated visual systems of large carnivores to resolve, but not humans. On moonless nights, stripes are difficult for all species to resolve beyond ca. 9 m. In open treeless habitats where zebras spend most time, zebras are as clearly identified by the lion visual system as are similar-sized ungulates, suggesting that stripes cannot confer crypsis by disrupting the zebra's outline. Stripes confer a minor advantage over solid pelage in masking body shape in woodlands, but the effect is stronger for humans than for predators. Zebras appear to be less able than humans to resolve stripes although they are better than their chief predators. In conclusion, compared to the uniform pelage of other sympatric herbivores it appears highly unlikely that stripes are a form of anti-predator camouflage.

  9. ZEBRA battery meets USABC goals

    Science.gov (United States)

    Dustmann, Cord-H.

    In 1990, the California Air Resources Board has established a mandate to introduce electric vehicles in order to improve air quality in Los Angeles and other capitals. The United States Advanced Battery Consortium has been formed by the big car companies, Electric Power Research Institute (EPRI) and the Department of Energy in order to establish the requirements on EV-batteries and to support battery development. The ZEBRA battery system is a candidate to power future electric vehicles. Not only because its energy density is three-fold that of lead acid batteries (50% more than NiMH) but also because of all the other EV requirements such as power density, no maintenance, summer and winter operation, safety, failure tolerance and low cost potential are fulfilled. The electrode material is plain salt and nickel in combination with a ceramic electrolyte. The cell voltage is 2.58 V and the capacity of a standard cell is 32 Ah. Some hundred cells are connected in series and parallel to form a battery with about 300 V OCV. The battery system including battery controller, main circuit-breaker and cooling system is engineered for vehicle integration and ready to be mounted in a vehicle [J. Gaub, A. van Zyl, Mercedes-Benz Electric Vehicles with ZEBRA Batteries, EVS-14, Orlando, FL, Dec. 1997]. The background of these features are described.

  10. Social organisation of the Cape Mountain Zebra Equus Z. Zebra in the Mountain Zebra National Park*

    Directory of Open Access Journals (Sweden)

    B. L Penzhorn

    1979-01-01

    Full Text Available The social structure of Cape mountain zebras con- sists of breeding herds of one stallion, one to five mares and their offspring, as well as bachelor groups. Breeding herds remain stable over many years and when the stallion is displaced by another, the mares remain together. A dominance hierarchy exists, but leadership is random. Foals leave their maternal herds at a mean age of 22,3 months. The herd stallion tries to prevent the foals from leaving the herd. Bachelor groups are not as well defined as breeding herds, but core groups could be identified through a principal components analysis ordination. Family ties may be important in the establishment of core groups. Bachelors succeed in becoming herd stallions when about five years old. Aspects of the possible evolution of the social structure are discussed.

  11. EPRI's zebra mussel monitoring and control guidelines

    International Nuclear Information System (INIS)

    The Electric Power Research Institute (EPRI) Zebra Mussel Monitoring and Control Guidelines is a comprehensive compilation of US and European practices. The zebra mussel has infested all the Great Lakes and is positioned to spread to the adjoining river basins. The impact of the zebra mussel on power plants is as a biofouler clogging water systems and heat exchangers. The EPRI guidelines discuss the distribution of the zebra mussel in the US, identification of the zebra mussel, potential threats to power plants, and methods to initiate the monitoring and control program. Both preventive and corrective measures are presented. Preventive measures include various monitoring methods to initiate control techniques. The control techniques include both chemical and nonchemical together with combining techniques. Corrective methods include operational considerations, chemical cleaning, and mechanical/physical cleaning. It may also be possible to incorporate design changes, such as open to closed-loop backfit, backflushing, or pretreatment for closed systems. Table 1 shows a matrix of the monitoring methods. Table 2 presents a control matrix related to nuclear, fossil, and hydro raw water systems. Table 3 is a summary of the applicability of treatments to the various raw water systems. Appendixes are included that contain specifications to aid utilities in implementing several of the control technologies

  12. El "Arca" de No?? en las fuentes ??rabes

    OpenAIRE

    Castillo Castillo, Concepci??n

    1991-01-01

    El conocido tema b??blico del Arca de No?? fue asimilado, como otros tantos, por la tradici??n musulmana. Espigando en las distintas fuentes ??rabes hemos reunido unos datos acerca del Arca bajo los apartados de descripci??n, habitantes, y recorrido y asentam.Umto, llegando a la conclusi??n de c??mo a trav??s de los siglos la tradici??n musulmana se ha encargado de a??adir datos que en la mayor??a de los casos se alejan bastante de su punto de origen.

  13. 77 FR 27817 - Self-Regulatory Organizations; NYSE Arca, Inc.; Order Approving a Proposed Rule Change To List...

    Science.gov (United States)

    2012-05-11

    ... (``Valuation Agent''). \\4\\ Each Unit will represent an equal, undivided interest in the net assets of the Trust... calculation of the value of the net assets of the Trust and the NAV.\\20\\ NYSE Arca Equities Rule 8.201(e)(2... Arca's ``circuit breaker'' rule. See NYSE Arca Equities Rule 7.12. \\20\\ See Notice, supra note 3, 77...

  14. Cave crawling in zebra finch skulls

    DEFF Research Database (Denmark)

    Larsen, Ole Næsbye; Salomon, Rasmus; Jensen, Kenneth Kragh;

    Cave crawling in zebra finch skulls: what is the functional interaural canal? Ole Næsbye Larsen, Rasmus Salomon, Kenneth Kragh Jensen, and Jakob Christensen-Dalsgaard Department of Biology, University of Southern Denmark, Campusvej 55, DK-5230 Odense M, Denmark The middle ears of birds are...... gains and delays in the IAC can produce very different directionalities of the ears but it is still uncertain how interaural transmission gain and delay can be shaped by evolution by anatomical adaptations. A closer inspection of the zebra finch cranium using micro-CT scanning reveals that not only is...

  15. Research continues on zebra mussel control

    International Nuclear Information System (INIS)

    Researchers are working on many fronts to learn methods for controlling and combatting zebra mussels, a species of mussel that can attach to the inside of water intakes at hydroelectric and thermal power plants, and can reduce or block water flow. Biologists at the University of Toledo in Ohio report that compounds from the African soapberry plant called lemmatoxins are lethal to zebra mussels. In laboratory tests, researchers have determined 1 to 2 milligrams of purified lemmatoxins per liter will kill the mussels. In field tests, biologist Harold Lee flushed water through a mussel-infested pipe. He found that the berry extract killed mussels in four to eight hours, making continuous treatment of water intake pipes unnecessary, according to a report in New Scientists. The University of Toledo participated in another project, funded by the American Water Works Association Research Foundation. That project team included the cities of Toledo and Cleveland, Ohio, Finkbeiner, Pettis ampersand Strout, Ltd. consulting engineers, and researchers from Ohio's Case Western Reserve University. The team identified a chemical oxidant, sodium hypochlorite, as a cost-effective agent for controlling zebra mussels at water treatment plant intakes. Toledo has used the sodium hypochlorite and reports the chemical has cleared colonies of zebra mussels that had attached to the intake of its water treatment plant

  16. Dynamics of zebra finch and mockingbird vocalizations

    Science.gov (United States)

    Cimenser, Aylin

    Along with humans, whales, and bats, three groups of birds which include songbirds (oscines) such as the Zebra Finch (Taeniopygia guttata) and Mockingbird (Mimus polyglottos) are the only creatures known to learn sounds by imitation. Numerous similarities between human and songbird vocalizations exist and, recently, it has been shown that Zebra Finch in particular possesses a gene, FoxP2, known to be involved in human language. This thesis investigates song development in Zebra Finches, as well as the temporal dynamics of song in Mockingbirds. Zebra Finches have long been the system of choice for studying vocal development, ontogeny, and complexity in birdsong. Physicists find them intriguing because the spectrally complex vocalizations of the Zebra Finch can exhibit sudden transitions to chaotic dynamics, period doubling & mode-locking phenomena. Mockingbirds, by contrast, provide an ideal system to examine the richness of an avian repertoire, since these musically versatile songbirds typically know upwards of 200 songs. To analyse birdsong data, we have developed a novel clustering algorithm that can be applied to the bird's syllables, tracing their dynamics back to the earliest stages of vocal development. To characterize birdsong we have used Fourier techniques, based upon multitaper spectral analysis, to optimally work around the constraints imposed by (Heisenberg's) time-frequency uncertainty principle. Furthermore, estimates that provide optimal compromise between frequency and temporal resolution have beautiful connections with solutions to the Helmholtz wave equation in prolate spheroidal coordinates. We have used this connection to provide firm foundation for certain heuristics used in the literature to compute associated spectral derivatives and supply a pedagogical account here in this thesis. They are of interest because spectral derivatives emphasize sudden changes in the dynamics of the underlying phenomenon, and often provide a nice way to visualize

  17. Physical Conditions in the Source Region of a Zebra Structure

    Science.gov (United States)

    Yasnov, L. V.; Karlický, M.; Stupishin, A. G.

    2016-07-01

    We analyze the physical conditions in the source region of a zebra structure, observed with the Ondřejov radiospectrograph during the 1 August 2010 solar flare. To determine the gyro-frequency harmonic numbers of the observed zebra lines, we compute the magnetic field strength, the electron density, and their spatial scales in the source region of the zebra structure. The region where the flare occurred is analyzed using EUV (171 Å and 335 Å) observations. To determine the conditions in the zebra source region, the magnetic field structure is reconstructed using observed photospheric magnetic field data. By computing the dependence of the magnetic field vs. height in this reconstruction and by comparing the magnetic field strength derived from the zebra structure, we determine the dependence of the electron density vs. height in the zebra source-region. We identify the loops where the zebra structure was generated at heights of about 2.5 - 3.3 Mm. Assuming the barometric law for the electron density, we determine the temperature in the zebra source-region to be T ≈ 2.0 × 104 K. Comparing the obtained values of the temperature and electron density in the zebra source-region with a model of the solar atmosphere, we find that the zebra structure was generated in the transition region, in agreement with our previous results.

  18. CA/CPS: A Communications ZEBRA implementation using CPS

    International Nuclear Information System (INIS)

    CZ/CPS is an implementation of the Communications ZEBRA distributed computing environment utilizing the CPS communications protocol. CZ/CPS is intended for parallelization of high energy physics application programs using the CERN Program Library memory and data structure management features. CZ/CPS provides transparent communication of ZEBRA data structures among cooperative processes using standard interfaces for ZEBRA I/O. Examples of usage in a CPS HBOOK4 and GEANT3 application are provided

  19. Female Zebra Finches Smell Their Eggs.

    Directory of Open Access Journals (Sweden)

    Sarah Golüke

    Full Text Available Parental investment in unrelated offspring seems maladaptive from an evolutionary perspective, due to the costs of energy and resources that cannot be invested in related offspring at the same time. Therefore selection should favour mechanisms to discriminate between own and foreign offspring. In birds, much emphasis has been placed on understanding the visual mechanisms underlying egg recognition. However, olfactory egg recognition has almost been completely ignored. Here, we investigated whether female zebra finches (Taeniopygia guttata are able to discriminate between their own and a conspecific egg based on olfactory cues alone. Zebra finches are colonial-breeding songbirds. Eggs are monomorphic, i.e. without any spotting pattern, and intraspecific brood parasitism frequently occurs. In a binary choice experiment, female zebra finches were given the choice between the scent of their own and a conspecific egg. After the onset of incubation, females chose randomly and showed no sign of discrimination. However, shortly before hatching, females preferred significantly the odour of their own egg. The finding that females are capable to smell their own egg may inspire more research on the potential of olfaction involved in egg recognition, especially in cases where visual cues might be limited.

  20. Female Zebra Finches Smell Their Eggs.

    Science.gov (United States)

    Golüke, Sarah; Dörrenberg, Sebastian; Krause, E Tobias; Caspers, Barbara A

    2016-01-01

    Parental investment in unrelated offspring seems maladaptive from an evolutionary perspective, due to the costs of energy and resources that cannot be invested in related offspring at the same time. Therefore selection should favour mechanisms to discriminate between own and foreign offspring. In birds, much emphasis has been placed on understanding the visual mechanisms underlying egg recognition. However, olfactory egg recognition has almost been completely ignored. Here, we investigated whether female zebra finches (Taeniopygia guttata) are able to discriminate between their own and a conspecific egg based on olfactory cues alone. Zebra finches are colonial-breeding songbirds. Eggs are monomorphic, i.e. without any spotting pattern, and intraspecific brood parasitism frequently occurs. In a binary choice experiment, female zebra finches were given the choice between the scent of their own and a conspecific egg. After the onset of incubation, females chose randomly and showed no sign of discrimination. However, shortly before hatching, females preferred significantly the odour of their own egg. The finding that females are capable to smell their own egg may inspire more research on the potential of olfaction involved in egg recognition, especially in cases where visual cues might be limited. PMID:27192061

  1. LEVANTAMENTO DAS PLANTAS MEDICINAIS CULTIVADAS E COMERCIALIZADAS POR HORTICULTORES NO MUNICÍPIO DE ITUVERAVA-SP

    Directory of Open Access Journals (Sweden)

    GALDIANO, Lívia Cordaro

    2007-09-01

    Full Text Available On the survey of the use and the trade of medicinal plants is necessary in first place differentiatemany category of the yield. Some plants are traded such as, usually in dryness full kind or pulverized, others comelike extracts, others like distils oils or express and finally many of them are traded on the one chemical componentdefined kind. Then, the present work, has like achievement to rise all the varieties of medicinal plants cultivatedand traded by market gardeners of the municipal district Ituverava-SP. Were visited 15 market gardens, whichof them were applied a questionary to the responsible of the same, in period from July to August/2006.Amongthe cultivated plants, the kinds quotations are: Mint(Hortelã, Watercress(Agrião, Balm-mint (Erva-cidreira,”Capim-limão”, Cabbage (Couve,” Belladona”,” Picão”,” Mentrasso””, Erva Santa-maria”,” Boldo”,” Alfavaca”,”Canforim”, Basil( Manjericão, Wormwood ( Losna,Rosemary( Alecrim, Saffron (Açafrão.Mint was the plantthat showed higher eminence between the quotations above, being this cultivated and traded in 13 of 15 marketgarden studied. All of the market gardeners didn’t know how to answer, surely, the question about the utility ofeach plant traded, what shows the importance for information about the such subject. In agreement with the gainedfigures, could decide that the information about the medicinal plant’s cultivation are of huge importance for thecommunity, being that the same are cultivated and commercialized by the market gardeners of the municipal district Ituverava-SP, with eminence for mint.No levantamento do uso e comércio de plantas medicinais, é necessário, em primeiro lugar,distinguir diversas classes de produto. Algumas plantas são comercializadas como tais, geralmente em forma seca,inteiras ou pulverizadas, outras vêm como extratos, outras, como óleos destilados ou expressos, e finalmente váriassão comercializadas na forma de um

  2. FindZebra: A search engine for rare diseases

    DEFF Research Database (Denmark)

    Dragusin, Radu; Petcu, Paula; Lioma, Christina Amalia; Larsen, Birger; Jørgensen, Hans Henrik; Cox, Ingemar; Hansen, Lars Kai; Ingwersen, Peter; Winther, Ole

    2013-01-01

    Background: The web has become a primary information resource about illnesses and treatments for both medical and non-medical users. Standard web search is by far the most common interface for such information. It is therefore of interest to find out how well web search engines work for diagnostic...... approach for web search engines for rare disease diagnosis which includes 56 real life diagnostic cases, state-of-the-art evaluation measures, and curated information resources. In addition, we introduce FindZebra, a specialized (vertical) rare disease search engine. FindZebra is powered by open source...... search technology and uses curated freely available online medical information. Results: FindZebra outperforms Google Search in both default setup and customised to the resources used by FindZebra. We extend FindZebra with specialized functionalities exploiting medical ontological information and UMLS...

  3. The complete mitochondrial genome of the Metriaclima zebra.

    Science.gov (United States)

    Chen, Xi; Song, Xiao-Lei; Chen, Ling-Yun; Li, Yong

    2016-09-01

    Cichlid fish from East Africa are remarkable for phenotypic and behavioral diversity on a backdrop of genomic similarity. Metriaclima zebra is a member of the Cichlidae family. Here, we reported the complete mitogenome sequence of M. zebra, which was 16 582 bp and contained 13 protein-coding genes, 22 transfer RNA genes, 2 ribosomal RNA genes and 1 non-coding control region. A phylogenetic tree was constructed based on complete mitogenomes of M. zebra and 11 closely related Cichlidae species to approve the accuracy. The complete mitochondrial genome of the M. zebra would provide more information for the research of M. zebra and the evolution of Cichlidae family. PMID:26273916

  4. Análise de amostras de flores de Calêndula (Calendula officinalis L., Asteraceae) comercializadas na grande Curitiba

    OpenAIRE

    Lais Mondadori Otramario Santos; Luciana Aparecida de Oliveira; Eliane Patrícia Sichinel Tibulo; Cristina Peitz de Lima

    2015-01-01

    A espécie Calendula officinalis L. é uma planta herbácea pertencente à família Asteraceae, suas flores apresentam propriedades antimicrobianas, emolientes, antiinflamatórias e tonificantes da pele. Os flavonoides são utilizados como marcadores para avaliar a qualidade da droga vegetal. O objetivo do presente trabalho foi avaliar a identidade e qualidade de seis amostras de flores de C. officinalis L. comercializadas na Grande Curitiba (PR). Foram realizados os ensaios de identificação macrosc...

  5. Cave crawling in zebra Finch skulls

    DEFF Research Database (Denmark)

    Larsen, Ole Næsbye; Salomon, Rasmus; Jensen, Kenneth Kragh;

    2014-01-01

    The middle ears of birds are acoustically coupled through an air-filled interaural canal, often illustrated and modelled as a simple tube. It allows sound to propagate through the skull from one ear to the other and considerably enhance the cues for directional hearing by interaction with the...... by anatomical adaptations during evolution. A closer inspection of the zebra finch cranium using micro-CT scanning reveals that not only is IAC trabeculated and irregularly shaped but it also communicates with a set of highly complex, air-filled canals in the skull extending to the base of the beak...

  6. Environmentally Safe Control of Zebra Mussel Fouling

    Energy Technology Data Exchange (ETDEWEB)

    Daniel Molloy

    2008-02-29

    The two primary objectives of this USDOE-NETL contract were successfully achieved during the project: (1) to accelerate research on the development of the bacterium Pseudomonas fluorescens strain CL145A (Pf-CL145A) as a biocontrol agent for zebra mussels (Dreissena polymorpha) and quagga mussels (Dreissena rostriformis bugensis)--two invasive freshwater bivalve species that are infesting water pipes in power plants; and (2) to identify a private-sector company that would move forward to commercialize Pf-CL145A as a substitute for the current polluting use of biocide chemicals for control of these dreissenid mussels in power plant pipes.

  7. Analysis of the ArcA regulon in anaerobically grown Salmonella enterica sv. Typhimurium

    Directory of Open Access Journals (Sweden)

    Porwollik Steffen

    2011-03-01

    Full Text Available Abstract Background Salmonella enterica serovar Typhimurium (S. Typhimurium is a Gram-negative pathogen that must successfully adapt to the broad fluctuations in the concentration of dissolved dioxygen encountered in the host. In Escherichia coli, ArcA (Aerobic Respiratory Control helps the cells to sense and respond to the presence of dioxygen. The global role of ArcA in E. coli is well characterized; however, little is known about its role in anaerobically grown S. Typhimurium. Results We compared the transcriptional profiles of the virulent wild-type (WT strain (ATCC 14028s and its isogenic arcA mutant grown under anaerobic conditions. We found that ArcA directly or indirectly regulates 392 genes (8.5% of the genome; of these, 138 genes are poorly characterized. Regulation by ArcA in S. Typhimurium is similar, but distinct from that in E. coli. Thus, genes/operons involved in core metabolic pathways (e.g., succinyl-CoA, fatty acid degradation, cytochrome oxidase complexes, flagellar biosynthesis, motility, and chemotaxis were regulated similarly in the two organisms. However, genes/operons present in both organisms, but regulated differently by ArcA in S. Typhimurium included those coding for ethanolamine utilization, lactate transport and metabolism, and succinate dehydrogenases. Salmonella-specific genes/operons regulated by ArcA included those required for propanediol utilization, flagellar genes (mcpAC, cheV, Gifsy-1 prophage genes, and three SPI-3 genes (mgtBC, slsA, STM3784. In agreement with our microarray data, the arcA mutant was non-motile, lacked flagella, and was as virulent in mice as the WT. Additionally, we identified a set of 120 genes whose regulation was shared with the anaerobic redox regulator, Fnr. Conclusion(s We have identified the ArcA regulon in anaerobically grown S. Typhimurium. Our results demonstrated that in S. Typhimurium, ArcA serves as a transcriptional regulator coordinating cellular metabolism, flagella

  8. The zebra mussel: US utility implications

    International Nuclear Information System (INIS)

    Dreissena polymorpha, the freshwater macrofouling zebra mussel, was introduced to Lake St. Clair, near Detroit, Michigan, in 1985. It has since spread throughout Lake Erie. Its planktonic veliger larval stage disperses on water currents and adults are transported by human and natural vectors, making it likely to spread throughout most of the United States and southern Canada except for the southwestern and southern United State, where summer water temperatures are above tolerated levels. Veligers enter raw water systems on intake currents to settle and grow to adults attached by secreted byssal threads to hard surfaces. Accumulations of adults impede flow, aggravate sedimentation and corrosion, and foul small-diameter components. Settlement occurs at flow velocities less than 1.5--2.0 m/sec. Mussels can reduce effective pipe diameters and foul intake structures, steam condensers, heat exchangers, fire protection systems, and cooling tower basins. Establishment of mussels in raw water systems should be prevented because subsequent removal is difficult and expensive. Mitigation procedures include manual removal, robotic cleaning, thermal backwashing, water jetting, application of molluscicides, and possibly line pigging and acidic chemical cleaning. Control technologies include oxidizing and non-oxidizing molluscicides, robotic cleaning, shell strainers, exposure of veligers to high voltage electrical fields, thermal backwashing and sand-filtration. The United States power industry can utilize extensive European experience with this species and domestic experience with the Asian clam in its development of effective controls for zebra mussel fouling

  9. [Application of zebra fishes in studies on traditional Chinese medicines].

    Science.gov (United States)

    Tian, Li-li; Zhu, Guo-fu

    2015-03-01

    The zebra fish model, as an integral animal model, features small volume, high throughput, low cost, short cycle and reliable experimental results, thus has been widely used in medical studies. Traditional Chinese medicines (TCM) constitute a complex system, their active ingredients and action mechanisms are among study hotspots in during the development of modern TCMs. Along with the constant improvement of advanced technologies and methods, zebra fishes have been increasingly applied in studies on TCMs and shown advantages in active screening, and toxicity and metabolism studies. In this paper, TCM studies by using zebra fishes in recent years are summarized to provide new ideas and methods for basic studies on TCMs. PMID:26087540

  10. El sentido de la historia en El Arca Rusa.

    OpenAIRE

    Nicolás Ocaranza

    2007-01-01

    El Arca Rusa de Alexandr Sokurov es un magnífico espejismo, una imagen histórica evocada en una sola toma y secuencia audiovisual que no necesitó de montaje para el registro cinematográfico. La película, rodada en video de alta definición en el actual museo Hermitage de San Petersburgo, se despliega en un continuum, sin interrupciones ni quiebres de lo que parece ser la evocación de un tiempo perdido. Esta obra se convirtió en el largometraje filmado ininterrumpidamente más extenso de la hist...

  11. Protandric hermaphroditism in the bivalve Arca noae (Mollusca: Arcidae

    Directory of Open Access Journals (Sweden)

    G. BELLO

    2013-04-01

    Full Text Available Following the histological analysis of Arca noae samples from the south-western Adriatic Sea, five hermaphroditic specimens were found out of 168 sexed individuals (3.0%. The hermaphrodite gonads showed the co-occurrence of male and female germ cells within the same acini, i.e. both spermatozoa in the lumen and oogonia lining its wall. Oogonia increased in size through winter, thus suggesting that the direction of sex change is from male to female. Both the biometrical analyses and theoretical considerations strongly suggest that A. noae is an obligate protandric species.

  12. Zebra and Quagga Mussel Distribution in North America - Direct Download

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — The concern caused by the explosive spread of the zebra mussel, (Dreissena polymorpha), within the United States resulted in passage of the Nonindigenous Aquatic...

  13. 77 FR 68163 - Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing and Immediate Effectiveness of...

    Science.gov (United States)

    2012-11-15

    ... From the Federal Register Online via the Government Publishing Office SECURITIES AND EXCHANGE COMMISSION Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing and Immediate Effectiveness of Proposed Rule Change To Amend the NYSE Arca Options Fee Schedule Relating to Pricing Applicable to Electronic Transactions in Non-Penny...

  14. 78 FR 10233 - Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing of Proposed Rule Change Relating...

    Science.gov (United States)

    2013-02-13

    ... From the Federal Register Online via the Government Publishing Office SECURITIES AND EXCHANGE COMMISSION Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing of Proposed Rule Change Relating to the Listing and Trading of the SPDR Blackstone/GSO Senior Loan ETF Under NYSE Arca Equities Rule 8.600 February 7, 2013. Pursuant to...

  15. 78 FR 19766 - Self-Regulatory Organizations; NYSE Arca, Inc.; Order Granting Approval of Proposed Rule Change...

    Science.gov (United States)

    2013-04-02

    ... From the Federal Register Online via the Government Publishing Office SECURITIES AND EXCHANGE COMMISSION Self-Regulatory Organizations; NYSE Arca, Inc.; Order Granting Approval of Proposed Rule Change Relating to the Listing and Trading of the SPDR Blackstone/GSO Senior Loan ETF Under NYSE Arca Equities Rule 8.600 March 27, 2013. I....

  16. Prevention of zebra mussel infestation and dispersal during aquaculture operations

    Science.gov (United States)

    Waller, D.L.; Fisher, S.W.; Dabrowska, H.

    1996-01-01

    The zebra mussel Dreissena polymorpha, an exotic invasive species, poses a major threat to North American fish management programs and the aquaculture industry. Fish hatcheries may become infected with zebra mussels from a variety of sources, including the water supply, fish shipments, boats, and equipment. The hatcheries could then serve as agents for the overland dispersal of zebra mussels into stocked waters and to other fish hatcheries. We evaluated the effectiveness and safety of aquaculture chemicals for use in controlling zebra mussels in fish hatcheries and preventing dispersal of veligers during fish transport. Chemicals were evaluated for use in fish transport and as disinfectants for ponds and equipment. Standardized static toxicity tests were conducted with representative species of warmwater, coolwater, and coldwater fishes and with larval (3-d-old veligers), early juvenile (settling larvae), and adult zebra mussels. Chemical concentrations and exposure durations were based on recommended treatment levels for fish, eggs, and ponds. Recommended treatment levels were also exceeded, if necessary, to establish lethal levels for zebra mussels of different developmental stages. Our results indicate that some chemicals currently in use in hatcheries may be effective for controlling zebra mussels in various operations. Chloride salts were the safest and most effective therapeutants tested for use in fish transport. The toxicity of chloride salts to fish varied among species and with temperature; only one treatment regime (sodium chloride at 10,000 mg/L) was safe to all fish species that we tested, but it was only effective on veliger and settler stages of the zebra mussel. Effective disinfectants were benzalkonium chloride for use on equipment and rotenone for use in ponds after fish are harvested. The regulatory status of the identified chemicals is discussed as well as several nonchemical control alternatives.

  17. Zebra battery technologies for all electric smart car

    OpenAIRE

    O'Sullivan, T M; Bingham, Chris; Clark, R E

    2006-01-01

    This paper describes the operational behaviour and advantages of the high temperature, sodium nickel chloride (Zebra) battery, for use in all electric urban (city) vehicles. It is shown that an equivalent parallel electrical circuit can be employed to accurately simulate the electrochemical behaviour inherent in the most recent generation of Zebra cells. The experimental procedure is outlined and summary attributes of the investigation validated by both simulation studies, and experimentally,...

  18. A Minimally-Invasive Procedure for Sexing Young Zebra Finches

    OpenAIRE

    Soderstrom, Ken; Qin, Weixi; Leggett, Matthew H.

    2007-01-01

    Zebra finches have been widely used to study neurobiology underlying vocal development. Because only male zebra finches learn song, efficient developmental use of these animals requires early determination of sex at ages that precede maturation of secondary sex characteristics. We have developed a sex determination method that combines a forensics method of genomic DNA isolation (from very small blood samples) with PCR amplification from Z and W sex chromosomes (males are ZZ, females ZW). Thi...

  19. FRUTAS COMERCIALIZADAS EM FEIRA LIVRE APRESENTAM MAIOR TEOR DE ȕ-CAROTENO E VALOR DE VITAMINA A

    Directory of Open Access Journals (Sweden)

    Nádia Maria Lopes AMORIM

    2012-01-01

    Full Text Available Em países em desenvolvimento, como o Brasil, a maior parte da vitamina A da dieta é proveniente de carotenoides pró-vitamínicos A como Į-caroteno e, principalmente, ȕ-caroteno presentes em frutas e hortaliças. O conteúdo de carotenoides nas frutas pode ser afetado por diversos fatores, entre eles o local de comercialização. Assim, foram investigados a ocorrência e o conteúdo de Į- e ȕ-caroteno em cinco frutas (goiaba Paluma, kiwi, mamão Formosa, manga Haden e maracujá azedo comercializadas em três mercados e uma feira livre do município de Viçosa, Minas Gerais. Os carotenoides foram extraídos em acetona e analisados por cromatografia líquida de alta eficiência, utilizando detector de arranjo de diodos. O Į-caroteno não foi encontrado em nenhuma amostra. O ȕ-caroteno foi identificado e quantificado em todas as frutas. Os teores de ȕ-caroteno e os valores de vitamina A das frutas comercializadas na feira livre, exceto no mamão, foram estatisticamente superiores aos daquelas comercializadas nos mercados. O maior conteúdo de ȕ-caroteno foi observado no maracujá (1,97mg/100g, seguido da manga Haden (1,47mg/100g, goiaba Paluma (1,05mg/100g, mamão Formosa (0,38mg/100g e kiwi (0,20mg/100g. O maracujá, a manga Haden e a goiaba Paluma mostraram-se excelentes fontes de pró-vitamina A para crianças e boas fontes para homens adultos. O mamão Formosa mostrou-se fonte de vitamina A para crianças. O maracujá, a manga Haden, a goiaba Paluma e o mamão Formosa mostraram-se fontes de ȕ-caroteno e contribuíram de forma importante para o suprimento das recomendações de vitamina A para homens adultos e crianças.

  20. Zebra: An advanced PWR lattice code

    Energy Technology Data Exchange (ETDEWEB)

    Cao, L.; Wu, H.; Zheng, Y. [School of Nuclear Science and Technology, Xi' an Jiaotong Univ., No. 28, Xianning West Road, Xi' an, ShannXi, 710049 (China)

    2012-07-01

    This paper presents an overview of an advanced PWR lattice code ZEBRA developed at NECP laboratory in Xi'an Jiaotong Univ.. The multi-group cross-section library is generated from the ENDF/B-VII library by NJOY and the 361-group SHEM structure is employed. The resonance calculation module is developed based on sub-group method. The transport solver is Auto-MOC code, which is a self-developed code based on the Method of Characteristic and the customization of AutoCAD software. The whole code is well organized in a modular software structure. Some numerical results during the validation of the code demonstrate that this code has a good precision and a high efficiency. (authors)

  1. Zebra: An advanced PWR lattice code

    International Nuclear Information System (INIS)

    This paper presents an overview of an advanced PWR lattice code ZEBRA developed at NECP laboratory in Xi'an Jiaotong Univ.. The multi-group cross-section library is generated from the ENDF/B-VII library by NJOY and the 361-group SHEM structure is employed. The resonance calculation module is developed based on sub-group method. The transport solver is Auto-MOC code, which is a self-developed code based on the Method of Characteristic and the customization of AutoCAD software. The whole code is well organized in a modular software structure. Some numerical results during the validation of the code demonstrate that this code has a good precision and a high efficiency. (authors)

  2. Doppler coefficient measurements in Zebra Core 5

    International Nuclear Information System (INIS)

    Measurements using a central hot loop in Zebra Core 5 are described. Results are given for the Doppler coefficients found in a number of assemblies with PuO2 and 16% PuO2/84% depleted UO2 pins, loaded with different combinations of steel, sodium or void pins. The mixed oxide results are in general about 20% more negative than was calculated using the FD2 data set, but agreement is good if the plutonium contributions in the calculations are omitted. The small positive Doppler coefficient calculated for Pu239 was not observed, and two measurements indicated instead a small negative effect. The Doppler effect in the mixed oxide systems was found to vary approximately as 1/T. The results from the empty loop and non-fissile assemblies indicate either a small negative Doppler effect in steel or alternatively the presence of an unexplained expansion effect. (author)

  3. The zebra finch neuropeptidome: prediction, detection and expression

    Directory of Open Access Journals (Sweden)

    Annangudi Suresh P

    2010-04-01

    Full Text Available Abstract Background Among songbirds, the zebra finch (Taeniopygia guttata is an excellent model system for investigating the neural mechanisms underlying complex behaviours such as vocal communication, learning and social interactions. Neuropeptides and peptide hormones are cell-to-cell signalling molecules known to mediate similar behaviours in other animals. However, in the zebra finch, this information is limited. With the newly-released zebra finch genome as a foundation, we combined bioinformatics, mass-spectrometry (MS-enabled peptidomics and molecular techniques to identify the complete suite of neuropeptide prohormones and final peptide products and their distributions. Results Complementary bioinformatic resources were integrated to survey the zebra finch genome, identifying 70 putative prohormones. Ninety peptides derived from 24 predicted prohormones were characterized using several MS platforms; tandem MS confirmed a majority of the sequences. Most of the peptides described here were not known in the zebra finch or other avian species, although homologous prohormones exist in the chicken genome. Among the zebra finch peptides discovered were several unique vasoactive intestinal and adenylate cyclase activating polypeptide 1 peptides created by cleavage at sites previously unreported in mammalian prohormones. MS-based profiling of brain areas required for singing detected 13 peptides within one brain nucleus, HVC; in situ hybridization detected 13 of the 15 prohormone genes examined within at least one major song control nucleus. Expression mapping also identified prohormone messenger RNAs in areas associated with spatial learning and social behaviours. Based on the whole-genome analysis, 40 prohormone probes were found on a commonly used zebra finch brain microarray. Analysis of these newly annotated transcripts revealed that six prohormone probes showed altered expression after birds heard song playbacks in a paradigm of song

  4. Song Recognition in Zebra Finches: Are There Sensitive Periods for Song Memorization?

    Science.gov (United States)

    Braaten, Richard F.

    2010-01-01

    Male zebra finches learn to sing songs that they hear between 25 and 65 days of age, the sensitive period for song learning. In this experiment, male and female zebra finches were exposed to zebra finch songs either before (n = 9) or during (n = 4) the sensitive period. Following song exposure, recognition memory for the songs was assessed with an…

  5. Zebra finch as a developmental model.

    Science.gov (United States)

    Mak, Siu-Shan; Wrabel, Anna; Nagai, Hiroki; Ladher, Raj K; Sheng, Guojun

    2015-11-01

    The domesticated zebra finch (Taeniopygia guttata) is a well-established animal model for studying vocal learning. It is also a tractable model for developmental analyses. The finch genome has been sequenced and methods for its transgenesis have been reported. Hatching and sexual maturation in this species takes only two weeks and three months, respectively. Finch colonies can be established relatively easily and its eggs are laid at a stage earlier than in other common avian experimental models, facilitating the analysis of very early avian development. Representing the Neoaves to which 95% of all bird species belong, the finch can potentially complement two existing, Galloanserae developmental models, the chick, and quail. Here, we provide a step-by-step guide for how to set up a finch colony in a conventional laboratory environment. Technical tips are offered to optimize hens' productivity and ensure a constant supply of fertilized finch eggs. Methods of handling finch eggs and embryos for subsequent embryological, cellular, or molecular analyses are also discussed. We conclude by emphasizing scientific values and cost effectiveness of maintaining a finch colony for avian developmental studies. genesis 53:669-677, 2015. © 2015 Wiley Periodicals, Inc. PMID:26385755

  6. Mechanisms of copying behaviour in zebra finches.

    Science.gov (United States)

    Guillette, Lauren M; Healy, Susan D

    2014-10-01

    When an individual is faced with choosing between unfamiliar food options, it may benefit initially by choosing the option chosen by other animals so avoiding potentially poisonous food. It is not clear which cues the naïve forager learns from the demonstrator for choosing between food options. To determine firstly which birds (zebra finches, Taeniopygia guttata) would copy a demonstrator's choice, in Experiment 1 we presented each observer with a demonstrator feeding from one of two differently coloured feeders and then tested the observer's feeder colour preference. Of the same-sex/mixed-sex demonstrator-observer pairs tested only females copied male demonstrators. In Experiment 2, birds did not prefer either feeder colour in the absence of demonstrators confirming the social learning effect observed in Experiment 1. In Experiment 3, copying females fed significantly more at the feeder of the demonstrated colour, rather than at the location of the demonstrated feeder. These data point not just to the identity of the individual to be copied but also to the kind of information learned. PMID:25444776

  7. Vocal tract articulation in zebra finches.

    Directory of Open Access Journals (Sweden)

    Verena R Ohms

    Full Text Available BACKGROUND: Birdsong and human vocal communication are both complex behaviours which show striking similarities mainly thought to be present in the area of development and learning. Recent studies, however, suggest that there are also parallels in vocal production mechanisms. While it has been long thought that vocal tract filtering, as it occurs in human speech, only plays a minor role in birdsong there is an increasing number of studies indicating the presence of sound filtering mechanisms in bird vocalizations as well. METHODOLOGY/PRINCIPAL FINDINGS: Correlating high-speed X-ray cinematographic imaging of singing zebra finches (Taeniopygia guttata to song structures we identified beak gape and the expansion of the oropharyngeal-esophageal cavity (OEC as potential articulators. We subsequently manipulated both structures in an experiment in which we played sound through the vocal tract of dead birds. Comparing acoustic input with acoustic output showed that OEC expansion causes an energy shift towards lower frequencies and an amplitude increase whereas a wide beak gape emphasizes frequencies around 5 kilohertz and above. CONCLUSION: These findings confirm that birds can modulate their song by using vocal tract filtering and demonstrate how OEC and beak gape contribute to this modulation.

  8. KM3NeT-ARCA project status and plan

    Directory of Open Access Journals (Sweden)

    Coniglione R.

    2016-01-01

    Full Text Available The KM3NeT Collaboration aims at building a research infrastructure in the depths of the Mediterranean Sea hosting a cubic kilometre neutrino telescope. The KM3NeT/ARCA detector is the ideal instrument to look for high-energy neutrino sources thanks to the latitude of the detector and to the optical characteristics of the sea water. The detector latitude allows for a wide coverage of the observable sky including the region of the Galactic centre and the optical sea water properties allow for the measure of the neutrino direction with excellent angular resolution also for cascade events. The technologically innovative components of the detector and the status of construction will be presented as well as the capability it offers to discover neutrinos.

  9. IMPACT OF WATER PH ON ZEBRA MUSSEL MORTALITY

    International Nuclear Information System (INIS)

    The experiments conducted this past quarter have suggested that the bacterium Pseudomonas fluorescens strain CL0145A is effective at killing zebra mussels throughout the entire range of pH values tested (7.2 to 8.6). Highest mortality was achieved at pH values characteristic of preferred zebra mussel waterbodies, i.e., hard waters with a range of 7.8 to 8.6. In all water types tested, however, ranging from very soft to very hard, considerable mussel kill was achieved (83 to 99% mean mortality), suggesting that regardless of the pH or hardness of the treated water, significant mussel kill can be achieved upon treatment with P. fluorescens strain CL0145A. These results further support the concept that this bacterium has significant potential for use as a zebra mussel control agent in power plant pipes receiving waters with a wide range of physical and chemical characteristics

  10. Halicephalobus gingivalis (Nematoda) infection in a Grevy's zebra (Equus grevyi).

    Science.gov (United States)

    Isaza, R; Schiller, C A; Stover, J; Smith, P J; Greiner, E C

    2000-03-01

    A 6-yr-old female Grevy's zebra (Equus grevyi) with a disseminated rhabditiform nematode infection is described. Antemortem clinical signs were limited to blindness and abnormal behavior believed to be caused by a recurrent nematode-induced uveitis. Histologic examination of the kidneys, heart, eyes, uterus, and lymph nodes revealed granulomas containing multiple sections of rhabditiform nematodes. Most of the recovered nematodes were larval stages with only a few adult females noted. The adults measured 243-297 microm x 11-16 microm (x = 269 x 14 microm). The distinctive rhabditiform esophagi had corpus:isthmus:bulb proportions of 19:11:5. On the basis of adult morphology, the nematode was identified as Halicephalobus gingivalis. This is the first report of this parasite in a zebra and indicates that this parasitic granulomatous disease should be considered in zebras with neurologic disease. PMID:10884129

  11. 78 FR 48920 - Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing and Immediate Effectiveness of...

    Science.gov (United States)

    2013-08-12

    ... corporate governance and notice requirements. This current policy is appropriate in light of NYSE Arca... summarizing important Exchange corporate governance and notice requirements disseminated to all listed issuers... which have been altered by merger, acquisition, consolidation or other corporate action,...

  12. Heart synchronization for SPIM microscopy of living zebra fish

    Science.gov (United States)

    Taylor, J. M.; Saunter, C. D.; Chaudhry, B.; Henderson, D. J.; Love, G. D.; Girkin, J. M.

    2011-03-01

    We describe work on producing a selective plane illumination microscope for cardiac imaging in zebra fish embryos. The system has a novel synchronization system for imaging oscillating structures (e.g. the heart) and will have adaptive optics for image optimization.

  13. Potato psyllid vector density and zebra chip disease

    Science.gov (United States)

    Zebra chip disease (ZC), which is caused by ‘Candidatus Liberibacter solanacearum’ (Lso) and vectored by potato psyllids Bactericera cockerelli, is a continuing threat to the North American potato industry. Current management entails frequent insecticide sprays for the vectors as thresholds for spra...

  14. Complete genome sequence of a novel circovirus from zebra finch.

    Science.gov (United States)

    Rinder, Monika; Schmitz, Anna; Peschel, Andrea; Korbel, Rüdiger

    2015-01-01

    A novel circovirus was identified in zebra finches (Taeniopygia guttata). The genome of the circovirus strain, designated 8454V25-1, comprised 1,982 nucleotides with two major open reading frames encoding a replication-associated protein and a viral capsid protein. PMID:26021933

  15. Endophytic bacteria in potato tubers affected by zebra chip disease

    Science.gov (United States)

    Potato zebra chip disease (ZCD) could drastically reduce quality and value of all market classes of potato, costing growers and processors millions of dollars in losses in North America. Endophytic bacteria colonize the internal tissue and could have both positive and negative effects on host plants...

  16. Monitoramento da contaminação por elementos traço em ostras comercializadas em Recife, Pernambuco, Brasil

    Directory of Open Access Journals (Sweden)

    André Dias Cavalcanti

    2003-10-01

    Full Text Available Amostras de ostras comercializadas em Recife, Pernambuco, Brasil, foram monitoradas em relação ao conteúdo de elementos traço (Hg, Zn, Fe, Cu e Mn durante o período de um ano (março/2001 a fevereiro/2002. Mercúrio foi o principal contaminante encontrado nas ostras e o elemento que apresenta maior risco à saúde pública. Foram encontrados valores de concentração de Hg em ostras de até 551,12µg/kg (peso úmido. Esses valores sugerem que a ingestão de ostras deve ser feita com restrições, principalmente, pela população que vive de sua coleta como forma de subsistência, por crianças, e mulheres grávidas. A avaliação dos níveis de mercúrio em frutos do mar é um importante fator para avaliar o risco de contaminação por mercúrio em pessoas não ocupacionalmente expostas.

  17. DETERMINAÇÃO DA QUALIDADE MICROBIOLÓGICA DE POLPAS DE AÇAÍ CONGELADAS COMERCIALIZADAS NA CIDADE DE POUSO ALEGRE – MG

    OpenAIRE

    Mariza FARIA; Laila Brasil Domingues OLIVEIRA; Francisco Eduardo de Carvalho COSTA

    2012-01-01

    A demanda por açaí tem crescido gradativamente nos mercados nacional e internacional, devido seu caráter energético e nutritivo. No entanto, o fruto é extremamente manipulado durante toda cadeia de produção da polpa, o que propicia a presença de uma elevada carga microbiana, sendo este um dos fatores responsáveis pela sua deterioração. O objetivo deste trabalho foi avaliar a qualidade microbiológica de polpas de açaí congeladas comercializadas em 12 estabelecimentos, n...

  18. A New Antiproliferative and Antioxidant Peptide Isolated from Arca subcrenata

    Directory of Open Access Journals (Sweden)

    Qin Zheng

    2013-05-01

    Full Text Available A new antitumor and antioxidant peptide (H3 was isolated from Arca subcrenata Lischke using ion exchange and hydrophobic column chromatography. The purity of H3 was over 99.3% in reversed phase-high performance liquid chromatography (RP-HPLC and the molecular weight was determined to be 20,491.0 Da by electrospray-ionization mass spectrometry (ESI-MS/MS. The isoelectric point of H3 was measured to be 6.65 by isoelectric focusing-polyacrylamide gel electrophoresis. Partial amino acid sequence of this peptide was determined as ISMEDVEESRKNGMHSIDVNH DGKHRAYWADNTYLM-KCMDLPYDVLDTGGKDRSSDKNTDLVDLFELDMVPDRK NNECMNMIMDVIDTN-TAARPYYCSLDVNHDGAGLSMEDVEEDK via MALDI-TOF/ TOF-MS and de novo sequencing. The in vitro antitumor activity of H3 was evaluated by 3-(4,5-dimethyl-2-thiazolyl-2,5-diphenyl-2H-tetrazolium bromide (MTT assay. The result indicated that H3 exhibited significant antiproliferative activity against HeLa, HepG2 and HT-29 cell lines with IC50 values of 10.8, 10.1 and 10.5 μg/mL. The scavenging percentage of H3 at 8 mg/mL to 2,2-diphenyl-1-picrylhydrazyl (DPPH and hydroxyl radicals were 56.8% and 47.5%, respectively.

  19. Predation on exotic zebra mussels by native fishes: Effects on predator and prey

    Science.gov (United States)

    Magoulick, D.D.; Lewis, L.C.

    2002-01-01

    1. Exotic zebra mussels, Dreissena polymorpha, occur in southern U.S. waterways in high densities, but little is known about the interaction between native fish predators and zebra mussels. Previous studies have suggested that exotic zebra mussels are low profitability prey items and native vertebrate predators are unlikely to reduce zebra mussel densities. We tested these hypotheses by observing prey use of fishes, determining energy content of primary prey species of fishes, and conducting predator exclusion experiments in Lake Dardanelle, Arkansas. 2. Zebra mussels were the primary prey eaten by 52.9% of blue catfish, Ictalurus furcatus; 48.2% of freshwater drum, Aplodinotus grunniens; and 100% of adult redear sunfish, Lepomis microlophus. Blue catfish showed distinct seasonal prey shifts, feeding on zebra mussels in summer and shad, Dorosoma spp., during winter. Energy content (joules g-1) of blue catfish prey (threadfin shad, Dorosoma petenense; gizzard shad, D. cepedianum; zebra mussels; and asiatic clams, Corbicula fluminea) showed a significant species by season interaction, but shad were always significantly greater in energy content than bivalves examined as either ash-free dry mass or whole organism dry mass. Fish predators significantly reduced densities of large zebra mussels (>5 mm length) colonising clay tiles in the summers of 1997 and 1998, but predation effects on small zebra mussels (???5 mm length) were less clear. 3. Freshwater drum and redear sunfish process bivalve prey by crushing shells and obtain low amounts of higher-energy food (only the flesh), whereas blue catfish lack a shell-crushing apparatus and ingest large amounts of low-energy food per unit time (bivalves with their shells). Blue catfish appeared to select the abundant zebra mussel over the more energetically rich shad during summer, then shifted to shad during winter when shad experienced temperature-dependent stress and mortality. Native fish predators can suppress adult zebra

  20. Optimal Management of a Potential Invader: The Case of Zebra Mussels in Florida

    OpenAIRE

    Lee, Donna J.; Damian C. Adams; Rossi, Frederick J.

    2007-01-01

    Dominant users of Lake Okeechobee water resources are agricultural producers and recreational anglers. These uses will be directly affected, should the lake become infested with zebra mussels. We employ a probabilistic bioeconomic simulation model to estimate the potential impact of zebra mussels on consumptive water uses, recreational angling, and wetland ecosystem services under alternative public management scenarios. Without public management, the expected net economic impact from zebra m...

  1. FindZebra: A search engine for rare diseases

    DEFF Research Database (Denmark)

    Dragusin, Radu; Petcu, Paula; Lioma, Christina Amalia;

    2013-01-01

    Background: The web has become a primary information resource about illnesses and treatments for both medical and non-medical users. Standard web search is by far the most common interface for such information. It is therefore of interest to find out how well web search engines work for diagnostic...... approach for web search engines for rare disease diagnosis which includes 56 real life diagnostic cases, state-of-the-art evaluation measures, and curated information resources. In addition, we introduce FindZebra, a specialized (vertical) rare disease search engine. FindZebra is powered by open source...... medical concepts to demonstrate different ways of displaying the retrieved results to medical experts. Conclusions: Our results indicate that a specialized search engine can improve the diagnostic quality without compromising the ease of use of the currently widely popular web search engines. The proposed...

  2. Factors limiting song acquisition in adult zebra finches.

    Science.gov (United States)

    Funabiki, Yasuko; Funabiki, Kazuo

    2009-09-15

    Song learning takes place in two separate or partially overlapping periods, a sensory phase in which a tutor song is memorized and a sensorimotor phase in which a copy of the model is produced. The stage of song development where song becomes stable and stereotyped is called crystallization. Adult birds usually do not learn new song in many species including the zebra finch. However, it is not known whether song crystallization as such or aging impedes adult learning. Exposure to loud noises prevents birds from developing and crystallizing their song, because they cannot control their voice by auditory feedback. Zebra finches even without previous experience of hearing or singing a song failed to learn a song model provided in adulthood. Thus, neither the absence of a tutor song nor the lack of song crystallization enables new song learning in adulthood, but age per se limits the ability or motivation to learn song. PMID:19623623

  3. Drinking Songs: Alcohol Effects on Learned Song of Zebra Finches

    OpenAIRE

    Olson, Christopher R.; Owen, Devin C.; Ryabinin, Andrey E.; MELLO, CLAUDIO V.

    2014-01-01

    Speech impairment is one of the most intriguing and least understood effects of alcohol on cognitive function, largely due to the lack of data on alcohol effects on vocalizations in the context of an appropriate experimental model organism. Zebra finches, a representative songbird and a premier model for understanding the neurobiology of vocal production and learning, learn song in a manner analogous to how humans learn speech. Here we show that when allowed access, finches readily drink alco...

  4. Mortality of zebra mussel, Dreissena polymorpha, veligers during downstream transport

    Science.gov (United States)

    Horvath, T.G.; Lamberti, G.A.

    1999-01-01

    1. Streams flowing from lakes which contain zebra mussels, Dreissena polymorpha, provide apparently suitable habitats for mussel colonization and downstream range expansion, yet most such streams contain few adult mussels. We postulated that mussel veligers experience high mortality during dispersal via downstream transport. They tested this hypothesis in Christiana Creek, a lake-outlet stream in south-western Michigan, U.S.A., in which adult mussel density declined exponentially with distance downstream. 2. A staining technique using neutral red was developed and tested to distinguish quickly live and dead veligers. Live and dead veligers were distinguishable after an exposure of fresh samples to 13.3 mg L-1 of neutral red for 3 h. 3. Neutral red was used to determine the proportion of live veligers in samples taken longitudinally along Christiana Creek. The proportion of live veligers (mean ?? SE) declined from 90 ?? 3% at the lake outlet to 40 ?? 8% 18 km downstream. 4. Veligers appear to be highly susceptible to damage by physical forces (e.g. shear), and therefore, mortality in turbulent streams could be an important mechanism limiting zebra mussel dispersal to downstream reaches. Predictions of zebra mussel spread and population growth should consider lake-stream linkages and high mortality in running waters.

  5. The first complete mitochondrial genome of the Maylandia zebra.

    Science.gov (United States)

    Xia, Yan; Dang, Xiao; Xu, Qiwu; Zhang, Dongya

    2016-09-01

    Maylandia zebra, a member of the family cichlid living in individual African lakes, are regarded as a significant evolution model. Recently the genome sequencing had been done, but there is no sufficient information about its mitochondria. Herein, we first assembled the complete mitochondrial genome sequence of Maylandia zebra. It is a 16 582 bp long sequence with most mitogenome's characteristic structure, 13 protein-coding genes, 22 tRNA genes, 2 rRNA genes and 1 putative control region. The GC-content of our fresh sequence is 45.86%, similar to closely related species Oreochromis niloticus. The accuracy and utility of new determined mitogenome sequences can be verified by the phylogenetic analysis, based on whole mitogenome alignment with Neolamprologus brichardi, Pseudotropheus crabro, Oreochromis niloticu, which is closest relative to Maylandia zebra, and 6 others. Using the full mitogenome, we expect to address taxonomic issues and study the related evolution events. Moreover, this is the first report of the mitogenome of genus Maylandia. PMID:27158870

  6. DNA adduct measurements in zebra mussels, Dreissena polymorpha, Pallas

    International Nuclear Information System (INIS)

    The purpose of this study was to examine PAH accumulation and bulky DNA adduct formation in the digestive gland of zebra mussels exposed in their habitat or in controlled laboratory conditions to complex mixture of PAH. DNA adducts were measured using a 32P-postlabelling protocol with nuclease P1 enrichment adapted from Reddy and Randerath [Reddy, M.V., Randerath, K., 1986. Nuclease P1-mediated enhancement of sensitivity of 32P-postlabelling test for structurally diverse DNA adducts. Carcinogenesis 7, 1543-1551]. Specimens collected in the upper part of the Seine estuary were shown to accumulate higher levels of PAH (up to 1.6 μg g-1 dry weight) in comparison to individuals from the reference site (0.053 μg g-1 dry weight). The former exhibited elevated levels of DNA adducts (up to 4.0/108 nucleotides) and higher diversity of individual adducts with five distinct spots being specifically detected in individuals originating from the Seine estuary. Zebra mussels exposed for 5 days to 0.01% (v/v) of organic extract of sediment from the Seine estuary were shown to accumulate high amounts of PAH (up to 138 μg g-1 dry weight) but exhibited relatively low levels of DNA adducts. Exposure to benzo[a]pyrene led to a dose-dependent accumulation of B[a]P (up to 7063 μg g-1 dry weight) and a clear induction of DNA adduct formation in the digestive gland of mussels (up to 1.13/108 nucleotides). Comparisons with other bivalves exposed to the same model PAH, revealed similar levels of adducts and comparable adduct profiles with a main adduct spot and a second faint one. This study clearly demonstrated that zebra mussels are able to biotransform B[a]P and probably other PAH into reactive metabolites with DNA-binding activity. This work also demonstrated the applicability of the nuclease P1 enhanced 32P-postlabelling method for bulky adduct detection in the digestive gland of zebra mussels. DNA adduct measurement in zebra mussels could be a suitable biomarker to monitor PAH

  7. Modelling the effects of diving ducks on zebra mussels Dreissena polymorpha in lakes

    NARCIS (Netherlands)

    Nes, van E.H.; Noordhuis, R.; Lammens, E.H.R.R.; Portielje, R.; Reeze, B.; Peeters, E.T.H.M.

    2008-01-01

    An individual-based model describing the growth of zebra mussels (Dreissena polymorpha) is presented. The model is spatially explicit and predicts length¿frequency distributions of zebra mussels. The parameters and model inputs with the strongest effect on the model outcomes were identified using a

  8. Newspaper Coverage of Zebra Mussels in North America : A Case of "Afghanistanism"?

    OpenAIRE

    Roush, Donny; Fortner, Rosanne

    1996-01-01

    Few environmental issues have arisen so abruptly, spread so rapidly, and been so clearly linked to human activity as has the introduction of nonindigenous zebra mussels to the surface freshwater of North America. This research examines communication patterns in information about zebra mussels as an example of how the mass media deal with threats to the environment.

  9. Are Horses Like Zebras, or Vice Versa? Children's Sensitivity to the Asymmetries of Directional Comparisons

    Science.gov (United States)

    Chestnut, Eleanor K.; Markman, Ellen M.

    2016-01-01

    Adults exhibit strong preferences when framing symmetrical relations. Adults prefer, for example, "A zebra is like a horse" to "A horse is like a zebra," and "The bicycle is near the building" to "The building is near the bicycle." This is because directional syntax requires more typical or prominent items…

  10. Antioxidant Activities of Hydrolysates of Arca Subcrenata Prepared with Three Proteases

    OpenAIRE

    Liyan Song; Tingfei Li; Rongmin Yu; Chunyan Yan; Yu Zhao; Shengfang Ren

    2008-01-01

    In order to get products with antioxidant activity from Arca subcrenata Lischke, the optimal hydrolase and hydrolysis conditionswere investigated in the paper. Three proteases (neutrase, alcalase and papain) were applied to hydrolyze the homogenate of A. subcrenata. An orthogonaldesign was used to optimize hydrolysis conditions, and the pH-stat methods was used to determine the degree of hydrolysis. Viewed from the angle ofreducing power, such as scavenging activities against α,α-diphen...

  11. Antioxidant Activities of Hydrolysates of Arca Subcrenata Prepared with Three Proteases

    OpenAIRE

    Song, Liyan; Li, Tingfei; Yu, Rongmin; Yan, Chunyan; Ren, Shengfang; Zhao, Yu

    2008-01-01

    In order to get products with antioxidant activity from Arca subcrenata Lischke, the optimal hydrolase and hydrolysis conditions were investigated in the paper. Three proteases (neutrase, alcalase and papain) were applied to hydrolyze the homogenate of A. subcrenata. An orthogonal design was used to optimize hydrolysis conditions, and the pH-stat methods was used to determine the degree of hydrolysis. Viewed from the angle of reducing power, such as scavenging activities against α,α-diphenyl-...

  12. Antioxidant Activities of Hydrolysates of Arca Subcrenata Prepared with Three Proteases

    OpenAIRE

    Song, Liyan; Li, Tingfei; Yu, Rongmin; Yan, Chunyan; Ren, Shengfang; ZHAO Yu

    2008-01-01

    In order to get products with antioxidant activity from Arca subcrenata Lischke, the optimal hydrolase and hydrolysis conditionswere investigated in the paper. Three proteases (neutrase, alcalase and papain) were applied to hydrolyze the homogenate of A. subcrenata. An orthogonaldesign was used to optimize hydrolysis conditions, and the pH-stat methods was used to determine the degree of hydrolysis. Viewed from the angle ofreducing power, such as scavenging activities against α,α-diphenyl-β-p...

  13. Bioaccumulation of 239+240Pu in benthic organisms crab (Scylla serrata) and arca (Anadara granosa) : a case study from Trombay

    International Nuclear Information System (INIS)

    The study presents the concentration of (239+240)Pu in various size groups of crab (SCYLLA SERRATA) and arca (ANADARA GRANOSA). Around 96 crabs and 650 arcas were harvested from the Mumbai Harbour Bay. Crabs and arcas were grouped in different size groups as per their widths. The maximum concentration 239+240Pu is observed in case of crab for the lowest size group whereas for arca the same is observed in the highest size group. This difference in the uptake of (239+240)Pu is attributed to the difference in metabolic functions of the two species. Bio-accumulation factor (Bp) values in case of crab flesh ranged between 70 to 1140 kg-1 with a GM value of 180 and in arca the value ranged between 6 to 60 l kg-1 with a GM of 20. The values for shell were higher by factors of 2 to 9 in case of crab and 3 to 22 in case of arca. The smallest size group of crab shows maximum Bp value whereas for arca maximum Bp is observed for maximum size group. (author)

  14. Scanning electron microscopy of Strongylus spp. in zebra.

    Science.gov (United States)

    Els, H J; Malan, F S; Scialdo-Krecek, R C

    1983-12-01

    The external ultrastructure of the anterior and posterior extremities of the nematodes, Strongylus asini , Strongylus vulgaris, Strongylus equinus and Strongylus edentatus, was studied with scanning electron microscopy (SEM). Fresh specimens of S. asini were collected from the caecum, ventral colon and vena portae of Equus burchelli and Equus zebra hartmannae ; S. vulgaris from the caecum, colon and arteria ileocolica of E. burchelli ; S. equinus from the ventral colon of E. z. hartmannae and S. edentatus from the caecum and ventral colon of both zebras , during surveys of parasites in zebras in the Etosha Game Reserve, South West Africa/Namibia, and the Kruger National Park, Republic of South Africa. The worms were cleaned, fixed and mounted by standard methods and photographed in a JEOL JSM - 35C scanning electron microscope (SEM) operating at 12kV . The SEM showed the following differences: the tips of the external leaf-crowns varied and were fine and delicate in S. asini , coarse and broad in S. vulgaris and, in S. equinus and S. edentatus, closely adherent, separating into single elements for half their length. The excretory pores showed only slight variation, and the morphology of the copulatory bursae did not differ from those seen with light microscopy. The genital cones differed markedly: S. asini had a ventral triangular projection and laterally 2 finger-like projections: in S. vulgaris there were numerous bosses on the lateral and ventral aspects of the cone; in S. equinus 2 finger-like processes projected laterocaudally ; and in S. edentatus 2 pairs of papilla-like processes projected laterally on the ventral aspects, and a pair of rounded projections and a pair of hair-like structures adorned the dorsal aspects.(ABSTRACT TRUNCATED AT 250 WORDS) PMID:6676687

  15. Digital gene expression analysis of the zebra finch genome

    Directory of Open Access Journals (Sweden)

    Burke Terry

    2010-04-01

    Full Text Available Abstract Background In order to understand patterns of adaptation and molecular evolution it is important to quantify both variation in gene expression and nucleotide sequence divergence. Gene expression profiling in non-model organisms has recently been facilitated by the advent of massively parallel sequencing technology. Here we investigate tissue specific gene expression patterns in the zebra finch (Taeniopygia guttata with special emphasis on the genes of the major histocompatibility complex (MHC. Results Almost 2 million 454-sequencing reads from cDNA of six different tissues were assembled and analysed. A total of 11,793 zebra finch transcripts were represented in this EST data, indicating a transcriptome coverage of about 65%. There was a positive correlation between the tissue specificity of gene expression and non-synonymous to synonymous nucleotide substitution ratio of genes, suggesting that genes with a specialised function are evolving at a higher rate (or with less constraint than genes with a more general function. In line with this, there was also a negative correlation between overall expression levels and expression specificity of contigs. We found evidence for expression of 10 different genes related to the MHC. MHC genes showed relatively tissue specific expression levels and were in general primarily expressed in spleen. Several MHC genes, including MHC class I also showed expression in brain. Furthermore, for all genes with highest levels of expression in spleen there was an overrepresentation of several gene ontology terms related to immune function. Conclusions Our study highlights the usefulness of next-generation sequence data for quantifying gene expression in the genome as a whole as well as in specific candidate genes. Overall, the data show predicted patterns of gene expression profiles and molecular evolution in the zebra finch genome. Expression of MHC genes in particular, corresponds well with expression

  16. Is the body condition of the invasive zebra mussel (Dreissena polymorpha) enhanced through attachment to native freshwater mussels (Bivalvia, Unionidae)?

    Science.gov (United States)

    Pilotto, Francesca; Sousa, Ronaldo; Aldridge, David C

    2016-05-15

    The invasion of zebra mussels, Dreissena polymorpha, into Western Europe and North America has driven widespread ecological change. Attachment of zebra mussels to the shell of native unionoid mussels has resulted in reductions in unionoid abundance and, in extreme cases, their localised extirpations. While the impacts of zebra mussels on infested unionoids are well documented, the possible benefits of the association to the zebra mussel have been little considered. We collected zebra mussels attached to unionoids and to inanimate structures. Zebra mussels attached to unionoids had significantly larger shells, higher standardized body mass and glycogen content than those attached to inanimate substrates, suggesting that D. polymorpha benefits from settling upon unionoids. The body condition of individual zebra mussels was negatively correlated with the number of zebra mussels attached to the unionoid, indicating intraspecific competition. Therefore, zebra mussels seem positively affected through attachment to unionoid mussels, but that these benefits decrease at higher densities of fouling. This association may offer advantages to the spread of zebra mussels within unionoid-rich systems, especially at sites with soft substrates and at the early stages of the invasion process where intraspecific competition is likely to be lower and benefits to the zebra mussels are higher. PMID:26925735

  17. Factors Affecting Zebra Mussel Kill by the Bacterium Pseudomonas fluorescens

    Energy Technology Data Exchange (ETDEWEB)

    Daniel P. Molloy

    2004-02-24

    The specific purpose of this research project was to identify factors that affect zebra mussel kill by the bacterium Pseudomonas fluorescens. Test results obtained during this three-year project identified the following key variables as affecting mussel kill: treatment concentration, treatment duration, mussel siphoning activity, dissolved oxygen concentration, water temperature, and naturally suspended particle load. Using this latter information, the project culminated in a series of pipe tests which achieved high mussel kill inside power plants under once-through conditions using service water in artificial pipes.

  18. La calidad de varias bebidas alcohólicas comercializadas en México y las consecuencias potenciales en la salud pública

    OpenAIRE

    Francisco López-Naranjo; Israel Hanani Godínez-García; Reyes Flores-Hernández; Marina Altagracia-Martínez; Rebeca Córdova-Moreno

    2013-01-01

    México es uno de los países de Latino América con un alto consumo de alcohol. Cuarenta y ocho bebidas alcohólicas (BA) comercializadas en México fueron analizadas por métodos establecidos físico-químicos para la determinación de etanol y metanol; la espectroscopia de absorción atómica se utilizó para detectar la presencia en cantidades trazas de Cu, Pb y Cd. Las muestras BA analizadas para la determinación de metanol y para la detección de la presencia de los metales pesados tóxicos (cobre, p...

  19. Avaliação da qualidade de folhas de boldo-do-chile (Peumus boldus Molina comercializadas em Curitiba, PR

    Directory of Open Access Journals (Sweden)

    M.C.S. Barbosa

    2001-01-01

    Full Text Available Foi realizada a avaliação da qualidade de amostras de boldo-do-chile (Peumus boldus Molina comercializadas na Região Metropolitana de Curitiba. Os resultados mostraram que todas as amostras são autênticas, mas os resultados das análises físico-químicas mostraram-se discrepantes em relação aos parametros da Farmacopéia Brasileira e outras bibliografias de referência.Samples of boldo-do-chile (Peumus boldus Molina commercialized at the metropolitan area of Curitiba/PR were evaluated to establish their quality control patterns. The results showed that all samples are authentic but the data obtained for the physico-chemical parameters differ from those related at the Brazilian Pharmacopoeia IV ed.

  20. Avaliação da concentração de flúor em águas minerais comercializadas no Brasil

    OpenAIRE

    Villena Rita S.; Borges Denise G.; Cury Jaime A.

    1996-01-01

    A utilização de flúor sistêmico deve ser controlada em termos de risco/benefício, pois enquanto a subdosagem não trouxer benefício anticárie, a sobredosagem estará associada com fluorose dental. Assim, uma das preocupações é o consumo de águas minerais, o qual tem aumentado nos últimos anos. Deste modo, foi realizado estudo com o objetivo de analisar a concentração de flúor em águas minerais comercializadas no Brasil. Foram analisadas 104 marcas comerciais, de diferentes regiões do País. Util...

  1. Food habits of diving ducks in the Great Lakes after the zebra mussel invasion

    Science.gov (United States)

    Custer, Christine M.; Custer, T.W.

    1996-01-01

    Zebra mussels (Dreissena polymorpha) invaded the Great Lakes in the mid-1980s and quickly reached high densities. The objective of this study was to determine current consumption of zebra mussels by waterfowl in the Great Lakes region. Feeding Lesser Scaups (Aythya affinis), Greater Scaups (A. marila), Canvasbacks (A. valisineria), Redheads (A. americana), Buffleheads (Bucephala albeola) and Common Goldeneyes (B. clangula) were collected in western Lake Erie and in Lake St. Clair between fall and spring, 1992-1993 to determine food habits. All 10 Redheads, 97% of Lesser Scaups, 83% of Goldeneyes, 60% of Buffleheads and 9% of Canvasbacks contained one or more zebra mussels in their upper gastrointestinal tracts. The aggregate percent of zebra mussels in the diet of Lesser Scaups was higher in Lake Erie (98.6%) than in Lake St. Clair (54.4%). Zebra mussels (aggregate percent) dominated the diet of Common Goldeneyes (79.2%) but not in Buffleheads (23.5%), Redheads (21%) or Canvasbacks (9%). Lesser Scaups from Lake Erie fed on larger zebra mussels ( = 10.7 i?? 0.66 mm SE) than did Lesser Scaups from Lake St. Clair ( = 4.4 i?? 0.22 mm). Lesser Scaups, Buffleheads and Common Goldeneyes from Lake Erie consumed zebra mussels of similar size.

  2. Economic impacts of zebra mussels on drinking water treatment and electric power generation facilities.

    Science.gov (United States)

    Connelly, Nancy A; O'Neill, Charles R; Knuth, Barbara A; Brown, Tommy L

    2007-07-01

    Invasions of nonnative species such as zebra mussels can have both ecological and economic consequences. The economic impacts of zebra mussels have not been examined in detail since the mid-1990s. The purpose of this study was to quantify the annual and cumulative economic impact of zebra mussels on surface water-dependent drinking water treatment and electric power generation facilities (where previous research indicated the greatest impacts). The study time frame was from the first full year after discovery in North America (Lake St. Clair, 1989) to the present (2004); the study area was throughout the mussels' North American range. A mail survey resulted in a response rate of 31% for electric power companies and 41% for drinking water treatment plants. Telephone interviews with a sample of nonrespondents assessed nonresponse bias; only one difference was found and adjusted for. Over one-third (37%) of surveyed facilities reported finding zebra mussels in the facility and almost half (45%) have initiated preventive measures to prevent zebra mussels from entering the facility operations. Almost all surveyed facilities (91%) with zebra mussels have used control or mitigation alternatives to remove or control zebra mussels. We estimated that 36% of surveyed facilities experienced an economic impact. Expanding the sample to the population of the study area, we estimated 267 million dollars (BCa 95% CI = 161 million dollars - 467 million dollars) in total economic costs for electric generation and water treatment facilities through late 2004, since 1989. Annual costs were greater (44,000 dollars/facility) during the early years of zebra mussel infestation than in recent years (30,000 dollars). As a result of this and other factors, early predictions of the ultimate costs of the zebra mussel invasion may have been excessive. PMID:17530329

  3. A retrospective study of disease and mortality in zebra finches.

    Science.gov (United States)

    Prattis, S M; Cioffee, C J; Reinhard, G; Zaoutis, T E

    1990-07-01

    Few published reports exist describing morbidity and mortality in domestic zebra finch colonies maintained in a laboratory animal setting. A retrospective study of clinical disease and mortality in quarantined adult zebra finches was performed. Animals were observed during the 2 week quarantine period and for at least 1 month afterwards (42 days). Signs of disease, including feather and beak abnormalities, oculonasal discharge, increased respiratory rate or stridor, abdominal enlargement, pasty vent, diarrhea, lameness and pectoral muscle loss, were evaluated in our colony during this time. History, physical examination, laboratory testing and postmortem evaluation were used to determine causes of clinical disease. Common clinical findings in sick finches included sudden death, ruffled feathers, increased respiratory rate or gape mouthed breathing, pasty vent or frank diarrhea, and beak discoloration. Organisms frequently isolated were Staphylococcus spp., E. coli, Enterobacter spp., and Coccidia spp. Of the finches that died while in the colony (29.5%), 23.0% died in the first week after arrival. Pathogens frequently isolated from tissues cultured at necropsy included: E. coli, Staphylococcus aureus, Enterobacter spp., and Candida albicans. When observed, pathological lesions consisted of air sacculitis, fibrinopurulent polyserositis and ventriculitis. PMID:2166869

  4. Copper Wire Arrays at the 1 MA Zebra Facility

    Science.gov (United States)

    Coverdale, C. A.; Jones, B.; Ampleford, D. J.; Deeney, C.; Lepell, P. D.; Safronova, A. S.; Kantsyrev, V. L.; Ouart, N.; Ivanov, V. V.

    2006-10-01

    Experiments to study the implosion dynamics and radiation characteristics of copper z-pinches have been fielded at the 1 MA Zebra facility. At Zebra, load diameters ranged from 8mm to 16mm, with 6 to 14 wires, and load masses of 80 to 200 μg. All arrays utilized 10 micron diameter wire. The impact of initial load mass and initial load diameter on the precursor and the stagnated plasma has been evaluated through spectroscopy, shadowgraphy, and fluence measurements. Plasma parameters have been extracted from modeling of the time-integrated L-shell spectra to study temperature and density variations as a function of spatial position and initial load configuration. Comparisons will be made with harder x-ray spectra and pinhole images to identify regions of highest temperature and density. Shadowgraphy has been fielded to study the formation of the precursor and the main implosion; significant structure is observed. Substantial radiation is observed from the precursor, with variations in the precursor associated with initial load configuration. *Sandia is a multi-program laboratory operated by Sandia Corporation, a Lockheed Martin Company, for the United States Department of Energy's National Nuclear Security Administration under Contract DE-AC04-94AL85000.

  5. Co-existence of zebra mussels and freshwater unionids: Population dynamics of Leptodea fragilis in a coastal wetland infested with zebra mussels

    Science.gov (United States)

    Nichols, S. Jerrine; Amberg, Jon

    1999-01-01

    In 1996, thousands of live Leptodea fragilis were collected from a marsh located in the western basin of Lake Erie that was infested with zebra mussels (Dreissena polymorpha). Despite the presence of zebra mussels at this site for a number of years, this L. fragilis population showed no signs of competition-induced changes in population dynamics. Biofouling was limited: fewer than 1% of the L. fragilis showed evidence of recent or past zebra mussel colonization. Successful recruitment occurred yearly, with multiple year classes collected that ranged in age from 1 to 12 years. However, age and shell length were not well correlated. Seventy-one percent of the individuals collected were 51-80 mm long, but ranged in age from 2 to 4.5 years. Three different patterns of growth or shell deposition were found. Some individuals grew rapidly, reaching 105 mm in 3.5 years, while others grew only 4.5 mm over the same time period. A few grew poorly during some years but very rapidly in others. Individuals with a shell length of 41 mm or more were sexually mature and females were more common than males. The strong recruitment and steady growth of this population showed no change between the years before and after the zebra mussel invasion, indicating that this marsh is functioning as a natural refugium from potential problems caused by zebra mussels.

  6. 77 FR 49032 - Self-Regulatory Organizations; NYSE Arca, Inc.; Order Granting Approval of Proposed Rule Changes...

    Science.gov (United States)

    2012-08-15

    ... Securities Exchange Act Release No. 67244 (June 22, 2012), 77 FR 38701 (SR-NYSEArca-2012-67) (the ``Notice''). II. Background NYSE Arca Rule 3.2 sets forth a process for the nomination and selection of fair... Rule 3.2 sets forth a similar process for the nomination and selection of fair representation...

  7. 78 FR 21650 - Self-Regulatory Organizations; NYSE Arca, Inc.; Order Granting Approval of Proposed Rule Change...

    Science.gov (United States)

    2013-04-11

    ... (February 20, 2013), 78 FR 13103 (``Notice''). \\4\\ In approving the proposed rule changes, the Commission... Commission, along with other corporate governance documents.\\8\\ \\7\\ See Section 3(a)(27) of the Act, 15 U.S.C... NYSE Arca Holdings Bylaws, along with other corporate documents, are rules of the Exchange \\7\\ and...

  8. 77 FR 38116 - Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Designation of a Longer Period for...

    Science.gov (United States)

    2012-06-26

    ... Exchange Act Release No. 66966 (May 11, 2012), 77 FR 29419. \\4\\ See Letter from Gus Sauter, Managing... Commission Action on Proposed Rule Change Proposing a Pilot Program To Create a Lead Market Maker Issuer Incentive Program for Issuers of Certain Exchange-Traded Products Listed on NYSE Arca, Inc. June 20,...

  9. 77 FR 65752 - Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing and Immediate Effectiveness of...

    Science.gov (United States)

    2012-10-30

    ... permit the firm to have at least one trader on the Floor of the Exchange as a Floor-based open outcry... for firms to acquire additional Market Maker OTPs. The Exchange believes that the proposed OTP pricing... Proposed Rule Change Amending the NYSE Arca Options Fee Schedule To Change the Monthly Cost for...

  10. 78 FR 16731 - Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing and Immediate Effectiveness of...

    Science.gov (United States)

    2013-03-18

    ... execution. \\4\\ See Securities Exchange Act Release No. 65730 (November 10, 2011), 76 FR 71410 (November 17... COMMISSION Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing and Immediate Effectiveness of... Reduce the Floor Broker Rebate for Qualified Contingent Cross Transactions March 8, 2013. Pursuant...

  11. 78 FR 4508 - Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing of Amendment No. 2, and Order...

    Science.gov (United States)

    2013-01-22

    ... composed entirely of ``Independent Directors'' \\19\\ and have a written charter.\\20\\ \\19\\ ``Independent... listed company be required to have a compensation committee composed entirely of Independent Directors... continues to have a majority of independent directors, as NYSE Arca believes this would ensure that...

  12. 77 FR 9278 - Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing and Immediate Effectiveness of...

    Science.gov (United States)

    2012-02-16

    .... 66115 (January 6, 2012), 77 FR 1969 (January 12, 2012) (SR-NYSEArca-2011-101) (notice of filing and... month, the minimum adding ADV requirement for Investor Tier 1 would be 38.25 million adding shares a day... Proposed Rule Change Amending the NYSE Arca Equities Fee Schedule To Increase the Investor Tier 1...

  13. 77 FR 27106 - Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing and Immediate Effectiveness of...

    Science.gov (United States)

    2012-05-08

    ... COMMISSION Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing and Immediate Effectiveness of... Holder of the equipment, installation, and maintenance provided by the Exchange, and (2) the cost to the.... III. Date of Effectiveness of the Proposed Rule Change and Timing for Commission Action The...

  14. 78 FR 11261 - Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing and Immediate Effectiveness of...

    Science.gov (United States)

    2013-02-15

    ... related to the value to the Exchange's market quality associated with higher volumes in Customer order... Proposed Rule Change To Amend the NYSE Arca Options Fee Schedule To Introduce a New Electronic Customer... Options Fee Schedule (the ``Fee Schedule'') to introduce a new electronic Customer rate for...

  15. 75 FR 65041 - Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing and Immediate Effectiveness of...

    Science.gov (United States)

    2010-10-21

    ... Instruct NYSE Arca To Bypass Non-Regulation NMS Protected Market Centers When Routing Away October 15, 2010...-Regulation NMS protected market centers when routing away. The text of the proposed rule change is available... are not posting Protected Quotations within the meaning of Regulation NMS. In March 2008, NYSE...

  16. 78 FR 72955 - Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing of Proposed Rule Change, as...

    Science.gov (United States)

    2013-12-04

    ... capitalization companies,\\10\\ by investing in exchange-traded funds (``ETFs''),\\11\\ and/or swap agreements... Fund Shares (as described in NYSE Arca Equities Rule 8.600). The ETFs all will be listed and traded in the U.S. on registered exchanges. The ETFs in which the Fund may invest will primarily be...

  17. 78 FR 21452 - Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing and Immediate Effectiveness of...

    Science.gov (United States)

    2013-04-10

    ... COMMISSION Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing and Immediate Effectiveness of... and have market maker obligations which require them to pay for equipment and connectivity. Customers... Effectiveness of the Proposed Rule Change and Timing for Commission Action The foregoing rule change...

  18. 77 FR 63362 - Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing and Immediate Effectiveness of...

    Science.gov (United States)

    2012-10-16

    ... platforms may choose from a range of possible, and equally reasonable, pricing strategies as the means of... FR 52769 (Aug. 30, 2012) (SR-NYSEArca-2012-89). Access and Redistribution Fees The Exchange proposes.... 62188 (May 27, 2010), 75 FR 31484 (June 3, 2010) (SR-NYSEArca-2010-23). Because the Arca...

  19. 77 FR 36307 - Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing of Proposed Rule Change Amending...

    Science.gov (United States)

    2012-06-18

    ... Corporate Governance Code that would be added, given that Holdco was formed under and subject to the laws of...-72), 77 FR 3297. NYSE Arca explained the reasons for incorporating the Proposed Amendments in Holdco... corporate governance and regulatory obligations that are addressed by means of ownership and...

  20. 75 FR 20030 - Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing and Immediate Effectiveness of...

    Science.gov (United States)

    2010-04-16

    ... COMMISSION Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing and Immediate Effectiveness of... Schedule is available on the Commission's Website at http://www.sec.gov . A copy of this filing is... comments were solicited or received with respect to the proposed rule change. III. Date of Effectiveness...

  1. 75 FR 63233 - Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing and Immediate Effectiveness of...

    Science.gov (United States)

    2010-10-14

    ... COMMISSION Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing and Immediate Effectiveness of... Effectiveness of the Proposed Rule Change and Timing for Commission Action The foregoing rule change is... for website viewing and printing in the Commission's Public Reference Room, 100 F Street,...

  2. 77 FR 19401 - Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing of Proposed Rule Change Amending...

    Science.gov (United States)

    2012-03-30

    ... Securities/the Exchange associated with the liquidation of the error positions. \\15\\ If Arca Securities... the liquidation of error positions, as well as records associated with the liquidation of error... perfect the mechanism of a free and open market and a national market system and, in general, to...

  3. 75 FR 25892 - Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing and Immediate Effectiveness of...

    Science.gov (United States)

    2010-05-10

    ..., 2009), 74 FR 46272 (September 8, 2009) (Order approving (i) the removal of NYSE Arca Equities Rule 7.26... derivative instruments. The purpose of this filing is to eliminate the requirement that Market Makers must... Proposed Rule Change Amending Market Maker Requirements for Certain Covered Products April 30,...

  4. 75 FR 26304 - Self-Regulatory Organizations; Notice of Filing of Proposed Rule Change by NYSE Arca, Inc...

    Science.gov (United States)

    2010-05-11

    ... governance committee.\\6\\ \\3\\ See Securities Exchange Act Release No. 53382 (February 27, 2006), 71 FR 11251... Audit Committee, Compensation Committee, and Regulatory Oversight Committee May 4, 2010. Pursuant to... eliminate its audit committee (the ``NYSE Arca Audit Committee''), its compensation committee (the......

  5. 77 FR 25218 - Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing of Proposed Rule Change To List...

    Science.gov (United States)

    2012-04-27

    ..., flywheel, or micro turbines; Energy efficiency such as energy efficient building materials, power, lighting... (``Environmental Themes''): Alternative renewable power such as solar, wind, geothermal, hydro, or biomass... Arca Equities Rule 8.600. See, e.g., Securities Exchange Act Release Nos. 57801 (May 8, 2008), 73...

  6. "Bird Song Metronomics": Isochronous Organization of Zebra Finch Song Rhythm.

    Science.gov (United States)

    Norton, Philipp; Scharff, Constance

    2016-01-01

    The human capacity for speech and vocal music depends on vocal imitation. Songbirds, in contrast to non-human primates, share this vocal production learning with humans. The process through which birds and humans learn many of their vocalizations as well as the underlying neural system exhibit a number of striking parallels and have been widely researched. In contrast, rhythm, a key feature of language, and music, has received surprisingly little attention in songbirds. Investigating temporal periodicity in bird song has the potential to inform the relationship between neural mechanisms and behavioral output and can also provide insight into the biology and evolution of musicality. Here we present a method to analyze birdsong for an underlying rhythmic regularity. Using the intervals from one note onset to the next as input, we found for each bird an isochronous sequence of time stamps, a "signal-derived pulse," or pulse(S), of which a subset aligned with all note onsets of the bird's song. Fourier analysis corroborated these results. To determine whether this finding was just a byproduct of the duration of notes and intervals typical for zebra finches but not dependent on the individual duration of elements and the sequence in which they are sung, we compared natural songs to models of artificial songs. Note onsets of natural song deviated from the pulse(S) significantly less than those of artificial songs with randomized note and gap durations. Thus, male zebra finch song has the regularity required for a listener to extract a perceived pulse (pulse(P)), as yet untested. Strikingly, in our study, pulses(S) that best fit note onsets often also coincided with the transitions between sub-note elements within complex notes, corresponding to neuromuscular gestures. Gesture durations often equaled one or more pulse(S) periods. This suggests that gesture duration constitutes the basic element of the temporal hierarchy of zebra finch song rhythm, an interesting parallel

  7. Effects of inbreeding on sperm quality in Zebra Finches Taeniopygia guttata

    Czech Academy of Sciences Publication Activity Database

    Opatová, Pavlína; Ihle, M.; Albrechtová, Jana; Tomášek, Oldřich; Kempenaers, B.; Forstmeier, W.; Albrecht, Tomáš

    Badajoz: European Ornithologist's Union, 2015 - (Martin, G.; Marzal, A.). s. 017 [Conference of the European Ornithologist's Union /10./. 24.08.2015-28.08.2015, Badajoz] Institutional support: RVO:68081766 Keywords : zebra finches * sperm Subject RIV: EG - Zoology

  8. Genomic and neural analysis of the estradiol-synthetic pathway in the zebra finch

    OpenAIRE

    London Sarah E; Clayton David F

    2010-01-01

    Abstract Background Steroids are small molecule hormones derived from cholesterol. Steroids affect many tissues, including the brain. In the zebra finch, estrogenic steroids are particularly interesting because they masculinize the neural circuit that controls singing and their synthesis in the brain is modulated by experience. Here, we analyzed the zebra finch genome assembly to assess the content, conservation, and organization of genes that code for components of the estrogen-synthetic pat...

  9. RASPODJELA I SASTAV POPULACIJE KUNJKE Arca noae U PAŠMANSKOM KANALU

    OpenAIRE

    Peharda, Melita; Stagličić, Nika; Ezgeta, Daria; VRGOČ, Nedo; Isajlović, Igor; Krstulović–Šifner, Svjetlana

    2009-01-01

    Kunjka (Arca noae) jestivi je školjkaš koji se komercijalno sakuplja u istočnom dijelu Jadrana, primarno metodom autonomnog ronjenja. Nema pouzdanih statističkih podataka o sakupljanju ove vrste kao ni podataka o raspodjeli i sastavu populacija iskorištavanih »stokova«, što je nužno za uspostavu održive razine eksploatacije. Cilj je ovog istraživanja bio određivanje raspodjele i sastava populacije vrste A. noae u jednom od područja sakupljanja — Pašmanskom kanalu. Istraživanje je provedeno u ...

  10. Removal of algae by the zebra mussel (Dreissena polymorpha) population in western Lake Erie: a bioenergetics approach

    Science.gov (United States)

    Madenjian, Charles P.

    1995-01-01

    A bioenergetics model for growth of a zebra mussel (Dreissena polymorpha) individual was verified with observations on zebra mussel growth in western Lake Erie. The bioenergetics model was then applied to the zebra mussel population in the western basin of Lake Erie to estimate the removal of phytoplankton by mussels. According to the modeling results, the zebra mussel population consumed 5.0 million tonnes of phytoplankton, while 1.4 million tonnes of phytoplankton was deposited in pseudofeces from the mussels. Thus, a total of 6.4 ± 2.4 million tonnes of phytoplankton was removed from the water column by zebra mussel in western Lake Erie during 1990. Primary production was estimated to be 24.8 million tonnes; therefore, zebra mussel removed the equivalent of 26 ± 10% of the primary production for western Lake Erie.

  11. Floristic analysis of the Mountain Zebra National Park, Eastern Cape

    Directory of Open Access Journals (Sweden)

    U. Pond

    2002-12-01

    Full Text Available As part of a larger project to assess the vegetation dynamics and conservation potential of the enlarged Mountain Zebra National Park, a checklist was produced to determine the plant species richness for this area. Six hundred and eighty species, represented by 333 genera and 87 families were identified. One hundred and eighty species belong to the Monocotyledoneae and 479 species to the Dicotyledoneae. By far the largest families are the Asteraceae with 129 and the Poaceae with 82 species. Thirteen Red Data species were recorded. A number of fynbos elements were encountered, the most noteworthy being two families endemic to the Cape Floristic Region, the Penaeaceae and Grubbiaceae. A very high species to square kilometre ratio of 5.05 supports the area’s rich floristic composition.

  12. Ultrastructural and Histochemical Characterization of the Zebra Mussel Adhesive Apparatus

    Science.gov (United States)

    Farsad, Nikrooz

    Since their accidental introduction into the Great Lakes in mid- to late-1980s, the freshwater zebra mussels, Dreissena polymorpha, have colonized most lakes and waterways across eastern North America. Their rapid spread is partly attributed to their ability to tenaciously attach to hard substrates via an adhesive apparatus called the byssus, resulting in serious environmental and economic impacts. A detailed ultrastructural study of the byssus revealed a 10 nm adhesive layer at the attachment interface. Distributions of the main adhesive amino acid, 3,4-dihydroxyphenylalanine (DOPA), and its oxidizing (cross-linking) enzyme, catechol oxidase, were determined histochemically. It was found that, upon aging, DOPA levels remained high in the portion of the byssus closest to the interface, consistent with an adhesive role. In contrast, reduced levels of DOPA corresponded well with high levels of catechol oxidase in the load-bearing component of the byssus, presumably forming cross-links and increasing the cohesive strength.

  13. Improving production of Zebra Fish Embryos in the lab

    DEFF Research Database (Denmark)

    Thomsen, Jens Peter; Adu, Robert Ohene

    2011-01-01

    The utilization of fish embryos in toxicity testing of hazardous chemicals has recently been adopted in order to satisfy stricter rules and regulations related to using adult animals in toxicity testing. This paper presents optimising steps towards improving zebra fish embryo production in the...... within an hour of onset of light, an improvement over the 50-60 eggs produced in the previous work. This result demonstrates that with the right culture conditions and proper optimisation of procedure the required number of embryos needed for toxicity testing can be obtained....... laboratory. Culture conditions were maintained in the aquaria as stipulated in the OECD draft proposal for a new guideline on fish embryo tests. Furthermore, a sequence of steps were adopted and followed to improve upon previous work done in the lab in 2006. About 200 eggs were produced in one spawn trap...

  14. Effect of acute stresses on zebra fish (Danio rerio) metabolome measured by NMR-based metabolomics.

    Science.gov (United States)

    Mushtaq, Mian Yahya; Marçal, Rosilene Moretti; Champagne, Danielle L; van der Kooy, Frank; Verpoorte, Robert; Choi, Young Hae

    2014-09-01

    We applied an acute stress model to zebra fish in order to measure the changes in the metabolome due to biological stress. This was done by submitting the fish to fifteen minutes of acute confinement (netting) stress, and then five minutes for the open field and light/dark field tests. A polar extract of the zebra fish was then subjected to (1)H nuclear magnetic spectroscopy. Multivariate data analysis of the spectra showed a clear separation associated to a wide range of metabolites between zebra fish that were submitted to open field and light/dark field tests. Alanine, taurine, adenosine, creatine, lactate, and histidine were high in zebra fish to which the light/dark field test was applied, regardless of stress, while acetate and isoleucine/lipids appeared to be higher in zebra fish exposed to the open field test. These results show that any change in the environment, even for a small period of time, has a noticeable physiological impact. This research provides an insight of how different mechanisms are activated under different environments to maintain the homeostasis of the body. It should also contribute to establish zebra fish as a model for metabolomics studies. PMID:25098933

  15. Efficacy of Pseudomonas fluorescens (Pf-CL145A) spray dried powder for controlling zebra mussels adhering to test substrates

    Science.gov (United States)

    Luoma, James A.; Severson, Todd J.; Weber, Kerry L.; Mayer, Denise A.

    2015-01-01

    A mobile bioassay trailer was used to assess the efficacy of Pseudomonas fluorescens (Pf-CL145A) spray dried powder (SDP) formulation for controlling zebra mussels (Dreissena polymorpha) from two midwestern lakes: Lake Carlos (Alexandria, Minnesota) and Shawano Lake (Shawano, Wisconsin). The effects of SDP exposure concentration and exposure duration on zebra mussel survival were evaluated along with the evaluation of a benthic injection application technique to reduce the amount of SDP required to induce zebra mortality.

  16. High variation and very low differentiation in wide ranging plains zebra (Equus quagga): insights from mtDNA and microsatellites

    DEFF Research Database (Denmark)

    Lorenzen, Eline D; Arctander, Peter; Siegismund, Hans R

    2008-01-01

    Patterns of genetic differentiation in the plains zebra (Equus quagga) were analysed using mitochondrial DNA control region variation and seven microsatellites. The six morphologically defined subspecies of plains zebra lacked the population genetic structure indicative of distinct evolutionary u...

  17. How well can fishes prey on zebra mussels in eastern North America?

    Science.gov (United States)

    French, John R. P., III

    1993-01-01

    Literature on mollusk-eating fishes was reviewed to determine the potential for different species of fish to control zebra mussels in eastern North America. At least six species are potential predators of zebra mussels because they possess (1) both upper and lower pharyngeal teeth or (2) lower pharyngeal teeth and chewing pads located on the dorsal roof for crushing mollusk shells. Freshwater drum (Aplodinotus grunniens) and two centrarchids, redear sunfish (Lepomis microlophus) and pumpkinseed (L. gibbosus), possess both upper and lower pharyngeal teeth and are likely to consume more zebra mussels than fishes with only lower pharyngeal teeth. Only two catostomid species, copper and river redhorses (Moxostoma hubbsi and M. carinatum), have chewing pads that enable them to crush mollusks. The exotic omnivorous common carp (Cyprinus carpio), possessing lower teeth and a chewing pad, may prey on zebra mussels when aquatic insect larvae, its preferred food, become rare. Managing populations of drum, sunfishes and redhorses to reduce exploitation of large individuals and improve their habitats are suggested as means to intensify biological control of zebra mussels in eastern North America. Other Eurasian molluscivores, the roach (Rutilus rutilus) and the black carp (Mylopharyngodon piceus) should not be introduced into North America because research has shown repeatedly that an introduced biological controller usually does not forage for unwanted pests or reside only in preferred habitats of pests. Drum, sunfishes and redhorses should be preferred over these exotics as biological controllers of zebra mussels in North America because these native fishes will likely occupy newly established habitats of zebra mussels.

  18. The use of chlorine dioxide for zebra mussel control - A perspective of treatment histories

    Energy Technology Data Exchange (ETDEWEB)

    Smolik, N.; Rusznak, L.; Anderson, J.; Hale, L. [Ashland Chemical Coman, Drew Division, Booton, NJ (United States)

    1995-06-01

    It is of utmost importance to provide updated performance results of various chemical treatments presently being utilized for zebra mussel control. Zebra mussels have a distinctive ability to endure environmental changes by reproducing effectively and attaching to various hard surfaces. These traits are cause for concern and have resulted in some operating difficulties for industries bordering infested waterways. Various methods are being employed by industries to deal with the problems associated with these species. One of the options is control via chemical treatment. Prior field test studies showed that chlorine dioxide was determined to be an effective molluscicidal agent for adult zebra mussel eradication. Continuous feed of chlorine dioxide at treatment levels ranging from 0.25 - 5.0 ppm above the oxidant demand provided 100% adult zebra mussel mortality which required between 2.9 - 8.8 days of treatment. Previous studies also showed that water temperature was an essential parameter in determining the time required to achieve 100% mortality of adult zebra mussels. Further field applications were undertaken at three electric utility sites located in the midwest. These facilities were concerned with the potential for zebra mussels to reduce efficiency and availability by blocking water flow or plugging equipment. Treatment applications at these facilities consisted of a continuous feed of chlorine dioxide ranging from 0.15 - 0.5 ppm above the oxidant demand. Significant mortality was achieved in monitored mussels tested at each utility in a period ranging from two to four days. This time period was directly related to a number of parameters, with the predominant one being water temperature. Data from these field applications is presented in this paper and confirms that chlorine dioxide is an effective molluscicide for adult zebra mussel control.

  19. Neuroendocrine regulation of long-term pair maintenance in the monogamous zebra finch.

    Science.gov (United States)

    Prior, Nora H; Soma, Kiran K

    2015-11-01

    This article is part of a Special Issue "SBN 2014". Understanding affiliative behavior is critical to understanding social organisms. While affiliative behaviors are present across a wide range of taxa and contexts, much of what is known about the neuroendocrine regulation of affiliation comes from studies of pair-bond formation in prairie voles. This leaves at least three gaps in our current knowledge. First, little is known about long-term pair-bond maintenance. Second, few studies have examined non-mammalian systems, even though monogamy is much more common in birds than in mammals. Third, the influence of breeding condition on affiliation is largely unknown. The zebra finch (Taeniopygia guttata) is an excellent model system for examining the neuroendocrine regulation of affiliative behaviors, including the formation and maintenance of a long-term pair bond. Zebra finches form genetically monogamous pair bonds, which they actively maintain throughout the year. The genomic and neuroanatomical resources, combined with the wealth of knowledge on the ecology and ethology of wild zebra finches, give this model system unique advantages to study the neuroendocrine regulation of pair bonding. Here, we review the endocrinology of opportunistic breeding in zebra finches, the sex steroid profiles of breeding and non-breeding zebra finches (domesticated and wild), and the roles of sex steroids and other signaling molecules in pair-maintenance behaviors in the zebra finch and other monogamous species. Studies of zebra finches and other songbirds will be useful for broadly understanding the neuroendocrine regulation of affiliative behaviors, including pair bonding and monogamy. PMID:25935729

  20. Estudo da contaminação por enteroparasitas em hortaliças comercializadas nos supermercados da cidade do Rio de Janeiro

    Directory of Open Access Journals (Sweden)

    Joaquim Pereira da Silva

    1995-09-01

    Full Text Available Através de métodos parasitológicos usuais avaliou-se a contaminação por cistos e ovos de enteroparasitas de 220 amostras de hortaliças que são consumidas cruas e comercializadas nas zonas norte (de menor poder aquisitivo e sul (de maior poder aquisitivo da Cidade do Rio de Janeiro. Apesar de não ter havido aparente diferença na procedência das hortaliças avaliadas, constatou-se maior grau de contaminação nas amostras procedentes da zotza norte e nas amostras de alface (Lactuca sativa. Discutiu-se a possibilidade de a diferença observada estar relacionada ao acondicionamento das hortaliças ou ser devido à manipulação das mesmas por vendedores e consumidores.Parasitological examinations were performed in material derived from 220 vegetables to detect cysts and eggs of intestinal parasites. This material was collected from supermarkets in northern and southern areas and from CEASA (Central Supply Market - 40 vegetables in Rio de Janeiro city. Vegetables proceeding from the northern areas presented a greater degree of contamination mostly of helminth eggs; lettuce was the most contaminated vegetable. The authors suggest that differences found between the northern and southern areas of the city may be due to either packing or manipulation by shop assistants and consumers.

  1. Qualidade microbiológica de salada de frutas comercializadas por ambulantes na cidade de Juazeiro do Norte – Ceará

    Directory of Open Access Journals (Sweden)

    Jôcy Emanuela Ferreira dos Santos

    2015-04-01

    Full Text Available O presente trabalho avaliou a qualidade microbiológica de salada de frutas comercializadas por ambulantes na cidade de Juazeiro do Norte - Ceará. Foram coletadas seis amostras de salada de frutas, sendo duas em cada ponto de coleta. As amostras foram coletadas pela manhã no centro da cidade, as amostras foram mantidas em recipientes isotérmicos e levadas para o Laboratório de Microbiologia de Alimentos da FATEC – Cariri. Realizaram-se análises de coliformes a 45°C e Salmonella spp, segundo as Normas da APHA 2001. Os resultados foram interpretados de acordo com a RDC N°12, de janeiro de 2001 da ANVISA. Para coliformes a 45°C foram encontrados resultados iguais a 2,4x102 NMP/g; 1,5x102 NMP/g; 4,6x102 NMP/g; ≥2,4x102 NMP/g; 4,6x102 NMP/g e ≥2,4x102, para as amostras A1, A2, B1, B2, C1 e C2 respectivamente. Estes resultados revelam que 33,33% das amostras, encontra-se em desacordo com o padrão federal vigente que permite 5x102 NMP/g. Para Salmonella spp., os resultados encontrados foram de ausência em todas as amostras.

  2. Effects of the exotic zebra mussel (Dreissena polymorpha) on metal cycling in Lake Erie

    International Nuclear Information System (INIS)

    This research demonstrated the impact of high densities of the zebra mussel (Dreissena polymorpha) on the cycling of copper, nickel, and zinc in a lake environment. Experiments with mussels on sedimentation traps in western Lake Erie and with mussels in flow-through tanks receiving Lake Erie water showed that zebra mussels remove metals from the water column, incorporate metals in their tissues, and deposit metals on the lake bottom. Removal of metals from the water column was estimated at 10-17%·day-1 of the amounts present. This material was largely deposited on the lake bottom; zebra mussels more than doubled the rate at which metals were being added to the lake bottom. Metal biodeposition rates were extremely high (e.g., 50 mg Zn·m-2·day-1) in high-turbidity areas with elevated metal levels. Two factors contributed to metal biodeposition by zebra mussels. First, their production of feces and pseudofeces increased the rate at which suspended matter was being added to the sediment (accounting for 92% of the increased metal biodeposition). Second, the material coming out of suspension had higher metal concentrations when zebra mussels were present (constituting 8% of the increased biodeposition). (author)

  3. Bioaccumulation of human waterborne protozoa by zebra mussel (Dreissena polymorpha): interest for water biomonitoring.

    Science.gov (United States)

    Palos Ladeiro, M; Aubert, D; Villena, I; Geffard, A; Bigot, A

    2014-01-01

    Cryptosporidium parvum, Giardia duodenalis and Toxoplasma gondii are ubiquitous pathogens, which waterborne transmission has been largely demonstrated. Since they can be found in various watercourses, interactions with aquatic organisms are possible. Protozoan detection for watercourses biomonitoring is currently based on large water filtration. The zebra mussel, Dreissena polymorpha, is a choice biological model in ecotoxicological studies which are already in use to detect chemical contaminations in watercourses. In the present study, the zebra mussel was tested as a new tool for detecting water contamination by protozoa. In vivo exposures were conducted in laboratory experiments. Zebra mussel was exposed to various protozoan concentrations for one week. Detection of protozoa was realized by Taqman real time qPCR. Our experiments evidenced C. parvum, G. duodenalis and T. gondii oocyst bioaccumulation by mussels proportionally to ambient contamination, and significant T. gondii prevalence was observed in muscle tissue. To our knowledge, this is the first study that demonstrates T. gondii oocyst accumulation by zebra mussel. The results from this study highlight the capacity of zebra mussels to reveal ambient biological contamination, and thus to be used as a new effective tool in sanitary biomonitoring of water bodies. PMID:24112626

  4. LETHALITY OF PSEUDOMONAS FLUORESCENS STRAIN CLO145A TO THE 2 ZEBRA MUSSEL SPECIES PRESENT IN NORTH AMERICA

    Energy Technology Data Exchange (ETDEWEB)

    Daniel P. Molloy

    2001-10-28

    These experiments indicated that bacterial strain CL0145A of Pseudomonas fluorescens is equally lethal to the 2 zebra mussel species present in North America, Dreissena polymorpha and Dreissena bugensis. Thus, this bacterial strain should be equally effective at killing zebra mussels in power plant pipes, irrespective of which species is present.

  5. Modeling the Role of Zebra Mussels in the Proliferation of Blue-green Algae in Saginaw Bay, Lake Huron

    Science.gov (United States)

    Under model assumptions from Saginaw Bay 1991, selective rejection of blue-green algae by zebra mussels appears to be a necessary factor in the enhancement of blue-green algae production in the presence of zebra mussels. Enhancement also appears to depend on the increased sedime...

  6. LETHALITY OF PSEUDOMONAS FLUORESCENS STRAIN CLO145A TO THE 2 ZEBRA MUSSEL SPECIES PRESENT IN NORTH AMERICA

    International Nuclear Information System (INIS)

    These experiments indicated that bacterial strain CL0145A of Pseudomonas fluorescens is equally lethal to the 2 zebra mussel species present in North America, Dreissena polymorpha and Dreissena bugensis. Thus, this bacterial strain should be equally effective at killing zebra mussels in power plant pipes, irrespective of which species is present

  7. Caracterização socio-econômico-cultural de raizeiros e procedimentos pós-colheita de plantas medicinais comercializadas em Maceió, AL Cultural, economic and social characterization of herb sellers and post-harvest procedures of medicinal plants commercialized in Maceió, Alagoas State, Brazil

    OpenAIRE

    De Araújo, A. C.; J P Silva; J.L.X.L. Cunha; J.L.O. Araújo

    2009-01-01

    Objetivou-se, com este trabalho, estabelecer o perfil sócio-econômico-cultural de raizeiros, bem como executar um levantamento dos procedimentos pós-colheita para as plantas medicinais comercializadas em feiras e mercados ao ar livre na cidade de Maceió, AL. Foram abordados aspectos sociais, econômicos e culturais de 46 raizeiros, bem como os procedimentos pós-colheita adotados para a conservação das plantas medicinais comercializadas no município. Os raizeiros entrevistados eram, na maioria,...

  8. Rotationally driven 'zebra stripes' in Earth's inner radiation belt.

    Science.gov (United States)

    Ukhorskiy, A Y; Sitnov, M I; Mitchell, D G; Takahashi, K; Lanzerotti, L J; Mauk, B H

    2014-03-20

    Structured features on top of nominally smooth distributions of radiation-belt particles at Earth have been previously associated with particle acceleration and transport mechanisms powered exclusively by enhanced solar-wind activity. Although planetary rotation is considered to be important for particle acceleration at Jupiter and Saturn, the electric field produced in the inner magnetosphere by Earth's rotation can change the velocity of trapped particles by only about 1-2 kilometres per second, so rotation has been thought inconsequential for radiation-belt electrons with velocities of about 100,000 kilometres per second. Here we report that the distributions of energetic electrons across the entire spatial extent of Earth's inner radiation belt are organized in regular, highly structured and unexpected 'zebra stripes', even when the solar-wind activity is low. Modelling reveals that the patterns are produced by Earth's rotation. Radiation-belt electrons are trapped in Earth's dipole-like magnetic field, where they undergo slow longitudinal drift motion around the planet because of the gradient and curvature of the magnetic field. Earth's rotation induces global diurnal variations of magnetic and electric fields that resonantly interact with electrons whose drift period is close to 24 hours, modifying electron fluxes over a broad energy range into regular patterns composed of multiple stripes extending over the entire span of the inner radiation belt. PMID:24646996

  9. Prevention and control of zebra mussels: proactive and reactive strategies

    International Nuclear Information System (INIS)

    Most plant people would agree that having zebra mussels in any raw water system is not desirable. System blockage, loss of heat transfer and other associated safety hazards are not pleasant to deal with. Therefore most industries strive to minimise the effect of infestation. Opinions differ as to how to do this most efficiently and economically. Some facilities are committed to preventing the settlement of veligers in their piping systems and on some of the external structures they consider critical. This is the proactive approach. Others allow settlement and only treat the system or surface after fouling has occurred. This is the reactive approach. Which is the best and most economical treatment will depend on the individual facility and sometimes on the individual system. The paper examines the different proactive and reactive strategies available to-date and how they are being used. It will also discuss some of the criteria for choosing a proactive vs. reactive approach and why the decision has to be made individually by each facility. (author)

  10. Drinking songs: alcohol effects on learned song of zebra finches.

    Directory of Open Access Journals (Sweden)

    Christopher R Olson

    Full Text Available Speech impairment is one of the most intriguing and least understood effects of alcohol on cognitive function, largely due to the lack of data on alcohol effects on vocalizations in the context of an appropriate experimental model organism. Zebra finches, a representative songbird and a premier model for understanding the neurobiology of vocal production and learning, learn song in a manner analogous to how humans learn speech. Here we show that when allowed access, finches readily drink alcohol, increase their blood ethanol concentrations (BEC significantly, and sing a song with altered acoustic structure. The most pronounced effects were decreased amplitude and increased entropy, the latter likely reflecting a disruption in the birds' ability to maintain the spectral structure of song under alcohol. Furthermore, specific syllables, which have distinct acoustic structures, were differentially influenced by alcohol, likely reflecting a diversity in the neural mechanisms required for their production. Remarkably, these effects on vocalizations occurred without overt effects on general behavioral measures, and importantly, they occurred within a range of BEC that can be considered risky for humans. Our results suggest that the variable effects of alcohol on finch song reflect differential alcohol sensitivity of the brain circuitry elements that control different aspects of song production. They also point to finches as an informative model for understanding how alcohol affects the neuronal circuits that control the production of learned motor behaviors.

  11. Zebra mussels mitigation at Ontario Hydro's hydroelectric generating facilities

    International Nuclear Information System (INIS)

    The Great Lakes and their connecting channels have recently been invaded by a tiny freshwater mollusc that has already cost Ontario Hydro millions of dollars. Dreissena polymorpha, commonly known as the zebra mussel, entered the great lakes in ballast water carried by a ship from Europe in 1985. These mussels threaten to reduce or totally block the flow of water in auxiliary systems of any generating station, water treatment plant or municipal water facility that uses raw lake water and to cause accelerated corrosion of the metallic substrate to which they attach themselves. To satisfy the immediate need for control, chlorination was identified as the most effective interim measure to prevent the biofouling of the raw water systems. Detection and monitoring of mussels and the installation, operation, environmental constraints, benefits and deficiencies of the chemical treatment system are presented. Long term objectives for control of the mussels are to develop alternatives to chlorination (ozone, hydrogen peroxide, protective coatings, thermal shock, mechanical filtration, etc.) for application at existing facilities and for incorporation into the design of new facilities and rehabilitation programs. 3 refs., 5 figs

  12. Food preference and copying behaviour in zebra finches, Taeniopygia guttata.

    Science.gov (United States)

    Guillette, Lauren M; Morgan, Kate V; Hall, Zachary J; Bailey, Ida E; Healy, Susan D

    2014-11-01

    As a social species zebra finches might be expected to copy the food choices of more experienced conspecifics. This prediction has been tested previously by presenting observers with two demonstrator birds that differ in some way (e.g., sex, familiarity), each feeding on a different colour food source. However, if the observer subsequently exhibits a preference, it is unclear whether it has copied the choice of one demonstrator or avoided the choice of the other. Furthermore, this choice may actually be influenced by pre-existing preferences, a potential bias that is rarely tested. Here we examine whether apparent copying or avoidance can be explained by pre-existing preferences. In Experiment 1, observers had the opportunity to watch a conspecific forage from one of the two differently coloured food hoppers. In Experiment 2, the observers did not have this opportunity. In both experiments observers were subsequently tested for their food hopper preference and all but one preferred one colour over the other. In Experiment 1 some observers showed evidence for copying, while others seemed to avoid the colour preferred by the demonstrator. In Experiment 2 females generally preferred the white hopper. Pre-existing colour preferences could, therefore, explain the apparent copying/avoidance we observed. This article is part of a Special Issue entitled: Cognition in the wild. PMID:24797456

  13. Association of Bactericera cockerelli (Homoptera: Psyllidae) with "zebra chip," a new potato disease in southwestern United States and Mexico.

    Science.gov (United States)

    Munyaneza, J E; Crosslin, J M; Upton, J E

    2007-06-01

    A new defect of potato, Solanum tuberosum L., "zebra chip," so named for the characteristic symptoms that develop in fried chips from infected potato tubers, has recently been documented in several southwestern states of the United States, in Mexico, and in Central America. This defect is causing millions of dollars in losses to both potato producers and processors. Zebra chip plant symptoms resemble those caused by potato purple top and psyllid yellows diseases. Experiments were conducted to elucidate the association between the psyllid Bactericera cockerelli (Sulc) (Homoptera: Psyllidae) and zebra chip by exposing clean potato plants to this insect under greenhouse and field conditions. Potato plants and tubers exhibiting zebra chip symptoms were tested for phytoplasmas by polymerase chain reaction. Potato psyllids collected from infected potato fields also were tested. Results indicated that there was an association between the potato psyllid and zebra chip. Plants exposed to psyllids in the greenhouse and field developed zebra chip. In the greenhouse, 25.8 and 59.2% of tubers exhibited zebra chip symptoms in the raw tubers and fried chips, respectively. In the field, 15 and 57% of tubers showed symptoms in raw tubers and chips, respectively. No zebra chip was observed in tubers from plants that had not been exposed to psyllids, either in the greenhouse or field. No phytoplasmas were detected from potato plants or tubers with zebra chip symptoms, suggesting that these pathogens are not involved in zebra chip. Of the 47 samples of potato psyllids tested, only two tested positive for the Columbia Basin potato purple top phytoplasma. PMID:17598522

  14. STUDY REGARDING THE LIGHT INFLUENCES ON EMBRYO DEVELOPMENT IN ZEBRA FISH (Danio rerio

    Directory of Open Access Journals (Sweden)

    MIHAELA BĂDILIŢĂ

    2013-12-01

    Full Text Available The aim of this paper is to emphasize the main aspects of the ways in which lightinfluences the development of zebra fish (Danio rerio embryos.During the experiments 3 variants with natural light, continuous light and totally darkwere used to monitor the development of zebra fish embryos in 40 ml Nunk culturedishes at optimum density (1 embryo/ 3 ml and at 28,5oC temperature.It could be noticed that most embryos died in continuous light medium (57%. Thismeans that such mediums are not suitable to embryos’ development. For the controlvariant (natural light it was recorded the lowest mortality rate of only 17% and intotally dark variant the mortality was of 40%.Researches on the influence of light on zebra fish embryo development showed that themost suited medium for supporting, growing and developing the Danio rerio embryosit the medium having natural light.

  15. Lessons learned in over 100 zebra mussel control applications at industrial facilities

    Energy Technology Data Exchange (ETDEWEB)

    McGough, C.M.; Gilland, P.H.; Muia, R.A. [Calgon Corp., Pittsburgh, PA (United States)

    1998-12-31

    Since their introduction into US waterways, Zebra Mussels (Dreissena polymorphae) have spread rapidly throughout the Great Lakes and Mississippi regions. These mussels have continued to colonize the intake pipes of industrial water supplies and water distribution systems throughout the affected areas. Their colonization has compromised plant safety and production efficiency, and steadily increased costs to water users. The design of each industrial plant water distribution system is unique. A comprehensive zebra mussel control strategy using the best available options must be considered in each specific situation. This paper discusses the successful use of one strategy (a quaternary ammonia-based molluscicide) in the battle against zebra mussels. The commercial life cycle of an industrial molluscicide began with initial toxicity screening in the laboratory. The evaluation continued at plant sites through field trials and applications. Lessons learned from these experiences helped direct the efforts toward the development of a second generation program.

  16. Scope of problem assessed at IVO. The zebra mussel`s campaign of world conquest

    Energy Technology Data Exchange (ETDEWEB)

    Silvonen, J.; Oesch, P. [ed.

    1998-07-01

    The migrating shell - or `zebra mussel` as it is called on account of its black and white stripes - was originally a fresh-water mussel, but has since also adapted to brackish waters. As a result of human activity the species has spread quickly and widely from its native habitat. Operators of power plants and water treatment plants in particular have not been very happy about this. During its larval stage the zebra mussel can enter the cooling water systems; fasten itself to the pipes and - in the worst case - clog the system. The Environmental Protection Division of IVO has been assessing the spread of the zebra mussel and the resulting problems with the aid of reference literature and the assistance of Finnish researchers

  17. The perception of regularity in an isochronous stimulus in zebra finches (Taeniopygia guttata) and humans.

    Science.gov (United States)

    van der Aa, Jeroen; Honing, Henkjan; ten Cate, Carel

    2015-06-01

    Perceiving temporal regularity in an auditory stimulus is considered one of the basic features of musicality. Here we examine whether zebra finches can detect regularity in an isochronous stimulus. Using a go/no go paradigm we show that zebra finches are able to distinguish between an isochronous and an irregular stimulus. However, when the tempo of the isochronous stimulus is changed, it is no longer treated as similar to the training stimulus. Training with three isochronous and three irregular stimuli did not result in improvement of the generalization. In contrast, humans, exposed to the same stimuli, readily generalized across tempo changes. Our results suggest that zebra finches distinguish the different stimuli by learning specific local temporal features of each individual stimulus rather than attending to the global structure of the stimuli, i.e., to the temporal regularity. PMID:25725348

  18. Home range sizes for burchell's zebra equus burchelli antiquorum from the Kruger National Park

    Directory of Open Access Journals (Sweden)

    G.L. Smuts

    1975-07-01

    Full Text Available Annual home range sizes were determined for 49 marked zebra family groups in the Kruger National Park. Sizes varied from 49 to 566 sq. km, the mean for the Park being 164 square kilometre. Mean home range sizes for different zebra sub-populations and biotic areas were found to differ considerably. Present herbivore densities have not influenced intra- and inter-specific tolerance levels to the extent that home range sizes have increased. Local habitat conditions, and particularly seasonal vegetational changes, were found to have the most profound influence on the shape and mean size of home ranges. The large home range sizes obtained in the Kruger Park, when compared to an area such as the Ngorongoro Crater, can be ascribed to a lower carrying capacity with respect to zebra, large portions of the habitat being sub-optimal, either seasonally or annually.

  19. Predicted sensitivity of the KM3NeT/ARCA detector to a diffuse flux of cosmic neutrinos

    Directory of Open Access Journals (Sweden)

    Coniglione R.

    2016-01-01

    Full Text Available The KM3NeT Collaboration has started the construction of a research infrastructure hosting a network of underwater neutrino detectors in the Mediterranean Sea. Two instruments based on the same technology are being built: KM3NeT/ORCA to measure the neutrino mass hierarchy and to study atmospheric neutrino oscillations and KM3NeT/ARCA to detect high-energy cosmic neutrinos both in diffuse and point source mode. The excellent angular resolution of the ARCA detector, with an instrumented volume of about one Gton, will allow for an unprecedented exploration of the neutrino sky searching for neutrinos coming from defined sources of sky regions, like the Galactic Plane and the Fermi Bubbles. It will also look for diffuse high energy neutrino fluxes following the indication provided by the IceCube signal. This contribution will report on the sensitivity of the KM3NeT/ARCA telescope with particular attention to the region of the Galactic Plane. Comparisons with theoretical expectations are also discussed.

  20. Freqüência de enteroparasitas em amostras de alface (Lactuca sativa) comercializadas em Lavras, Minas Gerais Frequency of intestinal parasites in samples of lettuce (Lactuca sativa) commercialized in Lavras, Minas Gerais State

    OpenAIRE

    Antônio Marcos Guimarães; Endrigo Gabellini Leonel Alves; Henrique César Pereira Figueiredo; Geraldo Márcio da Costa; Luciano dos Santos Rodrigues

    2003-01-01

    O objetivo deste trabalho foi realizar uma avaliação parasitológica em amostras de alface (Lactuca sativa) comercializadas em Lavras, MG. As amostras de alfaces apresentaram baixos padrões higiênicos, indicados pela presença de formas parasitológicas de origem animal ou humana e alta concentração de coliformes fecais.The aim of this study was to evaluate the parasitological contamination in samples of lettuce (Lactuca sativa) commercialized in Lavras city, Minas Gerais. The samples of lettuce...

  1. Ocorrência e diferenciação de espécies de Listeria spp. em salsichas tipo hot dog a granel e em amostras de carne moída bovina comercializadas no Distrito Federal

    OpenAIRE

    Rafael Rocha de Andrade; Patrícia Helena Caldeira da Silva; Nara Rúbia Souza; Luci Sayori Murata; Vitor Salvador Picão Gonçalves; Angela Patrícia Santana

    2014-01-01

    Listeria monocytogenes é um patógeno relevante veiculado por alimentos. Sua identificação precisa é importante para a correta determinação do risco associado à ingestão do alimento. O objetivo deste trabalho foi verificar a ocorrência das espécies de Listeria spp. em amostras de salsichas tipo hot dog e carne moída bovina, comercializadas a granel no Distrito Federal. Foram analisadas 162 amostras, sendo 127 de salsichas tipo hot dog e 35 amostras de carne moída bovina. O isolamento e a ident...

  2. DETERMINAÇÃO DE CU, NI E ZN POR ICP-MS EM INFUSÕES DA ERVA-MATE COMERCIALIZADAS NAS REGIÕES DO SUL DO BRASIL

    OpenAIRE

    Saidelles, Ana Paula Fleig; Rosane Maria KIRCHNER; Érico Marlon de Moraes FLORES; Nara Rejane Zamberlan dos SANTOS; Joana Kirchner BENEDETTI; Litiele Cezar da CRUZ

    2013-01-01

    Muito tempo antes de ser conhecida a composição da Ilex paraguariensis (erva-mate), os indígenas utilizavam a mesma não somente pelo seu paladar, mas principalmente por conhecerem seus benefícios. Neste trabalho foi feita a determinação e avaliação dos valores de concentração de metais na primeira e segunda infusão em erva-mate comercializadas e industrializadas nos estados da região sul do Brasil. Para as infusões das amostras foi utilizada água destilada deionizada a...

  3. Formation of zebra pattern in low-frequency Jovian radio emission

    CERN Document Server

    Kuznetsov, A A

    2012-01-01

    We investigate the formation of zebra-like fine spectral structures (consisting of several parallel bands in the dynamic spectrum) in the Jovian broadband kilometric radiation; such radio bursts were observed by Cassini in 2000/2001. We assume that the emission is generated due to a plasma mechanism in the Io plasma torus. We have shown that the double plasma resonance effect (that was proposed earlier as a formation mechanism of the solar zebra patterns) is able to produce the observed spectral structures. The observed frequency drifts are caused, most likely, by the dynamics of the electron acceleration site. The required conditions in the emission source are discussed.

  4. Proper care, husbandry, and breeding guidelines for the zebra finch, Taeniopygia guttata.

    Science.gov (United States)

    Olson, Christopher R; Wirthlin, Morgan; Lovell, Peter V; Mello, Claudio V

    2014-12-01

    The zebra finch Taeniopygia guttata castanotis is a songbird commonly used in the laboratory, particularly for studies of vocal learning, neurobiology, and physiology. Within the laboratory, it is important to adopt careful husbandry practices that allow for normal development of the birds. For example, their song is a learned trait, passed culturally from adult males to juveniles, and thus its learning can be influenced by the health and social conditions of the birds present in the laboratory. Here we present guidelines for the successful maintenance and breeding of captive zebra finches. PMID:25342067

  5. Developmental stress increases reproductive success in male zebra finches.

    Science.gov (United States)

    Crino, Ondi L; Prather, Colin T; Driscoll, Stephanie C; Good, Jeffrey M; Breuner, Creagh W

    2014-11-22

    There is increasing evidence that exposure to stress during development can have sustained effects on animal phenotype and performance across life-history stages. For example, developmental stress has been shown to decrease the quality of sexually selected traits (e.g. bird song), and therefore is thought to decrease reproductive success. However, animals exposed to developmental stress may compensate for poor quality sexually selected traits by pursuing alternative reproductive tactics. Here, we examine the effects of developmental stress on adult male reproductive investment and success in the zebra finch (Taeniopygia guttata). We tested the hypothesis that males exposed to developmental stress sire fewer offspring through extra-pair copulations (EPCs), but invest more in parental care. To test this hypothesis, we fed nestlings corticosterone (CORT; the dominant avian stress hormone) during the nestling period and measured their adult reproductive success using common garden breeding experiments. We found that nestlings reared by CORT-fed fathers received more parental care compared with nestlings reared by control fathers. Consequently, males fed CORT during development reared nestlings in better condition compared with control males. Contrary to the prediction that developmental stress decreases male reproductive success, we found that CORT-fed males also sired more offspring and were less likely to rear non-genetic offspring compared with control males, and thus had greater overall reproductive success. These data are the first to demonstrate that developmental stress can have a positive effect on fitness via changes in reproductive success and provide support for an adaptive role of developmental stress in shaping animal phenotype. PMID:25297860

  6. The ZEBRA electric vehicle battery: power and energy improvements

    Science.gov (United States)

    Galloway, Roy C.; Haslam, Steven

    Vehicle trials with the first sodium/nickel chloride ZEBRA batteries indicated that the pulse power capability of the battery needed to be improved towards the end of the discharge. A research programme led to several design changes to improve the cell which, in combination, have improved the power of the battery to greater than 150 W kg -1 at 80% depth of discharge. Bench and vehicle tests have established the stability of the high power battery over several years of cycling. The gravimetric energy density of the first generation of cells was less than 100 Wh kg -1. Optimisation of the design has led to a cell with a specific energy of 120 Wh kg -1 or 86 Wh kg -1 for a 30 kWh battery. Recently, the cell chemistry has been altered to improve the useful capacity. The cell is assembled in the over-discharged state and during the first charge the following reactions occur: at 1.6 V: Al+4NaCl=NaAlCl 4+3Na; at 2.35 V: Fe+2NaCl=FeCl 2+2Na; at 2.58 V: Ni+2NaCl=NiCl 2+2 Na. The first reaction serves to prime the negative sodium electrode but occurs at too low a voltage to be of use in providing useful capacity. By minimising the aluminium content more NaCl is released for the main reactions to improve the capacity of the cell. This, and further composition optimisation, have resulted in cells with specific energies in excess of 140 Wh kg -1, which equates to battery energies>100 Wh kg -1. The present production battery, as installed in a Mercedes Benz A class electric vehicle, gives a driving range of 205 km (128 miles) in city and hill climbing. The cells with improved capacity will extend the practical driving range to beyond 240 km (150 miles).

  7. Avaliação da concentração de flúor em águas minerais comercializadas no Brasil

    Directory of Open Access Journals (Sweden)

    Rita S. Villena

    1996-12-01

    Full Text Available A utilização de flúor sistêmico deve ser controlada em termos de risco/benefício, pois enquanto a subdosagem não trouxer benefício anticárie, a sobredosagem estará associada com fluorose dental. Assim, uma das preocupações é o consumo de águas minerais, o qual tem aumentado nos últimos anos. Deste modo, foi realizado estudo com o objetivo de analisar a concentração de flúor em águas minerais comercializadas no Brasil. Foram analisadas 104 marcas comerciais, de diferentes regiões do País. Utilizou-se eletrodo específico Orion 96-09 e analisador de íons Orion EA 940, previamente calibrados com soluções padrões de flúor. Foram observadas concentrações de flúor variando de 0,0 a 4,4 ppm. Constataram-se: 1 Concentrações significativas de flúor não relatadas pelo produtor; 2 Concentrações de flúor sem significado preventivo anti-cárie, embora o produtor destaque na embalagem "Água Mineral Fluoretada"; 3 Concentrações de flúor capazes de provocar fluorose dental severa, embora o produtor não faça nenhuma referência que o mesmo existe. Conclui-se ser necessário um Sistema de Vigilância Sanitária para o controle de flúor nas águas minerais oferecidas à população brasileira, quer seja em termos de benefício como de risco.

  8. Avaliação farmacognostica e da rotulagem das drogas vegetais boldo-do-chile (Peumus boldus Molina e camomila (Matricaria recutita L. comercializadas em Fortaleza, CE

    Directory of Open Access Journals (Sweden)

    F.P. SOARES

    2015-09-01

    Full Text Available RESUMO Boldo-do-chile (Peumus boldus e camomila (Matricaria recutita são plantas empregadas na fitoterapia principalmente para o tratamento de desordens hepáticas e intestinais, atuando também como anti-inflamatório e antiespasmódico, respectivamente. Por isso, o presente trabalho objetivou avaliar a qualidade farmacognostica dessas drogas vegetais comercializadas em Fortaleza (CE, além das informações de suas rotulagens. Quarenta e duas amostras de boldo, e quarenta e cinco amostras de camomila, procedentes de farmácias, de lojas de produtos naturais e de bancas de raizeiros, foram analisadas quanto à autenticidade, à pureza e às informações contidas na rotulagem desses produtos conforme legislação vigente. Na verificação de impurezas, 35,7% das amostras de boldo e 57,7% das amostras de camomila excederam o teor máximo de matéria estranha; no teor de cinzas totais, 33,3% das amostras de boldo foram reprovadas; rotulagens das amostras de boldo (100% e de camomila (96,6% apresentaram erros ou ausência de informações. Os resultados das análises confirmam, portanto, a necessidade urgente de melhor fiscalização e intervenção na produção e venda dessas e de outras drogas vegetais para adequação às normas vigentes.

  9. Review of techniques to prevent introduction of zebra mussels (Dreissena polymorpha) during native mussel (Unionoidea) conservation activities

    Science.gov (United States)

    Cope, W.G.; Newton, T.J.; Gatenby, C.M.

    2003-01-01

    Because of the declines in diversity and abundance of native freshwater mussels (superfamily Unionoidea), and the potential decimation of populations of native mussels resulting from the rapid spread of the exotic zebra mussel Dreissena polymorpha, management options to eliminate or reduce the threat of the zebra mussel are needed. Relocating native mussels to refugia (artificial and natural) has been proposed to mitigate the threat of zebra mussels to native species. Relocation of native mussels to refugia such as fish hatchery facilities or natural habitats within their historic range. Which are unlikely to be infested by zebra mussels, necessitates that protocols be developed to prevent the inadvertent introduction of zebra mussels. Several recent studies have developed Such protocols, and have assessed their effectiveness on the health and survival of native mussels during subsequent relocation to various refugia. The purpose of this project is to synthesize and evaluate the current protocols and to develop a set of procedures that resource managers and researchers should consider before conducting conservation activities in zebra mussel infested waters. We found that the existing protocols have many common points of concern, such as facility modification and suitability, zebra mussel risk assessment and management procedures, and health and disease management procedures. These conservation protocols may have broad applicability to other situations and locations. A summary and evaluation of the information in these main areas, along with recommended guidelines, are presented in this article.

  10. A dominance shift from the zebra mussel to the invasive quagga mussel may alter the trophic transfer of metals

    International Nuclear Information System (INIS)

    Bioinvasions are a major cause of biodiversity and ecosystem changes. The rapid range expansion of the invasive quagga mussel (Dreissena rostriformis bugensis) causing a dominance shift from zebra mussels (Dreissena polymorpha) to quagga mussels, may alter the risk of secondary poisoning to predators. Mussel samples were collected from various water bodies in the Netherlands, divided into size classes, and analysed for metal concentrations. Concentrations of nickel and copper in quagga mussels were significantly lower than in zebra mussels overall. In lakes, quagga mussels contained significantly higher concentrations of aluminium, iron and lead yet significantly lower concentrations of zinc66, cadmium111, copper, nickel, cobalt and molybdenum than zebra mussels. In the river water type quagga mussel soft tissues contained significantly lower concentrations of zinc66. Our results suggest that a dominance shift from zebra to quagga mussels may reduce metal exposure of predator species. - Highlights: • Invading quagga mussels often displace existing zebra mussels. • Interspecies difference in metal concentration may alter exposure of predators. • Zebra and quagga mussel soft tissue were analysed for metal concentrations. • Generally, quagga mussels contained lower concentrations of metals. • A dominance shift to quagga mussels may reduce metal exposure of predators. - A shift in dominance from zebra mussels to invading quagga mussels may reduce the transfer of metals to predator species

  11. Ocorrência de Salmonella e coliformes de origem fecal na canela em pó (Cinnamomum cassia Blume a Cinnamomum zeylanicum Nees) comercializada em Florianópolis, Santa Catarina, Brasil Salmonella and fecal coliforms in cinnamon (Cinnamomum cassia Blume and Cinnamomum zeylanicum Nees) sold in the city of Florianópolis, Santa Catarina, Brazil

    OpenAIRE

    Jane Maria de S. Philippi; Eliane Moretto

    1995-01-01

    Cem amostras de canela em pó de dez marcas diferentes comercializadas na cidade de Florianópolis, SC, foram submetidas à análise microbiológica, pesquisando-se Salmonella e coliformes de origem fecal. Em nenhuma amostra foi detectada Salmonella. Coliformes de origem fecal foram encontrados entre os valores

  12. Removal of enteric viruses and Escherichia coli from municipal treated effluent by zebra mussels.

    Science.gov (United States)

    Mezzanotte, Valeria; Marazzi, Francesca; Bissa, Massimiliano; Pacchioni, Sole; Binelli, Andrea; Parolini, Marco; Magni, Stefano; Ruggeri, Franco M; De Giuli Morghen, Carlo; Zanotto, Carlo; Radaelli, Antonia

    2016-01-01

    Dreissena polymorpha is a widespread filter-feeder species, resistant to a broad range of environmental conditions and different types of pollutants,which has recently colonized Italian freshwaters. Although widely used to monitor pollution in freshwater environments, this species is also an important food source for some fish and water birds. It can also be used to concentrate or remove particulate organic matter to interrupt avian-to-human transmission of pollutants and control health risks for animals and humans. In this study, the accumulation/inactivation in D. polymorpha of human health-related spiked enteric viruses was described. The removal of endogenous Escherichia coli, the classical indicator of fecal contamination,was tested as well.Our preliminary lab-scale results demonstrate that zebra mussels can reduce significantly poliovirus titer after 24 h and rotavirus titer after 8 h. E. coli counts were also reduced in the presence of zebra mussels by about 1.5 log after 4 h and nearly completely after 24 h. The fate of the two enteric viruses after concentration by zebra mussels was also investigated after mechanical disruption of the tissues. To our knowledge, the accumulation from water and inactivation of human health-related enteric viruses by zebra mussels has never been reported. PMID:26372942

  13. ZEBRA MUSSEL COLONIZATION OF RUSTY CRAYFISH IN GREEN BAY, LAKE MICHIGAN

    Science.gov (United States)

    In August, 1995 six rusty crayfish colonized with zebra mussels were captured in small-meshed fyke-nets sets set apart as of a fish sampling effort at Peter's Marsh and Long-Tail Point Wetland in lower Green Bay. Mussels colonized virtually all areas of the crayfish bodies, but ...

  14. Evaluation of several chemical disinfectants for removing zebra mussels from unionid mussels

    Science.gov (United States)

    Waller, D.L.; Fisher, S.W.

    1998-01-01

    We evaluated the safety and effectiveness of chemical treatments for killing veliger and juvenile stages of the zebra mussel Dreissena polymorpha attached to unionid mussels. Static toxicity tests were conducted on eight unionid mussel species with common aquaculture chemicals (benzalkonium chloride, formalin, hydrogen peroxide, calcium chloride, potassium chloride, and sodium chloride). The concentration and duration of each chemical treatment tested had previously been found to kill zebra mussel veligers and juveniles. Several species (e.g., Elliptio dilatata, Lampsilis cardium, and Lasmigona complanata) incurred less than 10% mortality in chloride salt treatments, while in other species (e.g., Obliquaria reflexa and Leptodea fragilis) mortality varied greatly among treatment regimes. Treatments with benzalkonium chloride, formalin, and hydrogen peroxide were less than 90% effective on juvenile stages of zebra mussels and, therefore, were ruled out after preliminary trials. Limited application of specific chemical treatments may be feasible for more tolerant species; however, effective disinfection of unionid shells will require the use of chemical treatment followed by a quarantine period to completely remove zebra mussel larvae and juveniles.

  15. Wild at heart? : differential maternal investment in wild and domesticated zebra finches (Taeniopygia guttata)

    OpenAIRE

    Pariser, Emma C

    2010-01-01

    Over the past twenty years there has been an exponential increase in the investigation of maternal effects. Understanding the adaptive function of maternal allocation strategies is integral to interpreting the evolutionary outcomes of sexual selection. Thus, model animal systems that facilitate experimental manipulation and controlled investigation of the physiological and behavioural mechanisms underlying maternal effects are important to evolutionary biologists. The zebra finch (Taeniopygia...

  16. Regulatory Differences in Natal Down Development between Altricial Zebra Finch and Precocial Chicken.

    Science.gov (United States)

    Chen, Chih-Kuan; Ng, Chen Siang; Wu, Siao-Man; Chen, Jiun-Jie; Cheng, Po-Liang; Wu, Ping; Lu, Mei-Yeh Jade; Chen, Di-Rong; Chuong, Cheng-Ming; Cheng, Hsu-Chen; Ting, Chau-Ti; Li, Wen-Hsiung

    2016-08-01

    Birds can be classified into altricial and precocial. The hatchlings of altricial birds are almost naked, whereas those of precocial birds are covered with natal down. This regulatory divergence is thought to reflect environmental adaptation, but the molecular basis of the divergence is unclear. To address this issue, we chose the altricial zebra finch and the precocial chicken as the model animals. We noted that zebra finch hatchlings show natal down growth suppressed anterior dorsal (AD) skin but partially down-covered posterior dorsal (PD) skin. Comparing the transcriptomes of AD and PD skins, we found that the feather growth promoter SHH (sonic hedgehog) was expressed higher in PD skin than in AD skin. Moreover, the data suggested that the FGF (fibroblast growth factor)/Mitogen-activated protein kinase (MAPK) signaling pathway is involved in natal down growth suppression and that FGF16 is a candidate upstream signaling suppressor. Ectopic expression of FGF16 on chicken leg skin showed downregulation of SHH, upregulation of the feather growth suppressor FGF10, and suppression of feather bud elongation, similar to the phenotype found in zebra finch embryonic AD skin. Therefore, we propose that FGF16-related signals suppress natal down elongation and cause the naked AD skin in zebra finch. Our study provides insights into the regulatory divergence in natal down formation between precocial and altricial birds. PMID:27189543

  17. Potato psyllids and their bacterial allies: Two fronts in the war against zebra chip disease.

    Science.gov (United States)

    Potato psyllid is a major pest of potato in the western United States that transmits the pathogen that causes zebra chip disease. Potato psyllids, like all psyllids, have close associations with bacterial endosymbionts living within them. These endosymbionts may be obligate or facultative, and the...

  18. Study of bioengineered zebra fish olfactory receptor 131-2: receptor purification and secondary structure analysis.

    Directory of Open Access Journals (Sweden)

    Kwong-Joo Leck

    Full Text Available How fishes are able to detect trace molecules in large bodies of water is not understood. It is plausible that they use olfactory receptors to detect water-soluble compounds. How the zebra fish Danio Rerio, an organism with only 98 functional olfactory receptors, is able to selectively detect and recognize numerous compounds in water remains a puzzling phenomenon. We are interested in studying the biochemical and molecular mechanisms of olfaction in fish. Here, we report on the study of a bioengineered zebra fish olfactory receptor OR131-2, affinity-purified from a HEK293S tetracycline-inducible system. This receptor was expressed and translocated to the cell plasma membrane as revealed by confocal microscopy. Circular dichroism spectroscopy showed that the purified zebra fish receptor folded into an α-helical structure, as observed for other G-protein coupled receptors (GPCRs. Our study shows that it is possible to produce viable quantities of the zebra fish olfactory receptor. This will not only enable detailed structural and functional analyses, but also aid in the design of biosensor devices in order to detect water-soluble metabolites or its intermediates, which are associated with human health.

  19. Potato tuber chemistry of promising germplasm exhibiting tolerance to zebra chip disease

    Science.gov (United States)

    Long-term sustainable management of zebra chip (ZC) disease of potato requires development of tolerant or resistant germplasm. To this end, 283 potato varieties and breeding clones were infected with the ZC putative causal agent ‘Candidatus Liberibacter solanacearum’ (Lso) by potato psyllid vector i...

  20. Variations in Zebra Chip disease expression and tuber biochemistry in response to vector density

    Science.gov (United States)

    This study examined effects of the number of ‘Candidatus Liberibacter solanacearum’ (Lso)-positive psyllids feeding on potatoes to Lso titers, zebra chip disease (ZC) symptom severity, and levels of amino acids, carbohydrates, and phenolics in tubers harvested weeks later. Red La Soda and Russet Nor...

  1. Bindweed Psyllid: Biology, Natural History, and Interactions with the Zebra Chip Pathogen

    Science.gov (United States)

    Bactericera maculipennis is a native psyllid that commonly occurs on field bindweed in the western United States. We have found that Pacific Northwest populations of B. maculipennis carry Liberibacter solanacearum, the pathogen associated with zebra chip disease of potato. In North America, this p...

  2. Zebra - sõbralik ja lillelõhnaline / Ell-Maaja Randküla

    Index Scriptorium Estoniae

    Randküla, Ell-Maaja, 1939-2016

    2006-01-01

    Tallinnas Narva mnt. 7 asuva kohviku Zebra sisekujundus. Sisearhitekt Tiiu Truus. Ehitus: AS KMG Ehitus. Materjalidest on kasutatud triibulise mustriga puitu Zebrano ja looduskivi. Laes on dekoratiivsed lipud, mille graafiline kujundus on Tiiu Priskolt ja Mati Veermetsalt. Tualettruumi looduskivist valamu ja põrandavaasi autor on Kaido Kivi. Ill.: põhiplaan, 11 värv. vaadet

  3. Infestation of research zebra finch colony with 2 novel mite species.

    Science.gov (United States)

    Siddalls, Monica; Currier, Timothy A; Pang, Jassia; Lertpiriyapong, Kvin; Patterson, Mary M

    2015-02-01

    A zebra finch (Taeniopygia guttata) housed in a neuroscience laboratory was observed to have numerous feather mites. Subsequently, similar mites were found on other birds in the animal facility and research space. The most abundant mite was a novel, undescribed species in the genus Neocheyletiella. Whereas known Neocheyletiella mites have previously been characterized as skin parasites of various birds worldwide, the species on the zebra finches is unique because it lives and builds nests in the feathers. Infrequent specimens of a 'true' feather mite, a new species of Megninialges, were present also. Although multiple treatments using a pyrethrin spray were effective in eradicating the mites, topical ivermectin later was found to be more efficacious, better tolerated by the birds, and less labor intensive. This case highlights the general dearth of information regarding ectoparasites in zebra finches, even though these are the most frequently used songbirds in biomedical research. The mite epizootic also underscores the diverse pathogens possible in zebra finches that arrive from outside sources and why ongoing health monitoring of finch colonies is warranted. PMID:25730757

  4. Effects of oxidative stress and carotenoid intake on sperm/nmorphology and function in zebra finches

    Czech Academy of Sciences Publication Activity Database

    Tomášek, Oldřich; Albrechtová, Jana; Opatová, Pavlína; Němcová, M.; Albrecht, Tomáš

    Badajoz : European Ornithologist's Union, 2015 - (Martin, G.; Marzal, A.). S8.4 [Conference of the European Ornithologist's Union /10./. 24.08.2015-28.08.2015, Badajoz] Institutional support: RVO:68081766 Keywords : zebra finch es * sperm Subject RIV: EG - Zoology

  5. Zebra Crossing: Walking in Two Continents Sharing and Celebrating Difference through Music

    Science.gov (United States)

    Joseph, Dawn

    2011-01-01

    I use the metaphor "zebra crossing" in my reflective narrative to describe my plight and struggle as a non-white person growing up and working in Johannesburg, South Africa, during the apartheid era. This article considers and compares the notions of culture, diversity and identity as I now work in a tertiary institution in Melbourne, Australia. I…

  6. The Quantitative Ethology of the Zebra Finch: A Study in Comparative Psychometrics.

    Science.gov (United States)

    Figueredo, Aurelio Jose; And Others

    1992-01-01

    A quantitative ethogram was developed for the zebra finch, using one-zero focal animal sampling on an ethologically comprehensive checklist of 52 behavioral items, and it was assessed for interobserver reliability and construct validity. Applying the quantitative methods of psychometrics allows verification of ethological theory and testing of…

  7. The Zebra Fish IBD Model Assessed By Novel Probe Based TagMan Assays

    DEFF Research Database (Denmark)

    Kania, Per Walter; Buchmann, Kurt; Haarder, Simon

    2015-01-01

    models it is known that oxazolone and TNBS can induce conditions mimicking ulcerative colitis (Th2 like response) and Crohn's disease (Th1/Th17 like response), respectively. Zebra fish (body weight 0.5 g) were divided into 4 groups (each with 2 replicates) and instilled rectally with H2O, ethanol, TNBS...

  8. Assessing the potential for fish predation to impact zebra mussels (Dreissena polymorpha): Insight from bioenergetics models

    Science.gov (United States)

    Eggleton, M.A.; Miranda, L.E.; Kirk, J.P.

    2004-01-01

    Rates of annual food consumption and biomass were modeled for several fish species across representative rivers and lakes in eastern North America. Results were combined to assess the relative potential of fish predation to impact zebra mussels (Dreissena polymorpha). Predicted annual food consumption by fishes in southern waters was over 100% greater than that in northern systems because of warmer annual water temperatures and presumed increases in metabolic demand. Although generally increasing with latitude, biomasses of several key zebra mussel fish predators did not change significantly across latitudes. Biomasses of some less abundant fish predators did increase significantly with latitude, but increases were not of the magnitude to offset predicted decreases in food consumption. Our results generally support the premise that fishes in rivers and lakes of the southern United States (U.S.) have inherently greater potential to impact zebra mussels by predation. Our simulations may provide a partial explanation of why zebra mussel invasions have not been as rapid and widespread in southern U.S. waters compared to the Great Lakes region. ?? Blackwell Munksgaard, 2004.

  9. Oxygen profile in zebra fish (Danio rerio) elucidated by theory and experiment

    NARCIS (Netherlands)

    Kranenbarg, S.; Boogaart, van den J.G.M.; Leeuwen, van J.L.

    2003-01-01

    We present a numerical-experi mental diffusion study in which we elucidate the spatial oxygen profile around and inside a zebra fish embryo in the pre-circulation stage (24-28 hpf). Lowest oxygen partial pressures are found in the head with a gradient of posteriorly increasing pressure along the mid

  10. Automatic detection of zebra crossings from mobile LiDAR data

    Science.gov (United States)

    Riveiro, B.; González-Jorge, H.; Martínez-Sánchez, J.; Díaz-Vilariño, L.; Arias, P.

    2015-07-01

    An algorithm for the automatic detection of zebra crossings from mobile LiDAR data is developed and tested to be applied for road management purposes. The algorithm consists of several subsequent processes starting with road segmentation by performing a curvature analysis for each laser cycle. Then, intensity images are created from the point cloud using rasterization techniques, in order to detect zebra crossing using the Standard Hough Transform and logical constrains. To optimize the results, image processing algorithms are applied to the intensity images from the point cloud. These algorithms include binarization to separate the painting area from the rest of the pavement, median filtering to avoid noisy points, and mathematical morphology to fill the gaps between the pixels in the border of white marks. Once the road marking is detected, its position is calculated. This information is valuable for inventorying purposes of road managers that use Geographic Information Systems. The performance of the algorithm has been evaluated over several mobile LiDAR strips accounting for a total of 30 zebra crossings. That test showed a completeness of 83%. Non-detected marks mainly come from painting deterioration of the zebra crossing or by occlusions in the point cloud produced by other vehicles on the road.

  11. Examining the role of tuber biochemistry in the development of zebra chip in stored potato tubers

    Science.gov (United States)

    Zebra chip disease (ZC), associated with infection by the bacterium ‘Candidatus Liberibacter solanacearum’ (Lso), is an emerging problem for potato growers in the United States, Mexico, and New Zealand. Although potato tubers exhibiting ZC symptoms will be rejected by processors, it remains possible...

  12. Evidence that Cell Death is Associated with Zebra Chip Disease in Potato Tubers

    Science.gov (United States)

    Zebra chip (ZC) is an established and highly destructive disease of potato (Solanum tuberosum L.) that occurs in several southwestern states of the United States, Mexico, Central America, and New Zealand. The causal agent for this disease has not been identified. However, the bacterium ‘Candidatus ...

  13. Sex-specific effects of yolk testosterone on survival, begging and growth of zebra finches

    NARCIS (Netherlands)

    von Engelhardt, N; Carere, C; Dijkstra, C; Groothuis, TGG

    2006-01-01

    Yolk androgens affect offspring hatching, begging, growth and survival in many bird species. If these effects are sex-specific, yolk androgen deposition may constitute a mechanism for differential investment in male and female offspring. We tested this hypothesis in zebra finches. In this species, f

  14. Development of a molecular diagnostic system to discriminate Dreissena polymorpha (zebra mussel) and Dreissena bugensis (quagga mussel)

    Science.gov (United States)

    Hoy, M.S.; Kelly, K.; Rodriguez, R.J.

    2010-01-01

    A 3-primer PCR system was developed to discriminate invasive zebra (Dreissena polymorpha) and quagga (Dreissena bugensis) mussel. The system is based on: 1) universal primers that amplifies a region of the nuclear 28s rDNA gene from both species and 2) a species-specific primer complementary to either zebra or quagga mussel. The species-specific primers bind to sequences between the binding sites for the universal primers resulting in the amplification of two products from the target species and one product from the nontarget species. Therefore, nontarget products are positive amplification controls. The 3-primer system accurately discriminated zebra and quagga mussels from seven geographically distinct populations.

  15. Zebra Finch Song Phonology and Syntactical Structure across Populations and Continents-A Computational Comparison.

    Science.gov (United States)

    Lachlan, Robert F; van Heijningen, Caroline A A; Ter Haar, Sita M; Ten Cate, Carel

    2016-01-01

    Learned bird songs are often characterized by a high degree of variation between individuals and sometimes between populations, while at the same time maintaining species specificity. The evolution of such songs depends on the balance between plasticity and constraints. Captive populations provide an opportunity to examine signal variation and differentiation in detail, so we analyzed adult male zebra finch (Taeniopygia guttata) songs recorded from 13 populations across the world, including one sample of songs from wild-caught males in their native Australia. Cluster analysis suggested some, albeit limited, evidence that zebra finch song units belonged to universal, species-wide categories, linked to restrictions in vocal production and non-song parts of the vocal repertoire. Across populations, songs also showed some syntactical structure, although any song unit could be placed anywhere within the song. On the other hand, there was a statistically significant differentiation between populations, but the effect size was very small, and its communicative significance dubious. Our results suggest that variation in zebra finch songs within a population is largely determined by species-wide constraints rather than population-specific features. Although captive zebra finch populations have been sufficiently isolated to allow them to genetically diverge, there does not appear to have been any divergence in the genetically determined constraints that underlie song learning. Perhaps more surprising is the lack of locally diverged cultural traditions. Zebra finches serve as an example of a system where frequent learning errors may rapidly create within-population diversity, within broad phonological and syntactical constraints, and prevent the formation of long-term cultural traditions that allow populations to diverge. PMID:27458396

  16. Factors Affecting Driver Yielding Behavior at a Mid-Block Zebra Crossing

    Directory of Open Access Journals (Sweden)

    Wirach Hirun

    2016-04-01

    Full Text Available Zebra crossing is one of an important pedestrian facility but a number of mid-block zebra crossings for pedestrians in Thailand are not yet utilized. Although the law requires drivers to yield the right-of-way to pedestrians at crossing, within a marked crosswalk in Thailand, a number of drivers still will not yield for a pedestrian. This situation affects the safety of pedestrians and needs urgent attention of the relevant authorities/agencies to improve the situation, before the zebra crossings becomes a safety hazard. The objective of this paper is to investigate the driver behavior at zebra crossings and the factors that are affecting driver yield behavior are also explored. The questionnaire was produced by a Google Form and the drivers were recruited using a snowball sampling technique via a Facebook and Application LINE. Friends and family of the researcher were invited to complete the survey via Facebook and Application LINE and were also asked to pass on the questionnaire to their friends and family. A total of 445 people completed the survey. The descriptive statistics and the logistic regression were employed for analysis. The binary logit model was used with six attributes: age, sex, education, experience, type of vehicle, and knowledge of pedestrian’s right-of-way law was developed. The results indicated that more than 50% of drivers do not have an understanding of the pedestrian’s right-of-way law. The developed model revealed that the yielding behavior of the driver depends on age, education, and knowledge of the pedestrian right-of-way law. The odd number of knowledge of the pedestrian rightof- way law is 1.588. For this reason, educating the drivers to the pedestrian right-of-way law is a beginning point to improve the safety for pedestrians at a zebra crossing in Thailand.

  17. Robotic removal of zebra mussel accumulations in a nuclear power plant screenhouse

    International Nuclear Information System (INIS)

    Zebra mussel accumulations in the power plant intake system have increased over the last four years and have become a maintenance issue. Several treatment methods have been used, including mechanical cleaning by divers. This is limited to areas of relatively low flow velocity. Various sections of the screenhouse are not accessible except during an outage or when one of the intake tunnels can be otherwise be blocked and flow reduced. In addition, diver services are relatively costly. For the above reasons, the Indiana Michigan Power Co., Cook Nuclear Plant, contracted with ARD Environmental Inc. to develop and test a robotic system as an alternative to cleaning by divers. The first phase of this project addressed the requirement to clean the screenhouse floor in all areas, including those with high flow velocity. Subsequent phases will address robotic cleaning of other areas of the intake and the screenhouse structures. The objectives of the project were to: (1) Demonstrate the ability to deploy and retrieve a modified XT1000 vehicle in the inlet bay and screen bays; (2) Remove the accumulations of zebra mussels and possibly other pumpable material from the floor; (3) Reduce or eliminate the need for diver services and reduce overall cost of removing accumulations of zebra mussels; and, (4) Critique operations and develop recommendations for further enhancements to the robotic equipment and materials handling system. Implementation of the operating plan commenced on September 8, 1994, and was completed on October 7, 1994. The project demonstrated that robotic techniques are an efficient and cost effective alternative to diver operations for mechanical removal of zebra mussels. In particular, the robotic system was able to operate effectively in the high flow velocity areas including those at the intake tunnels. The ability to operate in the high flow areas means that zebra mussel removal may take place at any time, without affecting normal plant operations

  18. Strategies to control zebra mussel fouling at Kewaunee Nuclear Power Plant

    International Nuclear Information System (INIS)

    The zebra mussel, Dreissena polymorpha, is currently infesting the Great Lakes. First discovered in Lake St. Clair, it is now widespread in Lakes Erie and Ontario. The initial efforts relating to zebra mussel control at Wisconsin Public Service Corporation's (WPSC) Kewaunee Nuclear Power Plant (KNPP) precipitated from the Nuclear Regulatory Commission's (NRC) Generic Letter 89-13 regarding fouling of service water (SW) systems at nuclear power plants. In the summer of 1990, Stone and Webster Engineering Corporation (Stone and Webster) was contracted to perform an evaluation of known problems within the SW system. The purposes of the study were to evaluate the actual and potential magnitude of these problems, to evaluate corrective actions to resolve the problems, and to prepare recommendations which would adequately address the issues. Two of the recommendations of this study were to continue a zebra mussel monitoring program which WPSC had already implemented and to evaluate various biocide injection programs should one be required for zebra mussel control. The concern of utilities operating power stations which use waters infested with zebra mussels as their source of cooling and/or makeup water is that mussels (both adults and veligers) will enter plant water systems and foul piping and heat exchangers. This type of fouling can restrict flow through piping, process equipment, and heat exchangers. This type of fouling can restrict flow through piping, process equipment, and heat exchangers, thereby increasing head losses and reducing heat transfer capabilities. The greatest concern in that fouling of this type is within safety-related piping and equipment that are components of service water systems at nuclear power plants

  19. Zebra Fish Dnmt1 and Suv39h1 Regulate Organ-Specific Terminal Differentiation during Development

    OpenAIRE

    Rai, Kunal; Nadauld, Lincoln D; Chidester, Stephanie; Manos, Elizabeth J.; James, Smitha R.; Karpf, Adam R.; Cairns, Bradley R.; Jones, David A.

    2006-01-01

    DNA methylation and histone methylation are two key epigenetic modifications that help govern heterochromatin dynamics. The roles for these chromatin-modifying activities in directing tissue-specific development remain largely unknown. To address this issue, we examined the roles of DNA methyltransferase 1 (Dnmt1) and the H3K9 histone methyltransferase Suv39h1 in zebra fish development. Knockdown of Dnmt1 in zebra fish embryos caused defects in terminal differentiation of the intestine, exocr...

  20. Early responses to zebra mussels in the Great Lakes: a journey from information vacuum to policy and regulation

    Science.gov (United States)

    Griffiths, Ronald W.; Schloesser, Don W.; Kovalak, William P.

    2013-01-01

    Invasive species such as zebra mussels pose a threat to the economies and environments of coastal and fresh-water habitats around the world. Consequently, it is important that government policies and programs be adequate to protect these waters from invaders. This chapter documents key events that took place in the early years (1988-1991) of zebra mussel colonization of the Laurentian Great Lakes and evaluates government responses (policies and programs) to this disruptive, invasive, freshwater species.

  1. On the production and perception of syntactical regularities in zebra finches: experimenting with ABBA, ACDC and others

    OpenAIRE

    Heijningen, Cornelia Adriana Anna van

    2012-01-01

    Natural zebra finch song contains heterogeneity in the relative distribution of element types across 13 populations worldwide, but compared between individuals it contains relatively little structural constraints or rules in the order of elements. In contrast, from a perception point of view, zebra finches are able to detect differences in song structure and are able to learn rules to generalize these regularities to new element types in some instances, a hallmark of human language. This abil...

  2. Enteroparasitas em alfaces (Lactuca sativa comercializadas na cidade de Guarapuava (PR / Enteroparasites on commercial lettuce (Lactuca sativa in Guarapuava City, Paraná State

    Directory of Open Access Journals (Sweden)

    Silvia Cristina Osaki

    2010-08-01

    Full Text Available O consumo de hortaliças cruas constitui importante meio de transmissão de enteroparasitoses. O objetivo deste trabalho foi avaliar a contaminação parasitária em alfaces (Lactuca sativa comercializadas na cidade de Guarapuava (PR. No período de julho/2005 a junho/2006, 52 supermercados foram visitados, com colheita de um pé de alface. A análise parasitológica foi realizada após duas lavagens, filtragem em gaze e sedimentação. O sedimento, corado pelo lugol, foi analisado microscopicamente por exame direto e após centrífugo-flutuação em sulfato de zinco. Das 52 amostras de alface avaliadas, 18 (34,6% apresentaram uma ou mais estruturas parasitárias como cistos de Giardia spp. (7,7%, de Entamoeba spp. (11,5% e de Balantidium coli (3,8%, oocistos de coccídios (7,7% e ovos de Capillaria spp. (3,8%. Esse alto número de amostras contaminadas aponta deficiências na cadeia produtiva dessas hortaliças, indicando a necessidade de adequada higienização antes de seu consumo. AbstractThe ingestion of raw vegetables is an important mode of enteroparasites transmission. The aim of this study was to evaluate the parasitological contamination of lettuce (Lactuca sativa commercialized in Guarapuava City, Parana State. Fifty-two samples of lettuce were collected from supermarkets during the period of July 2005 and June 2006. Parasitological analysis was realized by the sedimentation technique. Lugol-stained sediments were microscopically analyzed by direct exam and after centrifugation-fluctuation in zinc sulfate. A total of 18 out of 52 lettuce samples analyzed (34.6% were positive for one or more parasitic structures. The parasites found in the analysis were Giardia spp. (7.7%, Entamoeba spp. (11.5%, Balantidium coli (3.8%, coccidian oocysts (7.7% and Capillaria spp. eggs (3.8%. Such high occurrence of contaminated samples revealed deficiencies in the chain of lettuce cultivation, which suggests a need for improvement in the current

  3. AVALIAÇÃO DA QUALIDADE FÍSICO-QUÍMICA DE POLPAS DE FRUTA CONGELADAS COMERCIALIZADAS NA CIDADE DE CUIABÁ-MT

    Directory of Open Access Journals (Sweden)

    ALEXANDRE SILVA BRASIL

    2016-02-01

    Full Text Available RESUMO O presente trabalho teve como objetivo avaliar a qualidade físico-química das polpas de frutas congeladas comercializadas na cidade de Cuiabá-MT, comparando com os padrões estabelecidos pela legislação vigente. O experimento foi desenvolvido em delineamento inteiramente casualizado, sendo cinco tratamentos (marcas denominadas A, B, C, D e E e três repetições, para as polpas de abacaxi, acerola, caju, goiaba e maracujá. Foram analisados os parâmetros pH, acidez titulável expressa em ácido cítrico, sólidos solúveis, ratio, vitamina C, açúcar redutor e quantificação da perda de vitamina C após 90 dias de armazenamento sob congelamento, em polpas de acerola e caju. Os dados obtidos foram submetidos à análise de variância, e as médias, comparadas pelo teste de Tukey, ao nível de 5% de probabilidade. A marca D apresentou não conformidade com a legislação para todas as polpas em, pelo menos, um dos parâmetros avaliados. Foi observado maior número de amostras em inadequação para o teor de vitamina C e, de forma geral, as polpas avaliadas apresentaram valores abaixo das especificações exigidas pelos Padrões de Identidade e Qualidade (PIQ para as mesmas. Todas as amostras avaliadas tiveram redução do teor de vitamina C durante armazenamento sob congelamento, sendo que nenhuma marca de polpa de acerola e apenas uma de caju apresentou, ao final de 90 dias, teor de vitamina C de acordo com o estabelecido pelo PIQ. Conclui-se que é necessária uma intensificação na fiscalização no processamento de polpas de frutas congeladas para garantia da saúde do consumidor.

  4. Plantas medicinais comercializadas no Mercado Municipal de Campo Grande-MS Commercialized medicinal plants in the Mercado Municipal of Campo Grande-MS

    Directory of Open Access Journals (Sweden)

    Mirella Ustulin

    2009-09-01

    Full Text Available O objetivo do presente trabalho foi realizar um levantamento etnofarmacológico das principais espécies vegetais comercializadas no Mercado Municipal de Campo Grande (MS. O estudo foi realizado entre agosto de 2002 e agosto de 2003, através de entrevistas com os raizeiros. Cerca de 117 espécies foram citadas. Foram selecionadas as plantas dos biomas Cerrado e Pantanal e dessas 34 espécies foram adquiridas. Das plantas adquiridas 22 foram identificadas botanicamente, pois o material das outras foi deficiente para determinação até espécie. Das plantas identifificadas, somente dez são típicas do cerrado, podendo-se citar a Curatella americana, Guazuma ulmifolia, Maclura tinctoria e Stryphnodendron obovatum. A família com o maior número de citação foi Asteraceae, seguida de Moraceae, Sterculiaceae e Leguminosae. A parte das plantas mais utilizada é a folha, preparada principalmente como infusão. A indicação terapêutica mais citada foi como cicatrizante, no tratamento de feridas e dores reumáticas. Grande parte das espécies têm indicação de utilização popular para várias patologias e a maioria das espécies (65,2% não teve qualquer estudo farmacológico que confirmasse a indicação popular. Somente oito espécies (34,8% tiveram alguma atividade confirmada na literatura.The aim of this paper was the survey of the medicinal plants most used from Campo Grande population and commercialized in the Mercado Municipal of Campo Grande, Mato Grosso do Sul, Brazil. The survey was performed in 2002 and 2003 by interviewing and revealed 117 species. Thirty four species were acquired, and of those 22 were identified. Of those ten are only typical of the Cerrado, like as: Curatella americana, Guazuma ulmifolia, Maclura tinctoria, Stryphnodendron obovatum etc. The most mentioned families were Asteraceae, Moraceae, Sterculiaceae and Leguminosae. The most used part of the plant is the leaf, mainly prepared as infusion. These folk

  5. Análise sensorial da água de coco anão verde processada e comercializada no sertão paraibano e cearense

    Directory of Open Access Journals (Sweden)

    Suziane Alves Josino Lima

    2015-06-01

    Full Text Available O Brasil, atualmente, possui uma grande tendência de crescimento do cultivo do coqueiro anão verde, onde o principal objetivo deste se da para a produção da água de coco, sua cultura esta distribuída em todo o território nacional, destacadamente na região Nordeste onde se concentram os maiores plantios do país. A água de coco é um produto natural que vem ganhando espaço no mercado como uma bebida de vasto potencial comercial, pois além de ser um produto natural é praticamente livre de contaminações, possui baixo teor calórico, considerável valor nutricional e apresenta aroma e sabor suaves e agradáveis. Neste contexto se faz necessário a avaliação da qualidade sensorial da água de coco industrializada e comercializada de forma a garantir a qualidade do produto para o consumidor. Com isso este trabalho objetivou avaliar sensorialmente á água de coco anão verde, produzidas comercialmente e envasadas, por indústrias do Sertão Paraibano e do Ceará. As amostras de água de coco proveniente das indústrias, foram analisadas sensorialmente no laboratório de microbiologia do CVT – UFCG - Pombal, utilizando o teste de comparação múltiplas utilizando uma escala hedônica de 9 pontos (9 = gostei extremamente, até 1 desgostei, também foi aplicado o teste de intenção de compra utilizando-se uma escala estruturada de 5 pontos (1 = certamente compraria, até 5 = Certamente compraria, conforme metodologia do Instituto Adolfo Lutz. Os resultados dos testes somente se deram até o 15 dias de armazenamento, onde 70% dos copos de água de coco armazenados, apresentaram-se turvos e com produção de gás, demonstrando apartir deste ponto impróprios para o consumo. Com 30 dias de armazenamento todas as amostras apresentaram insatisfatórios para consumo, demonstrando resultados preocupantes quanto a estabilidade da qualidade do produto durante sua validade comercial. Sugere-se como forma de garantia e manutenção da qualidade

  6. Genomic and neural analysis of the estradiol-synthetic pathway in the zebra finch

    Directory of Open Access Journals (Sweden)

    London Sarah E

    2010-04-01

    Full Text Available Abstract Background Steroids are small molecule hormones derived from cholesterol. Steroids affect many tissues, including the brain. In the zebra finch, estrogenic steroids are particularly interesting because they masculinize the neural circuit that controls singing and their synthesis in the brain is modulated by experience. Here, we analyzed the zebra finch genome assembly to assess the content, conservation, and organization of genes that code for components of the estrogen-synthetic pathway and steroid nuclear receptors. Based on these analyses, we also investigated neural expression of a cholesterol transport protein gene in the context of song neurobiology. Results We present sequence-based analysis of twenty steroid-related genes using the genome assembly and other resources. Generally, zebra finch genes showed high homology to genes in other species. The diversity of steroidogenic enzymes and receptors may be lower in songbirds than in mammals; we were unable to identify all known mammalian isoforms of the 3β-hydroxysteroid dehydrogenase and 17β-hydroxysteroid dehydrogenase families in the zebra finch genome assembly, and not all splice sites described in mammals were identified in the corresponding zebra finch genes. We did identify two factors, Nobox and NR1H2-RXR, that may be important for coordinated transcription of multiple steroid-related genes. We found very little qualitative overlap in predicted transcription factor binding sites in the genes for two cholesterol transport proteins, the 18 kDa cholesterol transport protein (TSPO and steroidogenic acute regulatory protein (StAR. We therefore performed in situ hybridization for TSPO and found that its mRNA was not always detected in brain regions where StAR and steroidogenic enzymes were previously shown to be expressed. Also, transcription of TSPO, but not StAR, may be regulated by the experience of hearing song. Conclusions The genes required for estradiol synthesis and

  7. Pre- and postnatal growth phenomena of Burchell's Zebra Equus Burchelli Antiquorum

    Directory of Open Access Journals (Sweden)

    G.L. Smuts

    1975-07-01

    Full Text Available Between 1969 and 1972 growth data were collected from 175 zebra Equus burchelli antiquorum and 138 zebra embryos and foetuses from the Central District of the Kruger National Park, Republic of South Africa. Statistical analysis of data indicated no significant difference between body mass of adult stallions (range == 267,3 to 373,3 kg; mean = 318,5 kg; n = 57 and adult non-pregnant mares (range = 272,6 to 386,9 kg; mean = 321,6 kg; n = 51 (t = 0,587. The heaviest zebra had a body mass of 429,4 kilogram. This was a pregnant mare carrying a 35,2 kg foetus. Von Bertalanffy growth curves indicated that shoulder heights in young zebra may reach the adult range by one year of age, the adult body mass range is, however, only attained after three years of age. These curves also showed that age classification of free roaming zebra is only reliable up to the age of about two years, after which individual variation is too great. Stallions were significantly taller at the shoulder than mares (mean = 1,8 cm (t = 2,032 and neck thickness was the only body dimension showing visible sexual dimorphism in adults. Here the stallion had a neck girth on average 8,1 cm greater than the mare. Regression equations for estimating body mass from body dimensions were calculated by using a standard logarithmic transformation and fitting a linear regression by the method of least squares and also by undertaking standard straight line linear regression analyses. Exponential curves obtained by the first method indicated that growth was not isometric (not linear and that the ratios of any of the dimensions of length to body mass were con- stantly changing, i.e. growth is allometric. Marked allometric growth differences existed between the two sexes except in the case of the heart girth-body mass relationship. Comparison of growth data from E. b. antiquorum with that of E. b. boehmi from Tanzania (Sachs 1967, indicates that E. b. antiquorum is considerably larger. Body masses

  8. High-Throughput Selection of Retrovirus Producer Cell Lines Leads to Markedly Improved Efficiency of Germ Line-Transmissible Insertions in Zebra Fish

    OpenAIRE

    Chen, Wenbiao; Burgess, Shawn; Golling, Greg; Amsterdam, Adam; Hopkins, Nancy

    2002-01-01

    Vesicular stomatitis virus glycoprotein G-pseudotyped mouse retroviral vectors have been used as mutagens for a large-scale insertional mutagenesis screen in the zebra fish. To reproducibly generate high-titer virus stocks, we devised a method for rapidly selecting cell lines that can yield high-titer viruses and isolated a producer cell line that yields virus at a high titer on zebra fish embryos. Virus produced from this line, designated GT virus, is nontoxic following injection of zebra fi...

  9. Espécies medicinais comercializadas como "quebra-pedras" em Porto Alegre, Rio Grande do Sul, Brasil Medicinal species sold as "quebra-pedras" in Porto Alegre, Rio Grande do Sul, Brazil

    Directory of Open Access Journals (Sweden)

    Adriana Morais Aita

    2009-06-01

    Full Text Available Este trabalho visa identificar as espécies comercializadas como quebra-pedras em Porto Alegre, verificar indícios de toxicidade e estabelecer padrões morfológicos para diferenciação das mesmas. São espécies utilizadas na medicina popular principalmente para afecções nos rins e bexiga bem como diuréticas. As 16 amostras foram adquiridas de 14 comerciantes atuantes em bancas fixas ou em feiras-livres. Realizou-se uma revisão bibliográfica para levantamento de dados referentes à utilização de plantas medicinais com o nome de quebra-pedras em diferentes cidades do Rio Grande do Sul. Indícios de toxicidade, dados químicos e biológicos destas plantas foram revisados em diferentes bases de dados e em bibliografia específica. Identificaram-se sete espécies comercializadas como quebra-pedras em Porto Alegre: Euphorbia prostrata e E. serpens (Euphorbiaceae, Phyllanthus niruri e P. tenellus (Phyllanthaceae, Desmodium incanum (Fabaceae, Cunila microcephala (Lamiaceae e Heimia salicifolia (Lythraceae. Destas, as espécies de Phyllanthus e Euphorbia são as que apresentam maior semelhança morfológica quando comercializadas secas e fragmentadas.The aims of this work were to identify the species sold as "quebra-pedras" in Porto Alegre, verify signs of toxicity and establish morphological patterns that help to distinguish such species. Those species are believed to be diuretic and are used in popular medicine mainly to treat kidney and bladder affections. The samples (16 were purchased from 14 sellers who work in permanent market stalls or in public marketplaces. A bibliographic revision gathered data on the use of medicinal plants called "quebra-pedras" in several cities of Rio Grande do Sul. Signs of toxicity, chemical and biological data of these plants were reviewed from different databases and specific bibliography. Seven species were identified among those sold as "quebra-pedras" in Porto Alegre: Euphorbia prostrata and E. serpens

  10. PERBANDINGAN KECEPATAN PEMBIUSAN DAN RECOVERY IKAN HIAS ZEBRA JAKARTA MENGGUNAKAN SIANIDA DAN MINYAK CENGKEH

    Directory of Open Access Journals (Sweden)

    Wahyu Andy Nugraha

    2010-10-01

    Full Text Available This research aimed to compare the stunning time and recovery time of reef fish Zebra Jakarta. Sianida and clove oil was used as anaesthetic agent in this experiment. Both substances used concentration of 5 ppm. 5 fish was used in each concentration. Fish was exposed to each concentration one by one and once fish undergo in total loss of equilibrium, time was recorded. Fish then tranferred to recovery tank contained fresh aerated sea water. Once fish recovered, time was recorded. Result shows that fish exposed to clove oil 5 ppm have faster stunning time than fish exposed to cyanide 5 ppm. However, fish exposed to cyanide 5 ppm have faster recovery time compared to fish exposed to clove oil 5 ppm.Key words : Stunning time, Zebra Jakarta, Cyanide, Clove oil

  11. Quasi-periodic wiggles of microwave zebra structures in a solar flare

    CERN Document Server

    Yu, Sijie; Selzer, L A; Tan, Baolin; Yan, Yihua

    2013-01-01

    Quasi-periodic wiggles of microwave zebra pattern structures with period range from about 0.5 s to 1.5 s are found in a X-class solar flare on 2006 December 13 at the 2.6-3.8 GHz with the Chinese Solar Broadband Radio Spectrometer (SBRS/Huairou). Periodogram and correlation analysis show that the wiggles have two-three significant periodicities and almost in phase between stripes at different frequency. The Alfven speed estimated from the zebra pattern structures is about 700 Km/s. We obtain the spatial size of the waveguiding plasma structure to be about 1 Mm with the detected period of about 1 s. It suggests the ZP wiggles can be associated with the fast mag- netoacoustic oscillations in the flaring active region. The lack of a significant phase shift between wiggles of different stripes suggests that the ZP wiggles are caused by a standing sausage oscillation.

  12. A model of so-called "Zebra" emissions in solar flare radio burst continua

    Directory of Open Access Journals (Sweden)

    R. A. Treumann

    2011-09-01

    Full Text Available A simple mechanism for the generation of electromagnetic "Zebra" pattern emissions is proposed. "Zebra" bursts are regularly spaced narrow-band radio emissions on the otherwise broadband radio continuum emitted by the active solar corona. The mechanism is based on the generation of an ion-ring distribution in a magnetic mirror geometry in the presence of a properly directed field-aligned electric potential field. Such ion-rings or ion-conics are well known from magnetospheric observations. Under coronal conditions they may become weakly relativistic. In this case the ion-cyclotron maser generates a number of electromagnetic ion-cyclotron harmonics which modulate the electron maser emission. The mechanism is capable of switching the emission on and off or amplifying it quasi-periodically which is a main feature of the observations.

  13. Antioxidant Activities of Hydrolysates of Arca Subcrenata Prepared with Three Proteases

    Directory of Open Access Journals (Sweden)

    Liyan Song

    2008-11-01

    Full Text Available In order to get products with antioxidant activity from Arca subcrenata Lischke, the optimal hydrolase and hydrolysis conditionswere investigated in the paper. Three proteases (neutrase, alcalase and papain were applied to hydrolyze the homogenate of A. subcrenata. An orthogonaldesign was used to optimize hydrolysis conditions, and the pH-stat methods was used to determine the degree of hydrolysis. Viewed from the angle ofreducing power, such as scavenging activities against α,α-diphenyl-β-picrylhydrazyl (DPPH radical and hydrogen peroxide, the antioxidantactivities of the alcalase hydrolysate (AH were superior to neutrase hydrolysate (NH and papain hydrolysate (PH, and its EC50 values in DPPHradical and hydrogen peroxide scavenging effect were 6.23 mg/ml and 19.09 mg/ml, respectively. Moreover, compared with products hydrolyzed byneutrase and papain, the molecular mass of AH was lower and its content ofamino acid of peptides was higher. Therefore, alcalase was selected as theoptimal enzyme to produce active ingredients since its hydrolysate exhibitedthe best antioxidant activity among them and possessed large amount ofpotential active peptides.

  14. The effects of rearing conditions on sexual traits and preferences in zebra finches

    OpenAIRE

    Holveck, Marie-Jeanne

    2008-01-01

    Although theory predicts that females should prefer the highest quality male, female mating preferences within populations often show pronounced variation. What causes and maintains this variation remains poorly understood. This thesis addresses the influence of rearing conditions both on female mating preferences and male advertising signals in the zebra finch Taeniopygia guttata. It reconciles earlier apparently contradicting findings on the relative importance of visual versus acoustic sig...

  15. Occurrence of metazoan parasites of zebra fish Danio rerio (Cyprinidae) in Bangladesh

    Czech Academy of Sciences Publication Activity Database

    Ondračková, Markéta; Spence, R.; Smith, C.

    Brno : Ústav biologie obratlovců AV ČR, 2006 - (Bryja, J.; Zukal, J.). s. 135 ISBN 80-903329-4-3. [Zoologické dny. 09.02.2006-10.02.2006, Brno] R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60930519 Keywords : zebra fish * Bangladesh Subject RIV: EH - Ecology, Behaviour

  16. Preparation and evaluation of biocide-loaded particles to control the biofouling zebra mussel, Dreissena polymorpha

    OpenAIRE

    R. Costa; Aldridge, D. C.; Moggridge, G. D.

    2011-01-01

    The freshwater zebra mussel Dreissena polymorpha is a powerful biofouling bivalve, which has tremendous impact on industrial facilities whose operation depends on the intensive use of freshwater, such as waterworks and power stations. The control of the pest in industrial environments remains a major challenge due to low selectivity over non-target organisms and the expense of the large quantities of biocides required. A novel delivery technique involving the encapsulation of a toxin within h...

  17. Pharyngeal teeth of the freshwater drum (Aplodinotus grunniens) a predator of the zebra mussel (Dreissena polymorpha)

    Science.gov (United States)

    French, John R. P., III

    1997-01-01

    The morphology of pharyngeal teeth of freshwater drum (Aplodinotus grunniens) was studied to determine changes that occur during growth of drum that may relate to consumption of zebra mussel (Dreissena polymorpha) by larger fish. Pharyngeal teeth were of three types. Cardiform teeth were replaced by villiform teeth, which were replaced by molariform teeth as the size class of drum increased. Molariform teeth comprised over 85% of total surface area of dentition in fish 265 mm long.

  18. Myosin heavy-chain isoforms in the flight and leg muscles of hummingbirds and zebra finches

    OpenAIRE

    Velten, Brandy P.; Welch, Kenneth C.

    2014-01-01

    Myosin heavy chain (MHC) isoform complement is intimately related to a muscle's contractile properties, yet relatively little is known about avian MHC isoforms or how they may vary with fiber type and/or the contractile properties of a muscle. The rapid shortening of muscles necessary to power flight at the high wingbeat frequencies of ruby-throated hummingbirds and zebra finches (25–60 Hz), along with the varied morphology and use of the hummingbird hindlimb, provides a unique opportunity to...

  19. Juvenile zebra finches learn the underlying structural regularities of their fathers’ song

    OpenAIRE

    Otilia eMenyhart; Oren eKolodny; Goldstein, Michael H.; DeVoogd, Timothy J.; Shimon eEdelman

    2015-01-01

    Natural behaviors, such as foraging, tool use, social interaction, birdsong, and language, exhibit branching sequential structure. Such structure should be learnable if it can be inferred from the statistics of early experience. We report that juvenile zebra finches learn such sequential structure in song. Song learning in finches has been extensively studied, and it is generally believed that young males acquire song by imitating tutors (Zann, 1996). Variability in the order of elements in a...

  20. Sex-specific effects of yolk testosterone on survival, begging and growth of zebra finches

    OpenAIRE

    von Engelhardt, N.; Carere, C; Dijkstra, C; Groothuis, TGG

    2006-01-01

    Yolk androgens affect offspring hatching, begging, growth and survival in many bird species. If these effects are sex-specific, yolk androgen deposition may constitute a mechanism for differential investment in male and female offspring. We tested this hypothesis in zebra finches. In this species, females increase yolk-testosterone levels and produce male-biased sex ratios when paired to more attractive males. We therefore predicted that especially sons benefit from elevated yolk androgens. E...

  1. The transparent lens and cornea in the mouse and zebra fish eye

    OpenAIRE

    Greiling, Teri M.S.; Clark, John I.

    2007-01-01

    The lens and cornea combine to form a single optical element in which transparency and refraction are the fundamental biophysical characteristics required for a functional visual system. Although lens and cornea have different cellular and extracellular specializations that contribute to transparency and refraction, their development is closely related. In the embryonic mouse, the developing cornea and lens separate early. In contrast, zebra fish lens and cornea remain connected during early ...

  2. Summary of Ontario Hydro's 1990-91 zebra mussel research program

    International Nuclear Information System (INIS)

    Ontario Hydro is the principal supplier of electricity to the Province of Ontario. It serves 3.6 million customers, with an inservice capacity of 28,200 MW. Ontario Hydro has seven fossil, five nuclear, and four hydraulic stations in the Great Lakes Basin and surrounding watershed. In addition, there are another 60 inland hydraulic stations and numerous dams. As the largest single user of raw water from the Great Lakes Basin, Ontario Hydro recognized the need to control zebra mussels early in 1989. At that time, very little was known in North America about the zebra mussel life cycle and potential impact. European utilities were consulted, but as we now know, zebra mussels are not perceived to be a problem in Europe at this time. To satisfy the immediate need for control, chlorination was identified as the most effective interim measure to prevent the fouling of systems which draw water from the aquatic environment. Due to the current regulatory environment, this solution is considered short term and Ontario Hydro was compelled to initiate a comprehensive research effort aimed at providing alternative methods of control. Most of the research effort during 1990, was methods of control. Most of the research effort during 1990, was directed towards this goal. Many alternative control measures, both chemical and nonchemical were considered. Also considered were the potential effects of the control measures and zebra mussels on station operations. A multidisciplinary team involving aquatic biologists, chemists, corrosion specialists, and civil and mechanical engineers from the various departments of Ontario Hydro was asked to address the problem. Some of the research also involved collaborative studies with universities, US utilities, American Water Works Association, and Canadian industries. Following is a summary of the research effort in 1990, and a preview of the research underway in 1991

  3. Effects of suspended sediments on food uptake for zebra mussels in Lake Markermeer, The Netherlands

    OpenAIRE

    Penning, W.E.; L Pozzato; Vijverberg, T.; Noordhuis, R.; bij de Vaate, A.; Van Donk, E.; Dionisio Pires, L.M.

    2013-01-01

    Until 1992, zebra mussels (Dreissena polymorpha) were an important food source for diving ducks in Lake Markermeer (The Netherlands). After 1993, the mussel biomass sharply declined, and the current population is in poor condition (maximum shell length 0.5 g L-1. The NS concentrations used in this study are high, but analyses of the near-bottom TSM concentrationsshow that these values occur frequently and may be partly responsible for the poor mussel status in Lake Markermeer.

  4. An experimental assessment of the imaging quality of the low energy gamma-ray telescope ZEBRA

    Science.gov (United States)

    Caroli, E.; Dicocco, G.; Spada, G.; Spizzichino, A.; Stephen, J. B.; Carter, J. N.; Butler, R. C.; Natalucci, L.; Charalambous, P. M.; Dean, A. J.

    1985-01-01

    One gamma-ray detection plane of the ZEBRA telescope, consisting of nine position sensitive scintillation crystal bars designed to operate over the spectral range 0.2 to 10 MeV, has been constructed in the laboratory. A series of experimental images has been generated using a scaled down flight pattern mask in conjunction with a diverging gamma-ray beam. Point and extended sources have been imaged in order to assess quantitatively the performance of the system.

  5. Same-sex partner preference in zebra finches: pairing flexibility and choice.

    Science.gov (United States)

    Tomaszycki, Michelle L; Zatirka, Brendon P

    2014-11-01

    This study examined flexibility and choice in same-sex pair-bonding behavior in adult zebra finches (Taeniopygia guttata). Zebra finches form life-long monogamous relationships and extra pair behavior is very low, making them an ideal species in which to study same-sex pairing. We examined same-sex behaviors using both semi-naturalistic choice paradigms and skewed sex ratios. In the first experiment, we allowed zebra finches to pair in aviaries with equal sex ratios as part of multiple experiments. On average, 6.4% (N = 78) of unmanipulated pairs were same-sex: all but one was female-female. In a second experiment, we identified pairs from same-sex cages and selected 20 total same-sex pairs (10 of each sex). We then gave pairs a chance to court and pair with members of the opposite sex and observed their behavior for three days. Females did not retain their partner, but most paired with males. In contrast, some males did retain their partner. Similarly, females were more likely to engage in pairing behaviors with males than with their partners or other females whereas males were equally likely to engage in same-sex and opposite-sex pairing behaviors. These findings suggest that same-sex partnerships in zebra finches can be facultative, based on the sex ratio of the group in which they live, but can also be a choice, when opportunities to pair with opposite-sex individuals are possible. Furthermore, it is possible that females are more flexible in this choice of same-sex partnerships than are males. PMID:25190500

  6. Lessons from a transplantation of zebra mussels into a small urban river: An integrated ecotoxicological assessment

    OpenAIRE

    Bourgeault, A.; Gourlay-Francé, C.; Vincent-Hubert, F.; Palais, F.; Geffard, A.; Biagianti-Risbourg, S.; Pain-devin, S.; Tusseau Vuillemin, M.H.

    2010-01-01

    It is often difficult to evaluate the level of contamination in small urban rivers because pollution is mainly diffuse, with low levels of numerous substances. The use of a coupled approach using both chemical and biological measurements may provide an integrated evaluation of the impact of micro-pollution on the river. Zebra mussels were transplanted along a metal and organic pollution gradient in spring 2008. For two months, mussels and water samples were collected from two sites every two ...

  7. The Zebra Battery: a South African contender for electric vehicle application

    Directory of Open Access Journals (Sweden)

    J. Coertzer

    1996-07-01

    Full Text Available The Zebra battery is one of the most promising power sources for electric vehicles which might be on sale before the year 2000. It is a South African development which started at the CSIR and is at present jointly managed by the Anglo American Corpora­tion of S.A. and the German company A.E.G. The chemical reaction converts common salt and nickel to nickel chloride and sodium during the charging phase.

  8. Proper Care, Husbandry, and Breeding Guidelines for the Zebra Finch, Taeniopygia guttata

    OpenAIRE

    Olson, Christopher R.; Wirthlin, Morgan; Lovell, Peter V; MELLO, CLAUDIO V.

    2014-01-01

    The zebra finch Taeniopygia guttata castanotis is a songbird commonly used in the laboratory, particularly for studies of vocal learning, neurobiology, and physiology. Within the laboratory, it is important to adopt careful husbandry practices that allow for normal development of the birds. For example, their song is a learned trait, passed culturally from adult males to juveniles, and thus its learning can be influenced by the health and social conditions of the birds present in the laborato...

  9. Diet, maternal condition, and offspring sex ratio in the zebra finch, Poephila guttata

    OpenAIRE

    Bradbury, R.B.; Blakey, J K

    1998-01-01

    Where maternal condition affects condition and reproductive potential of offspring differentially with respect to sex, mothers in relatively good condition should produce more of the sex whose fitness is more dependent on condition. We experimentally manipulated body-condition in unmated zebra finches by feeding them for three months on high- or low-quality diets. Birds were then allowed to breed, while keeping the same diets. Females on the lower quality diet were in better condition and hat...

  10. Freqüência de enteroparasitas em amostras de alface (Lactuca sativa comercializadas em Lavras, Minas Gerais Frequency of intestinal parasites in samples of lettuce (Lactuca sativa commercialized in Lavras, Minas Gerais State

    Directory of Open Access Journals (Sweden)

    Antônio Marcos Guimarães

    2003-10-01

    Full Text Available O objetivo deste trabalho foi realizar uma avaliação parasitológica em amostras de alface (Lactuca sativa comercializadas em Lavras, MG. As amostras de alfaces apresentaram baixos padrões higiênicos, indicados pela presença de formas parasitológicas de origem animal ou humana e alta concentração de coliformes fecais.The aim of this study was to evaluate the parasitological contamination in samples of lettuce (Lactuca sativa commercialized in Lavras city, Minas Gerais. The samples of lettuce showed low hygienic conditions, indicated by the presence of parasites of animal or human origin and high concentration of fecal coliforms.

  11. Avaliação das condições de higiene dos carrinhos ambulantes de água de coco comercializada em Brasília - DF - doi: 10.5102/ucs.v9i1.1235

    OpenAIRE

    Laura Parente Ribeiro; Antônio Felipe Marangon

    2011-01-01

    O consumo da água de coco verde comercializada em carrinhos ambulantes no país é crescente e significativo, colocando em risco a saúde do consumidor. O presente estudo objetivou avaliar as condições de higiene da comercialização de água de coco feita por carrinhos ambulantes na cidade de Brasília, Distrito Federal. Os principais aspectos analisados foram às condições de higiene dos manipuladores, condições das instalações dos carrinhos ambulantes e de conservação e higienização dos utensílios...

  12. STUDY ON EMBRYO DEVELOPMENT IN ZEBRA FISH (Danio rerio DEPENDING ON DIFFERENT pH LEVELS

    Directory of Open Access Journals (Sweden)

    MIHAELA BĂDILIŢĂ

    2013-12-01

    Full Text Available The aim of this paper is to emphasize the main aspects of the ways in whichdifferent pH levels influence the development of zebra fish (Danio rerio embryos.During the experiments there have been used 6 variants with different pH levels inorder to monitor the development of zebra fish embryos in 40 ml Nunk culturedishes at optimum density (1 embryo/ 3 ml and at an optimal temperature of28.5oC.It could be noticed that most embryos died in a pH=6 medium (70%. This meansthat such a medium is not suitable to embryo’s development. For the controlvariant (pH=7 it has been recorded the lowest mortality rate of only 23% and inthe case of other variants the mortality was of 30-40%.The studies of the pH influence upon the zebra fish embryo development haveunderlined the fact that little digressions from the optimal conditions can led toirreversible modifications within the roe which sometimes are even lethal.

  13. Investigation of Acute Toxicity Diazinon, Deltamethrin, Butachlor and pretilachlor on Zebra Cichlid (Cryptoheros nigrofasciatus

    Directory of Open Access Journals (Sweden)

    Ali Sadeghi

    2014-06-01

    Full Text Available Background: The presence of pesticide due to the huge demand for agricultural purposes is very prevalent in surface waters of Iran. These pesticides could finally accumulate in aquatic ecosystems and have been proved to have toxic effects on aquatic animals. The aim of this study was to assess the acute toxicity of Diazinon, Deltamethrin, Butachlor and Pretilachlor on Zebra Cichlid (Cryptoheros nigrofasciatus. Methods: Fish samples were exposed to different concentrations of Diazinon (60% (0, 2, 4, 8, 16 and 32 ppm, Deltamethrin (2.5% (0, 0.02, 0.04, 0.10, 0.20 and 0.40 ppm, butachlor (60% (0, 2, 4, 8, 16 and 32 ppm and pretilachlor (50% (0, 5, 10, 20, 30 and 40 ppm for 96 h within the 100 L glass aquaria and cumulative mortality of Zebra Cichlid fish was calculated in 24-h interval. Results: The very low LC50 obtained for diazinon (5.06±0.37 ppm, deltamethrin (0.15±0.39 ppm, butachlor (8.93±0.26 ppm and pretilachlor (20.72±0.58 ppm indicated that these are highly toxic chemicals. Conclusion: Our results demonstrate that deltamethrin and pretilachlor had the lowest and highest rate of mortality on the Zebra Cichlid respectively.

  14. Acetylcholinesterase in central vocal control nuclei of the zebra finch (Taeniopygia guttata)

    Indian Academy of Sciences (India)

    Monika Sadananda

    2004-06-01

    The distribution of acetylcholinesterase (AChE) in the central vocal control nuclei of the zebra finch was studied using enzyme histochemistry. AChE fibres and cells are intensely labelled in the forebrain nucleus area X, strongly labelled in high vocal centre (HVC) perikarya, and moderately to lightly labelled in the somata and neuropil of vocal control nuclei robust nucleus of arcopallium (RA), medial magnocellular nucleus of the anterior nidopallium (MMAN) and lateral magnocellular nucleus of the anterior nidopallium (LMAN). The identified sites of cholinergic and/or cholinoceptive neurons are similar to the cholinergic presence in vocal control regions of other songbirds such as the song sparrow, starling and another genus of the zebra finch (Poephila guttata), and to a certain extent in parallel vocal control regions in vocalizing birds such as the budgerigar. AChE presence in the vocal control system suggests innervation by either afferent projecting cholinergic systems and/or local circuit cholinergic neurons. Co-occurrence with choline acetyltransferase (ChAT) indicates efferent cholinergic projections. The cholinergic presence in parts of the zebra finch vocal control system, such as the area X, that is also intricately wired with parts of the basal ganglia, the descending fibre tracts and brain stem nuclei could underlie this circuitry’s involvement in sensory processing and motor control of song.

  15. Zebra mussels (Dreissena polymorpha) as indicators of freshwater contamination with lindane

    International Nuclear Information System (INIS)

    Zebra mussels are common freshwater mollusks in many European lakes and rivers. Their abundance, wide distribution, and filtering activity make them good candidates to evaluate the contamination of fresh waters with environmental contaminants. The purpose of this work was to determine the kinetics of lindane in zebra mussels and compare laboratory results with in situ measurements. Exposure was conducted in small tanks, under controlled experimental conditions. Our results indicated that mussels accumulated lindane with a bioconcentration factor around 10. They generally reached equilibrium within 4 days. Elimination was rapid but biphasic and the terminal elimination half-life was long (>168 h). Age of the mussels and temperature also affected the kinetics of lindane in mussels. In the Lake of eneva, zebra mussels were sampled and showed that mussels accumulated it to significant values (up to 900 ng/g fresh weight) depending on the site and period of sampling. The in situ results, together with the laboratory exposures, showed that freshwater mussels could be used to monitor point sources of pollutants such as lindane over short periods of time (<1 week)

  16. Simple Approaches to Improve the Automatic Inventory of ZEBRA Crossing from Mls Data

    Science.gov (United States)

    Arias, P.; Riveiro, B.; Soilán, M.; Díaz-Vilariño, L.; Martínez-Sánchez, J.

    2015-08-01

    The city management is increasingly supported by information technologies, leading to paradigms such as smart cities, where decision-makers, companies and citizens are continuously interconnected. 3D modelling turns of great relevance when the city has to be managed making use of geospatial databases or Geographic Information Systems. On the other hand, laser scanning technology has experienced a significant growth in the last years, and particularly, terrestrial mobile laser scanning platforms are being more and more used with inventory purposes in both cities and road environments. Consequently, large datasets are available to produce the geometric basis for the city model; however, this data is not directly exploitable by management systems constraining the implementation of the technology for such applications. This paper presents a new algorithm for the automatic detection of zebra crossing. The algorithm is divided in three main steps: road segmentation (based on a PCA analysis of the points contained in each cycle of collected by a mobile laser system), rasterization (conversion of the point cloud to a raster image coloured as a function of intensity data), and zebra crossing detection (using the Hough Transform and logical constrains for line classification). After evaluating different datasets collected in three cities located in Northwest Spain (comprising 25 strips with 30 visible zebra crossings) a completeness of 83% was achieved.

  17. Acute phase protein and protein electrophoresis values for captive Grant's zebra (Equus burchelli).

    Science.gov (United States)

    Cray, Carolyn; Hammond, Elizabeth; Haefele, Holly

    2013-12-01

    Grant's zebra (Equus burchelli) are commonly kept in zoos and are subject to routine health monitoring and research studies. Recently, assays for acute phase proteins (APP) have been described in many wildlife species, and specific assays for serum amyloid A (SAA) have been well validated and studied in horses (Equus ferus caballus), in which it serves as a major APP. In the present study, serum samples from 26 Grant's zebra were subject to analysis by using assays for SAA, haptoglobin (HP), and protein electrophoresis. Reference intervals were calculated by using the robust method: SAA 1.8-31.4 mg/L and HP 0.37-1.58 mg/ml. Significant differences in SAA and HP were observed in clinically abnormal zebra; in some cases, these differences were marked and were noted in the absence of abnormal values for protein electrophoretic fractions. These data indicate that APP may be a valuable and sensitive tool in monitoring inflammation in this species. PMID:24450080

  18. Batteries: An Advanced Na-FeCl2 ZEBRA Battery for Stationary Energy Storage Application

    Energy Technology Data Exchange (ETDEWEB)

    Li, Guosheng; Lu, Xiaochuan; Kim, Jin Yong; Viswanathan, Vilayanur V.; Meinhardt, Kerry D.; Engelhard, Mark H.; Sprenkle, Vincent L.

    2015-06-17

    Sodium-metal chloride batteries, ZEBRA, are considered as one of the most important electrochemical devices for stationary energy storage applications because of its advantages of good cycle life, safety, and reliability. However, sodium-nickel chloride (Na-NiCl2) batteries, the most promising redox chemistry in ZEBRA batteries, still face great challenges for the practical application due to its inevitable feature of using Ni cathode (high materials cost). In this work, a novel intermediate-temperature sodium-iron chloride (Na-FeCl2) battery using a molten sodium anode and Fe cathode is proposed and demonstrated. The first use of unique sulfur-based additives in Fe cathode enables Na-FeCl2 batteries can be assembled in the discharged state and operated at intermediate-temperature (<200°C). The results in this work demonstrate that intermediate-temperature Na-FeCl2 battery technology could be a propitious solution for ZEBRA battery technologies by replacing the traditional Na-NiCl2 chemistry.

  19. Castration modulates singing patterns and electrophysiological properties of RA projection neurons in adult male zebra finches

    Directory of Open Access Journals (Sweden)

    Songhua Wang

    2014-04-01

    Full Text Available Castration can change levels of plasma testosterone. Androgens such as testosterone play an important role in stabilizing birdsong. The robust nucleus of the arcopallium (RA is an important premotor nucleus critical for singing. In this study, we investigated the effect of castration on singing patterns and electrophysiological properties of projection neurons (PNs in the RA of adult male zebra finches. Adult male zebra finches were castrated and the changes in bird song assessed. We also recorded the electrophysiological changes from RA PNs using patch clamp recording. We found that the plasma levels of testosterone were significantly decreased, song syllable’s entropy was increased and the similarity of motif was decreased after castration. Spontaneous and evoked firing rates, membrane time constants, and membrane capacitance of RA PNs in the castration group were lower than those of the control and the sham groups. Afterhyperpolarization AHP time to peak of spontaneous action potential (AP was prolonged after castration.These findings suggest that castration decreases song stereotypy and excitability of RA PNs in male zebra finches.

  20. Gene duplication and fragmentation in the zebra finch major histocompatibility complex

    Directory of Open Access Journals (Sweden)

    Burt David W

    2010-04-01

    Full Text Available Abstract Background Due to its high polymorphism and importance for disease resistance, the major histocompatibility complex (MHC has been an important focus of many vertebrate genome projects. Avian MHC organization is of particular interest because the chicken Gallus gallus, the avian species with the best characterized MHC, possesses a highly streamlined minimal essential MHC, which is linked to resistance against specific pathogens. It remains unclear the extent to which this organization describes the situation in other birds and whether it represents a derived or ancestral condition. The sequencing of the zebra finch Taeniopygia guttata genome, in combination with targeted bacterial artificial chromosome (BAC sequencing, has allowed us to characterize an MHC from a highly divergent and diverse avian lineage, the passerines. Results The zebra finch MHC exhibits a complex structure and history involving gene duplication and fragmentation. The zebra finch MHC includes multiple Class I and Class II genes, some of which appear to be pseudogenes, and spans a much more extensive genomic region than the chicken MHC, as evidenced by the presence of MHC genes on each of seven BACs spanning 739 kb. Cytogenetic (FISH evidence and the genome assembly itself place core MHC genes on as many as four chromosomes with TAP and Class I genes mapping to different chromosomes. MHC Class II regions are further characterized by high endogenous retroviral content. Lastly, we find strong evidence of selection acting on sites within passerine MHC Class I and Class II genes. Conclusion The zebra finch MHC differs markedly from that of the chicken, the only other bird species with a complete genome sequence. The apparent lack of synteny between TAP and the expressed MHC Class I locus is in fact reminiscent of a pattern seen in some mammalian lineages and may represent convergent evolution. Our analyses of the zebra finch MHC suggest a complex history involving

  1. De las arcas reales a las arcas de la nación. El presupuesto y la contabilidad pública como valladares frente a la arbitrariedad gubernamental

    Directory of Open Access Journals (Sweden)

    Fernando López Castellano

    2012-01-01

    social. Cuando se presenta el Informe de la Comisión Especial de Hacienda de las Cortes sobre el Nuevo Plan de Contribuciones, a 6 de julio de 1813, el autor del artículo del Tribuno del Pueblo Español indica : “Las arcas hasta aquí llamadas Reales, son arcas de la Nación”. En este artículo, se examina el trabajo prolífico de un reformador, José Canga Argüelles, que estuvo en el centro de este movimiento orientado a la “racionalización” de la administración. Burócrata formado en la administración de la monarquía y político en el nuevo Estado, inicia la institucionalización del presupuesto y promueve una reforma profunda de la Contabilidad Pública.Von Kassen des Königs bis zu Kassen der Nation. Der Haushaltsplan und die Staatsbuchführung wie Schutzwehren vor der Willkür der Regierung (1808-1814 - Während der französischen Besatzung (1808-1814 ist die Steuerreform mit einer tiefen wirtschaftlichen, politischen und sozialen Umwandlung verbunden gewesen. Während der Vorlage des Berichtes der Außerordentlichen Kommission für die Finanzen von Cortes über den Neuen Plan der Steuereinnahmen, am 6. Juli 1813 weist der Autor des Artikels des Tribuns des spanischen Volkes hin : “die königlichen sogenannten Kassen bis hierher, sind die Kassen der Nation”. Dieser Artikel stellt die fruchtbare Arbeit eines Reformers vor, José Canga Argüelles, der im Herzen dieser Bewegung gewesen ist und der sich um die Rationalisierung der Verwaltung gemüht hat. Bürokrat in der Verwaltung der ehemaligen Monarchie, Politiker im neuen Staat, unternahm er die Institutionalisierung des Haushaltsplanes und vertrat eine tiefe Reform der Staatsbuchführung.

  2. Application experience with ADBAC/DGH cationic surfactants for zebra mussel control in a nuclear service water system

    International Nuclear Information System (INIS)

    In response to the introduction and rapid growth of the zebra mussel population in the Great Lakes and the issuance of NRC Generic Letter 89-13 (Service Water Problems Affecting Safety-Related Equipment). A midwest nuclear station instituted a zebra mussel monitoring and control program. The nuclear station uses Lake Michigan as a cooling water source for two 1,100 MW Westinghouse 4-loop design, pressurized water reactors (PWR). Two years of monitoring indicated a growth in zebra mussel population from 0.5 organisms/m2 in July 1990 to 100 organisms/m2 by November 1990. This rapid increase indicated an urgent need for viable methods of zebra mussel control to protect the plant's essential service water (ESW) and non-essential service water (NESW) systems. In April 1991, the station formulated a plan that combined increased system inlet temperature with targeted application of a proprietary product containing two cationic surfactants, ADBAC/DGH. Sidestream biomonitoring boxes were seeded with zebra mussels and observed as a measure of the efficacy of the treatment. Where recommended dosages and duration were maintained, 100% control was achieved

  3. Zebra chip-diseased potato tubers are characterized by increased levels of host secondary metabolites, amino acids, and defense-related proteins

    Science.gov (United States)

    Zebra chip disease, a serious threat to potato production in the United States and elsewhere, is associated with 'Cadidatus Liberibacter solacearum'. Little is known about host chemistry effects on zebra chip disease symptom development in potatoes (Solanum tuberosum). This research compared chemic...

  4. Using Digital Images of the Zebra Finch Song System as a Tool to Teach Organizational Effects of Steroid Hormones: A Free Downloadable Module

    Science.gov (United States)

    Grisham, William; Schottler, Natalie A.; Beck McCauley, Lisa M.; Pham, Anh P.; Ruiz, Maureen L.; Fong, Michelle C.; Cui, Xinran

    2011-01-01

    Zebra finch song behavior is sexually dimorphic: males sing and females do not. The neural system underlying this behavior is sexually dimorphic, and this sex difference is easy to quantify. During development, the zebra finch song system can be altered by steroid hormones, specifically estradiol, which actually masculinizes it. Because of the…

  5. A New in Vitro Anti-Tumor Polypeptide Isolated from Arca inflata

    Directory of Open Access Journals (Sweden)

    Jian Xu

    2013-12-01

    Full Text Available A new in vitro anti-tumor polypeptide, coded as J2-C3, was isolated from Arca inflata Reeve and purified by diethyl-aminoethanol (DEAE-sepharose Fast Flow anion exchange and phenyl sepharose CL-4B hydrophobic chromatography. J2-C3 was identified to be a homogeneous compound by native polyacrylamide gel electrophoresis (Native-PAGE. The purity of J2-C3 was over 99% in reversed phase-high performance liquid chromatography (RP-HPLC. The molecular weight was determined as 20,538.0 Da by electrospray-ionization mass spectrometry (ESI-MS/MS. J2-C3 was rich in Glx (Gln + Glu, Lys, and Asx (Asp + Asn according to amino acid analysis. Four partial amino acid sequences of this peptide were determined as L/ISMEDVEESR, KNGMHSI/LDVNHDGR, AMKI/LI/LNPKKGI/LVPR and AMGAHKPPKGNEL/IGHR via MALDI-TOF/TOF-MS and de novo sequencing. Secondary structural analysis by CD spectroscopy revealed that J2-C3 had the α-helix (45.2%, β-sheet (2.9%, β-turn (26.0% and random coil (25.9%. The anti-tumor effect of J2-C3 against human tumor cells was measured by 3-(4,5-dimethylthiazol-2-yl-2,5-diphenyltetrazolium bromide (MTT assay, and the IC50 values of J2-C3 were 65.57, 93.33 and 122.95 µg/mL against A549, HT-29 and HepG2 cell lines, respectively. Therefore, J2-C3 might be developed as a potential anti-tumor agent.

  6. Phosphorylation of Epstein-Barr Virus ZEBRA Protein at Its Casein Kinase 2 Sites Mediates Its Ability To Repress Activation of a Viral Lytic Cycle Late Gene by Rta

    OpenAIRE

    El-Guindy, Ayman S.; Miller, George

    2004-01-01

    ZEBRA, a member of the bZIP family, serves as a master switch between latent and lytic cycle Epstein-Barr virus (EBV) gene expression. ZEBRA influences the activity of another viral transactivator, Rta, in a gene-specific manner. Some early lytic cycle genes, such as BMRF1, are activated in synergy by ZEBRA and Rta. However, ZEBRA suppresses Rta's ability to activate a late gene, BLRF2. Here we show that this repressive activity is dependent on the phosphorylation state of ZEBRA. We find that...

  7. Ballast water as a vector of coral pathogens in the Gulf of Mexico: the case of the Cayo Arcas coral reef.

    Science.gov (United States)

    Aguirre-Macedo, M Leopoldina; Vidal-Martinez, Victor M; Herrera-Silveira, Jorge A; Valdés-Lozano, David S; Herrera-Rodríguez, Miguel; Olvera-Novoa, Miguel A

    2008-09-01

    The discharge of nutrients, phytoplankton and pathogenic bacteria through ballast water may threaten the Cayo Arcas reef system. To assess this threat, the quality of ballast water and presence of coral reef pathogenic bacteria in 30 oil tankers loaded at the PEMEX Cayo Arcas crude oil terminal were determined. The water transported in the ships originated from coastal, oceanic or riverine regions. Statistical associations among quality parameters and bacteria were tested using redundancy analysis (RDA). In contrast with coastal or oceanic water, the riverine water had high concentrations of coliforms, including Vibrio cholerae 01 and, Serratia marcescens and Sphingomona spp., which are frequently associated with "white pox" and "white plague type II" coral diseases. There were also high nutrient concentrations and low water quality index values (WQI and TRIX). The presence of V. cholerae 01 highlights the need for testing ballast water coming from endemic regions into Mexican ports. PMID:18639903

  8. Genome-wide annotation and analysis of zebra finch microRNA repertoire reveal sex-biased expression

    Directory of Open Access Journals (Sweden)

    Luo Guan-Zheng

    2012-12-01

    Full Text Available Abstract Background MicroRNAs (miRNAs are small noncoding RNAs that regulate gene expression post-transcriptionally in a wide range of biological processes. The zebra finch (Taeniopygia guttata, an oscine songbird with characteristic learned vocal behavior, provides biologists a unique model system for studying vocal behavior, sexually dimorphic brain development and functions, and comparative genomics. Results We deep sequenced small RNA libraries made from the brain, heart, liver, and muscle tissues of adult male and female zebra finches. By mapping the sequence reads to the zebra finch genome and to known miRNAs in miRBase, we annotated a total of 193 miRNAs. Among them, 29 (15% are avian specific, including three novel zebra finch specific miRNAs. Many of the miRNAs exhibit sequence heterogeneity including length variations, untemplated terminal nucleotide additions, and internal substitution events occurring at the uridine nucleotide within a GGU motif. We also identified seven Z chromosome-encoded miRNAs. Among them, miR-2954, an avian specific miRNA, is expressed at significantly higher levels in males than in females in all tissues examined. Target prediction analysis reveals that miR-2954, but not other Z-linked miRNAs, preferentially targets Z chromosome-encoded genes, including several genes known to be expressed in a sexually dimorphic manner in the zebra finch brain. Conclusions Our genome-wide systematic analysis of mature sequences, genomic locations, evolutionary sequence conservation, and tissue expression profiles of the zebra finch miRNA repertoire provides a valuable resource to the research community. Our analysis also reveals a miRNA-mediated mechanism that potentially regulates sex-biased gene expression in avian species.

  9. Simple sequence repeats in zebra finch (Taeniopygia guttata expressed sequence tags: a new resource for evolutionary genetic studies of passerines

    Directory of Open Access Journals (Sweden)

    Birkhead Timothy R

    2007-02-01

    Full Text Available Abstract Background Passerines (perching birds are widely studied across many biological disciplines including ecology, population biology, neurobiology, behavioural ecology and evolutionary biology. However, understanding the molecular basis of relevant traits is hampered by the paucity of passerine genomics tools. Efforts to address this problem are underway, and the zebra finch (Taeniopygia guttata will be the first passerine to have its genome sequenced. Here we describe a bioinformatic analysis of zebra finch expressed sequence tag (EST Genbank entries. Results A total of 48,862 ESTs were downloaded from GenBank and assembled into contigs, representing an estimated 17,404 unique sequences. The unique sequence set contained 638 simple sequence repeats (SSRs or microsatellites of length ≥20 bp and purity ≥90% and 144 simple sequence repeats of length ≥30 bp. A chromosomal location for the majority of SSRs was predicted by BLASTing against assembly 2.1 of the chicken genome sequence. The relative exonic location (5' untranslated region, coding region or 3' untranslated region was predicted for 218 of the SSRs, by BLAST search against the ENSEMBL chicken peptide database. Ten loci were examined for polymorphism in two zebra finch populations and two populations of a distantly related passerine, the house sparrow Passer domesticus. Linkage was confirmed for four loci that were predicted to reside on the passerine homologue of chicken chromosome 7. Conclusion We show that SSRs are abundant within zebra finch ESTs, and that their genomic location can be predicted from sequence similarity with the assembled chicken genome sequence. We demonstrate that a useful proportion of zebra finch EST-SSRs are likely to be polymorphic, and that they can be used to build a linkage map. Finally, we show that many zebra finch EST-SSRs are likely to be useful in evolutionary genetic studies of other passerines.

  10. Status of the EC-FP7 Project ARCAS: Comparing the economics of accelerator-driven systems and fast reactors as minor actinide burners

    International Nuclear Information System (INIS)

    The ARCAS Project aims to compare, on a technological and economical basis, accelerator-driven systems and fast reactors as minor actinide burners. It is split into five work packages: the reference scenario definition, the fast reactor system definition, the accelerator-driven system definition, the fuel reprocessing and fabrication facilities definition and the economical comparison. This paper summarises the status of the project and its five work packages. (authors)

  11. EC-FP7 ARCAS: technical and economical comparison of Fast Reactors and Accelerator Driven Systems for transmutation of Minor Actinides

    International Nuclear Information System (INIS)

    The ARCAS project aims to compare, on a technological and economical basis, Accelerator Driven Systems and Fast Reactors as Minor Actinide burners. It is split in five work packages: the reference scenario definition, the fast reactor system definition, the accelerator driven system definition, the fuel reprocessing and fabrication facilities definition and the economical comparison. This paper summarizes the status of the project and its five work packages. (author)

  12. NOAH’S ARK SHELL (ARCA NOAE LINNAEUS, 1758) – WHAT DO WE NEED TO KNOW FOR STARTING UP ITS AQUACULTURE?

    OpenAIRE

    Ivan Župan; Tomislav Šarić; Melita Peharda; Daria Ezgeta-Balić

    2012-01-01

    Noah’s ark shell Arca noae Linnaeus, 1758 is one of the most important commercially exploited bivalve species in the eastern Adriatic Sea. High harvesting pressure, as a consequence of increasing market demands, could in the future result in its overexploitation in some areas. All mentioned above, together with a high market price, make A. noae a new species for introduction into aquaculture. Several studies have recently been conducted concerning biology and ecology of A. noae in the Adriati...

  13. Effects of elevated carbon dioxide concentrations on survivorship in zebra mussels (Dreissena polymorpha) and Asian clams (Corbicula fluminea)

    Energy Technology Data Exchange (ETDEWEB)

    McMahon, R.F.; Matthews, M.A.; Shaffer, L.R.; Johnson, P.D. [Univ. of Texas, Arlington, TX (United States)

    1995-06-01

    In order to determine their tolerance to elevated concentrations of carbon dioxide, Asian clams and zebra mussels were collected. Subsamples of both species were acclimated to 25{degrees}C>14 days and then exposed in water at 25{degrees}C to various concentrations of CO{sub 2} and survivorship recorded. Zebra mussels were allowed to byssally attach prior to testing. Media CO{sub 2} concentrations were maintained by continuous bubbling with appropriate gas mixtures. Gas treatment included: (1) anoxia; (2) hypercapnic anoxia; and (3) hypercapnic normoxia. Deaths were recorded in subsamples of both species every 12-24 h until 100% mortality was achieved. No significant mortality occurred among specimens of either species in air bubbled control media in any experiment. Mortality time of zebra mussels exposed to anoxia under 100% N{sub 2} was 103.7 h and of Asian clams, 349.7 h. Mortality was more rapid among samples of both species exposed to anoxia under 100% CO{sub 2}, mean time to death being 43.6 h for zebra mussels and 46.3 h for Asian clams. There was no difference in the survivorship of samples of either species under atmospheres of either 5% CO{sub 2} and 95% N{sub 2} or 100% N{sub 2}, however, Asian clams survived anoxia under either atmosphere 4 to 5 times longer than did zebra mussels. There was no significant mortality among Asian clam or zebra mussel samples after a 39 day exposure to hypercapnic normoxia. While exposure to hypercapnic normoxia under an atmosphere of 5% CO{sub 2}:19% O{sub 2}:76% N{sub 2} did not induce mortality in zebra mussel samples, it completely suppressed all byssal thread production after 7 days of exposure and induced all sampled individuals to release from their byssal attachments within 10 days of exposure. These results indicate that CO{sub 2} injection may be an easily applied, cost-effective, environmentally acceptable molluscicide for mitigation and control of raw water system macrofouling by Asian clams and zebra mussels.

  14. Mate call as reward: Acoustic communication signals can acquire positive reinforcing values during adulthood in female zebra finches (Taeniopygia guttata).

    Science.gov (United States)

    Hernandez, Alexandra M; Perez, Emilie C; Mulard, Hervé; Mathevon, Nicolas; Vignal, Clémentine

    2016-02-01

    Social stimuli can have rewarding properties and promote learning. In birds, conspecific vocalizations like song can act as a reinforcer, and specific song variants can acquire particular rewarding values during early life exposure. Here we ask if, during adulthood, an acoustic signal simpler and shorter than song can become a reward for a female songbird because of its particular social value. Using an operant choice apparatus, we showed that female zebra finches display a preferential response toward their mate's calls. This reinforcing value of mate's calls could be involved in the maintenance of the monogamous pair-bond of the zebra finch. (PsycINFO Database Record PMID:26881942

  15. Examination of the potential of chlorine dioxide for use in zebra mussel veliger control

    Energy Technology Data Exchange (ETDEWEB)

    Rusznak, L.; Smolik, N.; Hale, L.; Freymark, S. [Ashland Chemical Company, Drew Division, Boonton, NJ (United States)

    1995-06-01

    Dreissena polymorpha (zebra mussel) veligers were treated with various concentrations of chlorine dioxide and exposed at several time intervals to determine the effectiveness of this oxidant as a veliger control agent. The direction of this testing was based on previous studies which determined the effectiveness of chlorine dioxide as a molluscicide for adult zebra mussel control. Zebra mussel veligers were collected from the Niagara River shoreline at an untreated site and tested using filtered river water from the same source. All testing was conducted on site at an industrial plant in order to insure the integrity of veligers collected for this study. The plankton wheel method was used to examine the effects of chlorine dioxide. This methodology involves intense microscopic examination of the test organism prior to and after chemical exposure todeterminen molluscicidal efficacy. Veliger mortality was determined based on observations of veliger movement. Typical criteria for the determination of mortality was expanded to include four categories; veliger actively swimming, internal musculature movement, no internal musculature movement observed, however not necessarily indicating a mortality and obviously a mortality. The treatment levels ranged from 0.75 ppm - 2.0 ppm which are considered to simulate treatment levels in actual applications. Mortality levels ranged on average from 16%-42% based on 30 minute or 60 minute exposure times. The determination exposure time was based on water flow time intervals in actural applications. Sodium hypochlorite was also evaluated in order to compare the effectiveness of chlorine dioxide against this known veliger control agent. Testing resulted in chlorine dioxide providing significantly better veliger control than sodium hypochlorite under similar conditions.

  16. Combined effects of depleted uranium and ionising radiation on zebra fish embryos

    International Nuclear Information System (INIS)

    In the environment, living organisms are exposed to a mixture of stressors, and the combined effects are deemed as multiple stressor effects. In the present work, the authors studied the multiple stressor effect in embryos of the zebra fish (Danio rerio) from simultaneous exposure to alpha particles and depleted uranium (DU) through quantification of apoptotic signals at 24 h post-fertilisation (hpf) revealed by vital dye acridine orange staining. In each set of experiments, dechorionated zebra fish embryos were divided into 4 groups, each having 10 embryos: Group (C) in which the embryos did not receive any further treatment; Group (IU) in which the embryos received an alpha-particle dose of 0.44 mGy at 5 hpf and were then exposed to 100 μg l-1 of DU from 5 to 6 hpf; Group (I) in which the embryos received an alpha-particle dose of 0.44 mGy at 5 hpf and Group (U) in which the dechorionated embryos were exposed to 100 μg l-1 of DU from 5 to 6 hpf. The authors confirmed that an alpha-particle dose of 0.44 mGy and a DU exposure for 1 h separately led to hormetic and toxic effects assessed by counting apoptotic signals, respectively, in the zebra fish. Interestingly, the combined exposure led to an effect more toxic than that caused by the DU exposure alone, so effectively DU changed the beneficial effect (hormesis) brought about by alpha-particle irradiation into an apparently toxic effect. This could be explained in terms of the promotion of early death of cells predisposed to spontaneous transformation by the small alpha-particle dose (i.e. hormetic effect) and the postponement of cell death upon DU exposure. (authors)

  17. Todralazine protects zebra fish from lethal doses of ionizing radiation: role of hematopoietic stem cell expansion

    International Nuclear Information System (INIS)

    Radiation induced cell killing and hematopoietic stem cell depletion leads to compromised immune functions and opportunistic infections which significantly affect the recovery and survival upon irradiation. Any agent which can expand residual hematopoietic stem cells in irradiated organism can render protection from the effects of lethal doses of ionizing radiation. Johns Hopkins Clinical compound library (JHCCL) was screened for protection against lethal doses of ionizing radiation using developing zebra fish as a model organism. Modulation of radiation induced reactive oxygen species by the small molecules were done by DCFDA staining and for visual identification and quantification of apoptosis acridine orange assay, flow cytometry were employed respectively. Hematopoietic stem cell expansion potential was assessed by quantifying runx1 expression, a marker for definitive stem cells, were done by RT-PCR and by the kinetics of recovery from chemically induced anaemia. Todralazine hydrochloride from JHCCL exhibited promising results with potential anti radiation effects. A dose of 5μM was found to be the most effective and has rendered significant organ and whole body protection (100% survival advantage over a period of 6 days) against 20 Gy. However todralazine did not modulated radiation induced free radicals (monitored within 2 h of irradiation) and apoptosis in zebra fish embryos analysed at 8 and 24h post irradiation. Flow cytometric quantification of pre G1 population suggested the same. Chemoinformatics approaches were further carried out to elucidate possible targets which are contributing to its radioprotection potential. Structural similarity search suggested several targets and possible hematopoietic stem cell expanding potential. Treatment of zebra fish embryos with todralazine has lead to significant proliferation of hematopoietic stem cell as indicated by increase in expression of runx1. HSC expanding potential of todralazine was further supported by

  18. Current Status of Health and Safety Issues of Sodium/Metal Chloride (Zebra) Batteries

    International Nuclear Information System (INIS)

    This report addresses environmental, health, and safety (EH ampersand S) issues associated with sodium/ metal chloride batteries, in general, although most references to specific cell or battery types refer to units developed or being developed under the Zebra trademark. The report focuses on issues pertinent to sodium/metal chloride batteries and their constituent components; however, the fact that some ''issues'' arise from interaction between electric vehicle (EV) and battery design com- pels occasional discussion amid the context of EV vehicle design and operation. This approach has been chosen to provide a reasonably comprehensive account of the topic from a cell technology perspective and an applications perspective

  19. Avaliação da toxidade de misturas de desinfetantes em peixe zebra

    OpenAIRE

    Silva, Carla Ofélia Ferreira da

    2011-01-01

    Grandes quantidades de produtos químicos (por exemplo, detergentes e desinfetantes) são usados em hospitais para limpeza e desinfeção. Os seus efluentes consistem em misturas que podem causar sérios problemas ambientais. Neste trabalho foram estudados os efeitos de três misturas entre desinfetantes hospitalares: glutaraldeído (GA), formaldeído (FA) ou ortoftaldeído (OPA), com o surfatante cloreto de benzalcónio (BKC), nos primeiros estádios de vida do peixe zebra. Os ensa...

  20. Oscillating magnetic field disrupts magnetic orientation in Zebra finches, Taeniopygia guttata

    Directory of Open Access Journals (Sweden)

    Wiltschko Wolfgang

    2009-10-01

    Full Text Available Abstract Background Zebra finches can be trained to use the geomagnetic field as a directional cue for short distance orientation. The physical mechanisms underlying the primary processes of magnetoreception are, however, largely unknown. Two hypotheses of how birds perceive magnetic information are mainly discussed, one dealing with modulation of radical pair processes in retinal structures, the other assuming that iron deposits in the upper beak of the birds are involved. Oscillating magnetic fields in the MHz range disturb radical pair mechanisms but do not affect magnetic particles. Thus, application of such oscillating fields in behavioral experiments can be used as a diagnostic tool to decide between the two alternatives. Methods In a setup that eliminates all directional cues except the geomagnetic field zebra finches were trained to search for food in the magnetic north/south axis. The birds were then tested for orientation performance in two magnetic conditions. In condition 1 the horizontal component of the geomagnetic field was shifted by 90 degrees using a helmholtz coil. In condition 2 a high frequently oscillating field (1.156 MHz was applied in addition to the shifted field. Another group of birds was trained to solve the orientation task, but with visual landmarks as directional cue. The birds were then tested for their orientation performance in the same magnetic conditions as applied for the first experiment. Results The zebra finches could be trained successfully to orient in the geomagnetic field for food search in the north/south axis. They were also well oriented in test condition 1, with the magnetic field shifted horizontally by 90 degrees. In contrast, when the oscillating field was added, the directional choices during food search were randomly distributed. Birds that were trained to visually guided orientation showed no difference of orientation performance in the two magnetic conditions. Conclusion The results

  1. Efeitos de erros de tradução no peixe zebra

    OpenAIRE

    Neves, Ana Catarina Reis Vela

    2014-01-01

    O stress proteotóxico é responsável pela degeneração celular frequentemente associada a doenças neurodegenerativas e ao envelhecimento. No entanto não é ainda claro como é que o stress proteotóxico contribui para esta degeneração. Para clarificar esta questão, foram utilizados peixes zebra transgénicos que expressam tRNA mutantes em todas as células e tecidos. Estes tRNAs introduzem erradamente serina devido a mutações no seu anticodão, contribuindo para a síntese de prot...

  2. Current Status of Health and Safety Issues of Sodium/Metal Chloride (Zebra) Batteries

    Energy Technology Data Exchange (ETDEWEB)

    Trickett, D.

    1998-12-15

    This report addresses environmental, health, and safety (EH&S) issues associated with sodium/ metal chloride batteries, in general, although most references to specific cell or battery types refer to units developed or being developed under the Zebra trademark. The report focuses on issues pertinent to sodium/metal chloride batteries and their constituent components; however, the fact that some ''issues'' arise from interaction between electric vehicle (EV) and battery design compels occasional discussion amid the context of EV vehicle design and operation. This approach has been chosen to provide a reasonably comprehensive account of the topic from a cell technology perspective and an applications perspective.

  3. AVALIAÇÃO DA QUALIDADE DE MANTEIGAS TIPO EXTRA COMERCIALIZADAS NO ESTADO DO RIO DE JANEIRO QUALITY EVALUATION OF BUTTERS COMMERCIALIZED IN RIO DE JANEIRO STATE

    Directory of Open Access Journals (Sweden)

    Ivanilda M. AUGUSTA

    1998-10-01

    Full Text Available A manteiga é um produto gorduroso onde a fase aquosa está dispersa na fase oleosa formando emulsão do tipo água/óleo. As análises físicas e químicas revelam se a fase oleosa apresenta alterações decorrentes de hidrólise, rancificação ou adulteração. A adição de outras gorduras na manteiga provoca alterações em seus índices físicos e químicos. Para avaliar a qualidade de manteigas tipo extra com sal comercializadas no Estado do Rio de Janeiro, cinco marcas nacionais e duas importadas, totalizando 66 amostras, foram submetidas às análises de acidez, índice de peróxidos, índice de iodo, teor de umidade, teor de cloreto de sódio e composição em ácidos graxos por cromatografia gasosa de alta resolução. A acidez das amostras variou de 0,76 a 2,03 ml SN%; o índice de peróxidos de 0,15 a 3,82 meq peróxidos/kg gordura; o índice de iodo de 20,76 a 53,46 g I2/100g gordura; o teor de umidade de 11,3 a 20,3%; o teor de cloreto de sódio de 0,14 a 2,21%; a composição em % dos principais ácidos graxos foi C14:0 (9,7-12,1%; C16:0 (22,0-26,1%; C18:0 (9,6-11,7% e C18:1 (21,9-24,2%. Os resultados das amostras foram comparados com o RIISPOA (1952 e com a Portaria n0. 146/96 do MAARA. Todas as amostras analisadas estavam com a acidez dentro dos padrões; 85,5% estavam com índice de peróxidos acima do permitido; 15,2% estavam fora dos limites de índice de iodo; 34,8% estavam com excesso de umidade e 7,5% estavam com o teor de cloreto de sódio acima do permitido. A composição em ácidos graxos estava dentro dos padrões.Butter is a fatty product where the aqueous phase is dispersed in oil phase forming a water/oil emulsion. The physical and chemical analysis determine the occurrence of hidrolysis, rancification or adulteration in the oil phase. The improper addition of other fats in butter formulation, in order to reduce costs, causes a modification of the oil phase physical and chemical characterisitics. Five brazilian

  4. KUNJKA (Arca noae LINNAEUS, 1758) – ŠTO MORAMO ZNATI PRIJE UVOĐENJA OVE VRSTE U AKVAKULTURU?

    OpenAIRE

    Župan, Ivan; Peharda, Melita; Ezgeta-Balić, Daria; Šarić, Tomislav

    2012-01-01

    Kunjka Arca noae Linnaeus, 1758 jedna je od najvažnijih komercijalno iskorištavanih vrsta školjkaša na istočnoj obali Jadrana. Visoki intenzitet ribolova, kao posljedica rastuće potražnje na tržištu, u budućnosti bi mogao dovesti do pretjerane eksploatacije prirodnih populacija u pojedinim područjima. Kada se navedenim činjenicama pridoda i visoka cijena na tržištu, kunjka A. noae se nameće kao moguća nova vrsta u akvakulturu. Nedavno je provedeno nekoliko istraživanja o biologiji i ekologij...

  5. PREBAČAJ KUNJKE Arca noae Linnaeus, 1758 IZ PRIRODNIH UVJETA U RAZLIČITE UVJETE EKSPERIMENTALNOG UZGOJA

    OpenAIRE

    Župan, Ivan; Rogošić, Jozo; Šarić, Tomislav; Kanski, Danijel

    2013-01-01

    Kunjka Arca noae Linnaeus, 1758 je jedna od komercijalno važnih vrsta školjkaša u Hrvatskoj koja se izlovljava iz prirodnih staništa. Istražili smo odnos dužina prema spolu, udio spolova i preživljavanje nakon prebačaja iz prirodnog staništa u eksperimentalne uzgojne uvjete. Statistički značajno manje dužine uočene su kod mužjaka (x=52,6±8,7 mm) u odnosu na ženke (x=60,2±9,5 mm). Ukupni udio spolova bio je 1,8 : 1,0 u korist mužjaka. Preživljavanje nakon 17 mjeseci iznosilo je 20,5%. Istraživ...

  6. Are Predators Limiting Zebra Mussel Colonization of Unionid Mussels in Great Lake Coastal Wetlands?

    Science.gov (United States)

    de Szalay, F. A.; Bowers, R.

    2005-05-01

    Although many native mollusc populations have been eliminated in the Laurentian Great Lakes by the exotic zebra mussel, recent surveys have found abundant unionid (Bivalvia: Unionidae) populations in some coastal wetlands. Unionid burrowing in soft sediments and predation by fish have been shown to reduce numbers of attached zebra mussels, and we tested these factors in a Lake Erie coastal wetland. In 2002, we held live unionids (Leptodea fragilis, Quadrula quadrula) and Pyganodon grandis shells in exclosures with wire mesh bottoms that were buried to sediment depths of either 5, 10, or 20 cm. After 2 months, numbers of attached dreissenids on unionids were significantly higher inside all exclosure treatments than outside exclosures. This indicated that either unionid burrowing was prevented in all sediment depth treatments or molluscivores were excluded by exclosures. In 2004, we measured dreissenid colonization on Q. quadrula and PVC plates in bottomless exclosures with different mesh sizes. After 6 months, dreissenid numbers on PVC plates and on Q. quadrula in 2.5 cm X 2.5 cm and 5 cm X 10 cm mesh exclosures were significantly higher than in open exclosures. These data suggest that molluscivores are important in limiting dreissenids in Great Lake coastal wetlands.

  7. Computational Graph Model for 3D Cells Tracking in Zebra Fish Datasets

    Science.gov (United States)

    Zhang, Lelin; Xiong, Hongkai; Zhao, Yang; Zhang, Kai; Zhou, Xiaobo

    2007-11-01

    This paper leads to a novel technique for tracking and identification of zebra-fish cells in 3D image sequences, extending graph-based multi-objects tracking algorithm to 3D applications. As raised in previous work of 2D graph-based method, separated cells are modeled as vertices that connected by edges. Then the tracking work is simplified to that of vertices matching between graphs generated from consecutive frames. Graph-based tracking is composed of three steps: graph generation, initial source vertices selection and graph saturation. To satisfy demands in this work separated cell records are segmented from original datasets using 3D level-set algorithms. Besides, advancements are achieved in each of the step including graph regulations, multi restrictions on source vertices and enhanced flow quantifications. Those strategies make a good compensation for graph-based multi-objects tracking method in 2D space. Experiments are carried out in 3D datasets sampled from zebra fish, results of which shows that this enhanced method could be potentially applied to tracking of objects with diverse features.

  8. The zebra finch, Taeniopygia guttata: an avian model for investigating the neurobiological basis of vocal learning.

    Science.gov (United States)

    Mello, Claudio V

    2014-12-01

    Songbirds are capable of learning their vocalizations by copying a singing adult. This vocal learning ability requires juveniles to hear and memorize the sound of the adult song, and later to imitate it through a process involving sensorimotor integration. Vocal learning is a trait that songbirds share with humans, where it forms the basis of spoken language acquisition, with other avian groups (parrots and hummingbirds), and with a few other mammals (cetaceans, bats). It is however absent in traditional model organisms such as rodents and nonhuman primates. Zebra finches, a songbird species from Australia, are popular pets and are easy to breed. They also sing a relatively simple and stereotyped song that is amenable to quantitative analysis. Zebra finches have thus emerged as a choice model organism for investigating the neurobiological basis of vocal learning. A number of tools and methodologies have been developed to characterize the bioacoustics properties of their song, analyze the degree of accurate copying during vocal learning, map the brain circuits that control singing and song learning, and investigate the physiology of these circuits. Such studies have led to a large base of knowledge on song production and learning, and their underlying neural substrate. Several molecular resources have recently become available, including brain cDNA/EST databases, microarrays, BAC libraries, a molecular brain atlas, a complete genome assembly, and the ability to perform transgenesis. The recent availability of many other avian genomes provides unique opportunities for comparative analysis in the search for features unique to vocal learning organisms. PMID:25342070

  9. Juvenile zebra finches learn the underlying structural regularities of their fathers’ song

    Directory of Open Access Journals (Sweden)

    Otilia eMenyhart

    2015-05-01

    Full Text Available Natural behaviors, such as foraging, tool use, social interaction, birdsong, and language, exhibit branching sequential structure. Such structure should be learnable if it can be inferred from the statistics of early experience. We report that juvenile zebra finches learn such sequential structure in song. Song learning in finches has been extensively studied, and it is generally believed that young males acquire song by imitating tutors (Zann, 1996. Variability in the order of elements in an individual’s mature song occurs, but the degree to which variation in a zebra finch’s song follows statistical regularities has not been quantified, as it has typically been dismissed as production error (Sturdy et al., 1999. Allowing for the possibility that such variation in song is non-random and learnable, we applied a novel analytical approach, based on graph-structured finite-state grammars, to each individual’s full corpus of renditions of songs. This method does not assume syllable-level correspondence between individuals. We find that song variation can be described by probabilistic finite-state graph grammars that are individually distinct, and that the graphs of juveniles are more similar to those of their fathers than to those of other adult males. This grammatical learning is a new parallel between birdsong and language. Our method can be applied across species and contexts to analyze complex variable learned behaviors, as distinct as foraging, tool use, and language.

  10. Budgerigars and zebra finches differ in how they generalize in an artificial grammar learning experiment.

    Science.gov (United States)

    Spierings, Michelle J; Ten Cate, Carel

    2016-07-01

    The ability to abstract a regularity that underlies strings of sounds is a core mechanism of the language faculty but might not be specific to language learning or even to humans. It is unclear whether and to what extent nonhuman animals possess the ability to abstract regularities defining the relation among arbitrary auditory items in a string and to generalize this abstraction to strings of acoustically novel items. In this study we tested these abilities in a songbird (zebra finch) and a parrot species (budgerigar). Subjects were trained in a go/no-go design to discriminate between two sets of sound strings arranged in an XYX or an XXY structure. After this discrimination was acquired, each subject was tested with test strings that were structurally identical to the training strings but consisted of either new combinations of known elements or of novel elements belonging to other element categories. Both species learned to discriminate between the two stimulus sets. However, their responses to the test strings were strikingly different. Zebra finches categorized test stimuli with previously heard elements by the ordinal position that these elements occupied in the training strings, independent of string structure. In contrast, the budgerigars categorized both novel combinations of familiar elements as well as strings consisting of novel element types by their underlying structure. They thus abstracted the relation among items in the XYX and XXY structures, an ability similar to that shown by human infants and indicating a level of abstraction comparable to analogical reasoning. PMID:27325756

  11. Basis for the photoidentification of zebras (Equus burchellii in the National Zoological Garden of Cuba

    Directory of Open Access Journals (Sweden)

    Ernesto Testé Lozano

    2013-09-01

    Full Text Available Variability in facial strip patterns in zebras aloud its individualization. This is the basis for photo identification techniques that substitute traditional marking methods that can be expensive and traumatic. Current paper present an identification key of Equus burchelli captive in the National Zoological Garden of Cuba using left side pictures of their faces. Region of interest was limited by axes traced from posterior mouth edge, the eye and the lower base of neck. Strips crossing each ax were counted building a numerical code for each individual. The 68 % of captive zebras (54 individuals were photo identified. A group of 12 individuals had a code completely different from others, identifying each one. Remaining individuals could be grouped by similar codes, resulting in 11 pairs, and four groups of three, four, five and six individuals each. Every individual was characterized by the occurrence of spots, truncated strips, bridges between vertical stripes, periorbital bands, and bifurcated stripes. With all this characters a visual identification key was developed.

  12. Chronological history of zebra and quagga mussels (Dreissenidae) in North America, 1988-2010

    Science.gov (United States)

    Benson, Amy J.

    2013-01-01

    An unprecedented invasion began in North America in the mid-/late-1980s when two Eurasian mussel species, Dreissena polymorpha (zebra mussel) and Dreissena rostriformis bugensis (quagga mussel), became established in Laurentian Great Lakes. It is believed that Lake Erie was the initial location of establishment for both species, and within 3 years, zebra mussels had been found in all the Great Lakes. Since 1986, the combined distribution of two dreissenids has expanded throughout the Great Lakes region and the St. Lawrence River in Canada and also in the United States from the Great Lakes to the Mississippi Basin including Arkansas, Cumberland, Illinois, Missouri, Ohio, and Tennessee river basins. The distribution of dreissenid mussels in the Atlantic drainage has been limited to the Hudson and Susquehanna rivers. In the western United States, the quagga mussel established a large population in the lower Colorado River and spread to reservoirs in Arizona, California, Colorado, Nevada, and Utah. Overall, dreissenid species have been documented in 131 river systems and 772 inland lakes, reservoirs, and impoundments in the United States.

  13. Differences in metal sequestration between zebra mussels from clean and polluted field locations

    International Nuclear Information System (INIS)

    Organisms are able to detoxify accumulated metals by, e.g. binding them to metallothionein (MT) and/or sequestering them in metal-rich granules (MRG). The different factors involved in determining the capacity or efficiency with which metals are detoxified are not yet known. In this work we studied how the sub-cellular distribution pattern of cadmium, copper and zinc in whole tissue of zebra mussels from clean and polluted surface waters is influenced by the total accumulated metal concentration and by its physiological condition. Additionally we measured the metallothionein concentration in the mussel tissue. Metal concentration increased gradually in the metal-sensitive and detoxified sub-cellular fractions with increasing whole tissue concentrations. However, metal concentrations in the sensitive fractions did not increase to the same extent as metal concentrations in whole tissues. In more polluted mussels the contribution of MRG and MT became more important. Nevertheless, metal detoxification was not sufficient to prevent metal binding to heat-sensitive low molecular weight proteins (HDP fraction). Finally we found an indication that metal detoxification was influenced by the condition of the zebra mussels. MT content could be explained for up to 83% by variations in Zn concentration and physiological condition of the mussels.

  14. Familial differences in the effects of mercury on reproduction in zebra finches

    International Nuclear Information System (INIS)

    Ecotoxicologists often implicitly assume that populations are homogenous entities in which all individuals have similar responses to a contaminant. However, genetically variable responses occur within populations. This variation can be visualized using dose–response curves of genetically related groups, similar to the way that evolutionary biologists construct reaction norms. We assessed the variation in reproductive success of full-sibling families of captive zebra finches (Taeniopygia guttata) experimentally exposed to methylmercury. We found significant variation among families in the effects of methylmercury on several reproductive parameters. This variation suggests that there may be strong responses to selection for resistant genotypes in contaminated areas. This has important implications for the evolution of tolerance as well as risk assessment and wildlife conservation efforts on sites with legacy contamination. -- Highlights: •Dose-response curves can visualize genetic differences in response to pollutants. •Families of zebra finch respond differently to mercury contamination. •Differences in reproductive success can lead to selection for resistant genotypes. •Resistance to contamination has implications for risk assessment and conservation. -- Genetic variation in response to contaminants can lead to adaptation on long-term contaminated sites, with implications for risk assessment and conservation of impacted populations

  15. Lipid imaging in the zebra finch brain with secondary ion mass spectrometry

    Science.gov (United States)

    Amaya, Kensey R.; Monroe, Eric B.; Sweedler, Jonathan V.; Clayton, David F.

    2007-02-01

    Lipids have diverse functions in the nervous system, but the study of their anatomical distributions in the intact brain is rather difficult using conventional methodologies. Here we demonstrate the application of high resolution time-of-flight (ToF) secondary ion mass spectrometry (SIMS) to image various lipid components and cholesterol across an entire brain section prepared from an adult zebra finch (Taeniopygia guttata), with a spatial resolution of 2.3 [mu]m, resulting in the formation of 11.5 megapixel chemical images. The zebra finch is a songbird in which specific neural and developmental functions have been ascribed to discrete "song control nuclei" of the forebrain. We have observed a relative increase of palmitic acid C16:0 and oleic acid C18:1 in song control nuclei versus the surrounding tissue, while phosphate (PO3-), representative of phospholipids, was lower in these regions. Cholesterol was present at a high level only in the white matter of the optic tectum. More diffuse distributions were observed for stearic, arachidonic, linolenic, and palmitoleic acids. The presented results illustrate that SIMS imaging is a useful approach for assessing changes in lipid content during song circuit development and song learning.

  16. Discrimination of dynamic moving ripples in the zebra finch, Taeniopygia guttata

    Science.gov (United States)

    Osmanski, Michael S.; Dooling, Robert J.; Depireux, Didier A.

    2002-05-01

    Auditory processing of complex broadband sounds known as moving ripples has been studied both physiologically at the cortical level in mammals and psychophysically in humans [Depireux et al. (2001); Chi et al. (1999)]. These stimuli share spectro-temporal properties with many natural sounds, including species-specific vocalizations and the formant transitions of human speech [Versnel and Shamma (1998)]. One test of the generality of ripple processing beyond mammals would be to examine a non-mammalian species. Zebra finches may be excellent subjects for such a study because they produce complex broadband harmonic songs and neuronal responses in their auditory forebrain may be exquisitely tuned to the specific spectro-temporal patterns of their songs [Theunnissen and Doupe (1998)]. We trained these birds to discriminate between flat-spectrum broadband noise and moving ripples of different densities that move up or down in frequency at various rates. Results show that discrimination in zebra finches is better at those ripple densities and velocities which are prominent in their species-specific harmonic vocalizations. [Work supported by NIH Grant No. DC-00198 to RJD and NIDCD Training Grant No. DC-00046.

  17. Parasitism can be a confounding factor in assessing the response of zebra mussels to water contamination

    International Nuclear Information System (INIS)

    Biological responses measured in aquatic organisms to monitor environmental pollution could be also affected by different biotic and abiotic factors. Among these environmental factors, parasitism has often been neglected even if infection by parasites is very frequent. In the present field investigation, the parasite infra-communities and zebra mussel biological responses were studied up- and downstream a waste water treatment plant in northeast France. In both sites, mussels were infected by ciliates and/or intracellular bacteria, but prevalence rates and infection intensities were different according to the habitat. Concerning the biological responses differences were observed related to the site quality and the infection status. Parasitism affects both systems but seemed to depend mainly on environmental conditions. The influence of parasites is not constant, but remains important to consider it as a potential confounding factor in ecotoxicological studies. This study also emphasizes the interesting use of integrative indexes to synthesize data set. Highlights: ► Study of potential bias associated with the use of infected zebra mussels in ecotoxicological studies. ► Presence of infected mussels on banks and channels, up- and downstream a waste water treatment plant. ► Parasitism influence on biological responses dependent of mussel population history. ► Integrative index, an interesting tool to synthesize the set of biological data. - Parasitism influence on the host physiology would be strongly dependent on environmental conditions but remains a potential confounding factor in ecotoxicological studies.

  18. Parental influence on begging call structure in zebra finches (Taeniopygia guttata): evidence of early vocal plasticity.

    Science.gov (United States)

    Villain, Avelyne S; Boucaud, Ingrid C A; Bouchut, Colette; Vignal, Clémentine

    2015-11-01

    Begging calls are signals of need used by young birds to elicit care from adults. Different theoretical frameworks have been proposed to understand this parent-offspring communication. But relationships between parental response and begging intensity, or between begging characteristics and proxies of a young's need remain puzzling. Few studies have considered the adjustment of nestling begging features to previous experience as a possible explanation of these discrepancies. In this study, we tested the effect of a heterospecific rearing environment on individual developmental trajectories of the acoustic structure of nestling begging calls. Fifty-two zebra finch chicks were fostered either to Bengalese finch or to zebra finch parents, and begging calls were recorded at several stages of nestling development. Acoustic analyses revealed that the development of the spectral features of the begging calls differed between experimental conditions: chicks reared by Bengalese finches produced higher pitched and less broadband begging calls than chicks reared by conspecific parents. Differences were stronger in males than females and were not explained by differences in growth rate. We conclude that nestling begging calls can be plastic in response to social interactions with parents. PMID:26716009

  19. Zebra finches can use positional and transitional cues to distinguish vocal element strings.

    Science.gov (United States)

    Chen, Jiani; Ten Cate, Carel

    2015-08-01

    Learning sequences is of great importance to humans and non-human animals. Many motor and mental actions, such as singing in birds and speech processing in humans, rely on sequential learning. At least two mechanisms are considered to be involved in such learning. The chaining theory proposes that learning of sequences relies on memorizing the transitions between adjacent items, while the positional theory suggests that learners encode the items according to their ordinal position in the sequence. Positional learning is assumed to dominate sequential learning. However, human infants exposed to a string of speech sounds can learn transitional (chaining) cues. So far, it is not clear whether birds, an increasingly important model for examining vocal processing, can do this. In this study we use a Go-Nogo design to examine whether zebra finches can use transitional cues to distinguish artificially constructed strings of song elements. Zebra finches were trained with sequences differing in transitional and positional information and next tested with novel strings sharing positional and transitional similarities with the training strings. The results show that they can attend to both transitional and positional cues and that their sequential coding strategies can be biased toward transitional cues depending on the learning context. This article is part of a Special Issue entitled: In Honor of Jerry Hogan. PMID:25217867

  20. Assessment of Mercury Bioaccumulation in Zebra Cichlid (Cichlasoma Nigrofasciatum Exposed to Sublethal Concentrations of Permethrin

    Directory of Open Access Journals (Sweden)

    Mahdi Banaee

    2014-12-01

    Full Text Available Background: Aquatic ecosystems are frequently subjected to contamination by toxic heavy metals and pesticides, yet very little is known about the influence of pesticides on bioaccumulation of heavy metals in aquatic organisms. Mercury is a toxic metal with no known biological benefit to organisms. Bioavailability of mercury in aquatic environments depends on biological and non-biological parameters including other pollutants. Therefore, the objectives of this research were to determine the effects of permethrin on bioaccumulation of mercury in zebra cichlid. Methods: Acute toxicity (LC50 of permethrin and mercury chloride was evaluated by estimating mortality in Probit Model in SPSS (version 19.0 IBM. In sub-lethal toxicity, zebra cichlid (Cichlasoma nigrofasciatum was exposed to various concentrations of permethrin (0.0, 0.40, 0.80, 1.20 and 1.60 µg.L-1 combined with 20 µg.L-1 mercury chloride for 15 days. At the end of the experiment, mercury concentrations were measured using ICP-OES-Perkin elmer (optima 7300-DV. Results: 96 h LC50 values of permethrin and mercury for C. nigrofasciatum were calculated to be 17.55 µg.L-1 and 140.38 µg.L-1, respectively. Our results clearly showed that the bioaccumulation of mercury in the specimens increased with increasing concentrations of permethrin to 1.20 and 1.60 µg.L-1. Conclusion: Increasing the concentration of permethrin had synergistic effects on the bioaccumulation of mercury in fish.

  1. Altered auditory BOLD response to conspecific birdsong in zebra finches with stuttered syllables.

    Directory of Open Access Journals (Sweden)

    Henning U Voss

    Full Text Available How well a songbird learns a song appears to depend on the formation of a robust auditory template of its tutor's song. Using functional magnetic resonance neuroimaging we examine auditory responses in two groups of zebra finches that differ in the type of song they sing after being tutored by birds producing stuttering-like syllable repetitions in their songs. We find that birds that learn to produce the stuttered syntax show attenuated blood oxygenation level-dependent (BOLD responses to tutor's song, and more pronounced responses to conspecific song primarily in the auditory area field L of the avian forebrain, when compared to birds that produce normal song. These findings are consistent with the presence of a sensory song template critical for song learning in auditory areas of the zebra finch forebrain. In addition, they suggest a relationship between an altered response related to familiarity and/or saliency of song stimuli and the production of variant songs with stuttered syllables.

  2. Zebra Chip disease and potato biochemistry: Tuber physiological changes in response to ‘Candidatus Liberibacter solanacearum’ infection over time

    Science.gov (United States)

    Zebra chip disease (ZC), putatively caused by ‘Candidatus Liberibacter solanacearum’ (Lso), is of increasing concern to potato production in Mexico, the United States, and New Zealand. However, little is known about host tuber physiological changes that result in ZC symptom formation. This study exp...

  3. Zebra Chip, a New Potato Disease in North and Central America, is Associated with the Potato Psyllid

    Science.gov (United States)

    Zebra chip (ZC) is an important and emerging potato disease that is causing millions of dollars in losses to both potato producers and processors in the southwestern United States, Mexico, and Central America. This disease is characterized by symptoms that develop in fried chips from infected potato...

  4. Origin of Spanish invasion by the zebra mussel, Dreissena polymorpha (Pallas, 1771) revealed by amplified fragment length polymorphism (AFLP) fingerprinting

    NARCIS (Netherlands)

    Rajagopal, S.; Pollux, B.J.A.; Peters, J.L.; Cremers, G.; Moon- van der Staay, S.Y.; Alen, van T.; Eygensteyn, J.; Hoek, van A.H.A.M.; Palau, A.; Vaate, de A.B.; Velde, van der G.

    2009-01-01

    The zebra mussel, Dreissena polymorpha is an aquatic nuisance invasive species originally native to the Ponto-Caspian region where it is found in lakes and delta areas of large rivers draining into the Black and Caspian seas. The dispersal of D. polymorpha began at the end of the 18th century, at a

  5. Sex steroid profiles and pair-maintenance behavior of captive wild-caught zebra finches (Taeniopygia guttata).

    Science.gov (United States)

    Prior, Nora H; Yap, Kang Nian; Adomat, Hans H; Mainwaring, Mark C; Fokidis, H Bobby; Guns, Emma S; Buchanan, Katherine L; Griffith, Simon C; Soma, Kiran K

    2016-01-01

    Here, we studied the life-long monogamous zebra finch, to examine the relationship between circulating sex steroid profiles and pair-maintenance behavior in pairs of wild-caught zebra finches (paired in the laboratory for >1 month). We used liquid chromatography-tandem mass spectrometry to examine a total of eight androgens and progestins [pregnenolone, progesterone, dehydroepiandrosterone (DHEA), androstenediol, pregnan-3,17-diol-20-one, androsterone, androstanediol, and testosterone]. In the plasma, only pregnenolone, progesterone, DHEA, and testosterone were above the limit of quantification. Sex steroid profiles were similar between males and females, with only circulating progesterone levels significantly different between the sexes (female > male). Circulating pregnenolone levels were high in both sexes, suggesting that pregnenolone might serve as a circulating prohormone for local steroid synthesis in zebra finches. Furthermore, circulating testosterone levels were extremely low in both sexes. Additionally, we found no correlations between circulating steroid levels and pair-maintenance behavior. Taken together, our data raise several interesting questions about the neuroendocrinology of zebra finches. PMID:26610331

  6. Structure and expression of TLR4 in zebra finch (Taeniopygia guttata), the first Toll-like receptor in passerine birds

    Czech Academy of Sciences Publication Activity Database

    Vinkler, Michal; Bryjová, Anna; Albrecht, Tomáš; Bryja, Josef

    Barcelona: AOPC, 2008. P-240. [Annual Meeting of the Society for Molecular Biology and Evolution. 05.06.2008-08.06.2008, Barcelona] Institutional research plan: CEZ:AV0Z60930519 Keywords : zebra finch * toll-like receptors Subject RIV: EB - Genetics ; Molecular Biology http://www.aopc.es/abst/obtimpres.php?idAbst=991

  7. Size limitation on zebra mussels consumed by freshwater drum may preclude the effectiveness of drum as a biological controller

    Science.gov (United States)

    French, John R. P., III; Love, Joy G.

    1995-01-01

    The septa lengths of bivalve shells were used to estimate shell lengths of the largest zebra mussels (Dreissena polymorpha) crushed and consumed by freshwater drum (Aplodinotus grunniens) to determine if size limitation could preclude the effectiveness of drum as a biological controller of the zebra mussel. We examined gut samples of drum (273 to 542 mm long) collected from western Lake Erie in 1991, found the largest mussel (shell length = 21.4 mm) in the 11th largest drum (TL = 405 mm), and observed a reduction of mussel size in larger drum. The lack of a relationship between mussel size and drum size for larger specimens suggests that either drum prefer smaller mussels or the gape between the upper and lower pharyngeal teeth restricts drum feeding to zebra mussels of limited size. Although drum may reduce zebra mussel populations, because of the apparent size limitation of prey it is unlikely that drum would be fully effective as a biological controller; thus, this fish should not be introduced beyond its native range for that purpose.

  8. Zebra chip progression: from inoculation of potato plants with liberibacter to development of disease symptoms in tubers

    Science.gov (United States)

    Zebra chip (ZC), a new and serious disease of potatoes, has caused millions of dollars in losses to the potato industry in the United States, Mexico, Central America, and New Zealand. The disease has been associated with the bacterium “Candidatus Liberibacter solanacearum” transmitted to potato by t...

  9. Scanning electron microscopy and in vitro cultivation of endophytic bacteria from potato tubers related to Zebra Chip disease

    Science.gov (United States)

    Zebra chip disease (ZCD) drastically reduces the quality and market value of potatoes in North America. The disease is associated with a phloem-limited alpha-proteobacterium, “Candidatus Liberibacter solanacearum”. No effective measure is currently available to control ZCD. It is known that endoph...

  10. Avaliação das condições de higiene dos carrinhos ambulantes de água de coco comercializada em Brasília - DF - doi: 10.5102/ucs.v9i1.1235

    Directory of Open Access Journals (Sweden)

    Laura Parente Ribeiro

    2011-07-01

    Full Text Available O consumo da água de coco verde comercializada em carrinhos ambulantes no país é crescente e significativo, colocando em risco a saúde do consumidor. O presente estudo objetivou avaliar as condições de higiene da comercialização de água de coco feita por carrinhos ambulantes na cidade de Brasília, Distrito Federal. Os principais aspectos analisados foram às condições de higiene dos manipuladores, condições das instalações dos carrinhos ambulantes e de conservação e higienização dos utensílios utilizados para a comercialização da água de coco. Com base na RDC nº. 216 – BPF a pesquisa revelou fatores como: a falta de condições para a higienização de utensílios, a deficiência quanto à manipulação, a falta de informação básica de educação sanitária dos comerciantes e inadequada conservação e armazenamento dos produtos. Conclui-se que os carrinhos ambulantes que comercializam água de coco não possuem as condições básicas para o correto controle higiênico-sanitário.

  11. Análise de coliformes e verificação das Boas Práticas de Fabricação de carne moída comercializada na cidade de Campina Grande-PB

    Directory of Open Access Journals (Sweden)

    Renata Rodrigues de Lima Silva

    2015-04-01

    Full Text Available A indústria de alimentos é um ramo que se desenvolve ao longo dos anos e, com isso, a exigência por produtos microbiologicamente seguros é cada vez maior, visando evitar prejuízos financeiros e garantir a segurança alimentar ao consumidor. Nesse ramo, existem práticas que são adotadas a fim de garantir a qualidade sanitária e a conformidade dos produtos alimentícios com os regulamentos técnicos vigentes, buscando sempre métodos eficazes de prevenção contra a deterioração de alimentos e aumento de vida de prateleira. No setor de carnes, o controle do desenvolvimento microbiano é de grande importância, visto que este é um alimento que possui características favoráveis à proliferação de microrganismos. Foram avaliadas amostras de carne moída comercializadas em três redes de distribuição distintas. Em todas as amostras avaliadas, foi determinada a presença de coliformes totais, bem como valores superiores a 14% de inconformidade nos itens relacionados às Boas Práticas de Fabricação.

  12. “Bird Song Metronomics”: Isochronous Organization of Zebra Finch Song Rhythm

    Science.gov (United States)

    Norton, Philipp; Scharff, Constance

    2016-01-01

    The human capacity for speech and vocal music depends on vocal imitation. Songbirds, in contrast to non-human primates, share this vocal production learning with humans. The process through which birds and humans learn many of their vocalizations as well as the underlying neural system exhibit a number of striking parallels and have been widely researched. In contrast, rhythm, a key feature of language, and music, has received surprisingly little attention in songbirds. Investigating temporal periodicity in bird song has the potential to inform the relationship between neural mechanisms and behavioral output and can also provide insight into the biology and evolution of musicality. Here we present a method to analyze birdsong for an underlying rhythmic regularity. Using the intervals from one note onset to the next as input, we found for each bird an isochronous sequence of time stamps, a “signal-derived pulse,” or pulseS, of which a subset aligned with all note onsets of the bird's song. Fourier analysis corroborated these results. To determine whether this finding was just a byproduct of the duration of notes and intervals typical for zebra finches but not dependent on the individual duration of elements and the sequence in which they are sung, we compared natural songs to models of artificial songs. Note onsets of natural song deviated from the pulseS significantly less than those of artificial songs with randomized note and gap durations. Thus, male zebra finch song has the regularity required for a listener to extract a perceived pulse (pulseP), as yet untested. Strikingly, in our study, pulsesS that best fit note onsets often also coincided with the transitions between sub-note elements within complex notes, corresponding to neuromuscular gestures. Gesture durations often equaled one or more pulseS periods. This suggests that gesture duration constitutes the basic element of the temporal hierarchy of zebra finch song rhythm, an interesting parallel to the

  13. Song exposure regulates known and novel microRNAs in the zebra finch auditory forebrain

    Directory of Open Access Journals (Sweden)

    Kim Jong H

    2011-05-01

    Full Text Available Abstract Background In an important model for neuroscience, songbirds learn to discriminate songs they hear during tape-recorded playbacks, as demonstrated by song-specific habituation of both behavioral and neurogenomic responses in the auditory forebrain. We hypothesized that microRNAs (miRNAs or miRs may participate in the changing pattern of gene expression induced by song exposure. To test this, we used massively parallel Illumina sequencing to analyse small RNAs from auditory forebrain of adult zebra finches exposed to tape-recorded birdsong or silence. Results In the auditory forebrain, we identified 121 known miRNAs conserved in other vertebrates. We also identified 34 novel miRNAs that do not align to human or chicken genomes. Five conserved miRNAs showed significant and consistent changes in copy number after song exposure across three biological replications of the song-silence comparison, with two increasing (tgu-miR-25, tgu-miR-192 and three decreasing (tgu-miR-92, tgu-miR-124, tgu-miR-129-5p. We also detected a locus on the Z sex chromosome that produces three different novel miRNAs, with supporting evidence from Northern blot and TaqMan qPCR assays for differential expression in males and females and in response to song playbacks. One of these, tgu-miR-2954-3p, is predicted (by TargetScan to regulate eight song-responsive mRNAs that all have functions in cellular proliferation and neuronal differentiation. Conclusions The experience of hearing another bird singing alters the profile of miRNAs in the auditory forebrain of zebra finches. The response involves both known conserved miRNAs and novel miRNAs described so far only in the zebra finch, including a novel sex-linked, song-responsive miRNA. These results indicate that miRNAs are likely to contribute to the unique behavioural biology of learned song communication in songbirds.

  14. Investigation to determine staff exposure and describe animal bite surveillance after detection of a rabid zebra in a safari lodge in Kenya, 2011

    OpenAIRE

    Obonyo, Mark; Arvelo, Wences; Kadivane, Samuel; Orundu, Moses; Lankau, Emily; Gakuya, Francis; Munyua, Peninah; Githinji, Jane; Marano, Nina; Njenga, Kariuki; Omolo, Jared; Montgomery, Joel

    2014-01-01

    Introduction Rabies is a fatal viral infection, resulting in >55,000 deaths globally each year. In August 2011, a young orphaned zebra at a Kenyan safari lodge acquired rabies and potentially exposed >150 tourists and local staff. An investigation was initiated to determine exposures among the local staff, and to describe animal bite surveillance in the affected district. Methods We interviewed lodge staff on circumstances surrounding the zebra's illness and assessed their exposure status. We...

  15. Effect of a sausage oscillation on radio zebra-pattern structures in a solar flare

    CERN Document Server

    Yu, Sijie; Yan, Yihua

    2016-01-01

    Sausage modes that are axisymmetric fast magnetoacoustic oscillations of solar coronal loops are characterized by variation of the plasma density and magnetic field, and hence cause time variations of the electron plasma frequency and cyclotron frequency. The latter parameters determine the condition for the double plasma resonance (DPR), which is responsible for the appearance of zebra-pattern (ZP) structures in time spectra of solar type IV radio bursts. We perform numerical simulations of standing and propagating sausage oscillations in a coronal loop modeled as a straight, field-aligned plasma slab, and determine the time variation of the DPR layer locations. Instant values of the plasma density and magnetic field at the DPR layers allowed us to construct skeletons of the time variation of ZP stripes in radio spectra. In the presence of a sausage oscillation, the ZP structures are shown to have characteristic wiggles with the time period prescribed by the sausage oscillation. Standing and propagating saus...

  16. Personality over ontogeny in zebra finches: long-term repeatable traits but unstable behavioural syndromes.

    Science.gov (United States)

    Wuerz, Yvonne; Krüger, Oliver

    2015-01-01

    A crucial assumption of animal personality research is that behaviour is consistent over time, showing a high repeatability within individuals. This assumption is often made, sometimes tested using short time intervals between behavioural tests, but rarely thoroughly investigated across long time intervals crossing different stages of ontogeny. We performed such a longitudinal test across three life stages in zebra finches (Taeniopygia guttata), representing about 15-20% of their life span in captivity, and found repeatabilities ranging from 0.03 to 0.67. Fearlessness and exploration were the most repeatable traits both within and across life stages. Activity and aggression were repeatable across, but not or only partly within life stages. Boldness was not repeatable. Furthermore, we found no evidence for a consistent behavioural syndrome structure across ontogeny. Our results indicate that the consistency of behavioural traits and their correlations might be overestimated and suggest that life-long stability of animal personality should not simply be assumed. PMID:26813709

  17. Patterns of call communication between group-housed zebra finches change during the breeding cycle.

    Science.gov (United States)

    Gill, Lisa F; Goymann, Wolfgang; Ter Maat, Andries; Gahr, Manfred

    2015-01-01

    Vocal signals such as calls play a crucial role for survival and successful reproduction, especially in group-living animals. However, call interactions and call dynamics within groups remain largely unexplored because their relation to relevant contexts or life-history stages could not be studied with individual-level resolution. Using on-bird microphone transmitters, we recorded the vocalisations of individual zebra finches (Taeniopygia guttata) behaving freely in social groups, while females and males previously unknown to each other passed through different stages of the breeding cycle. As birds formed pairs and shifted their reproductive status, their call repertoire composition changed. The recordings revealed that calls occurred non-randomly in fine-tuned vocal interactions and decreased within groups while pair-specific patterns emerged. Call-type combinations of vocal interactions changed within pairs and were associated with successful egg-laying, highlighting a potential fitness relevance of calling dynamics in communication systems. PMID:26441403

  18. Sex-dependent effects of nutrition on telomere dynamics in zebra finches (Taeniopygia guttata).

    Science.gov (United States)

    Noguera, Jose C; Metcalfe, Neil B; Boner, Winnie; Monaghan, Pat

    2015-02-01

    At a cellular level, oxidative stress is known to increase telomere attrition, and hence cellular senescence and risk of disease. It has been proposed that dietary micronutrients play an important role in telomere protection due to their antioxidant properties. We experimentally manipulated dietary micronutrients during early life in zebra finches (Taeniopygia guttata). We found no effects of micronutrient intake on telomere loss during chick growth. However, females given a diet high in micronutrients during sexual maturation showed reduced telomere loss; there was no such effect in males. These results suggest that micronutrients may influence rates of cellular senescence, but differences in micronutrient requirement and allocation strategies, probably linked to the development of sexual coloration, may underlie sex differences in response. PMID:25716087

  19. Quagga and zebra mussel risk via veliger transfer by overland hauled boats

    Directory of Open Access Journals (Sweden)

    Larry B. Dalton

    2013-04-01

    Full Text Available Invasive quagga and zebra mussels (Dreissena rostriformis bugensis and Dreissena polymorpha, respectively pose a great threat to USwaters. Recreational boats constitute a significant risk for spreading the organisms. Recreational boats circulate large amounts of raw waterwhen in use, and if not drained and dried correctly can transport many mussel larvae, called veligers. Veligers experience very high mortality rates; however, the number of potentially transported veligers can be a serious risk to non-infested bodies of water, especially if multiple boats are involved. The risk of veliger transport was calculated for Lake Mead and Lake Michigan using boat capacities for water circulation and specific veliger density data. Results illustrate the importance of draining, drying, and/or decontaminating recreational boats after use.

  20. First Report of Coccidiosis and Gizzard Erosion in a Zebra Finch (Taeniopygia guttata of Iran

    Directory of Open Access Journals (Sweden)

    Moini, M.

    2012-06-01

    Full Text Available Coccidiosis and gizzard erosion are rare conditions in cage bird. A male zebra finch was presented with a history of watery diarrhea, anorexia, ruffled feathers, weight loss, and lethargy and died finally. Gross necropsy revealed small areas of erosions and hemorrhages on the gizzard wall. The intestine was oedematous. The spleen appeared pale and small. The testes were asymmetric.Histologically, necrosis of mucosal layer with infiltration of inflammatory cells observed in cecum. Eimeria stages were detected in the enterocytes. In Gizzard, hemorrhage and ulceration of mucosal layer with infiltration of polymorphonuclear cells in to the underlying mucosa were seen. In hepatic tissue, mild focal necrosis with mononuclear cells infiltration was seen. The disease was diagnosed as coccidiosis and gizzard erosion.

  1. An experimental test of condition-dependent male and female mate choice in zebra finches.

    Science.gov (United States)

    Holveck, Marie-Jeanne; Geberzahn, Nicole; Riebel, Katharina

    2011-01-01

    In mating systems with social monogamy and obligatory bi-parental care, such as found in many songbird species, male and female fitness depends on the combined parental investment. Hence, both sexes should gain from choosing mates in high rather than low condition. However, theory also predicts that an individual's phenotypic quality can constrain choice, if low condition individuals cannot afford prolonged search efforts and/or face higher risk of rejection. In systems with mutual mate choice, the interaction between male and female condition should thus be a better predictor of choice than either factor in isolation. To address this prediction experimentally, we manipulated male and female condition and subsequently tested male and female mating preferences in zebra finches Taeniopygia guttata, a songbird species with mutual mate choice and obligatory bi-parental care. We experimentally altered phenotypic quality by manipulating the brood size in which the birds were reared. Patterns of association for high- or low-condition individuals of the opposite sex differed for male and female focal birds when tested in an 8-way choice arena. Females showed repeatable condition-assortative preferences for males matching their own rearing background. Male preferences were also repeatable, but not predicted by their own or females' rearing background. In combination with a brief review of the literature on condition-dependent mate choice in the zebra finch we discuss whether the observed sex differences and between-studies differences arise because males and females differ in context sensitivity (e.g. male-male competition suppressing male mating preferences), sampling strategies or susceptibility to rearing conditions (e.g. sex-specific effect on physiology). While a picture emerges that juvenile and current state indeed affect preferences, the development and context-dependency of mutual state-dependent mate choice warrants further study. PMID:21901147

  2. An experimental test of condition-dependent male and female mate choice in zebra finches.

    Directory of Open Access Journals (Sweden)

    Marie-Jeanne Holveck

    Full Text Available In mating systems with social monogamy and obligatory bi-parental care, such as found in many songbird species, male and female fitness depends on the combined parental investment. Hence, both sexes should gain from choosing mates in high rather than low condition. However, theory also predicts that an individual's phenotypic quality can constrain choice, if low condition individuals cannot afford prolonged search efforts and/or face higher risk of rejection. In systems with mutual mate choice, the interaction between male and female condition should thus be a better predictor of choice than either factor in isolation. To address this prediction experimentally, we manipulated male and female condition and subsequently tested male and female mating preferences in zebra finches Taeniopygia guttata, a songbird species with mutual mate choice and obligatory bi-parental care. We experimentally altered phenotypic quality by manipulating the brood size in which the birds were reared. Patterns of association for high- or low-condition individuals of the opposite sex differed for male and female focal birds when tested in an 8-way choice arena. Females showed repeatable condition-assortative preferences for males matching their own rearing background. Male preferences were also repeatable, but not predicted by their own or females' rearing background. In combination with a brief review of the literature on condition-dependent mate choice in the zebra finch we discuss whether the observed sex differences and between-studies differences arise because males and females differ in context sensitivity (e.g. male-male competition suppressing male mating preferences, sampling strategies or susceptibility to rearing conditions (e.g. sex-specific effect on physiology. While a picture emerges that juvenile and current state indeed affect preferences, the development and context-dependency of mutual state-dependent mate choice warrants further study.

  3. Sex-Specific Audience Effect in the Context of Mate Choice in Zebra Finches.

    Science.gov (United States)

    Kniel, Nina; Bender, Stefanie; Witte, Klaudia

    2016-01-01

    Animals observing conspecifics during mate choice can gain additional information about potential mates. However, the presence of an observer, if detected by the observed individuals, can influence the nature of the behavior of the observed individuals, called audience effect. In zebra finches (Taeniopygia guttata castanotis), domesticated males show an audience effect during mate choice. However, whether male and female descendants of the wild form show an audience effect during mate choice is unknown. Therefore, we conducted an experiment where male and female focal birds could choose between two distinctive phenotypes of the opposite sex, an artificially adorned stimulus bird with a red feather on the forehead and an unadorned stimulus bird, two times consecutively, once without an audience and once with an audience bird (same sex as test bird). Males showed an audience effect when an audience male was present and spent more time with adorned and less time with unadorned females compared to when there was no audience present. The change in time spent with the respective stimulus females was positively correlated with the time that the audience male spent in front of its cage close to the focal male. Females showed no change in mate choice when an audience female was present, but their motivation to associate with both stimulus males decreased. In a control for mate-choice consistency there was no audience in either test. Here, both focal females and focal males chose consistently without a change in choosing motivation. Our results showed that there is an audience effect on mate choice in zebra finches and that the response to a same-sex audience was sex-specific. PMID:26839957

  4. Carotenos e provitamina A em bertalha e ervas aromáticas comercializadas em Viçosa, Estado de Minas Gerais, durante as quatro estações do ano = Carotenes and provitamin A in basella and aromatic herbs marketed in Viçosa, Minas Gerais State, during the four seasons of the year

    OpenAIRE

    Marina Andrade Batista; Helena Maria Pinheiro-Sant’Ana; José Benício Paes Chaves; Flávia Aparecida Moraes

    2006-01-01

    Este estudo teve como objetivos investigar o teor de a-caroteno, b-caroteno e calcular o valor de vitamina A em hortaliças comercializadas no mercado formal e informal de Viçosa, Estado de Minas Gerais, bem como avaliar a influência das quatro estações doano e do local de comercialização sobre o conteúdo desses nutrientes. As hortaliças (bertalha, cebolinha, coentro, manjericão e salsa) foram analisadas utilizando-se a cromatografia líquida de alta eficiência (CLAE). Devido ao conteúdo inexpr...

  5. Securitized commodities for the retail invesor : A discussion of exchange-traded funds and notes with quantitative analyses of commodity ETNs/ETFs on NYSE Arca.

    OpenAIRE

    Ådne, Jacobsen

    2011-01-01

    A discussion of exchange-traded funds and notes with quantitative analyses of commodity ETNs/ETFs on NYSE Arca. The unleveraged, non-inverse commodity ETP trackers analyzed in the thesis generally have low tracking errors. There are some exception in the case of the ETFs United States Oil Fund (OIL) and United States Natural Gas Fund (UNG) which not have been reliably trackers for parts of the research period, at least not when front month futures spot prices are utilized as their respective ...

  6. The Effects of Zebra Mussels (Dreissena polymorpha) on the Foraging Success of Eurasian Perch (Perca fluviatilis) and Ruffe (Gymnocephalus cernuus)

    Science.gov (United States)

    Dieterich, Axel; Mörtl, Martin; Eckmann, Reiner

    2004-07-01

    Complex habitat structures can influence the foraging success of fish. Competition for food between fish species can therefore depend on the competitors' abilities to cope with structural complexity. In laboratory experiments, we comparatively assessed effects of zebra mussels (Dreissena polymorpha Pall.) on the foraging success of Eurasian perch (Perca fluviatilis L.) and ruffe (Gymnocephalus cernuus (L.)). In single-species and mixed-species experiments, the fish were fed caddisfly larvae (Tinodes waeneri (L.)) over complex (mussel-covered stones) and less-complex (bare stones) substrates. With intraspecific competition, food consumption by perch and ruffe decreased significantly when the complex substrate was used. With interspecific competition, food consumption by perch and ruffe did not change with substrate complexity, but perch clearly out-competed ruffe on both substrates. Zebra mussel beds provide a refuge for macrozoobenthos against predation by ruffe and probably also by perch. (

  7. Genotoxic effects induced by the exposure to an environmental mixture of illicit drugs to the zebra mussel.

    Science.gov (United States)

    Parolini, Marco; Magni, Stefano; Castiglioni, Sara; Binelli, Andrea

    2016-10-01

    Despite the growing interest on the presence of illicit drugs in freshwater ecosystems, just recently the attention has been focused on their potential toxicity towards non-target aquatic species. However, these studies largely neglected the effects induced by exposure to complex mixtures of illicit drugs, which could be different compared to those caused by single psychoactive molecules. This study was aimed at investigating the genetic damage induced by a 14-day exposure to a realistic mixture of the most common illicit drugs found in surface waters worldwide (cocaine, benzoylecgonine, amphetamine, morphine and 3,4-methylenedioxymethamphetamine) on the zebra mussel (Dreissena polymorpha). The mixture caused a significant increase of DNA fragmentation and triggered the apoptotic process and micronuclei formation in zebra mussel hemocytes, pointing out its potential genotoxicity towards this bivalve species. PMID:27261879

  8. Zebra mussels (Dreissena polymorpha) limit food for larval fish (Pimephales promelas) in turbulent systems: A bioenergetics analysis

    Science.gov (United States)

    Bartsch, L.A.; Richardson, W.B.; Sandheinrich, M.B.

    2003-01-01

    We conducted a factorial experiment, in outdoor mesocosms, on the effects of zebra mussels and water column mixing (i.e., turbulence) on the diet, growth, and survival of larval fathead minnows (Pimephales promelas). Significant (P bioenergetics modeling and measured prey standing stocks indicated caloric resources of suitable prey in turbulence treatments during the early weeks of the experiment were insufficient to prevent starvation. Early mortality in the turbulence and mussels treatment likely released surviving fish from intense intraspecific competition and resulted in higher individual growth rates. A combination of high abundance of zebra mussels in an environment with a well-mixed water column can have significant effects on larval fish survival and growth.

  9. Determinação de mercúrio em águas sanitárias comercializadas em região do sudeste do Brasil Determination of mercury content in bleaches sold in southeastern Brazil

    Directory of Open Access Journals (Sweden)

    Odair Zenebon

    1994-04-01

    Full Text Available Para determinação de mercúrio presente como contaminante nas águas sanitárias usadas para desinfecção de água e alimentos, foi proposto um tratamento de amostra com ácido clorídrico para eliminação do cloro. A técnica de espectrofotometria de absorção atômica com gerador de vapor utilizada para quantificação do mercúrio apresentou uma recuperação de 103%. Foram analisadas 69 amostras de águas sanitárias de 35 diferentes marcas, comercializadas no Estado de São Paulo. Os valores obtidos para a mediana e nonagésimo percentil foram respectivamente: 15 e 67 ug/L. Pelas concentrações de mercúrio encontradas nas águas sanitárias, verificou-se que, usando as quantidades recomendadas para descontaminar água, frutas e hortaliças, o mercúrio residual não apresenta riscos à saúde, situando-se dentro dos valores estabelecidos pela legislação em vigor.In order to determine the mercury content present as a contaminant in samples of bleach used in water and food disinfection, a method for sample treatment using chloridric acid to eliminate the chlorine was proposed. The technique of cold vapour atomic absorption spectrophotometry, used to quantify the mercury, showed a recovery of 103%. Sixty nine samples of bleach were analysed and the values found for the median and 90th percentil were respectively, 15 and 67 mg/L. According to the values of residual mercury found and using the quantities of bleach recommended by the Brazilian Sanitary Authorities, the use of these disinfectants offers no risk to human health.

  10. Estudo da ocorrência de enteroparasitas em hortaliças comercializadas na região metropolitana de São Paulo, SP, Brasil: I - Pesquisa de helmintos

    Directory of Open Access Journals (Sweden)

    Oliveira Carlos Augusto Fernandes de

    1992-01-01

    Full Text Available Hortaliças in natura, comercializadas na região metropolitana de São Paulo, SP (Brasil, foram analisadas através de metodologia própria, visando à pesquisa e à identificação de formas de transmissão de helmintos intestinais de interesse médico. As hortaliças examinadas, constituídas de 50 amostras de cada variedade, foram de: alface (Lactuca sativa, variedades lisa e crespa, escarola (Chichorium sp e agrião (Nasturtium officinale. Os resultados evidenciaram elevados percentuais de contaminação em todas as variedades analisadas, porém, as freqüências de helmintos foram maiores no agrião. A escarola apresentou valores médios, geralmente situados entre as alfaces e o agrião. Os números médios de ovos e larvas por 100 gramas de amostra, embora elevados, não apresentaram diferenças estatisticamente significantes entre as quatro variedades de hortaliças estudadas. Uma grande variedade de helmintos, de ocorrência freqüente na população residente na Região Metropolitana de São Paulo, foi observada nas amostras. Os mais freqüentes, no entanto, foram: ancilostomídeos e Ascaris sp. Recuperaram-se também ovos de Toxocara sp, Fasciola sp e de tricostrongilídeos, comprovando a ocorrência de contaminação das hortaliças por fezes de animais domésticos. Considerando-se os resultados obtidos, ressalta-se a importância das hortaliças na transmissão de helmintíases intestinais, bem como a necessidade de medidas que propiciem uma melhoria na qualidade higiênico-sanitária destes alimentos.

  11. Ocorrência e diferenciação de espécies de Listeria spp. em salsichas tipo hot dog a granel e em amostras de carne moída bovina comercializadas no Distrito Federal

    Directory of Open Access Journals (Sweden)

    Rafael Rocha de Andrade

    2014-01-01

    Full Text Available Listeria monocytogenes é um patógeno relevante veiculado por alimentos. Sua identificação precisa é importante para a correta determinação do risco associado à ingestão do alimento. O objetivo deste trabalho foi verificar a ocorrência das espécies de Listeria spp. em amostras de salsichas tipo hot dog e carne moída bovina, comercializadas a granel no Distrito Federal. Foram analisadas 162 amostras, sendo 127 de salsichas tipo hot dog e 35 amostras de carne moída bovina. O isolamento e a identificação do gênero foram feitos por metodologia convencional e a distinção das espécies foi verificada por kit bioquímico específico (API-Listeria® e por análise de restrição de fragmentos da reação em cadeia da polimerase (RFLP-PCR do gene 23 rRNA. Foram isoladas 26 cepas de Listeria spp. das amostras de salsichas tipo hot dog, sendo identificadas 18 cepas de Listeria innocua e 08 cepas de Listeria monocytogenes. Das 35 amostras de carne moída bovina, foram isoladas 16 cepas de Listeria spp., sendo identificadas 12 cepas de Listeria innocua e 04 de Listeria monocytogenes. Houve concordância total na distinção das espécies de Listeria spp. através dos dois métodos empregados. A presença de Listeria spp. em amostras de salsicha do tipo hot dog a granel e em carne moída bovina a granel, de estabelecimentos comerciais do Distrito Federal, representa risco à saúde do consumidor.

  12. Environmental transmission of a personality trait: foster parent exploration behaviour predicts offspring exploration behaviour in zebra finches

    OpenAIRE

    Schuett, Wiebke; Dall, Sasha R X; Wilson, Alastair J.; Royle, Nick J.

    2013-01-01

    Consistent behavioural differences among individuals are common in many species and can have important effects on offspring fitness. To understand such ‘personality’ variation, it is important to determine the mode of inheritance, but this has been quantified for only a few species. Here, we report results from a breeding experiment in captive zebra finches, Taeniopygia guttata, in which we cross-fostered offspring to disentangle the importance of genetic and non-genetic transmission of behav...

  13. Housing conditions and sacrifice protocol affect neural activity and vocal behavior in a songbird species, the zebra finch (Taeniopygia guttata).

    Science.gov (United States)

    Elie, Julie Estelle; Soula, Hédi Antoine; Trouvé, Colette; Mathevon, Nicolas; Vignal, Clémentine

    2015-12-01

    Individual cages represent a widely used housing condition in laboratories. This isolation represents an impoverished physical and social environment in gregarious animals. It prevents animals from socializing, even when auditory and visual contact is maintained. Zebra finches are colonial songbirds that are widely used as laboratory animals for the study of vocal communication from brain to behavior. In this study, we investigated the effect of single housing on the vocal behavior and the brain activity of male zebra finches (Taeniopygia guttata): male birds housed in individual cages were compared to freely interacting male birds housed as a social group in a communal cage. We focused on the activity of septo-hypothalamic regions of the "social behavior network" (SBN), a set of limbic regions involved in several social behaviors in vertebrates. The activity of four structures of the SBN (BSTm, medial bed nucleus of the stria terminalis; POM, medial preoptic area; lateral septum; ventromedial hypothalamus) and one associated region (paraventricular nucleus of the hypothalamus) was assessed using immunoreactive nuclei density of the immediate early gene Zenk (egr-1). We further assessed the identity of active cell populations by labeling vasotocin (VT). Brain activity was related to behavioral activities of birds like physical and vocal interactions. We showed that individual housing modifies vocal exchanges between birds compared to communal housing. This is of particular importance in the zebra finch, a model species for the study of vocal communication. In addition, a protocol that daily removes one or two birds from the group affects differently male zebra finches depending of their housing conditions: while communally-housed males changed their vocal output, brains of individually housed males show increased Zenk labeling in non-VT cells of the BSTm and enhanced correlation of Zenk-revealed activity between the studied structures. These results show that

  14. Comparing a microbial biocide and chlorine as zebra mussel control strategies in an Irish drinking water treatment plant

    Directory of Open Access Journals (Sweden)

    Sara Meehan

    2013-06-01

    Full Text Available A need exists for an environmentally friendly mussel control method to replace chlorine and other traditional control methods currentlyutilised in drinking water plants and other infested facilities. Zequanox® is a newly commercialised microbial biocide for zebra and quaggamussels comprised of killed Pseudomonas fluorescens CL145A cells. The objective of this study was to compare the efficacy of adevelopmental formulation of Zequanox (referred to as MBI 401 FDP and chlorine treatments on adult and juvenile zebra mussels byrunning a biobox trial in conjunction with chlorine treatments at an infested Irish drinking water treatment plant. Since 2009, the plantmanagement has used a residual chlorine concentration of 2 mg/L in autumn to control both adult zebra mussels and juvenile settlement intheir three concrete raw water chambers. Juvenile mussel settlement was monitored in three bioboxes as well as in three treatment chambersin the plant for three months prior to treatment. Adult mussels were seeded into the chambers and bioboxes four days before treatment. InOctober 2011, the bioboxes were treated with MBI 401 FDP at 200 mg active substance/L, while chlorine treatment took place in the waterchambers. The MBI 401 FDP treatment lasted only 8 hours while chlorine treatment lasted seven days. Juvenile numbers were reduced tozero in both the bioboxes and treated chambers within seven days. Adult mussel mortality reached 80% for both the chlorine and MBI 401FDP treatment; however, mortality was achieved faster in the chlorine treatment. These results provided important insights into zebra musselcontrol alternatives to chlorine and supported further development of the now commercial product, Zequanox.

  15. The zebra mussel (Dreissena polymorpha), a new pest in North America: reproductive mechanisms as possible targets of control strategies

    Science.gov (United States)

    Ram, Jeffrey L.; Fong, Peter; Croll, Roger P.; Nichols, Susan J.; Wall, Darcie

    1992-01-01

    The zebra mussel (Dreissena polymorpha) has spread rapidly in temperate fresh waters of North America since its introduction into the Great Lakes in 1985 or 1986. It attaches to hard substrates, forming layers, occluding water intakes, encrusting and killing native mussels, filtering algae in competition with other planktivores, and possibly interfering with fish spawning. It reproduces prolifically, suggesting that an approach to its control may be by controlling its reproduction. Previous literature suggests that spawning in bivalves is regulated by both environmental and internal chemical cues. A suggested sequence is that phytoplankton chemicals initially trigger spawning; chemicals associated with gametes provide a species-specific pheromonal positive feedback for spawning; and the response to environmental chemicals is mediated internally by serotonin (5-HT). The role of 5-HT in zebra mussels is under investigation. Both males and females can be induced to spawn by either injection or external application of 5-HT. The response can also be activated by 8-hydroxy-2-(di-n-propylamino)-tetralin, an agonist at 5-HT1A receptors. HPLC analysis has detected 5-HT as the major biogenic amine in both male and female gonads. 5-HT immunocytochemistry demonstrates nerves containing serotonergic fibers innervating gonads of both males and females, with prominent varicosities surrounding the follicles in both sexes. A role of 5-HT in mediating spawning responses in zebra mussels is thus strongly supported. These studies have shown that reproductive behavior of zebra mussels can be modified by outside chemicals, a property that may be exploited for purposes of control.

  16. Simple sequence repeats in zebra finch (Taeniopygia guttata) expressed sequence tags: a new resource for evolutionary genetic studies of passerines

    OpenAIRE

    Birkhead Timothy R; Hale Matthew C; Slate Jon

    2007-01-01

    Abstract Background Passerines (perching birds) are widely studied across many biological disciplines including ecology, population biology, neurobiology, behavioural ecology and evolutionary biology. However, understanding the molecular basis of relevant traits is hampered by the paucity of passerine genomics tools. Efforts to address this problem are underway, and the zebra finch (Taeniopygia guttata) will be the first passerine to have its genome sequenced. Here we describe a bioinformatic...

  17. Molecular Cloning and Functional Characterization of Mannose Receptor in Zebra Fish (Danio rerio) during Infection with Aeromonas sobria.

    Science.gov (United States)

    Zheng, Feifei; Asim, Muhammad; Lan, Jiangfeng; Zhao, Lijuan; Wei, Shun; Chen, Nan; Liu, Xiaoling; Zhou, Yang; Lin, Li

    2015-01-01

    Mannose receptor (MR) is a member of pattern-recognition receptors (PRRs), which plays a significant role in immunity responses. Much work on MR has been done in mammals and birds while little in fish. In this report, a MR gene (designated as zfMR) was cloned from zebra fish (Danio rerio), which is an attractive model for the studies of animal diseases. The full-length cDNA of zfMR contains 6248 bp encoding a putative protein of 1428 amino acids. The predicted amino acid sequences showed that zfMR contained a cysteine-rich domain, a single fibronectin type II (FN II) domain, eight C-type lectin-like domains (CTLDs), a transmembrane domain and a short C-terminal cytoplasmic domain, sharing highly conserved structures with MRs from the other species. The MR mRNA could be detected in all examined tissues with highest level in kidney. The temporal expression patterns of MR, IL-1β and TNF-α mRNAs were analyzed in the liver, spleen, kidney and intestine post of infection with Aeromonas sobria. By immunohistochemistry assay, slight enhancement of MR protein was also observed in the spleen and intestine of the infected zebra fish. The established zebra fish-A. sobria infection model will be valuable for elucidating the role of MR in fish immune responses to infection. PMID:25988382

  18. Ecological impact assessment of sediment remediation in a metal-contaminated lowland river using translocated zebra mussels and resident macroinvertebrates

    International Nuclear Information System (INIS)

    The present study investigated to what extent accumulated metal levels in aquatic invertebrates can reflect environmental contamination and how these tissue levels can be related to alterations in macroinvertebrate communities in the dredged River Dommel. Metal accumulation was measured in translocated zebra mussels (Dreissena polymorpha) and resident Chironomidae. Furthermore, macroinvertebrate community composition was assessed. Our results indicated that trends of total metal concentrations in surface water of the Dommel in time are reflected well by metal levels in tissue of D. polymorpha. In contrast, sediment-bound metals were the most dominant exposure route for Chironomidae. Alterations in macroinvertebrate community composition were observed during dredging and significant relations between metal levels in invertebrate tissues and ecological responses were found. Our results demonstrated that metal accumulation in both zebra mussels and Chironomidae can be used as an integrated measure of metal bioavailability and to predict ecological effects of metal toxicity on macroinvertebrate communities. - Highlights: ► The use of tissue concentrations to assess environmental metal pollution was studied. ► Metal accumulation was measured in caged zebra mussels and resident Chironomidae. ► Shell condition of mussels and macroinvertebrate taxa distribution was assessed. ► Different accumulation between biota and relations with community level were found. ► Bioaccumulation is an integrated measure of metal toxicity in aquatic communities. - Metal accumulation in selected aquatic invertebrates can be used as an integrated measure of metal bioavailability and to predict ecological effects of metal toxicity.

  19. Bioavailability of particulate metal to zebra mussels: Biodynamic modelling shows that assimilation efficiencies are site-specific

    International Nuclear Information System (INIS)

    This study investigates the ability of the biodynamic model to predict the trophic bioaccumulation of cadmium (Cd), chromium (Cr), copper (Cu), nickel (Ni) and zinc (Zn) in a freshwater bivalve. Zebra mussels were transplanted to three sites along the Seine River (France) and collected monthly for 11 months. Measurements of the metal body burdens in mussels were compared with the predictions from the biodynamic model. The exchangeable fraction of metal particles did not account for the bioavailability of particulate metals, since it did not capture the differences between sites. The assimilation efficiency (AE) parameter is necessary to take into account biotic factors influencing particulate metal bioavailability. The biodynamic model, applied with AEs from the literature, overestimated the measured concentrations in zebra mussels, the extent of overestimation being site-specific. Therefore, an original methodology was proposed for in situ AE measurements for each site and metal. - Highlights: → Exchangeable fraction of metal particles did not account for the bioavailability of particulate metals. → Need for site-specific biodynamic parameters. → Field-determined AE provide a good fit between the biodynamic model predictions and bioaccumulation measurements. - The interpretation of metal bioaccumulation in transplanted zebra mussels with biodynamic modelling highlights the need for site-specific assimilation efficiencies of particulate metals.

  20. Molecular Cloning and Functional Characterization of Mannose Receptor in Zebra Fish (Danio rerio during Infection with Aeromonas sobria

    Directory of Open Access Journals (Sweden)

    Feifei Zheng

    2015-05-01

    Full Text Available Mannose receptor (MR is a member of pattern-recognition receptors (PRRs, which plays a significant role in immunity responses. Much work on MR has been done in mammals and birds while little in fish. In this report, a MR gene (designated as zfMR was cloned from zebra fish (Danio rerio, which is an attractive model for the studies of animal diseases. The full-length cDNA of zfMR contains 6248 bp encoding a putative protein of 1428 amino acids. The predicted amino acid sequences showed that zfMR contained a cysteine-rich domain, a single fibronectin type II (FN II domain, eight C-type lectin-like domains (CTLDs, a transmembrane domain and a short C-terminal cytoplasmic domain, sharing highly conserved structures with MRs from the other species. The MR mRNA could be detected in all examined tissues with highest level in kidney. The temporal expression patterns of MR, IL-1β and TNF-α mRNAs were analyzed in the liver, spleen, kidney and intestine post of infection with Aeromonas sobria. By immunohistochemistry assay, slight enhancement of MR protein was also observed in the spleen and intestine of the infected zebra fish. The established zebra fish-A. sobria infection model will be valuable for elucidating the role of MR in fish immune responses to infection.

  1. Assessment of Toxoplasma gondii levels in zebra mussel (Dreissena polymorpha) by real-time PCR: an organotropism study.

    Science.gov (United States)

    Palos Ladeiro, M; Bigot-Clivot, A; Aubert, D; Villena, I; Geffard, A

    2015-09-01

    Water quality is a public health concern that calls for relevant biomonitoring programs. Molecular tools such as polymerase chain reaction (PCR) are progressively becoming more sensitive and more specific than conventional techniques to detect pathogens in environmental samples such as water and organisms. The zebra mussel (Dreissena polymorpha) has already been demonstrated to accumulate and concentrate various human waterborne pathogens. In this study, first, a spiking experiment to evaluate detection levels of Toxoplasma gondii DNA in zebra mussel organs using real-time PCR was conducted. Overall, lower DNA levels in the hemolymph, digestive gland, and remaining tissues (gonad and foot) were detected compared to mantle, muscle, and gills. Second, an in vivo experiment with 1000 T. gondii oocysts per mussel and per day for 21 consecutive days, followed by 14 days of depuration time in protozoa-free water was performed. T. gondii DNA was detected in all organs, but greatest concentrations were observed in hemolymph and mantle tissues compared to the others organs at the end of the depuration period. These results suggest that (i) the zebra mussel is a potential new tool for measuring T. gondii concentrations and (ii) real-time PCR is a suitable method for pathogen detection in complex matrices such as tissues. PMID:25772876

  2. Within-year differences in reproductive investment in laboratory zebra finches ( Taeniopygia guttata), an opportunistically breeding bird

    Science.gov (United States)

    Williamson, Kathryn; Gilbert, Lucy; Rutstein, Alison N.; Pariser, Emma C.; Graves, Jeff A.

    2008-12-01

    Reproduction in opportunistically breeding bird species has traditionally been considered non-seasonal with individuals taking advantage of favourable environmental conditions as they arise. However, some studies imply that this opportunistic breeding may be superimposed on an underlying seasonality, which has effects on the readiness to breed when conditions are favourable. The zebra finch ( Taeniopygia guttata) is the classic opportunistic breeder and widely used as such in studies. In a series of laboratory-based breeding experiments, we found evidence to suggest that there are seasonal differences in maternal reproductive investment in the zebra finch even when photoperiod, temperature, relative humidity and diet were held constant. Females showed highly significant seasonal differences in clutch size and egg mass with laying order. Clutch size showed a spring/summer peak typical of multi-brooded species in the wild. There was also a significant increase in egg mass with laying order in all seasons except winter. This variation in breeding parameters with season may allow females to adjust investment depending on the potential fitness returns from a given reproductive attempt. These findings also raise a warning about interpreting results of multiple zebra finch breeding experiments that have been carried out in different seasons.

  3. Bioavailability of particulate metal to zebra mussels: Biodynamic modelling shows that assimilation efficiencies are site-specific

    Energy Technology Data Exchange (ETDEWEB)

    Bourgeault, Adeline, E-mail: bourgeault@ensil.unilim.fr [Cemagref, Unite de Recherche Hydrosystemes et Bioprocedes, 1 rue Pierre-Gilles de Gennes, 92761 Antony (France); FIRE, FR-3020, 4 place Jussieu, 75005 Paris (France); Gourlay-France, Catherine, E-mail: catherine.gourlay@cemagref.fr [Cemagref, Unite de Recherche Hydrosystemes et Bioprocedes, 1 rue Pierre-Gilles de Gennes, 92761 Antony (France); FIRE, FR-3020, 4 place Jussieu, 75005 Paris (France); Priadi, Cindy, E-mail: cindy.priadi@eng.ui.ac.id [LSCE/IPSL CEA-CNRS-UVSQ, Avenue de la Terrasse, 91198 Gif-sur-Yvette (France); Ayrault, Sophie, E-mail: Sophie.Ayrault@lsce.ipsl.fr [LSCE/IPSL CEA-CNRS-UVSQ, Avenue de la Terrasse, 91198 Gif-sur-Yvette (France); Tusseau-Vuillemin, Marie-Helene, E-mail: Marie-helene.tusseau@ifremer.fr [IFREMER Technopolis 40, 155 rue Jean-Jacques Rousseau, 92138 Issy-Les-Moulineaux (France)

    2011-12-15

    This study investigates the ability of the biodynamic model to predict the trophic bioaccumulation of cadmium (Cd), chromium (Cr), copper (Cu), nickel (Ni) and zinc (Zn) in a freshwater bivalve. Zebra mussels were transplanted to three sites along the Seine River (France) and collected monthly for 11 months. Measurements of the metal body burdens in mussels were compared with the predictions from the biodynamic model. The exchangeable fraction of metal particles did not account for the bioavailability of particulate metals, since it did not capture the differences between sites. The assimilation efficiency (AE) parameter is necessary to take into account biotic factors influencing particulate metal bioavailability. The biodynamic model, applied with AEs from the literature, overestimated the measured concentrations in zebra mussels, the extent of overestimation being site-specific. Therefore, an original methodology was proposed for in situ AE measurements for each site and metal. - Highlights: > Exchangeable fraction of metal particles did not account for the bioavailability of particulate metals. > Need for site-specific biodynamic parameters. > Field-determined AE provide a good fit between the biodynamic model predictions and bioaccumulation measurements. - The interpretation of metal bioaccumulation in transplanted zebra mussels with biodynamic modelling highlights the need for site-specific assimilation efficiencies of particulate metals.

  4. DNA adduct measurements in zebra mussels, Dreissena polymorpha, Pallas. Potential use for genotoxicant biomonitoring of fresh water ecosystems.

    Science.gov (United States)

    Le Goff, J; Gallois, J; Pelhuet, L; Devier, M H; Budzinski, H; Pottier, D; André, V; Cachot, J

    2006-08-12

    The purpose of this study was to examine PAH accumulation and bulky DNA adduct formation in the digestive gland of zebra mussels exposed in their habitat or in controlled laboratory conditions to complex mixture of PAH. DNA adducts were measured using a 32P-postlabelling protocol with nuclease P1 enrichment adapted from Reddy and Randerath [Reddy, M.V., Randerath, K., 1986. Nuclease P1-mediated enhancement of sensitivity of 32P-postlabelling test for structurally diverse DNA adducts. Carcinogenesis 7, 1543-1551]. Specimens collected in the upper part of the Seine estuary were shown to accumulate higher levels of PAH (up to 1.6 microg g(-1) dry weight) in comparison to individuals from the reference site (0.053 microg g(-1) dry weight). The former exhibited elevated levels of DNA adducts (up to 4.0/10(8) nucleotides) and higher diversity of individual adducts with five distinct spots being specifically detected in individuals originating from the Seine estuary. Zebra mussels exposed for 5 days to 0.01% (v/v) of organic extract of sediment from the Seine estuary were shown to accumulate high amounts of PAH (up to 138 microg g(-1) dry weight) but exhibited relatively low levels of DNA adducts. Exposure to benzo[a]pyrene led to a dose-dependent accumulation of B[a]P (up to 7063 microg g(-1) dry weight) and a clear induction of DNA adduct formation in the digestive gland of mussels (up to 1.13/10(8) nucleotides). Comparisons with other bivalves exposed to the same model PAH, revealed similar levels of adducts and comparable adduct profiles with a main adduct spot and a second faint one. This study clearly demonstrated that zebra mussels are able to biotransform B[a]P and probably other PAH into reactive metabolites with DNA-binding activity. This work also demonstrated the applicability of the nuclease P1 enhanced 32P-postlabelling method for bulky adduct detection in the digestive gland of zebra mussels. DNA adduct measurement in zebra mussels could be a suitable

  5. Urban speleology applied to groundwater and geo-engineering studies: underground topographic surveying of the ancient Arca D’Água galleries catchworks (Porto, NW Portugal

    Directory of Open Access Journals (Sweden)

    Fontes G.

    2010-01-01

    Full Text Available The Porto settlement (Northwest Portugal, Iberian Peninsula was originally built in the twelfth century and has been developed on granitic hill slopes of the Douro riverside, being one of the oldest cities in Europe. In the urban area of Porto, the second most important city of the Portuguese mainland, there is a population of about 216,000 inhabitants. This study highlights the importance of urban speleological mapping applied to groundwater and geo-engineering studies. All the water that flows from the so-called Paranhos or Arca D’Água springs is captured by catchwork galleries and their utilization date back around 1120 AD. Paranhos spring galleries catchworks (c. 3,3 km extension and a -21m below ground level was one of the main water supplies to Porto City for more than six centuries and, nowadays, these waters are still appropriate for irrigation uses. Topographic, geological, geophysical and hydrogeological data were collected and interpreted, allowing the definition of a hydrogeotechnical zoning. All these features were mapped and overlaid using GIS mapping techniques. This multidisciplinary approach offers a good potential for reliable urban speleological and geo-engineering studies of Arca D’Água site.

  6. Long-term effects of manipulated natal brood size on metabolic rate in zebra finches.

    Science.gov (United States)

    Verhulst, Simon; Holveck, Marie-Jeanne; Riebel, Katharina

    2006-09-22

    Long-term effects of developmental conditions on health, longevity and other fitness components in humans are drawing increasing attention. In evolutionary ecology, such effects are of similar importance because of their role in the trade-off between quantity and quality of offspring. The central role of energy consumption is well documented for some long-term health effects in humans (e.g. obesity), but little is known of the long-term effects of rearing conditions on energy requirements later in life. We manipulated the rearing conditions in zebra finches (Taeniopygia guttata) using brood size manipulation and cross-fostering. It has previously been shown in this species that being reared in a large brood has negative fitness consequences, and that such effects are stronger in daughters than in sons. We show that, independent of mass, standard metabolic rate of 1-year-old birds was higher when they had been reared in a large brood, and this is to our knowledge the first demonstration of such an effect. Furthermore, the brood size effect was stronger in daughters than in sons. This suggests that metabolic efficiency may play a role in mediating the long-term fitness consequences of rearing conditions. PMID:17148435

  7. EFFECTS OF ORGANOPHOSPHATES ON ACUTE POISONING AND ACETYL CHOLINESTERASE INHIBITION IN ZEBRA FISH

    Directory of Open Access Journals (Sweden)

    TH Sukirtha* MV Usharani

    2013-03-01

    Full Text Available Organophosphates (Ops. are the most widely used insecticides available today. These are a group of insecticides used in chemical sprays to kill bugs, and insects in orchards, vineyards, vegetables and cereal crops. The present study examined effects of the pesticide Methyl parathion, Dichlorvos and Chlorpyrifos on adult zebra fish were exposed to various concentrations (5, 10 & 25mg/L for 24 and 48hrs acute toxic study. Chlorpyrifos showed mortality in all concentrations and Methyl parathion and Dichlorvos showed the same in 25 mg/L. LC 50 value for Methyl parathion and Dichlorvos was 5 & 10 mg/L respectively. The total protein, LPO content was increased except SOD, Catalase in the brain tissue of the treated fishes.  There was no significant decrease in the GPX activity at 5ppm test groups. The GPX activity decreased significantly in test group treated with 10ppm and a significant difference was found between 5ppm and 10ppm test groups. The histopathological studies of brain tissue showed that neuronal degeneration and tissue damages in the brain of treated fishes when compared with the control. Ops. produce toxicity by inhibiting the cholinesterase enzymes in the nervous system. Monitoring of acetyl cholinesterase (AChE inhibition has been widely used in terrestrial and freshwater aquatic systems as an indicator of OP exposure and effects.

  8. Research regarding the influence of royal jelly on sex reversal in zebra fishes (Danio rerio

    Directory of Open Access Journals (Sweden)

    Silvia Pătruică

    2010-11-01

    Full Text Available In this study we observed the influence of royal jelly on sex reversal in zebra fishes (Daniorerio. Experiments were made in the laboratories of aquaculture from Faculty of Animal Science andBiotechnologies, Timișoara in the period 01.03.2010 – 15.05.2010 on 225 individuals. The dinamics ofstandard body weight, the standard length and the maximum body high at all individuals from treeexperimental variants were evaluated. It was indentified the number of males and females by directexamination of the body and microscopic observation of histological samples. In the first experimentalvariant the food was mixed with 0.02 g powdered royal jelly and recorded at the end of the experiment70.76% females and 29.24% males. In the second experimental variant, a double dose of powderedroyal jelly was mixed in the feed, this leading to the increasing of females in the group to 81,19%. Inthe control variant the percentage of females was 50.7% and the percentage of males was 49.3%.

  9. ZebraBeat: a flexible platform for the analysis of the cardiac rate in zebrafish embryos

    Science.gov (United States)

    de Luca, Elisa; Zaccaria, Gian Maria; Hadhoud, Marwa; Rizzo, Giovanna; Ponzini, Raffaele; Morbiducci, Umberto; Santoro, Massimo Mattia

    2014-05-01

    Heartbeat measurement is important in assesssing cardiac function because variations in heart rhythm can be the cause as well as an effect of hidden pathological heart conditions. Zebrafish (Danio rerio) has emerged as one of the most useful model organisms for cardiac research. Indeed, the zebrafish heart is easily accessible for optical analyses without conducting invasive procedures and shows anatomical similarity to the human heart. In this study, we present a non-invasive, simple, cost-effective process to quantify the heartbeat in embryonic zebrafish. To achieve reproducibility, high throughput and flexibility (i.e., adaptability to any existing confocal microscope system and with a user-friendly interface that can be easily used by researchers), we implemented this method within a software program. We show here that this platform, called ZebraBeat, can successfully detect heart rate variations in embryonic zebrafish at various developmental stages, and it can record cardiac rate fluctuations induced by factors such as temperature and genetic- and chemical-induced alterations. Applications of this methodology may include the screening of chemical libraries affecting heart rhythm and the identification of heart rhythm variations in mutants from large-scale forward genetic screens.

  10. Metabolic and respiratory costs of increasing song amplitude in zebra finches.

    Directory of Open Access Journals (Sweden)

    Sue Anne Zollinger

    Full Text Available Bird song is a widely used model in the study of animal communication and sexual selection, and several song features have been shown to reflect the quality of the singer. Recent studies have demonstrated that song amplitude may be an honest signal of current condition in males and that females prefer high amplitude songs. In addition, birds raise the amplitude of their songs to communicate in noisy environments. Although it is generally assumed that louder song should be more costly to produce, there has been little empirical evidence to support this assumption. We tested the assumption by measuring oxygen consumption and respiratory patterns in adult male zebra finches (Taeniopygia guttata singing at different amplitudes in different background noise conditions. As background noise levels increased, birds significantly increased the sound pressure level of their songs. We found that louder songs required significantly greater subsyringeal air sac pressure than quieter songs. Though increased pressure is probably achieved by increasing respiratory muscle activity, these increases did not correlate with measurable increases in oxygen consumption. In addition, we found that oxygen consumption increased in higher background noise, independent of singing behaviour. This observation supports previous research in mammals showing that high levels of environmental noise can induce physiological stress responses. While our study did not find that increasing vocal amplitude increased metabolic costs, further research is needed to determine whether there are other non-metabolic costs of singing louder or costs associated with chronic noise exposure.

  11. EVALUATION OF BIOTIC AND TREATMENT FACTORS RELATING TO BACTERIAL CONTROL OF ZEBRA MUSSELS

    International Nuclear Information System (INIS)

    Testing over the last quarter has indicated the following regarding control of zebra mussels with bacterium Pseudomonas fluorescens strain CL0145A: (1) the concentration of bacteria suspended in water is directly correlated with mussel kill; (2) the ratio of bacterial mass per mussel, if too low, could limit mussel kill; a treatment must be done at a high enough ratio so that mussels do not deplete all the suspended bacteria before the end of the desired exposure period; (3) bacteria appear to lose almost all their toxicity after suspension for 24 hr in highly oxygenated water; (4) in a recirculating pipe system, the same percentage mussel kill will be achieved irrespective of whether all the bacteria are applied at once or divided up and applied intermittently in smaller quantities over a 10-hr period. Since this is the fourth quarterly report, a summation of all test results over the last twelve months is provided as a table in this report. The table includes the above-mentioned fourth-quarter results

  12. Frequency Dependence of Polarization of Zebra Pattern in Type-IV Solar Radio Bursts

    CERN Document Server

    Kaneda, Kazutaka; Iwai, Kazumasa; Tsuchiya, Fuminori; Obara, Takahiro

    2015-01-01

    We investigated the polarization characteristics of a zebra pattern (ZP) in a type-IV solar radio burst observed with AMATERAS on 2011 June 21 for the purpose of evaluating the generation processes of ZP. Analyzing highly resolved spectral and polarization data revealed the frequency dependence of the degree of circular polarization and the delay between two polarized components for the first time. The degree of circular polarization was 50-70 percent right-handed and it varied little as a function of frequency. Cross-correlation analysis determined that the left-handed circularly polarized component was delayed by 50-70 ms relative to the right-handed component over the entire frequency range of the ZP and this delay increased with the frequency. We examined the obtained polarization characteristics by using pre-existing ZP models and concluded that the ZP was generated by the double plasma resonance process. Our results suggest that the ZP emission was originally generated in a completely polarized state in...

  13. Active immunization against vasoactive intestinal polypeptide decreases neuronal recruitment and inhibits reproduction in zebra finches.

    Science.gov (United States)

    Vistoropsky, Yulia; Heiblum, Rachel; Smorodinsky, Nechama-Ina; Barnea, Anat

    2016-08-15

    Neurogenesis and neuronal recruitment occur in adult brains of many vertebrates, and the hypothesis is that these phenomena contribute to the brain plasticity that enables organisms to adjust to environmental changes. In mammals, vasoactive intestinal polypeptide (VIP) is known to have many neuroprotective properties, but in the avian brain, although widely distributed, its role in neuronal recruitment is not yet understood. In the present study we actively immunized adult zebra finches against VIP conjugated to KLH and compared neuronal recruitment in their brains, with brains of control birds, which were immunized against KLH. We looked at two forebrain regions: the nidopallium caudale (NC), which plays a role in vocal communication, and the hippocampus (HC), which is involved in the processing of spatial information. Our data demonstrate that active immunization against VIP reduces neuronal recruitment, inhibits reproduction, and induces molting, with no change in plasma prolactin levels. Thus, our observations suggest that VIP has a direct positive role in neuronal recruitment and reproduction in birds. J. Comp. Neurol. 524:2516-2528, 2016. © 2016 Wiley Periodicals, Inc. PMID:26801210

  14. Inner-shell radiation from wire array implosions on the Zebra generator

    Energy Technology Data Exchange (ETDEWEB)

    Ouart, N. D.; Giuliani, J. L.; Dasgupta, A. [Plasma Physics Division, Naval Research Laboratory, Washington, District of Columbia 20375 (United States); Safronova, A. S.; Kantsyrev, V. L.; Esaulov, A. A.; Shrestha, I.; Weller, M. E.; Shlyaptseva, V.; Osborne, G. C.; Stafford, A.; Keim, S. [Physics Department, University of Nevada, Reno, Nevada 89557 (United States); Apruzese, J. P. [Consultant to NRL through Engility Corp., Chantilly, Virginia 20151 (United States); Clark, R. W. [Berkeley Research Associates, Beltsville, Maryland 20705 (United States)

    2014-03-15

    Implosions of brass wire arrays on Zebra have produced L-shell radiation as well as inner-shell Kα and Kβ transitions. The L-shell radiation comes from ionization stages around the Ne-like charge state that is largely populated by a thermal electron energy distribution function, while the K-shell photons are a result of high-energy electrons ionizing or exciting an inner-shell (1s) electron from ionization stages around Ne-like. The K- and L-shell radiations were captured using two time-gated and two axially resolved time-integrated spectrometers. The electron beam was measured using a Faraday cup. A multi-zone non-local thermodynamic equilibrium pinch model with radiation transport is used to model the x-ray emission from experiments for the purpose of obtaining plasma conditions. These plasma conditions are used to discuss some properties of the electron beam generated by runaway electrons. A simple model for runaway electrons is examined to produce the Kα radiation, but it is found to be insufficient.

  15. Inbreeding depression of sperm traits in the zebra finch Taeniopygia guttata.

    Science.gov (United States)

    Opatová, Pavlína; Ihle, Malika; Albrechtová, Jana; Tomášek, Oldřich; Kempenaers, Bart; Forstmeier, Wolfgang; Albrecht, Tomáš

    2016-01-01

    Inbreeding depression, or the reduction in fitness due to mating between close relatives, is a key issue in biology today. Inbreeding negatively affects many fitness-related traits, including survival and reproductive success. Despite this, very few studies have quantified the effects of inbreeding on vertebrate gamete traits under controlled breeding conditions using a full-sib mating approach. Here, we provide comprehensive evidence for the negative effect of inbreeding on sperm traits in a bird, the zebra finch Taeniopygia guttata. We compared sperm characteristics of both inbred (pedigree F = 0.25) and outbred (pedigree F = 0) individuals from two captive populations, one domesticated and one recently wild-derived, raised under standardized conditions. As normal spermatozoa morphology did not differ consistently between inbred and outbred individuals, our study confirms the hypothesis that sperm morphology is not particularly susceptible to inbreeding depression. Inbreeding did, however, lead to significantly lower sperm motility and a substantially higher percentage of abnormal spermatozoa in ejaculate. These results were consistent across both study populations, confirming the generality and reliability of our findings. PMID:26811793

  16. Increased activity correlates with reduced ability to mount immune defenses to endotoxin in zebra finches.

    Science.gov (United States)

    Lopes, Patricia C; Springthorpe, Dwight; Bentley, George E

    2014-10-01

    When suffering from infection, animals experience behavioral and physiological alterations that potentiate the immune system's ability to fight pathogens. The behavioral component of this response, termed "sickness behavior," is characterized by an overall reduction in physical activity. A growing number of reports demonstrate substantial flexibility in these sickness behaviors, which can be partially overcome in response to mates, intruders and parental duties. Since it is hypothesized that adopting sickness behaviors frees energetic resources for mounting an immune response, we tested whether diminished immune responses coincided with reduced sickness behaviors by housing male zebra finches (Taeniopygia guttata) in social conditions that alter their behavioral response to an endotoxin. To facilitate our data collection, we developed and built a miniaturized sensor capable of detecting changes in dorsoventral acceleration and categorizing them as different behaviors when attached to the finches. We found that the immune defenses (quantified as haptoglobin-like activity, ability to change body temperature and bacterial killing capacity) increased as a function of increased time spent resting. The findings indicate that when animals are sick attenuation of sickness behaviors may exact costs, such as reduced immune function. The extent of these costs depends on how relevant the affected components of immunity are for fighting a specific infection. PMID:24888267

  17. A very small and super strong zebra pattern burst at the beginning of a solar flare

    Energy Technology Data Exchange (ETDEWEB)

    Tan, Baolin; Tan, Chengming; Zhang, Yin; Huang, Jing; Yan, Yihua [Key Laboratory of Solar Activity, National Astronomical Observatories of Chinese Academy of Sciences, Beijing 100012 (China); Mészárosová, Hana; Karlický, Marian, E-mail: bltan@nao.cas.cn [Astronomical Institute of the Academy of Sciences of the Czech Republic, Ondřejov 15165 (Czech Republic)

    2014-08-01

    Microwave emission with spectral zebra pattern structures (ZPs) is frequently observed in solar flares and the Crab pulsar. The previous observations show that ZP is a structure only overlapped on the underlying broadband continuum with slight increments and decrements. This work reports an unusually strong ZP burst occurring at the beginning of a solar flare observed simultaneously by two radio telescopes located in China and the Czech Republic and by the EUV telescope on board NASA's satellite Solar Dynamics Observatory on 2013 April 11. It is a very short and super strong explosion whose intensity exceeds several times that of the underlying flaring broadband continuum emission, lasting for just 18 s. EUV images show that the flare starts from several small flare bursting points (FBPs). There is a sudden EUV flash with extra enhancement in one of these FBPs during the ZP burst. Analysis indicates that the ZP burst accompanying an EUV flash is an unusual explosion revealing a strong coherent process with rapid particle acceleration, violent energy release, and fast plasma heating simultaneously in a small region with a short duration just at the beginning of the flare.

  18. A very small and super strong zebra pattern burst at the beginning of a solar flare

    International Nuclear Information System (INIS)

    Microwave emission with spectral zebra pattern structures (ZPs) is frequently observed in solar flares and the Crab pulsar. The previous observations show that ZP is a structure only overlapped on the underlying broadband continuum with slight increments and decrements. This work reports an unusually strong ZP burst occurring at the beginning of a solar flare observed simultaneously by two radio telescopes located in China and the Czech Republic and by the EUV telescope on board NASA's satellite Solar Dynamics Observatory on 2013 April 11. It is a very short and super strong explosion whose intensity exceeds several times that of the underlying flaring broadband continuum emission, lasting for just 18 s. EUV images show that the flare starts from several small flare bursting points (FBPs). There is a sudden EUV flash with extra enhancement in one of these FBPs during the ZP burst. Analysis indicates that the ZP burst accompanying an EUV flash is an unusual explosion revealing a strong coherent process with rapid particle acceleration, violent energy release, and fast plasma heating simultaneously in a small region with a short duration just at the beginning of the flare

  19. MICROWAVE ZEBRA PATTERN STRUCTURES IN THE X2.2 SOLAR FLARE ON 2011 FEBRUARY 15

    International Nuclear Information System (INIS)

    A zebra pattern (ZP) structure is the most intriguing fine structure on the dynamic spectrograph of a solar microwave burst. On 2011 February 15, an X2.2 flare event erupted on the solar disk, which is the first X-class flare since the solar Schwabe cycle 24. It is interesting that there are several microwave ZPs observed by the Chinese Solar Broadband Radio Spectrometer (SBRS/Huairou) at a frequency of 6.40-7.00 GHz (ZP1) and at a frequency of 2.60-2.75 GHz (ZP2) and by the Yunnan Solar Broadband Radio Spectrometer (SBRS/Yunnan) at a frequency of 1.04-1.13 GHz (ZP3). The most important phenomenon is the unusual high-frequency ZP structure (ZP1, up to 7.00 GHz) that occurred in the early rising phase of the flare and the two ZP structures (ZP2, ZP3) with relatively low frequencies that occurred in the decay phase of the flare. By scrutinizing the current prevalent theoretical models of ZP structure generations and comparing their estimated magnetic field strengths in the corresponding source regions, we suggest that the double plasma resonance model is the most probable one for explaining the formation of microwave ZPs, which may derive the magnetic field strengths at about 230-345 G, 126-147 G, and 23-26 G in the source regions of ZP1, ZP2, and ZP3, respectively.

  20. Multi-functional foot use during running in the zebra-tailed lizard (Callisaurus draconoides)

    CERN Document Server

    Li, Chen; Goldman, Daniel I; 10.1242/jeb.061937

    2013-01-01

    A diversity of animals that run on solid, level, flat, non-slip surfaces appear to bounce on their legs; elastic elements in the limbs can store and return energy during each step. The mechanics and energetics of running in natural terrain, particularly on surfaces that can yield and flow under stress, is less understood. The zebra-tailed lizard (Callisaurus draconoides), a small desert generalist with a large, elongate, tendinous hind foot, runs rapidly across a variety of natural substrates. We use high speed video to obtain detailed three-dimensional running kinematics on solid and granular surfaces to reveal how leg, foot, and substrate mechanics contribute to its high locomotor performance. Running at ~10 body length/s (~1 m/s), the center of mass oscillates like a spring-mass system on both substrates, with only 15% reduction in stride length on the granular surface. On the solid surface, a strut-spring model of the hind limb reveals that the hind foot saves about 40% of the mechanical work needed per s...

  1. Analytical developments for the speciation of uranium in zebra fish (Danio rerio) gills after exposure

    International Nuclear Information System (INIS)

    The objective of this thesis is to study the cellular compartmentalization and the chelation of uranium (U) by cytosolic proteins of gill cells of the zebra fish (Danio rerio, model specie in aquatic toxicology) under different direct exposure conditions (chronic vs. acute, 20 and 250 μg.L-1). This study required the development of hyphenated techniques (SEC, IEF off-gel, RP-UHPLC for the separation, ICP-SFMS, ESI-FTMS/MS for the detection) with the main challenges of maintaining the non-covalent U-biomolecule interactions and enhancing sensitivity for the analysis of environmentally relevant samples. After extraction, 24% to 32% of the total U detected in the gills were present in the cytosolic fraction, in which the U distribution on the biomolecules (as a function of their MW and pI) varied depending on the exposure level. Finally, U target biomolecules mapping allowed us (i) to highlight a particular affinity of U for acidic and/or P-containing proteins and (ii) to identify 24 protein candidates for U binding. (author)

  2. Evaluation of coatings to control zebra mussel colonization: Year two interim report, 1990-1991

    Energy Technology Data Exchange (ETDEWEB)

    Leitch, E.G.

    1992-05-25

    A study was carried out to identify coatings which are effective in protecting structures from zebra mussel fouling. Plates coated with antifouling paints were tested at Ontario Hydro's Nanticoke thermal generating station in 1990 and 1991 and were rated for their ability to resist mussel fouling or provide easily cleaned surfaces. Of the paints evaluated in 1990, only two silicones demonstrated good resistance to fouling, with the few mussels which did attach easily dislodged. Silicon-coated trash racks, after a year in use, were found to be in good condition and virtually free of mussels. All other coatings failed to prevent strong mussel attachment and were excluded from the 1991 trials. In addition to the two successful 1990 coatings, four silicones, a zinc silicate and a polyurethane were tested. The two silicones that were successful in 1990 continued to be in 1991. Three of the four 1991 silicones and the zinc silicate showed excellent resistance to mussel attachment, however mussels attached to the remaining silicone and the polyurethane with maximum percentage covers of 45% and 40%, respectively. 23 refs., 2 figs., 3 tabs.

  3. Occurrence of helminth eggs on vegetables sold in the city of Apucarana (PR Ocorrência de ovos de helmintos em hortaliças comercializadas na cidade de Apucarana (PR

    Directory of Open Access Journals (Sweden)

    Heloísa de Camargo Tozato

    2012-06-01

    Full Text Available The vegetable diseases transmitted represents a major public health problem, because it is estimated that millions of people worldwide are affected by parasites. This study aimed to quantify and identify the rate of contamination by helminth eggs on vegetables like watercress and endive marketed in four major supermarkets of Apucarana (PR. Were analyzed 128 sample of vegetables being: 64 of chicory and 64 of watercress, which were trimmer, weighed and washed in a tryptose lauryl sulfate 1% solution. There was a high rate of contamination in both varieties studied, with higher prevalence of chicory. Were found eggs of Ancylostoma sp., Ascaris sp. Diphilobotrium sp. Dipylidium sp. Hymenolepis sp. Taenia sp. and Enterobius sp. Considering these results, we stress the urgent need for official oversight and regulation by the competent local authorities in order to improve the hygienic quality of vegetables offered to the population, and minimize the rates of parasitic infections in adults and children (the most affected.As doenças veiculadas por hortaliças representam um importante problema de saúde pública, pois estima-se que milhões de pessoas de todo o mundo estejam acometidas por parasitoses. O presente estudo teve por objetivo quantificar e identificar o índice de contaminação por ovos de helmintos em hortaliças do tipo agrião e almeirão comercializadas em quatro grandes supermercados da cidade de Apucarana (PR. Foram analisadas 128 amostras de hortaliças sendo 64 de almeirão e 64 de agrião. As hortaliças foram desfolhadas, pesadas e lavadas em solução lauril sulfato triptose a 1%. Observou-se um índice elevado de contaminação nas duas variedades estudadas, com maior prevalência no almeirão. Foram encontrados ovos de Ancylostoma sp., Ascaris sp., Diphilobotrium sp., Dipylidium sp., Hymenolepis sp., Taenia sp. e Enterobius sp. Considerando esses resultados, salienta-se a necessidade urgente de fiscalização e regulamenta

  4. MICROBIOLOGICAL QUALITY OF HOMOGENIZED MEAT SOLD BY A SUPERMARKET OF GOIÂNIA (GO QUALIDADE MICROBIOLÓGICA DA CARNE HOMOGENEIZADA COMERCIALIZADA EM UM HIPERMERCADO DE GOIÂNIA - GO

    Directory of Open Access Journals (Sweden)

    Cristiano Sales Prado

    2007-09-01

    Full Text Available

    Seventy samples of homogenized meat produced and sold by a supermarket in Goiânia (GO, were analysed, from February 1996 to October 1997, in order to evaluate their microbiological quality. The microbiological analysis were mesophilic and psychrotrophic plate count, coliforms, fecal coliforms and Escherichia coli most probable number (MPN, Salmonella research, Streptococcus of D group MPN, Staphylococcus (positive coagulase enumeration and sulfide-reductor clostridia enumeration. In general the results indicated the good microbiological quality of the products. However, three positive samples to Salmonella were found, standing out the necessity of a permanent control, to avoid the transmission and dissemination of foodborne diseases.

    KEY-WORDS: Homogenized meat; microbiological quality; foodborne diseases.

    Foram analisadas 70 amostras de carne homogeneizada produzidas e comercializadas por um hipermercado de Goiânia (GO, no período de fevereiro de 1996 a outubro de 1997, para verificação da qualidade microbiológica. Foram realizadas análises para contagem padrão de microrganismos aeróbios ou facultativos mesófilos viáveis e de psicrotróficos, NMP de coliformes totais, fecais e de Escherichia coli, pesquisa de Salmonella, NMP de Streptococcus do grupo D, contagem de Staphylococcus (coagulase positiva e contagem de clostrídios sulfito-redutores. Os resultados indicaram, de maneira geral, a boa qualidade microbiológica dos produtos analisados. Entretanto, foram encontradas três amostras positivas para a pesquisa de Salmonella, ressaltando a necessidade de uma vigilância permanente, evitando a transmissão e a disseminação de toxinfecções de origem alimentar à população.

  5. Fiscalização de verduras comercializadas no município de Ribeirão Preto, SP Monitoring of vegetables commercially sold in Ribeirão Preto, SP, Brazil

    Directory of Open Access Journals (Sweden)

    Osvaldo M. Takayanagui

    2001-02-01

    Full Text Available O consumo de verduras cruas constitui importante meio de transmissão de várias doenças infecciosas. Este estudo tem como objetivo a avaliação microbiológica e parasitológica de verduras comercializadas no município de Ribeirão Preto, SP, abrangendo todos os pontos de venda ao consumidor. Do total de 172 estabelecimentos fixos ou ambulantes analisados, 115 (67% apresentaram hortaliças com irregularidades: elevada concentração de coliformes fecais em 63%, presença de Salmonella em 9% e de enteroparasitas em 33%. Os pontos de venda com maior freqüência de hortaliças com resultados inadequados foram: mercearias (92%, CEAGESP (75%, quitandas (71%, vendedores ambulantes (71%, feiras-livres (69%, supermercados (52% e hortas (18%. O tipo de contaminação apresentou distribuição uniforme em relação aos locais de venda e à variedade da hortaliça. A maioria (61% das verduras contaminadas era procedente de hortas localizadas no município de Ribeirão Preto. Considerando a elevada freqüência de contaminação fecal e o potencial risco de doenças veiculadas pelas hortaliças, sugerimos uma vigilância sanitária mais atuante na fiscalização de alimentos oferecidos à população.The ingestion of raw vegetables represents an important means of transmission of several infectious diseases. The objective of the present study was to perform a microbiological and parasitological evaluation of the vegetables commercially sold in the municipality of Ribeirão Preto, SP, Brazil. Of a total of 172 commercial concerns analyzed, 115 (67% presented irregularities in the vegetables they sold, such as elevated concentration of fecal coliforms in 63%, presence of Salmonella in 9%, and presence of enteroparasites in 33%. The commercial concerns with the highest frequencies of vegetables showing inadequate results were: grocery stores (92%, CEAGESP (75%, fruit and vegetables stores (71%, traveling vendors (71%, fairs (69%, supermarkets (52%, and

  6. Níveis de nitrito e nitrato em salsichas comercializadas na região metropolitana do Recife Level nitrite and nitrate in sausages commercialized in metropolitan region of Recife

    Directory of Open Access Journals (Sweden)

    Artur Bibiano de Melo Filho

    2004-09-01

    Full Text Available Os sais de nitrato e nitrito em excesso prejudicam a saúde. Com o objetivo de avaliar a qualidade de salsichas comercializadas em Recife-PE, os níveis de nitrito residual e nitrato foram determinados em 54 amostras de salsichas, coletadas segundo região de origem e marca, de acordo com 3 grupos e 9 sub-grupos: A Sul (A1, A2, A3; B Nordeste (B1, B2, B3, coletadas em supermercados; e, C indústrias locais e sem marcas (C1, C2, C3, em feiras livres. Aplicou-se testes ANOVA e Tukey. Constatou-se que no grupo (C 67% das amostras apresentavam-se com nitrito residual >150mg/kg (18% do total; e os níveis de nitrato >300mg/kg em 17(A, 67(B e 83%(C das amostras (pThe nitrite and nitrate salts in excess are harmfull to the health. With the objective to evaluate the quality of sausages commercialized in the Metropolitan Region of Recife, PE, the residual levels of nitrite and nitrate were measured in a 54 samples of hot-dog type sausage, that had constituted, as region of origin and mark, 3 groups and 9 sub-groups: (A the south one (A1, A2, A3; B northeast (B1, B2, B3, both, collected in supermarkets; and, C local industries, without marks (C1, C2, C3, in free fairs. ANOVA and Tukey tests were applied. The results showed that in 67% of the sausages from free fairs (C, (18% of total, the residual nitrite average were >150mg/kg above of the allowed maximum limit; and for nitrate value average, in 17(A, 67(B and 83 %(C of sausages, were >300mg/kg (max. allowed (p< 0.05. The results had allowed to conclude that the nitrite residual and nitrate levels in sausages, represent a risk to the health of the consumers due not following to the legislation in the production and commercialization of this product.

  7. DETERMINAÇÃO DE CU, NI E ZN POR ICP-MS EM INFUSÕES DA ERVA-MATE COMERCIALIZADAS NAS REGIÕES DO SUL DO BRASIL

    Directory of Open Access Journals (Sweden)

    Ana Paula Fleig SAIDELLES

    2013-08-01

    Full Text Available Muito tempo antes de ser conhecida a composição da Ilex paraguariensis (erva-mate, os indígenas utilizavam a mesma não somente pelo seu paladar, mas principalmente por conhecerem seus benefícios. Neste trabalho foi feita a determinação e avaliação dos valores de concentração de metais na primeira e segunda infusão em erva-mate comercializadas e industrializadas nos estados da região sul do Brasil. Para as infusões das amostras foi utilizada água destilada deionizada aquecida a 80o C. Para a determinação dos metais foi utilizada a espectrometria de massas com plasma indutivamente acoplado (ICP-MS. A concentração de cádmio, chumbo, cobalto, cromo, ferro e vanádio foram abaixo do limite de detecção (0,05 para cobre e níquel. Quando aplicado o teste de Tukey, observou-se diferença signifi- cativa para cobre na primeira infusão da erva-mate oriunda do PR em relação à produzida no RS e SC. Para níquel, a diferença foi significativa entre as infusões obtidas de ervas-mates produzidas no RS e de SC. Para Zn foi observado a menor variação de concentração entre as regiões e as duas infusões. Considerando a concentração de elementos, nas regiões estudadas, estes estão presentes principalmente na primeira infusão diminuindo de forma significativa na segunda infusão e decrescendo mais nas demais. Desta forma o chimarrão, infusão da erva-mate, nos estados do sul do Brasil, encontra-se com baixa concentração de metais e, conseqüentemente, baixo risco a saúde para a população consumidora da tradição.

  8. Biochemical and fatty acid composition of Arca noae (Bivalvia: Arcidae from the Mali Ston Bay, Adriatic Sea

    Directory of Open Access Journals (Sweden)

    I. DUPCIC RADIC

    2014-09-01

    Full Text Available Biochemical and fatty acid composition of the bivalve Arca noae were investigated in the Mali Ston Bay in relation to environmental conditions. Sampling was carried out monthly, from December 2001 to November 2002. Wet shellfish meat consists on average of 77.61% water and 22.39% dry matter, while dry shellfish meat consists on average of 89.04% organic and 10.96% inorganic matter. PCA analysis identified temperature, nitrate, silicate, MICRO, Chl a and salinity as the most important environmental factors influencing biochemical composition of A. noae. An increase of dry weight content of A. noae was observed during the spring when both the sea temperature and food supply increased rapidly. Contents of protein (54.39-62.06% of dry weight, carbohydrate (4.13-8.07% of dry weight and lipid (3.46-8.58% of dry weight varied significantly during the year. Protein and lipid level reached the maximum value in June. The fatty acid profiles of total lipids extracted from A. noae showed high level of unsaturation (UNS/SAT 1.9-3.4. Total polyunsaturated fatty acids (PUFA represented the majority of total fatty acids (40.3-59.9% of total fatty acids and the most abundant were eicosapentaenoic (20:5n-3 and docosahexaenoic (22:6n-3 acid. n-3/n-6 PUFA ratio value varied between 2.1 and 5.0 and was the highest during the spring (April to June. Due to their low lipid and high percentages of healthy polyunsaturated fatty acids A. noae can be evaluated as a quality seafood product. The most suitable period of the year for its consumption is in the spring when it reaches its highest nutritional values.

  9. Variable light environments induce plastic spectral tuning by regional opsin coexpression in the African cichlid fish, Metriaclima zebra.

    Science.gov (United States)

    Dalton, Brian E; Lu, Jessica; Leips, Jeff; Cronin, Thomas W; Carleton, Karen L

    2015-08-01

    Critical behaviours such as predation and mate choice often depend on vision. Visual systems are sensitive to the spectrum of light in their environment, which can vary extensively both within and among habitats. Evolutionary changes in spectral sensitivity contribute to divergence and speciation. Spectral sensitivity of the retina is primarily determined by visual pigments, which are opsin proteins bound to a chromophore. We recently discovered that photoreceptors in different regions of the retina, which view objects against distinct environmental backgrounds, coexpress different pairs of opsins in an African cichlid fish, Metriaclima zebra. This coexpression tunes the sensitivity of the retinal regions to the corresponding backgrounds and may aid in detection of dark objects, such as predators. Although intraretinal regionalization of spectral sensitivity in many animals correlates with their light environments, it is unknown whether variation in the light environment induces developmentally plastic alterations of intraretinal sensitivity regions. Here, we demonstrate with fluorescent in situ hybridization and qPCR that the spectrum and angle of environmental light both influence the development of spectral sensitivity regions by altering the distribution and level of opsins across the retina. Normally, M. zebra coexpresses LWS opsin with RH2Aα opsin in double cones of the ventral but not the dorsal retina. However, when illuminated from below throughout development, adult M. zebra coexpressed LWS and RH2Aα in double cones both dorsally and ventrally. Thus, environmental background spectra alter the spectral sensitivity pattern that develops across the retina, potentially influencing behaviours and related evolutionary processes such as courtship and speciation. PMID:26175094

  10. Underwater cleaning techniqued used for removal of zebra mussels at the FitzPatrick Nuclear Power Plant

    International Nuclear Information System (INIS)

    This paper discusses the use of a mechanical brush cleaning technology recently used to remove biofouling from the Circulating Water (CW) System at New York Power Authority's James A. FitzPatrick Nuclear Power Plant. The FitzPatrick plant had previously used chemical molluscicide to treat zebra mussels in the CW system. Full system treatment was performed in 1992 with limited forebay/screenwell treatment in 1993. The New York Power Authority (NYPA) decided to conduct a mechanical cleaning of the intake system in 1994. Specific project objectives included: (1) Achieve a level of surface cleaniness greater than 98%; (2) Remove 100% of debris, both existing sediment and debris generated as a result of cleaning; (3) Inspect all surfaces and components, identifying any problem areas; (4) Complete the task in a time frame within the 1994-95 refueling outage schedule window, and; (5) Determine if underwater mechanical cleaning is a cost-effective zebra mussel control method suitable for future application at FitzPatrick. A pre-cleaning inspection, including underwater video photography, was conducted of each area. Cleaning was accomplished using diver-controlled, multi-brush equipment included the electro-hydraulic powered Submersible Cleaning and Maintenance Platform (SCAMP), and several designs of hand-held machines. The brushes swept all zebra mussels off surfaces, restoring concrete and metal substrates to their original condition. Sensitive areas including pump housings, standpipes, sensor piping and chlorine injection tubing, were cleaned without degradation. Submersible vortex vacuum pumps were used to remove debris from the cavity. More than 46,000 ft2 of surface area was cleaned and over 460 cubic yards of dewatered debris were removed. As each area was completed, a post-clean inspection with photos and video was performed

  11. Underwater cleaning techniqued used for removal of zebra mussels at the FitzPatrick Nuclear Power Plant

    Energy Technology Data Exchange (ETDEWEB)

    Hobbs, B. [Seaward Marine Services, Inc., Fairfax, VA (United States); Kahabka, J. [New York Power Authority, White Plains, NY (United States)

    1995-06-01

    This paper discusses the use of a mechanical brush cleaning technology recently used to remove biofouling from the Circulating Water (CW) System at New York Power Authority`s James A. FitzPatrick Nuclear Power Plant. The FitzPatrick plant had previously used chemical molluscicide to treat zebra mussels in the CW system. Full system treatment was performed in 1992 with limited forebay/screenwell treatment in 1993. The New York Power Authority (NYPA) decided to conduct a mechanical cleaning of the intake system in 1994. Specific project objectives included: (1) Achieve a level of surface cleaniness greater than 98%; (2) Remove 100% of debris, both existing sediment and debris generated as a result of cleaning; (3) Inspect all surfaces and components, identifying any problem areas; (4) Complete the task in a time frame within the 1994-95 refueling outage schedule window, and; (5) Determine if underwater mechanical cleaning is a cost-effective zebra mussel control method suitable for future application at FitzPatrick. A pre-cleaning inspection, including underwater video photography, was conducted of each area. Cleaning was accomplished using diver-controlled, multi-brush equipment included the electro-hydraulic powered Submersible Cleaning and Maintenance Platform (SCAMP), and several designs of hand-held machines. The brushes swept all zebra mussels off surfaces, restoring concrete and metal substrates to their original condition. Sensitive areas including pump housings, standpipes, sensor piping and chlorine injection tubing, were cleaned without degradation. Submersible vortex vacuum pumps were used to remove debris from the cavity. More than 46,000 ft{sup 2} of surface area was cleaned and over 460 cubic yards of dewatered debris were removed. As each area was completed, a post-clean inspection with photos and video was performed.

  12. Extracellular acidification activates ovarian cancer G-protein-coupled receptor 1 and GPR4 homologs of zebra fish

    International Nuclear Information System (INIS)

    Mammalian ovarian G-protein-coupled receptor 1 (OGR1) and GPR4 are identified as a proton-sensing G-protein-coupled receptor coupling to multiple intracellular signaling pathways. In the present study, we examined whether zebra fish OGR1 and GPR4 homologs (zOGR1 and zGPR4) could sense protons and activate the multiple intracellular signaling pathways and, if so, whether the similar positions of histidine residue, which is critical for sensing protons in mammalian OGR and GPR4, also play a role to sense protons and activate the multiple signaling pathways in the zebra fish receptors. We found that extracellular acidic pH stimulated CRE-, SRE-, and NFAT-promoter activities in zOGR1 overexpressed cells and stimulated CRE- and SRE- but not NFAT-promoter activities in zGPR4 overexpressed cells. The substitution of histidine residues at the 12th, 15th, 162th, and 264th positions from the N-terminal of zOGR1 with phenylalanine attenuated the proton-induced SRE-promoter activities. The mutation of the histidine residue at the 78th but not the 84th position from the N-terminal of zGPR4 to phenylalanine attenuated the proton-induced SRE-promoter activities. These results suggest that zOGR1 and zGPR4 are also proton-sensing G-protein-coupled receptors, and the receptor activation mechanisms may be similar to those of the mammalian receptors. - Highlights: • Zebra fish OGR1 and GPR4 homologs (zOGR1, zGPR4) are proton-sensing receptors. • The signaling pathways activated by zOGR1 and zGPR4 are different. • Histidine residues critical for sensing protons are conserved

  13. Extracellular acidification activates ovarian cancer G-protein-coupled receptor 1 and GPR4 homologs of zebra fish

    Energy Technology Data Exchange (ETDEWEB)

    Mochimaru, Yuta [Laboratory of Cell Signaling Regulation, Department of Life Sciences, School of Agriculture, Meiji University, Kawasaki 214-8571 (Japan); Azuma, Morio [Laboratory of Regulatory Biology, Graduate School of Science and Engineering, University of Toyama, 3190 Gofuku, Toyama 930-8555 (Japan); Oshima, Natsuki; Ichijo, Yuta; Satou, Kazuhiro [Laboratory of Cell Signaling Regulation, Department of Life Sciences, School of Agriculture, Meiji University, Kawasaki 214-8571 (Japan); Matsuda, Kouhei [Laboratory of Regulatory Biology, Graduate School of Science and Engineering, University of Toyama, 3190 Gofuku, Toyama 930-8555 (Japan); Asaoka, Yoichi; Nishina, Hiroshi [Department of Developmental and Regenerative Biology, Medical Research Institute, Tokyo Medical and Dental University, Tokyo 113-8510 (Japan); Nakakura, Takashi [Department of Anatomy, Graduate School of Medicine, Teikyo University, 2-11-1 Kaga Itabashi-Ku, Tokyo 173-8605 (Japan); Mogi, Chihiro; Sato, Koichi; Okajima, Fumikazu [Laboratory of Signal Transduction, Institute for Molecular and Cellular Regulation, Gunma University, Maebashi 371-8512 (Japan); Tomura, Hideaki, E-mail: tomurah@meiji.ac.jp [Laboratory of Cell Signaling Regulation, Department of Life Sciences, School of Agriculture, Meiji University, Kawasaki 214-8571 (Japan)

    2015-02-20

    Mammalian ovarian G-protein-coupled receptor 1 (OGR1) and GPR4 are identified as a proton-sensing G-protein-coupled receptor coupling to multiple intracellular signaling pathways. In the present study, we examined whether zebra fish OGR1 and GPR4 homologs (zOGR1 and zGPR4) could sense protons and activate the multiple intracellular signaling pathways and, if so, whether the similar positions of histidine residue, which is critical for sensing protons in mammalian OGR and GPR4, also play a role to sense protons and activate the multiple signaling pathways in the zebra fish receptors. We found that extracellular acidic pH stimulated CRE-, SRE-, and NFAT-promoter activities in zOGR1 overexpressed cells and stimulated CRE- and SRE- but not NFAT-promoter activities in zGPR4 overexpressed cells. The substitution of histidine residues at the 12th, 15th, 162th, and 264th positions from the N-terminal of zOGR1 with phenylalanine attenuated the proton-induced SRE-promoter activities. The mutation of the histidine residue at the 78th but not the 84th position from the N-terminal of zGPR4 to phenylalanine attenuated the proton-induced SRE-promoter activities. These results suggest that zOGR1 and zGPR4 are also proton-sensing G-protein-coupled receptors, and the receptor activation mechanisms may be similar to those of the mammalian receptors. - Highlights: • Zebra fish OGR1 and GPR4 homologs (zOGR1, zGPR4) are proton-sensing receptors. • The signaling pathways activated by zOGR1 and zGPR4 are different. • Histidine residues critical for sensing protons are conserved.

  14. Relationship between prolactin, reproductive experience, and parental care in a biparental songbird, the zebra finch (Taeniopygia guttata).

    Science.gov (United States)

    Smiley, Kristina O; Adkins-Regan, Elizabeth

    2016-06-01

    Hormonal systems have long been thought to play an important role in stimulating the onset of parental behavior, a critical component of reproductive success in a variety of taxa. Elevations in the peptide hormone prolactin (PRL) have been repeatedly positively correlated with the onset and maintenance of parental care across vertebrate species. A causal role for PRL in parental care has been established in several mammalian species, but less evidence for a causal role of PRL and parental care exists in birds. The zebra finch, a socially monogamous, biparental songbird, is an exceptionally useful animal model to study parental care and other close social relationships. Both sexes share parental care equally, exhibit the same parental behaviors, and show a marked improvement in breeding success with experience. We hypothesize that PRL is critically involved in the expression of zebra finch parental care and predict that circulating PRL levels will increase with breeding experience. To begin testing this, we measured plasma PRL concentrations in 14 male-female zebra finch pairs (N=28) across two breeding cycles, using a repeated measures design. PRL was measured in the birds' first, reproductively inexperienced, breeding cycle beginning at courtship and extending through chick fledging. PRL was measured again during the birds' second, reproductively experienced, breeding cycle, beginning with egg laying until chick fledging. We found that plasma PRL is significantly elevated from non-breeding concentrations during late incubation and early post-hatch care and that this elevation is greater in the reproductively experienced cycle compared to the inexperienced cycle. Findings of this study will be used to inform hypotheses and predictions for future experimental manipulations of PRL during parental care. PMID:26602378

  15. Mitochondrial uncoupling as a regulator of life-history trajectories in birds: an experimental study in the zebra finch.

    Science.gov (United States)

    Stier, Antoine; Bize, Pierre; Roussel, Damien; Schull, Quentin; Massemin, Sylvie; Criscuolo, François

    2014-10-01

    Mitochondria have a fundamental role in the transduction of energy from food into ATP. The coupling between food oxidation and ATP production is never perfect, but may nevertheless be of evolutionary significance. The 'uncoupling to survive' hypothesis suggests that 'mild' mitochondrial uncoupling evolved as a protective mechanism against the excessive production of damaging reactive oxygen species (ROS). Because resource allocation and ROS production are thought to shape animal life histories, alternative life-history trajectories might be driven by individual variation in the degree of mitochondrial uncoupling. We tested this hypothesis in a small bird species, the zebra finch (Taeniopygia guttata), by treating adults with the artificial mitochondrial uncoupler 2,4-dinitrophenol (DNP) over a 32-month period. In agreement with our expectations, the uncoupling treatment increased metabolic rate. However, we found no evidence that treated birds enjoyed lower oxidative stress levels or greater survival rates, in contrast to previous results in other taxa. In vitro experiments revealed lower sensitivity of ROS production to DNP in mitochondria isolated from skeletal muscles of zebra finch than mouse. In addition, we found significant reductions in the number of eggs laid and in the inflammatory immune response in treated birds. Altogether, our data suggest that the 'uncoupling to survive' hypothesis may not be applicable for zebra finches, presumably because of lower effects of mitochondrial uncoupling on mitochondrial ROS production in birds than in mammals. Nevertheless, mitochondrial uncoupling appeared to be a potential life-history regulator of traits such as fecundity and immunity at adulthood, even with food supplied ad libitum. PMID:25063856

  16. Regeneração da barbatana caudal em peixe-zebra (Danio rerio): uma perspectiva biofísica

    OpenAIRE

    Ferreira, Fernando Ricardo da Silva, 1987-

    2011-01-01

    Tese de mestrado. Biologia (Biologia Evolutiva e do Desenvolvimento). Universidade de Lisboa, Faculdade de Ciências, 2011 O peixe-zebra (Danio rerio) regenera vários órgãos, o que o torna um excelente modelo para estudos de regeneração. Partindo de uma hipótese biofísica onde fluxos iónicos e correntes associadas são considerados eventos epigenéticos à regeneração, determinou-se o perfil de fluxos extracelulares dos iões cloreto e sódio na barbatana caudal durante as diferentes fases da re...

  17. Growth and atrophy of neurons labeled at their birth in a song nucleus of the zebra finch.

    OpenAIRE

    Konishi, M; Akutagawa, E

    1990-01-01

    The robust nucleus of the archistriatum (RA) is one of the forebrain nuclei that control song production in birds. In the zebra finch (Poephila guttata), this nucleus contains more and larger neurons in the male than in the female. A single injection of tritiated thymidine into the egg on the 6th or 7th day of incubation resulted in labeling of many RA neurons with tritium. The size of tritium-labeled neurons and the tissue volume containing them did not differ between the sexes at 15 days af...

  18. The influence of temperature, daylength and sucrose concentration on the growth and development of Alstroemeria 'Zebra' in vitro

    OpenAIRE

    Eleonora Gabryszewska

    2013-01-01

    The influence of temperature, daylength and sucrose concentration on the growth and development of Alstroemeria 'Zebra' in vitro was investigated. Only slightly more lateral rhizomes were formed at 25°C in comparison with 17°C on the medium with BA. Presence of BA in the medium strongly increased number of upright growing shoots and more shoots were formed in temperature 25°C than in temperature 17°C. Rhizome multiplication and formation of upright growing shoots were not significantly influe...

  19. In search of greener pastures: Using satellite images to predict the effects of environmental change on zebra migration

    Science.gov (United States)

    Bartlam-Brooks, Hattie L. A.; Beck, Pieter S. A.; Bohrer, Gil; Harris, Stephen

    2013-12-01

    ungulate migrations occurred in most grassland and boreal woodland ecosystems, but many have been lost due to increasing habitat loss and fragmentation. With the rate of environmental change increasing, identifying and prioritizing migration routes for conservation has taken on a new urgency. Understanding the cues that drive long-distance animal movements is critical to predicting the fate of migrations under different environmental change scenarios and how large migratory herbivores will respond to increasing resource heterogeneity and anthropogenic influences. We used an individual-based modeling approach to investigate the influence of environmental conditions, monitored using satellite data, on departure date and movement speed of migrating zebras in Botswana. Daily zebra movements between dry and rainy season ranges were annotated with coincident observations of precipitation from the Tropical Rainfall Measuring Mission data set and Moderate Resolution Imaging Spectroradiometer-derived normalized difference vegetation index (NDVI). An array of increasingly complex movement models representing alternative hypotheses regarding the environmental cues and controls for movement was parameterized and tested. The best and most justified model predicted daily zebra movement as two linear functions of precipitation rate and NDVI and included a modeled departure date as a function of cumulative precipitation. The model was highly successful at replicating both the timing and pace of seven actual migrations observed using GPS telemetry (R2 = 0.914). It shows how zebras rapidly adjust their movement to changing environmental conditions during migration and are able to reverse migration to avoid adverse conditions or exploit renewed resource availability, a nomadic behavior which should lend them a degree of resilience to climate and environmental change. Our results demonstrate how competing individual-based migration models, informed by freely available satellite data

  20. PAW [Physics Analysis Workstation] at Fermilab: CORE based graphics implementation of HIGZ [High Level Interface to Graphics and Zebra

    International Nuclear Information System (INIS)

    The Physics Analysis Workstation system (PAW) is primarily intended to be the last link in the analysis chain of experimental data. The graphical part of PAW is based on HIGZ (High Level Interface to Graphics and Zebra), which is based on the OSI and ANSI standard Graphics Kernel System (GKS). HIGZ is written in the context of PAW. At Fermilab, the CORE based graphics system DI-3000 by Precision Visuals Inc., is widely used in the analysis of experimental data. The graphical part of the PAW routines has been totally rewritten and implemented in the Fermilab environment. 3 refs

  1. Protective Effects of Silymarin Extract on Malthion-Induced Zebra Cichlid (Cichlasoma Nigrofasciatum Hepatotoxicity

    Directory of Open Access Journals (Sweden)

    Mahdi Banaee

    2015-03-01

    Full Text Available Background: There is much evidence indicating that natural substances from edible and medicinal plants possess powerful antioxidant and hepatoprotective activities. The objective of the present study was to investigate the potential hepatoprotective effect of silymarin in fish exposed to malathion. Methods: Zebra cichlid fish were allocated into five groups of which one group received normal feed and served as control. Fish from group 2 were treated with 0.1 mg.L-1 malathion. Fish from group 3 and 4 were fed with enriched diet with 1400 mg and 2100 mg silymarin per 1 kg feed, respectively. While fish from group 5 and 6 were fed with enriched diet with 1400 mg and 2100 mg silymarin per 1 kg feed, respectively and simultaneously were treated with 0.1 mg.L-1 malathion for 15 days. Activities of hepatic enzymes including alanine aminotransferase, aspartate aminotransferase, alkaline phosphatase and lactate dehydrogenase were evaluated. Oxidative stress was ascertained by measuring malondialdehyde as marker of lipid peroxidation and total cellular antioxidant capacity. Results: Exposure to malathion caused a significant increase in MDA levels and altered AST, ALT, ALP and LDH activities in liver tissues (p<0.05. The hepatic antioxidant capacity was significantly lowered in malathion treated fish as compared to the control group (p<0.05. Treatment with silymarin significantly ameliorated these changes in the malathion-treated groups. Conclusion: These finding demonstrated that silymarin have protective effects against the toxic influence of malathion on the examined biochemical parameters in liver tissue of fish.

  2. Cloning, Expression and Characterization of Zebra Fish Ferroportin in Hek 293T Cell Line

    Directory of Open Access Journals (Sweden)

    A Memarnejadian

    2012-01-01

    Full Text Available Background: Ferroportin (Fpn, a regulator of iron homeostasis is a conserved membrane protein that exports iron across the enterocytes, macrophages and hepatocytes into the blood circulation. Fpn has also critical influence on survival of microorganisms whose growth is dependent upon iron, thus preparation of Fpn is needed to study the role of iron in immunity and pathogenesis of micoorganisms.Methods: To prepare and characterize a recombinant ferroportin, total RNA was extracted from Indian zebrafish duodenum, and used to synthesize cDNA by RT-PCR. PCR product was first cloned in Topo TA vector and then subcloned into the GFP expression vector pEGFP-N1. The final resulted plasmid (pEGFP-ZFpn was used for expression of Fpn-EGFP protein in Hek 293T cells.Results: The expression was confirmed by appearance of fluorescence in Hek 293 T cells. Recombinant Fpn was further characterized by submission of its predicted amino acid sequences to the TMHMM V2.0 prediction server (hidden Markov model, NetOGlyc 3.1 and NetNGlyc 3.1 servers. The obtained Fpn from indian zebrafish also contained eight transmembrane domains with N- and C-termini inside the cytoplasm and harboured 78 O-glycosylated amino acids.Conclusion: The recombinant Fpn from Indian zebra fish was successfully expressed in Hek 293 cell line. Although the discrepancy in two amino acids was observed in our produced Fpn and resulted in an additional O-glycosylation site, but had no effect on the topology of the protein compared to other Fpn described by other researchers. Therefore this construct can be used in future iron studies.

  3. Parasite-mediated selection drives an immunogenetic tradeoff in plains zebra (Equus quagga)

    Science.gov (United States)

    Kamath, Pauline L.; Turner, Wendy C.; Küsters, Martina; Getz, Wayne M.

    2014-01-01

    Pathogen evasion of the host immune system is a key force driving extreme polymorphism in genes of the major histocompatibility complex (MHC). Although this gene family is well characterized in structure and function, there is still much debate surrounding the mechanisms by which MHC diversity is selectively maintained. Many studies have investigated relationships between MHC variation and specific pathogens, and have found mixed support for and against the hypotheses of heterozygote advantage, frequency-dependent or fluctuating selection. Few, however, have focused on the selective effects of multiple parasite types on host immunogenetic patterns. Here, we examined relationships between variation in the equine MHC gene, ELA-DRA, and both gastrointestinal (GI) and ectoparasitism in plains zebras (Equus quagga). Specific alleles present at opposing population frequencies had antagonistic effects, with rare alleles associated with increased GI parasitism and common alleles with increased tick burdens. These results support a frequency-dependent mechanism, but are also consistent with fluctuating selection. Maladaptive GI parasite ‘susceptibility alleles’ were reduced in frequency, suggesting that these parasites may play a greater selective role at this locus. Heterozygote advantage, in terms of allele mutational divergence, also predicted decreased GI parasite burden in genotypes with a common allele. We conclude that an immunogenetic trade-off affects resistance/susceptibility to parasites in this system. Because GI and ectoparasites do not directly interact within hosts, our results uniquely show that antagonistic parasite interactions can be indirectly modulated through the host immune system. This study highlights the importance of investigating the role of multiple parasites in shaping patterns of host immunogenetic variation.

  4. Zebra Mussel Farming in the Szczecin (Oder Lagoon: Water-Quality Objectives and Cost-Effectiveness

    Directory of Open Access Journals (Sweden)

    Thomas Neumann

    2012-06-01

    Full Text Available The Oder (Szczecin Lagoon in the southern Baltic Sea is a heavily eutrophicated and degraded coastal ecosystem. We applied a systems approach framework to critically evaluate whether existing water-management measures achieve water-quality objectives for the river and lagoon systems. Our simulations reveal that the existing water-quality objectives for the river and the coastal waters are not sufficiently complementary. We suggest new water-quality threshold concentrations, which are in agreement with the European Water Framework Directive, and we calculate acceptable maximum nutrient loads for the Oder River. These calculations suggest that external nutrient-load reductions in the river basin alone seem insufficient to achieve good water quality in the lagoon. A comprehensive eutrophication management approach should also include internal nutrient-retention and nutrient-removal measures in the lagoon. We focus on mussel farming, i.e., that of zebra mussels, Dreissena polymorpha, because they are efficient in removing nutrients and improving water transparency in the Oder Lagoon. For this purpose, the ecosystem model ERGOM is extended by a mussel module and an economic model. The economic model describes costs and benefits of mussel cultivation depending on the the farm size. We included additional potential sources of income such as water-quality tax or emission certificates. The simulations show that mussel farming in the lagoon is a suitable supportive measure and, at a load-reduction target of 50% or more, it is a cost-efficient measure for removing nutrients and for implementing the Baltic Sea Action Plan. In the Oder Lagoon, mussel farming could potentially remove nearly 1000 t of N (70 t of P/year, or about 2% of the present N and P loads, and it would have the additional benefit of improving water transparency.

  5. Metallothionein (MT) response after chronic palladium exposure in the zebra mussel, Dreissena polymorpha

    International Nuclear Information System (INIS)

    The effects of different exposure concentrations of palladium (Pd) on relative metallothionein (MT) response and bioaccumulation were investigated in zebra mussels (Dreissena polymorpha). The mussels were exposed to 0.05, 5, 50, and 500 μg/L Pd2+ for 10 weeks under controlled temperature and fasting conditions. Relative MT contents were assessed by a modified Ag-saturation method, which allows to discriminate between MT bound to Pd (Pd-MT) and MT bound to unidentified metals (Ag-MT). Determination of metal contents resulted from atomic absorption spectrometry following a microwave digestion. For unexposed mussels and mussels exposed to 0.05 μg/L Pd no metal accumulation could be detected. All other exposure concentrations resulted in detectable Pd accumulation in mussels with final tissue concentrations of 96 μg/g (500 μg/L), 45 μg/g (50 μg/L), and 9 μg/g (5 μg/L). Compared with initial levels Pd-MT concentrations at the end of the exposure period were 600 (500 μg/L), 160 (50 μg/L), and 27 (5 μg/L) times higher. These results show that an increase in MTs in D. polymorpha already occurs at relatively low aqueous Pd concentrations indicating that there is the need for detoxification of Pd in the mussel. Furthermore, correlations between Ag-MT and Pd accumulation indicate that higher exposure concentrations are associated with adverse effects on the mussels. Thus, harmful effects of chronic Pd exposure of organisms even in lowest concentrations cannot be excluded in the environment

  6. The complete genome sequence of 'Candidatus Liberibacter solanacearum', the bacterium associated with potato zebra chip disease.

    Directory of Open Access Journals (Sweden)

    Hong Lin

    Full Text Available Zebra Chip (ZC is an emerging plant disease that causes aboveground decline of potato shoots and generally results in unusable tubers. This disease has led to multi-million dollar losses for growers in the central and western United States over the past decade and impacts the livelihood of potato farmers in Mexico and New Zealand. ZC is associated with 'Candidatus Liberibacter solanacearum', a fastidious alpha-proteobacterium that is transmitted by a phloem-feeding psyllid vector, Bactericera cockerelli Sulc. Research on this disease has been hampered by a lack of robust culture methods and paucity of genome sequence information for 'Ca. L. solanacearum'. Here we present the sequence of the 1.26 Mbp metagenome of 'Ca. L. solanacearum', based on DNA isolated from potato psyllids. The coding inventory of the 'Ca. L. solanacearum' genome was analyzed and compared to related Rhizobiaceae to better understand 'Ca. L. solanacearum' physiology and identify potential targets to develop improved treatment strategies. This analysis revealed a number of unique transporters and pathways, all potentially contributing to ZC pathogenesis. Some of these factors may have been acquired through horizontal gene transfer. Taxonomically, 'Ca. L. solanacearum' is related to 'Ca. L. asiaticus', a suspected causative agent of citrus huanglongbing, yet many genome rearrangements and several gene gains/losses are evident when comparing these two Liberibacter. species. Relative to 'Ca. L. asiaticus', 'Ca. L. solanacearum' probably has reduced capacity for nucleic acid modification, increased amino acid and vitamin biosynthesis functionalities, and gained a high-affinity iron transport system characteristic of several pathogenic microbes.

  7. The Forebrain Song System Mediates Predictive Call Timing in Female and Male Zebra Finches.

    Science.gov (United States)

    Benichov, Jonathan I; Benezra, Sam E; Vallentin, Daniela; Globerson, Eitan; Long, Michael A; Tchernichovski, Ofer

    2016-02-01

    The dichotomy between vocal learners and non-learners is a fundamental distinction in the study of animal communication. Male zebra finches (Taeniopygia guttata) are vocal learners that acquire a song resembling their tutors', whereas females can only produce innate calls. The acoustic structure of short calls, produced by both males and females, is not learned. However, these calls can be precisely coordinated across individuals. To examine how birds learn to synchronize their calls, we developed a vocal robot that exchanges calls with a partner bird. Because birds answer the robot with stereotyped latencies, we could program it to disrupt each bird's responses by producing calls that are likely to coincide with the bird's. Within minutes, the birds learned to avoid this disruptive masking (jamming) by adjusting the timing of their responses. Notably, females exhibited greater adaptive timing plasticity than males. Further, when challenged with complex rhythms containing jamming elements, birds dynamically adjusted the timing of their calls in anticipation of jamming. Blocking the song system cortical output dramatically reduced the precision of birds' response timing and abolished their ability to avoid jamming. Surprisingly, we observed this effect in both males and females, indicating that the female song system is functional rather than vestigial. We suggest that descending forebrain projections, including the song-production pathway, function as a general-purpose sensorimotor communication system. In the case of calls, it enables plasticity in vocal timing to facilitate social interactions, whereas in the case of songs, plasticity extends to developmental changes in vocal structure. PMID:26774786

  8. Reduced vocal variability in a zebra finch model of dopamine depletion: implications for Parkinson disease.

    Science.gov (United States)

    Miller, Julie E; Hafzalla, George W; Burkett, Zachary D; Fox, Cynthia M; White, Stephanie A

    2015-11-01

    Midbrain dopamine (DA) modulates the activity of basal ganglia circuitry important for motor control in a variety of species. In songbirds, DA underlies motivational behavior including reproductive drive and is implicated as a gatekeeper for neural activity governing vocal variability. In the zebra finch, Taeniopygia guttata, DA levels increase in Area X, a song-dedicated subregion of the basal ganglia, when a male bird sings his courtship song to a female (female-directed; FD). Levels remain stable when he sings a less stereotyped version that is not directed toward a conspecific (undirected; UD). Here, we used a mild dose of the neurotoxin 6-hydroxydopamine (6-OHDA) to reduce presynaptic DA input to Area X and characterized the effects on FD and UD behaviors. Immunoblots were used to quantify levels of tyrosine hydroxylase (TH) as a biomarker for DA afferent loss in vehicle- and 6-OHDA-injected birds. Following 6-OHDA administration, TH signals were lower in Area X but not in an adjacent subregion, ventral striatal-pallidum (VSP). A postsynaptic marker of DA signaling was unchanged in both regions. These observations suggest that effects were specific to presynaptic afferents of vocal basal ganglia. Concurrently, vocal variability was reduced during UD but not FD song. Similar decreases in vocal variability are observed in patients with Parkinson disease (PD), but the link to DA loss is not well-understood. The 6-OHDA songbird model offers a unique opportunity to further examine how DA loss in cortico-basal ganglia pathways affects vocal control. PMID:26564062

  9. A prezygotic transmission distorter acting equally in female and male zebra finches Taeniopygia guttata.

    Science.gov (United States)

    Knief, Ulrich; Schielzeth, Holger; Ellegren, Hans; Kempenaers, Bart; Forstmeier, Wolfgang

    2015-08-01

    The two parental alleles at a specific locus are usually inherited with equal probability to the offspring. However, at least three processes can lead to an apparent departure from fair segregation: early viability selection, biased gene conversion and various kinds of segregation distortion. Here, we conduct a genome-wide scan for transmission distortion in a captive population of zebra finches (Taeniopygia guttata) using 1302 single-nucleotide polymorphisms (SNPs) followed by confirmatory analyses on independent samples from the same population. In the initial genome-wide scan, we found significant distortion at three linked loci on chromosome Tgu2 and we were able to replicate this finding in each of two follow-up data sets [overall transmission ratio = 0.567 (95% CI = 0.536-0.600), based on 1101 informative meioses]. Although the driving allele was preferentially transmitted by both heterozygous females [ratio = 0.560 (95% CI = 0.519-0.603)] and heterozygous males [ratio = 0.575 (95% CI = 0.531-0.623)], we could rule out postzygotic viability selection and biased gene conversion as possible mechanisms. Early postzygotic viability selection is unlikely, because it would result in eggs with no visible embryo and hence no opportunity for genotyping, and we confirmed that both females and males heterozygous for the driving allele did not produce a larger proportion of such eggs than homozygous birds. Biased gene conversion is expected to be rather localized, while we could trace transmission distortion in haplotypes of several megabases in a recombination desert. Thus, we here report the rare case of a prezygotically active transmission distorter operating equally effectively in female and male meioses. PMID:26087713

  10. Significance and Epidemiological Aspects of Late-Season Infections in the Management of Potato Zebra Chip.

    Science.gov (United States)

    Rush, C M; Workneh, F; Rashed, A

    2015-07-01

    Zebra chip (ZC) of potato is putatively caused by the fastidious, phloem-limited bacterium 'Candidatus Liberibacter solanacearum' (Lso), which is transmitted by the potato psyllid (Bactericera cockerelli). The disease, which significantly impacts both crop yield and quality, was first identified in the United States from south Texas in 2000. It reached epidemic levels in north Texas and certain production areas in Colorado, Nebraska, and New Mexico from 2004 to 2007 and it caused severe losses in fields in Oregon, Washington, and Idaho in 2011. The potato plant is susceptible to infection at all developmental stages, but disease management programs have focused on vector control through early and repeated insecticide applications, in an effort to minimize early to midseason infections which are most damaging. Growers often terminate spray programs 2 to 3 weeks prior to crop harvest due to lack of visible treatment effects on crop yield or quality. However, recent studies on vector transmission and host-pathogen interactions have revealed that late-season infections pose a significant, previously unrecognized, threat to crop quality. The pathogen can move from an infected leaf to tubers within 2 days; however, tubers infected less than 1 week before harvest will remain asymptomatic and the pathogen will be undetectable. When these tubers are placed into storage they are assumed to be disease free. However, Lso can continue to multiply in respiring tubers during storage, resulting in reduced tuber quality. Likewise, if plants become infected a few days before vines are killed, ZC can continue to develop in infected tubers before they are harvested. Perspectives on the significance of late-season infections and some of the more important issues associated with those infections are discussed. PMID:25894320

  11. The vegetation of the farms Ingleside and Welgedacht of the Mountain Zebra National Park, Eastern Cape

    Directory of Open Access Journals (Sweden)

    L.R. Brown

    2005-12-01

    Full Text Available South Africa is well known for its semi-arid lowland areas that have a distinct flora and species composition. Because ecosystems react differently to different management practices, it is important that a description and classification of the vegetation of an area be done. As part of a vegetation survey programme for the newly acquired farms incorporated into the Mountain Zebra National Park, the vegetation of the Ingleside and Welgedacht sections were surveyed following the Braun-Blanquet approach. From a TWINSPAN classification, refined by Braun-Blanquet procedures, 10 shrub and grassland plant communities, which can be grouped into seven major groups, were identified. A classification and description of these communities, as well as a vegetation map are presented. The diagnostic species as well as the prominent and less conspicuous species of the tree, shrub, herb and grass strata are outlined. The area generally comprises lowland communities and higher-lying communities. The lower-lying communities consist mainly of two communities and comprise the largest proportion of the area in hectares. In contrast, the higher-lying communities are more diverse with specific habitats. Using the Ecological Index Method the veld condition and grazing capacity were calculated for each community and the total study area. Large sections of the lowland areas are overgrazed due to previous farming grazing practices while the higher-lying areas that were less accessible to the animals are in a slightly better condition. Overall this has resulted in the area generally being degraded within a high grazing capacity of 30.1 ha/LSU.

  12. Effect of laying sequence on egg mercury in captive zebra finches: an interpretation considering individual variation.

    Science.gov (United States)

    Ou, Langbo; Varian-Ramos, Claire W; Cristol, Daniel A

    2015-08-01

    Bird eggs are used widely as noninvasive bioindicators for environmental mercury availability. Previous studies, however, have found varying relationships between laying sequence and egg mercury concentrations. Some studies have reported that the mercury concentration was higher in first-laid eggs or declined across the laying sequence, whereas in other studies mercury concentration was not related to egg order. Approximately 300 eggs (61 clutches) were collected from captive zebra finches dosed throughout their reproductive lives with methylmercury (0.3 μg/g, 0.6 μg/g, 1.2 μg/g, or 2.4 μg/g wet wt in diet); the total mercury concentration (mean ± standard deviation [SD] dry wt basis) of their eggs was 7.03 ± 1.38 μg/g, 14.15 ± 2.52 μg/g, 26.85 ± 5.85 μg/g, and 49.76 ± 10.37 μg/g, respectively (equivalent to fresh wt egg mercury concentrations of 1.24 μg/g, 2.50 μg/g, 4.74 μg/g, and 8.79 μg/g). The authors observed a significant decrease in the mercury concentration of successive eggs when compared with the first egg and notable variation between clutches within treatments. The mercury level of individual females within and among treatments did not alter this relationship. Based on the results, sampling of a single egg in each clutch from any position in the laying sequence is sufficient for purposes of population risk assessment, but it is not recommended as a proxy for individual female exposure or as an estimate of average mercury level within the clutch. PMID:25760460

  13. Optical imaging of retinotopic maps in a small songbird, the zebra finch.

    Directory of Open Access Journals (Sweden)

    Nina Keary

    Full Text Available BACKGROUND: The primary visual cortex of mammals is characterised by a retinotopic representation of the visual field. It has therefore been speculated that the visual wulst, the avian homologue of the visual cortex, also contains such a retinotopic map. We examined this for the first time by optical imaging of intrinsic signals in zebra finches, a small songbird with laterally placed eyes. In addition to the visual wulst, we visualised the retinotopic map of the optic tectum which is homologue to the superior colliculus in mammals. METHODOLOGY/PRINCIPAL FINDINGS: For the optic tectum, our results confirmed previous accounts of topography based on anatomical studies and conventional electrophysiology. Within the visual wulst, the retinotopy revealed by our experiments has not been illustrated convincingly before. The frontal part of the visual field (0 degrees +/-30 degrees azimuth was not represented in the retinotopic map. The visual field from 30 degrees -60 degrees azimuth showed stronger magnification compared with more lateral regions. Only stimuli within elevations between about 20 degrees and 40 degrees above the horizon elicited neuronal activation. Activation from other elevations was masked by activation of the preferred region. Most interestingly, we observed more than one retinotopic representation of visual space within the visual wulst, which indicates that the avian wulst, like the visual cortex in mammals, may show some compartmentation parallel to the surface in addition to its layered structure. CONCLUSION/SIGNIFICANCE: Our results show the applicability of the optical imaging method also for small songbirds. We obtained a more detailed picture of retinotopic maps in birds, especially on the functional neuronal organisation of the visual wulst. Our findings support the notion of homology of visual wulst and visual cortex by showing that there is a functional correspondence between the two areas but also raise questions based

  14. Ocorrência de Salmonella e coliformes de origem fecal na canela em pó (Cinnamomum cassia Blume a Cinnamomum zeylanicum Nees comercializada em Florianópolis, Santa Catarina, Brasil Salmonella and fecal coliforms in cinnamon (Cinnamomum cassia Blume and Cinnamomum zeylanicum Nees sold in the city of Florianópolis, Santa Catarina, Brazil

    Directory of Open Access Journals (Sweden)

    Jane Maria de S. Philippi

    1995-12-01

    Full Text Available Cem amostras de canela em pó de dez marcas diferentes comercializadas na cidade de Florianópolis, SC, foram submetidas à análise microbiológica, pesquisando-se Salmonella e coliformes de origem fecal. Em nenhuma amostra foi detectada Salmonella. Coliformes de origem fecal foram encontrados entre os valores The microbiological quality of a hundred samples of ten differents commercial brands of a ground cinnamon (Cinnamomum cassia Blume and Cinnamomum zeylanicum Nees from supermarkets in the city of Florianópolis, Brazil, was assessed. Salmonella and fecal coliforms were determined. Results were negative for Salmonella Fecal coliforms values ranged from 100 MPN per g. Fecal coliforms were detected in 37% of the cinnamon samples.

  15. Composição nutricional e avaliação de rótulo de rações secas para cães comercializadas em Jaboticabal-SP Nutritional composition and label evaluation of dry dog foods sold in Jaboticabal-SP

    OpenAIRE

    Carciofi, A. C.; R.S. Vasconcellos; N.C. Borges; J.V. Moro; Prada, F.; V. O. Fraga

    2006-01-01

    Avaliaram-se 49 marcas de rações para cães adultos e filhotes comercializadas em Jaboticabal-SP. Os alimentos foram divididos em três segmentos: econômico, standard e super-premium. Nessa ordem, as rações para cães adultos apresentaram, em média, 16,9%, 20,9% e 27,8% de proteína, 9,7%, 10,5% e 15% de gordura, 6,4%, 2,9% e 1,1% de fibra e 1,9%, 1,9% e 1,4% de Ca. Para filhotes, os produtos standard e super-premium apresentaram, respectivamente, 26,1% e 31,0% de proteína, 10,8% e 15,2% de gordu...

  16. Qualidade parasitológica e condições higiênico-sanitárias de hortaliças comercializadas na cidade de Florianópolis, Santa Catarina, Brasil Parasitological quality and hygienic-sanitary conditions of vegetables sold in the city of Florianópolis, Santa Catarina, Brazil

    Directory of Open Access Journals (Sweden)

    Bolivar Soares

    2005-12-01

    Full Text Available Embora as hortaliças sejam amplamente comercializadas e consumidas no Brasil, o consumo de verduras cruas constitui importante meio de transmissão de parasitas intestinais. Neste estudo, avaliou-se a presença de formas transmissíveis de três tipos de hortaliças (rúcula, agrião e alface-crespa comercializadas em cinco principais pontos de venda aos consumidores (dois supermercados, dois "sacolões" e em uma feira livre, na cidade de Florianópolis, Santa Catarina, Brasil, no período de junho 2003 a maio 2004. As hortaliças in natura foram lavadas com água e esta foi submetida ao método de sedimentação, durante um período de 24 horas. Concomitante à pesquisa laboratorial, foram avaliadas as condições de cultivo e manipulação de diferentes produtores agrícolas, os quais forneciam as hortaliças que eram posteriormente comercializadas em Florianópolis. A análise parasitológica mostrou alta freqüência de parasitas intestinais na maioria das amostras analisadas (40% a 76%. Entre os fatores envolvidos na contaminação das verduras, destacaram-se a origem das águas de irrigação, o acondicionamento, o transporte e a manipulação destas durante a coleta. Conclui-se que as hortaliças comercializadas nesta região têm relevante papel na transmissão de enfermidades intestinais, havendo necessidade de medidas específicas que evitem a contaminação desses vegetais.Although vegetables are widely sold and consumed in Brazil, the ingestion of raw vegetables is an important way of transmission of intestinal parasites. In this study, the presence of transmissible forms of intestinal parasites in three vegetable species commercially available in five very busy locations (two supermarkets, two "kilo markets" and a street market located in the city of Florianópolis, Santa Catarina, Brazil, within the period between June 2003 and May 2004 was evaluated. The in natura vegetables were washed with water and the washing water was

  17. Temperature and Ca2+-dependence of the sarcoplasmic reticulum Ca2(+)-ATPase in haddock, salmon, rainbow trout and zebra cichlid

    DEFF Research Database (Denmark)

    Godiksen, Helene; Jessen, Flemming

    2002-01-01

    the enzyme or its membrane lipid environment is still a matter of discussion. In this study we compared the temperature dependence and Ca2+-dependence of SR Ca2+-ATPase in haddock (Melanogrammus aeglefinus), salmon (Salmo, salar), rainbow trout (Oncorhynchus mykiss) and zebra cichlid (Cichlasoma...... nigrofasciatum). The Arrhenius plot of zebra cichlid showed a break point at 20 degreesC, and the haddock Arrhenius plot was non-linear with pronounced changes in slope in the. temperature area, 6-14 degreesC. In Arrhenius plot from both salmon and rainbow trout a plateau exists with an almost constant SR Ca2......+- ATPase activity. The temperature range of the plateau was 14-21 and 18-25 degreesC in salmon and rainbow trout, respectively. Ca2+-dependence in the four different fish species investigated was very similar with half maximal activation (K-0.5) between 0.2 and 0.6 muM and half maximal inhibition (I-0...

  18. VY6, a β-lactoglobulin-derived peptide, altered metabolic lipid pathways in the zebra fish liver.

    Science.gov (United States)

    Mohammed-Geba, K; Arrutia, F; Do-Huu, H; Borrell, Y J; Galal-Khallaf, A; Ardura, A; Riera, Francisco A; Garcia-Vazquez, Eva

    2016-04-20

    Today enormous research efforts are being focused on alleviating the massive, adverse effects of obesity. Short peptides are key targets for research as they can be generated from natural proteins, like milk. Here we conducted trypsinogen digestion of beta-lactoglobulin (β-lg), the major mammalian milk protein, to release the hexamer VY6. It was assayed in vivo for its activities on lipid metabolism using zebra fish as a vertebrate model. Zebra fish juveniles were injected with two different doses of the peptide: 100 and 800 μg per g fish and left for 5 days before sacrificing. Lipid measurements showed significant reduction in liver triglycerides and free cholesterol, as well as increased liver HDL cholesterol. Dose-dependent increases of the mRNA levels of the genes coding for the enzymes acyl coenzyme A oxidase 1 (acox1) and lipoprotein lipase (lpl) were also found. The complete results suggest significant anti-obesity activity of the β-lg-derived VY6 peptide. Its use as a nutraceutical has been discussed. PMID:26983953

  19. Acoustic communication and sound degradation: how do the individual signatures of male and female zebra finch calls transmit over distance?

    Directory of Open Access Journals (Sweden)

    Solveig C Mouterde

    Full Text Available BACKGROUND: Assessing the active space of the various types of information encoded by songbirds' vocalizations is important to address questions related to species ecology (e.g. spacing of individuals, as well as social behavior (e.g. territorial and/or mating strategies. Up to now, most of the previous studies have investigated the degradation of species-specific related information (species identity, and there is a gap of knowledge of how finer-grained information (e.g. individual identity can transmit through the environment. Here we studied how the individual signature coded in the zebra finch long distance contact call degrades with propagation. METHODOLOGY: We performed sound transmission experiments of zebra finches' distance calls at various propagation distances. The propagated calls were analyzed using discriminant function analyses on a set of analytical parameters describing separately the spectral and temporal envelopes, as well as on a complete spectrographic representation of the signals. RESULTS/CONCLUSION: We found that individual signature is remarkably resistant to propagation as caller identity can be recovered even at distances greater than a hundred meters. Male calls show stronger discriminability at long distances than female calls, and this difference can be explained by the more pronounced frequency modulation found in their calls. In both sexes, individual information is carried redundantly using multiple acoustical features. Interestingly, features providing the highest discrimination at short distances are not the same ones that provide the highest discrimination at long distances.

  20. Developmental effects of vasotocin and nonapeptide receptors on early social attachment and affiliative behavior in the zebra finch.

    Science.gov (United States)

    Baran, Nicole M; Sklar, Nathan C; Adkins-Regan, Elizabeth

    2016-02-01

    Zebra finches demonstrate selective affiliation between juvenile offspring and parents, which, like affiliation between pair partners, is characterized by proximity, vocal communication and contact behaviors. This experiment tested the hypothesis that the nonapeptide arginine vasotocin (AVT, avian homologue of vasopressin) and nonapeptide receptors play a role prior to fledging in the development of affiliative behavior. Zebra finch hatchlings of both sexes received daily intracranial injections (post-hatch days 2-8) of either AVT, Manning Compound (MC, a potent V1a receptor antagonist) or saline (vehicle control). The social development of both sexes was assessed by measuring responsiveness to isolation from the family and subsequent reunion with the male parent after fledging. In addition, we assessed the changes in affiliation with the parents, unfamiliar males, and unfamiliar females each week throughout juvenile development. Compared to controls, MC subjects showed decreased attachment to the parents and MC males did not show the normal increase in affiliative interest in opposite sex individuals as they reached reproductive maturity. In contrast, AVT subjects showed a sustained affiliative interest in parents throughout development, and males showed increased interest in opposite sex conspecifics as they matured. These results provide the first evidence suggesting that AVT and nonapeptide receptors play organizational roles in social development in a bird. PMID:26476409

  1. Subdivisions of the auditory midbrain (n. mesencephalicus lateralis, pars dorsalis in zebra finches using calcium-binding protein immunocytochemistry.

    Directory of Open Access Journals (Sweden)

    Priscilla Logerot

    Full Text Available The midbrain nucleus mesencephalicus lateralis pars dorsalis (MLd is thought to be the avian homologue of the central nucleus of the mammalian inferior colliculus. As such, it is a major relay in the ascending auditory pathway of all birds and in songbirds mediates the auditory feedback necessary for the learning and maintenance of song. To clarify the organization of MLd, we applied three calcium binding protein antibodies to tissue sections from the brains of adult male and female zebra finches. The staining patterns resulting from the application of parvalbumin, calbindin and calretinin antibodies differed from each other and in different parts of the nucleus. Parvalbumin-like immunoreactivity was distributed throughout the whole nucleus, as defined by the totality of the terminations of brainstem auditory afferents; in other words parvalbumin-like immunoreactivity defines the boundaries of MLd. Staining patterns of parvalbumin, calbindin and calretinin defined two regions of MLd: inner (MLd.I and outer (MLd.O. MLd.O largely surrounds MLd.I and is distinct from the surrounding intercollicular nucleus. Unlike the case in some non-songbirds, however, the two MLd regions do not correspond to the terminal zones of the projections of the brainstem auditory nuclei angularis and laminaris, which have been found to overlap substantially throughout the nucleus in zebra finches.

  2. The interplay of within-species perceptual predispositions and experience during song ontogeny in zebra finches (Taeniopygia guttata).

    Science.gov (United States)

    ter Haar, Sita M; Kaemper, Wiebke; Stam, Koen; Levelt, Clara C; ten Cate, Carel

    2014-12-01

    Vocal acquisition in songbirds and humans shows many similarities, one of which is that both involve a combination of experience and perceptual predispositions. Among languages some speech sounds are shared, while others are not. This could reflect a predisposition in young infants for learning some speech sounds over others, which combines with exposure-based learning. Similarly, in songbirds, some sounds are common across populations, while others are more specific to populations or individuals. We examine whether this is also due to perceptual preferences for certain within-species element types in naive juvenile male birds, and how such preferences interact with exposure to guide subsequent song learning. We show that young zebra finches lacking previous song exposure perceptually prefer songs with more common zebra finch song element types over songs with less common elements. Next, we demonstrate that after subsequent tutoring, birds prefer tutor songs regardless of whether these contain more common or less common elements. In adulthood, birds tutored with more common elements showed a higher song similarity to their tutor song, indicating that the early bias influenced song learning. Our findings help to understand the maintenance of similarities and the presence of differences among birds' songs, their dialects and human languages. PMID:25320162

  3. Sex-biased investment in yolk androgens depends on female quality and laying order in zebra finches (Taeniopygia guttata)

    Science.gov (United States)

    Gilbert, Lucy; Rutstein, Alison N.; Hazon, Neil; Graves, Jefferson A.

    2005-04-01

    The Trivers-Willard hypothesis predicts sex biases in parental investment according to parental condition. In addition, parents may need to sex bias their investment if there is an asymmetry between the sexes in offspring fitness under different conditions. For studying maternal differential investment, egg resources are ideal subjects because they are self contained and allocated unequivocally by the female. Recent studies show that yolk androgens can be beneficial to offspring, so here we test for sex-biased investment with maternal investment of yolk testosterone (T) in zebra finch (Taeniopygia guttata) eggs. From the Trivers-Willard hypothesis, we predicted females to invest more in male eggs in optimum circumstances (e.g. good-condition mother, early-laid egg), and more in female eggs under suboptimal conditions (e.g. poor-condition mother, late-laid egg). This latter prediction is also because in this species there is a female nestling disadvantage in poor conditions and we expected mothers to help compensate for this in female eggs. Indeed, we found more yolk T in female than male eggs. Moreover, in accordance with our predictions, yolk T in male eggs increased with maternal quality relative to female eggs, and decreased with laying order relative to female eggs. This supports our predictions for the different needs and value of male and female offspring in zebra finches. Our results support the idea that females may use yolk androgens as a tool to adaptively manipulate the inequalities between different nestlings.

  4. Experimental exposure to urban and pink noise affects brain development and song learning in zebra finches (Taenopygia guttata)

    Science.gov (United States)

    Curcio, Michael T.; Swaddle, John P.; MacDougall-Shackleton, Scott A.

    2016-01-01

    Recently, numerous studies have observed changes in bird vocalizations—especially song—in urban habitats. These changes are often interpreted as adaptive, since they increase the active space of the signal in its environment. However, the proximate mechanisms driving cross-generational changes in song are still unknown. We performed a captive experiment to identify whether noise experienced during development affects song learning and the development of song-control brain regions. Zebra finches (Taeniopygia guttata) were bred while exposed, or not exposed, to recorded traffic urban noise (Study 1) or pink noise (Study 2). We recorded the songs of male offspring and compared these to fathers’ songs. We also measured baseline corticosterone and measured the size of song-control brain regions when the males reached adulthood (Study 1 only). While male zebra finches tended to copy syllables accurately from tutors regardless of noise environment, syntax (the ordering of syllables within songs) was incorrectly copied affected by juveniles exposed to noise. Noise did not affect baseline corticosterone, but did affect the size of brain regions associated with song learning: these regions were smaller in males that had been had been exposed to recorded traffic urban noise in early development. These findings provide a possible mechanism by which noise affects behaviour, leading to potential population differences between wild animals occupying noisier urban environments compared with those in quieter habitats.

  5. Invasive zebra mussels (Driessena polymorpha) and Asian clams (Corbicula fluminea) survive gut passage of migratory fish species: implications for dispersal

    Science.gov (United States)

    Gatlin, Michael R.; Shoup, Daniel E.; Long, James M.

    2013-01-01

    The introduction and spread of invasive species is of great concern to natural resource managers in the United States. To effectively control the spread of these species, managers must be aware of the multitude of dispersal methods used by the organisms. We investigated the potential for survival through the gut of a migrating fish (blue catfish, Ictalurus furcatus) as a dispersal mechanism for two invasive bivalves: zebra mussel (Driessena polymorpha) and Asian clam (Corbicula fluminea). Blue catfish (N = 62) were sampled over several months from Sooner Lake, Oklahoma, transported to a laboratory and held in individual tanks for 48 h. All fecal material was collected and inspected for live mussels. Survival was significantly related to water temperature in the lake at the time of collection, with no mussels surviving above 21.1 C°, whereas 12 % of zebra mussels (N = 939) and 39 % of Asian clams (N = 408) consumed in cooler water survived gut passage. This research demonstrates the potential for blue catfish to serve as a dispersal vector for invasive bivalves at low water temperatures.

  6. Effects of lethal and sublethal concentrations of the herbicide, triclopyr butoxyethyl ester, in the diet of zebra finches.

    Science.gov (United States)

    Holmes, S B; Thompson, D G; Wainio-Keizer, K L; Capell, S S; Staznik, B

    1994-07-01

    Lethal and sublethal effects of dietary triclopyr butoxyethyl ester (TBEE) on zebra finches (Poephila guttata Gould) were determined in laboratory experiments conducted between 8 January and 1 May 1991. The 8-day median lethal dietary concentration, LC50 (95% confidence interval), of TBEE to zebra finches was 1,923 (1,627 to 2,277) mg/kg. In the sublethal effects experiment, when birds were exposed to 500 mg/kg TBEE in the diet for 29 days, food consumption and body weight were significantly depressed (P 0.05). Perch-hopping activity was depressed relative to controls in the 500 mg/kg group, and elevated in the 150 mg/kg group, but neither of these differences was significantly (P > 0.05). Disappearance of TBEE residues from treated seeds over the 29 day experimental period followed an exponential decay model, with half-lives in the order of 15 to 18 days. On the basis of our observation that TBEE had no significant adverse effects at a concentration greater than the maximum expected environmental concentration, we propose that forestry applications of triclopyr at registered dosage rates pose little risk to wild songbirds. PMID:7933272

  7. Zebra chip disease and potato biochemistry: tuber physiological changes in response to 'Candidatus Liberibacter solanacearum' infection over time.

    Science.gov (United States)

    Rashed, A; Wallis, C M; Paetzold, L; Workneh, F; Rush, C M

    2013-05-01

    Zebra chip disease, putatively caused by the bacterium 'Candidatus Liberibacter solanacearum', is of increasing concern to potato production in Mexico, the United States, and New Zealand. However, little is known about the etiology of this disease and changes that occur within host tubers that result in its symptoms. Previous studies found that increased levels of phenolics, amino acids, defense proteins, and carbohydrates in 'Ca. L. solanacearum'-infected tubers are associated with symptoms of zebra chip. This study was conducted to quantify variations in levels of these biochemical components in relation to the time of infestation, symptom severity, and 'Ca. L. solanacearum' titer. Levels of phenolics, peroxidases, polyphenol oxidases, and reducing sugars (glucose and, to some extent, fructose) changed during infection, with higher levels occurring in tubers infected at least 5 weeks before harvest than in those infected only a week before harvest and those of controls. Compared with the apical tuber ends, greater levels of phenolics, peroxidases, and sucrose occurred at the basal (stolon attachment) end of infected tubers. With the exception of phenolics, concentrations of the evaluated compounds were not associated with 'Ca. L. solanacearum' titer. However, there were significant associations between biochemical responses and symptom severity. The lack of a linear correlation between most plant biochemical responses and 'Ca. L. solanacearum' titer suggests that shifts in metabolic profiles are independent of variations in 'Ca. L. solanacearum' levels. PMID:23425237

  8. Short-term exposure to testosterone propionate leads to rapid bill color and dominance changes in zebra finches.

    Science.gov (United States)

    Ardia, Daniel R; Broughton, Deanna R; Gleicher, Michael J

    2010-08-01

    Testosterone (T) can influence both male-male competition and mate choice displays. In zebra finches, female mate choice is based in part on bill color, and bill color has been shown to be enhanced by long-term testosterone supplementation. However, it is not clear whether bill color plays a role in male-male interactions and how bill color responds to shorter-term changes in T. We tested whether a single injection of testosterone propionate (TP) would influence male-male dominance interactions and lead to rapid (over a three-day period) changes in bill color. In addition, we tested whether bill color predicted aggression and dominance. We allowed birds in triads to establish hierarchies and then injected either dominant or subordinate individuals with TP, in addition to establishing sham control triads. We found that red chroma, but not hue, predicted aggressiveness of males. Exposure to TP led both dominant and subordinate birds to increase dominance scores over three days, longer than the bill. Our results suggest that zebra finches can modulate T and bill color levels over short time periods and these changes may occur through positive feedback between T-levels and dominance. PMID:20406643

  9. Evaluation of Octhylphenol Effect on Development and Survival on Zebra Fish (Danio Rerio During Different Ontogenic Period

    Directory of Open Access Journals (Sweden)

    Gabi Dumitrescu

    2010-05-01

    Full Text Available This paper is part of a complex study of our research collective that studies the toxic effect of the ethinylestradiolum, and some of the polyethoxylated alkylphenols on the growth and reproduction of the Zebra fish (Danio rerio and of the common Carp (Cyprinus carpio. Our study aim was to evaluate the effect of octylphenol on growth and survival of zebra fish, from 21-115 days, and within 21-75 days of life. For this purpose, for each period under study, fishes were divided into three groups of 30 individuals, named: Lot 1 - Control, respectively lots 2 and 3, at which the administrated octylphenol concentrations were of 60 μg L-1, respectively 100 μg L-1. Fishes of the six groups were raised in 30-liters aquariums (30 fish / aquarium. The growth was measured by weighing and biometric measurements (total length, standard length, the length of the head, maximal height, minimal height and the mass of the body, while the surviving rate was established at the end of every period and at the end of the experiment, when we were able to calculate the total number of dead fish. Biometric study of the analysis performed in 75 days, 115 days respectively shows that octylphenol has negative influence on body development, and survival both, the highest percentage of mortality (46,66% was registered at 100 μgL-1 concentration, between 21 -75 days.

  10. A sensitive fluorescent sensor for the detection of endogenous hydroxyl radicals in living cells and bacteria and direct imaging with respect to its ecotoxicity in living zebra fish.

    Science.gov (United States)

    Liu, Fei; Du, Juan; Song, Da; Xu, Meiying; Sun, Guoping

    2016-03-17

    We have synthesized a novel fluorescent probe, , which shown a high potential for imaging of endogenous ˙OH in living cells and various types of bacteria. In addition, it is an excellent sensor for in vivo imaging of ˙OH generated following treatment with TiO2NPs in zebra fish. PMID:26947623

  11. Entomopathogenic fungi (Hypocreales) for control of potato psyllid, Bactericerta cockerelli (Sulc)(Hemiptera: Triozidae) in an area endemic for zebra chip disease of potato

    Science.gov (United States)

    Potato psyllid, Bactericera cockerelli (Šulc), is a serious pest of potato, tomato and other solanaceous vegetables in the United States, Mexico, Central America, and New Zealand and is responsible for transmission of Candidatus Liberibacter solanacearum causing a disease known as “zebra chip” (ZC)....

  12. Developmental exposure to a brominated flame retardant: An assessment of effects on physiology, growth, and reproduction in a songbird, the zebra finch

    International Nuclear Information System (INIS)

    Mixtures of polybrominated diphenyl ethers (PBDEs) have been widely used as additive flame retardants, and BDE-99 is one of the most predominant congeners found in the environment. BDE-99 has been reported in avian samples worldwide, yet knowledge of its toxicity to birds is minimal. We assessed the short- and long-term effects of nestling exposure to environmentally relevant levels of BDE-99 in a model passerine, the zebra finch. Early exposure to BDE-99 did not affect hematocrit, oxidative stress, or thyroid hormones in either the juvenile or adult stages, and there were no effects on chick growth or survival. BDE-99 exposure caused a dose-dependent delay in timing of reproduction, but there were no other effects on reproductive success. In zebra finches, endpoints related to reproductive behavior appear to be the most sensitive to BDE-99. However, passerines overall appear to be less sensitive than birds of prey or mammals to PBDE exposure. -- Highlights: •We exposed zebra finches nestlings to BDE-99 and raised them to sexual maturity. •Found no effects on physiology, chick growth, survival, or reproductive success. •As BDE-99 dose increased, laying interval increased. •Passerine birds possibly less sensitive to BDE-99 than mammals or other bird species. -- Nestling exposure to BDE-99 affects timing of breeding in zebra finches, but overall passerines appear to be less sensitive to PBDEs than mammals or other bird species

  13. A cost-benefit analysis of preventative management for zebra and quagga mussels in the Colorado-Big Thompson System

    Science.gov (United States)

    Thomas, Catherine M.

    2010-01-01

    Zebra and quagga mussels are fresh water invaders that have the potential to cause severe ecological and economic damage. It is estimated that mussels cause $1 billion dollars per year in damages to water infrastructure and industries in the United States (Pimentel et al., 2004). Following their introduction to the Great Lakes in the late 1980s, mussels spread rapidly throughout the Mississippi River Basin and the Eastern U.S. The mussel invasion in the West is young. Mussels were first identified in Nevada in 2007, and have since been identified in California, Arizona, Colorado, Utah, and Texas. Western water systems are very different from those found in the East. The rapid spread of mussels through the eastern system was facilitated by connected and navigable waterways. Western water systems are less connected and are characterized by man-made reservoirs and canals. The main vector of spread for mussels in the West is overland on recreational boats (Bossenbroek et al., 2001). In response to the invasion, many western water managers have implemented preventative management programs to slow the overland spread of mussels on recreational boats. In Colorado, the Colorado Department of Wildlife (CDOW) has implemented a mandatory boat inspection program that requires all trailered boats to be inspected before launching in any Colorado water body. The objective of this study is to analyze the costs and benefits of the CDOW boat inspection program in Colorado, and to identify variables that affect the net benefits of preventative management. Predicting the potential economic benefits of slowing the spread of mussels requires integrating information about mussel dispersal potential with estimates of control costs (Keller et al., 2009). Uncertainty surrounding the probabilities of establishment, the timing of invasions, and the damage costs associated with an invasion make a simulation model an excellent tool for addressing "what if" scenarios and shedding light on the

  14. Mutations of amino acids in the DNA-recognition domain of Epstein-Barr virus ZEBRA protein alter its sub-nuclear localization and affect formation of replication compartments

    International Nuclear Information System (INIS)

    ZEBRA, a transcription factor and DNA replication protein encoded by the Epstein-Barr virus (EBV) BZLF1 gene, plays indispensable roles in the EBV lytic cycle. We recently described the phenotypes of 46 single amino acid substitutions introduced into the DNA-recognition region of ZEBRA [Heston, L., El-Guindy, A., Countryman, J., Dela Cruz, C., Delecluse, H.J., and Miller, G. 2006]. The 27 DNA-binding-proficient mutants exhibited distinct defects in their ability to activate expression of the kinetic classes of viral genes. Four phenotypic variants could be discerned: wild-type, defective at activating Rta, defective at activating early genes, and defective at activating late genes. Here we analyze the distribution of ZEBRA within the nucleus and the localization of EA-D (the viral DNA polymerase processivity factor), an indicator of the development of replication compartments, in representatives of each phenotypic group. Plasmids encoding wild-type (WT) and mutant ZEBRA were transfected into 293 cells containing EBV-bacmids. WT ZEBRA protein was diffusely and smoothly distributed throughout the nucleus, sparing nucleoli, and partially recruited to globular replication compartments. EA-D induced by WT ZEBRA was present diffusely in some cells and concentrated in globular replication compartments in other cells. The distribution of ZEBRA and EA-D proteins was identical to WT following transfection of K188R, a mutant with a conservative change. The distribution of S186A mutant ZEBRA protein, defective for activation of Rta and EA-D, was identical to WT, except that the mutant ZEBRA was never found in globular compartments. Co-expression of Rta with S186A mutant rescued diffuse EA-D but not globular replication compartments. The most striking observation was that several mutant ZEBRA proteins defective in activating EA-D (R179A, K181A and A185V) and defective in activating lytic viral DNA replication and late genes (Y180E and K188A) were localized to numerous punctate

  15. Carotenos e provitamina A em bertalha e ervas aromáticas comercializadas em Viçosa, Estado de Minas Gerais, durante as quatro estações do ano - DOI: 10.4025/actascihealthsci.v28i1.1122 Carotenes and provitamin A in basella and aromatic herbs marketed in Viçosa, Minas Gerais State, during the four seasons of the year - DOI: 10.4025/actascihealthsci.v28i1.1122

    OpenAIRE

    José Benício Paes Chaves; Helena Maria Pinheiro-Sant'Ana; Marina Andrade Batista; Flávia Aparecida Moraes

    2006-01-01

    Este estudo teve como objetivos investigar o teor de α-caroteno, β-caroteno e calcular o valor de vitamina A em hortaliças comercializadas no mercado formal e informal de Viçosa, Estado de Minas Gerais, bem como avaliar a influência das quatro estações do ano e do local de comercialização sobre o conteúdo desses nutrientes. As hortaliças (bertalha, cebolinha, coentro, manjericão e salsa) foram analisadas utilizando-se a cromatografia líquida de alta eficiência (CLAE). Devido ao con...

  16. Avaliação parasitológica em alfaces (Lactuca sativa L. comercializadas em Serra Talhada, Pernambuco, Brasil / Parasitological evaluation in lettuces (Lactuca sativa L. marketed in Serra Talhada, Pernambuco, Brazil

    Directory of Open Access Journals (Sweden)

    Rebeca Gonçalves de Oliveira

    2014-08-01

    Full Text Available A prevalência de parasitoses intestinais cresce de forma expansiva no Brasil e em muitos países. A ocorrência de enteroparasitoses advém de várias maneiras, inclusive por con-sumo de vegetais contaminados, representando um grande problema em nível mundial. O objetivo deste trabalho foi avaliar a contaminação por parasitas intestinais em horta-liças comercializadas em Serra Talhada-PE. As amostras das hortaliças foram coletadas nas unidades de produção (hortas, na unidade de recepção do Programa de Aquisição de Alimentos (PAA e em diversos estabelecimentos comerciais localizadas no município. As amostras foram colocadas em sacos plásticos e mantidas em caixa isotérmica; em seguida, foram encaminhadas ao laboratório de Biologia da Unidade Acadêmica de Serra Talhada-UFRPE. Para a identificação dos parasitas foi utilizado o método de sedimenta-ção espontânea. Observou-se que das 80 amostras de alface analisadas 97,5% estavam positivas para formas parasitárias e outros organismos microscópicos, incluindo ovos e larvas de nematoides, cistos de protozoários, ovos de cestódeos e alguns artrópodes (insetos e ácaros. É de suma importância o conhecimento dos produtores e manipu-ladores em geral a respeito da contaminação, bem como o conhecimento das técnicas sanitizantes desenvolvidas para hortaliças, com intuito de diminuir a contaminação em todas as etapas ocorrentes desde o cultivo até ao consumo. ------------------------------------------------------------------------------------- Prevalence of intestinal parasites growing in Brazil and in many countries so expansive. The intestinal parasites comes in several ways, including by consumption of contami-nated vegetables, which represents a significant worldwide problem. The objective of this study is to assess the contamination by intestinal parasites in vegetables commer-cialized in Serra Talhada, in Pernambuco state. Samples of vegetables were collected at the

  17. Quality assessment of fruit pulps industrialized and commercialized in the city of Boa Vista – RR = Avaliação da qualidade de polpas de frutos industrializadas e comercializadas no município de Boa Vista – RR

    Directory of Open Access Journals (Sweden)

    Cássia Rejane Nascimento

    2012-12-01

    Full Text Available This work aimed to study the quality of frozen pulp, manufactured and marketed in Boa Vista - RR, through physico-chemical analysis. It were selected six Agroindustries that produce and market pulp in establishments located in Fair Passarão, supermarkets and home of juices, identified by the letters A, B, C, D, E and F. The variables studied were: soluble solids, titratable acidity and vitamin C, of the flavors: acerola, caja, cupuaçu, guava, soursop and passion fruit. The experiment was conducted in completely randomized design, being analyzed six brands of fruits pulps and six different fruits, with three replicates. The observed results demonstrate that none of the companies processing fruit pulp detail their identification inaccordance with the legislation. In the variables studied, only the cupuaçu pulp brands C and D and soursop brands B, C, D and E were in accordance with the technical regulation for fixing the identity and quality standard. Considering the variables in question, it was found that variations in the levels encountered and not adequacy of these standards could be minimized by the standardization of raw materials and processes used. =Objetivou-se com o presente trabalho estudar a qualidade de polpas congeladas, fabricadas e comercializadas no município de Boa Vista – RR, por meio de análises físico-químicas. Foram selecionadas seis Agroindústrias que produzem polpa e comercializam em estabelecimentos próprios localizados na Feira do Passarão, supermercados e casa de sucos, sendo identificadas pelas letras A, B, C, D, E e F. As variáveis estudadas foram: sólidos solúveis, acidez titulável e vitamina C, dos sabores: acerola, cajá, cupuaçu, goiaba, graviola e maracujá. O experimento foi conduzido em delineamento inteiramentecasualizado, sendo analisadas seis marcas de polpas e seis frutos diferentes, com três repetições. Os resultados observadosdemonstram que nenhuma das empresas de processamento de polpa

  18. Avaliação da concentração de flúor em águas minerais comercializadas no Brasil Evaluation of fluoride content of bottled drinking waters in Brazil

    Directory of Open Access Journals (Sweden)

    Rita S. Villena

    1996-12-01

    Full Text Available A utilização de flúor sistêmico deve ser controlada em termos de risco/benefício, pois enquanto a subdosagem não trouxer benefício anticárie, a sobredosagem estará associada com fluorose dental. Assim, uma das preocupações é o consumo de águas minerais, o qual tem aumentado nos últimos anos. Deste modo, foi realizado estudo com o objetivo de analisar a concentração de flúor em águas minerais comercializadas no Brasil. Foram analisadas 104 marcas comerciais, de diferentes regiões do País. Utilizou-se eletrodo específico Orion 96-09 e analisador de íons Orion EA 940, previamente calibrados com soluções padrões de flúor. Foram observadas concentrações de flúor variando de 0,0 a 4,4 ppm. Constataram-se: 1 Concentrações significativas de flúor não relatadas pelo produtor; 2 Concentrações de flúor sem significado preventivo anti-cárie, embora o produtor destaque na embalagem "Água Mineral Fluoretada"; 3 Concentrações de flúor capazes de provocar fluorose dental severa, embora o produtor não faça nenhuma referência que o mesmo existe. Conclui-se ser necessário um Sistema de Vigilância Sanitária para o controle de flúor nas águas minerais oferecidas à população brasileira, quer seja em termos de benefício como de risco.The utilization of a systemic fluoride method must be controlled in terms of risks and benefits. The reason for this is that while a small dose will not be effective in preventing dental caries, a larger dose may cause dental fluorosis. Therefore the knowledge of the fluoride concentration found in the bottled mineral waters sold throughout the Brazilian market the consumption of which has increased lately, is of great concern. The objective of the study was the analysis of the concentration of fluoride found in the bottled mineral waters. A hundred and four brands coming from different regions of Brazil were analysed using an Orion 96-09 ion specific electrode and an Orion EA 940

  19. Plantas medicinais e de uso religioso comercializadas em mercados e feiras livres no Rio de Janeiro, RJ, Brasil Medical and religious plants commercialized in conventional and open-air markets of Rio de Janeiro municipality Rio de Janeiro State, Brazil

    Directory of Open Access Journals (Sweden)

    Sheila Karla Santos de Azevedo

    2006-03-01

    Full Text Available Esse estudo objetivou o levantamento das espécies comercializadas em feiras livres e mercados no Rio de Janeiro, a verificação da utilização (medicinais e/ou de uso religioso e as formas de obtenção das mesmas (cultivo e/ou extrativismo em Mata Atlântica e/ou áreas ruderais. Foram visitadas quatro feiras livres e quatro mercados e realizadas coletas de campo, na Serra do Mendanha, acompanhadas por um informante. As informações foram provenientes de observação participante e entrevistas semi-estruturadas. Foram inventariadas 127 espécies pertencentes a 58 famílias, sendo Asteraceae (17 espécies, Lamiaceae (9, Leguminosae (7, Euphorbiacaea, Lauraceae, Piperaceae e Solanaceae (5 as de maior riqueza. A maioria das espécies é utilizada para fins terapêuticos (70,1% e existe um relativo equilíbrio entre extrativismo (40,4% e cultivo (52,8% para estas, com poucas incluídas nos dois casos (6,7%. Em relação às plantas utilizadas para fins religiosos, constatou-se que o extrativismo (64,3% sobrepõe-se ao cultivo (32,1%, com apenas 3,6% em ambos os casos. A coleta se dá predominantemente na Mata Atlântica (83,3%, em áreas que fazem parte ou circundam Unidades de Conservação. Isto reflete a crença de que estas espécies devam ser retiradas preferencialmente de seus locais de origem. Sugere-se que a pressão de coleta exercida sobre as plantas de uso religioso na Mata Atlântica contribua para a vulnerabilidade das mesmas.This paper has as a main goal to study the species commercialized in both conventional and open-air markets in Rio de Janeiro. It is reported the concurrency of the type of use (medical and/or religious together with the collection procedure of these plants, arising from cultivation and/or extraction from the Atlantic Rain Forest and/or from wastelands. Four open-air markets and four conventional markets were visited for this study, while the field collection in the Serra do Mendanha was accompanied by an

  20. Contaminação por compostos organoclorados em salsichas hot-dog comercializadas na cidade de Santa Maria (RS, Brasil Contamination for organochlorine compounds in hot-dog sausages, commercialized in the city of Santa Maria (RS, Brazil

    Directory of Open Access Journals (Sweden)

    Stanislau Bogusz Junior

    2004-10-01

    Full Text Available Com o objetivo de monitorar os resíduos de compostos tóxicos em alimentos, verificou-se a freqüência e os níveis de praguicidas organoclorados (OC e bifenilas policloradas (PCBs em amostras de salsichas Hot-Dog, comercializadas na Cidade de Santa Maria, Estado do Rio Grande do Sul (RS e, compararam-se os valores com aqueles estabelecidos pela Legislação. Para as análises, procedeu-se a extração da gordura das amostras. A partir da purificação desta, obteve-se um extrato do qual se determinaram os resíduos organoclorados por cromatografia gasosa com detector de captura eletrônica (CG - µECD63Ni. Verificou-se que o lindano e o HCB foram os pesticidas que apresentaram as maiores concentrações médias (0,001798ppm e 0,001652ppm, respectivamente. O somatório dos níveis médios dos pesticidas organoclorados detectados foi de 0,015783ppm, sendo que deste total 0,011165ppm pertencia aos metabólitos do DDT. Quanto as bifenilas policloradas, as maiores concentrações médias corresponderam às PCBs 10 (0,001817ppm e 28 (0,000317ppm. O somatório das PCBs foi de 0,002172ppm. As concentrações de praguicidas organoclorados e PCBs encontradas nas amostras analisadas estavam abaixo dos limites máximos permitidos pela legislação.With the objective of monitoring toxic compounds residues in food, the frequency and levels of organochlorine pesticides and polychlorinated biphenyls were verified in sausage samples, hot dog type, commercialized in the city of Santa Maria (RS, Brazil. Values were compared with the ones established by Brazilian legislation. For the analyses the extraction of fat from the samples was done. From the purification of the fat, there was acquisition of an extract in which was determined the organochlorine contaminants residues by gas chromatography with electronic capture detector (CG - µECD63Ni. It was learned that the lindane and HCB were the pesticides that presented the biggest concentration averages (0

  1. Epi-genetics modifications induced by a depleted uranium exposure in the zebra fish

    Energy Technology Data Exchange (ETDEWEB)

    Gombeau, K.; Pereira, S.; Adam-Guillermin, C. [IRSN/PRP-ENV/SERIS/LECO (France); Bourdineaud, J.P. [UMR CNRS 5805 EPOC (France); Ravanat, J.L. [INAC/Scib UMR E3 CEA-UJF (France)

    2014-07-01

    The work presented here integrates in the general framework of assessment of effects of chronic exposure to low doses of radionuclides. This evaluation necessarily involves the study of the mechanisms of toxic action at the cellular or subcellular level, in order to better understand the processes of propagation of effects to the level of the populations or ecosystems. As such, the question of the mechanisms underlying the trans-generational effects and the adaptive capacity of organisms is central, both in humans and in animal species. Epigenetic refer to changes in gene function that do not involve changes in DNA sequence, and which are transmitted in a hereditary manner by mitosis or meiosis. The latter plays a key role in these trans-generational effects. Among these changes, DNA-methylation is one of the most studied epigenetic parameters. This work is part of a PhD, included in the European COMET project (Euratom 7. Framework Program), and focuses on epigenetic modifications induced in zebra fish after a chronic exposure to radionuclides. Male and female fishes were exposed to 2 and 20 μg.L{sup -1} of depleted uranium for 24 days. After 7 and 24 days of exposure, brain, gonads, and eyes were collected in order to study changes in DNA methylation. In addition, genotoxicity was measured by the γH2AX assay. The overall changes in DNA methylation were studied by AFLP-MS and HPLC-MS, in order to know if the exposure to depleted uranium changes the global status of DNA methylation. We have found a decrease in the global level of methylation in the eyes of males after 24 days of exposure, the diminution being much more important and significant at the higher concentration of exposure (11.79 ± 3.62 against 52.43 ± 3.01 for controls) This study will be refined by analyzing the methylation of specific regions of the genome, because it represent the sequences of genes involved in major physiological functions and that may be subject to variations in the methylation

  2. Epi-genetics modifications induced by a depleted uranium exposure in the zebra fish

    International Nuclear Information System (INIS)

    The work presented here integrates in the general framework of assessment of effects of chronic exposure to low doses of radionuclides. This evaluation necessarily involves the study of the mechanisms of toxic action at the cellular or subcellular level, in order to better understand the processes of propagation of effects to the level of the populations or ecosystems. As such, the question of the mechanisms underlying the trans-generational effects and the adaptive capacity of organisms is central, both in humans and in animal species. Epigenetic refer to changes in gene function that do not involve changes in DNA sequence, and which are transmitted in a hereditary manner by mitosis or meiosis. The latter plays a key role in these trans-generational effects. Among these changes, DNA-methylation is one of the most studied epigenetic parameters. This work is part of a PhD, included in the European COMET project (Euratom 7. Framework Program), and focuses on epigenetic modifications induced in zebra fish after a chronic exposure to radionuclides. Male and female fishes were exposed to 2 and 20 μg.L-1 of depleted uranium for 24 days. After 7 and 24 days of exposure, brain, gonads, and eyes were collected in order to study changes in DNA methylation. In addition, genotoxicity was measured by the γH2AX assay. The overall changes in DNA methylation were studied by AFLP-MS and HPLC-MS, in order to know if the exposure to depleted uranium changes the global status of DNA methylation. We have found a decrease in the global level of methylation in the eyes of males after 24 days of exposure, the diminution being much more important and significant at the higher concentration of exposure (11.79 ± 3.62 against 52.43 ± 3.01 for controls) This study will be refined by analyzing the methylation of specific regions of the genome, because it represent the sequences of genes involved in major physiological functions and that may be subject to variations in the methylation of the

  3. PHA-stimulated immune-responsiveness in mercury-dosed zebra finches does not match results from environmentally exposed songbirds.

    Science.gov (United States)

    Caudill, Mitchell T; Spear, Eliza L; Varian-Ramos, Claire W; Cristol, Daniel A

    2015-04-01

    Dietary mercury exposure is associated with suppressed immune responsiveness in birds. This study examined the immune-responsiveness of domestic zebra finches (Taeniopygia guttata) experimentally exposed to mercury through their diet. We used the phytohemagglutinin (PHA) skin-swelling test to assay the effect of two modes of mercury exposure. Some finches received exposure to mercury only after reaching sexual maturity, while others were maintained on a mercury-dosed diet throughout life, including development. Each bird received one of five dietary concentrations of methylmercury cysteine (0.0, 0.3, 0.6, 1.2 or 2.4 ppm). In contrast to a study on wild songbirds at a mercury-contaminated site, we detected no relationship between mercury level and immunological response to PHA, regardless of mode of exposure. This result represents the first major difference found by our laboratory between wild birds exposed to environmental mercury and captive birds experimentally exposed to mercury. PMID:25638440

  4. Research progress on potato zebra chip disease%马铃薯斑马片病研究进展

    Institute of Scientific and Technical Information of China (English)

    李志强

    2012-01-01

    马铃薯斑马片病(potato zebra chip disease)是20世纪90年代中期在南美洲首次发现的新病害.近年该病害在美国、墨西哥及新西兰等地扩散为害,对当地马铃薯生产构成严重威胁.同时,也为害其他茄科作物.为此,对该病害的发生历史、分布、为害、病原、发生规律、检测技术及防控措施进行综述,并指出应加强检疫,防止该病害传入我国.

  5. X-ray pulse shaping in experiments with planar wire arrays at the 1.6 MA Zebra generator

    International Nuclear Information System (INIS)

    The shaping of the x-ray radiation pulse is very important in both radiation physics research and Inertial Confinement Fusion studies. The novel planar wire array (PWA) was found to be the effective radiator tested at the university-scale 1.6 MA, 100 ns Zebra generator. The single PWA consists of a single row of wires that are parallel to each other, while the double planar wire array (DPWA) and triple planar wire array (TPWA) include two or three parallel plane wire rows, respectively. All multi-planar geometries resulted in a cascade-type array implosion with a complicated multi-step precursor formation before plasma stagnation. The PWAs (without additional core foam target) feature a dynamic precursor evolution that is a powerful tool for x-ray pulse shaping. The shape and timing of the x-ray pulse from different PWAs were theoretically predicted and experimentally analyzed for a variety of planar wire arrays.

  6. A newly discovered superoantero-orbital sinus connecting to the interaural canal may play a role in zebra finch hearing

    DEFF Research Database (Denmark)

    Jensen, Kenneth Kragh; Christensen-Dalsgaard, Jakob; Suthers, Roderick A.; Larsen, Ole Næsbye

    to the orbits (superoantero-orbital sinus, SAOS) connects to the IAC via a tube inferomedial to the orbits (IMT). SAOS has a very complex shape with connections through an arc over the eye to the bullae of each ear and also to two smaller lateral sinuses in front of each eye. The contribution of this...... structure to auditory sensitivity has not been studied previously. We hypothesized that the extra air volume could form a resonator influencing the gain and delay of IAC. We tested the hypothesis by measuring sound transmission through IAC of zebra finches before and after filling the SAOS with a silicone...... impression medium. Six out of seven individuals showed an effect of filling the SAOS or the IMT on directionality and overall auditory sensitivity. The SAOS therefore does seem to have an effect on gain and delay in the interaural canal as well as on auditory sensitivity. The effect, however, was complex and...

  7. Extracellular acidification activates ovarian cancer G-protein-coupled receptor 1 and GPR4 homologs of zebra fish.

    Science.gov (United States)

    Mochimaru, Yuta; Azuma, Morio; Oshima, Natsuki; Ichijo, Yuta; Satou, Kazuhiro; Matsuda, Kouhei; Asaoka, Yoichi; Nishina, Hiroshi; Nakakura, Takashi; Mogi, Chihiro; Sato, Koichi; Okajima, Fumikazu; Tomura, Hideaki

    2015-02-20

    Mammalian ovarian G-protein-coupled receptor 1 (OGR1) and GPR4 are identified as a proton-sensing G-protein-coupled receptor coupling to multiple intracellular signaling pathways. In the present study, we examined whether zebra fish OGR1 and GPR4 homologs (zOGR1 and zGPR4) could sense protons and activate the multiple intracellular signaling pathways and, if so, whether the similar positions of histidine residue, which is critical for sensing protons in mammalian OGR and GPR4, also play a role to sense protons and activate the multiple signaling pathways in the zebra fish receptors. We found that extracellular acidic pH stimulated CRE-, SRE-, and NFAT-promoter activities in zOGR1 overexpressed cells and stimulated CRE- and SRE- but not NFAT-promoter activities in zGPR4 overexpressed cells. The substitution of histidine residues at the 12th, 15th, 162th, and 264th positions from the N-terminal of zOGR1 with phenylalanine attenuated the proton-induced SRE-promoter activities. The mutation of the histidine residue at the 78th but not the 84th position from the N-terminal of zGPR4 to phenylalanine attenuated the proton-induced SRE-promoter activities. These results suggest that zOGR1 and zGPR4 are also proton-sensing G-protein-coupled receptors, and the receptor activation mechanisms may be similar to those of the mammalian receptors. PMID:25576873

  8. Early Life Manipulations of the Nonapeptide System Alter Pair Maintenance Behaviors and Neural Activity in Adult Male Zebra Finches.

    Science.gov (United States)

    Baran, Nicole M; Tomaszycki, Michelle L; Adkins-Regan, Elizabeth

    2016-01-01

    Adult zebra finches (T. guttata) form socially monogamous pair bonds characterized by proximity, vocal communication, and contact behaviors. In this experiment, we tested whether manipulations of the nonapeptide hormone arginine vasotocin (AVT, avian homolog of vasopressin) and the V1a receptor (V1aR) early in life altered species-typical pairing behavior in adult zebra finches of both sexes. Although there was no effect of treatment on the tendency to pair in either sex, males in different treatments exhibited profoundly different profiles of pair maintenance behavior. Following a brief separation, AVT-treated males were highly affiliative with their female partner but sang very little compared to Controls. In contrast, males treated with a V1aR antagonist sang significantly less than Controls, but did not differ in affiliation. These effects on behavior in males were also reflected in changes in the expression of V1aR and immediate early gene activity in three brain regions known to be involved in pairing behavior in birds: the medial amygdala, medial bed nucleus of the stria terminalis, and the lateral septum. AVT males had higher V1aR expression in the medial amygdala than both Control and antagonist-treated males and immediate early gene activity of V1aR neurons in the medial amygdala was positively correlated with affiliation. Antagonist treated males showed decreased activity in the medial amygdala. In addition, there was a negative correlation between the activity of V1aR cells in the medial bed nucleus of the stria terminalis and singing. Treatment also affected the expression of V1aR and activity in the lateral septum, but this was not correlated with any behaviors measured. These results provide evidence that AVT and V1aR play developmental roles in specific pair maintenance behaviors and the neural substrate underlying these behaviors in a bird. PMID:27065824

  9. Early Life Manipulations of the Nonapeptide System Alter Pair Maintenance Behaviors and Neural Activity in Adult Male Zebra Finches

    Directory of Open Access Journals (Sweden)

    Nicole M. Baran

    2016-03-01

    Full Text Available Adult zebra finches (T. guttata form socially monogamous pair bonds characterized by proximity, vocal communication, and contact behaviors. In this experiment, we tested whether manipulations of the nonapeptide hormone arginine vasotocin (AVT, avian homologue of vasopressin and the V1a receptor (V1aR early in life altered species-typical pairing behavior in adult zebra finches of both sexes. Although there was no effect of treatment on the tendency to pair in either sex, males in different treatments exhibited profoundly different profiles of pair maintenance behavior. Following a brief separation, AVT-treated males were highly affiliative with their female partner but sang very little compared to Controls. In contrast, males treated with a V1aR antagonist sang significantly less than Controls, but did not differ in affiliation. These effects on behavior in males were also reflected in changes in the expression of V1aR and immediate early gene activity in three brain regions known to be involved in pairing behavior in birds: the medial amygdala, medial bed nucleus of the stria terminalis, and the lateral septum. AVT males had higher V1aR expression in the medial amygdala than both Control and antagonist-treated males and immediate early gene activity of V1aR neurons in the medial amygdala was positively correlated with affiliation. Antagonist treated males showed decreased activity in the medial amygdala. In addition, there was a negative correlation between the activity of V1aR cells in the medial bed nucleus of the stria terminalis and singing. Treatment also affected the expression of V1aR and activity in the lateral septum, but this was not correlated with any behaviors measured. These results provide evidence that AVT and V1aR play developmental roles in specific pair maintenance behaviors and the neural substrate underlying these behaviors in a bird.

  10. Cellular energy allocation in zebra mussels exposed along a pollution gradient: linking cellular effects to higher levels of biological organization

    International Nuclear Information System (INIS)

    Organisms exposed to suboptimal environments incur a cost of dealing with stress in terms of metabolic resources. The total amount of energy available for maintenance, growth and reproduction, based on the biochemical analysis of the energy budget, may provide a sensitive measure of stress in an organism. While the concept is clear, linking cellular or biochemical responses to the individual and population or community level remains difficult. The aim of this study was to validate, under field conditions, using cellular energy budgets [i.e. changes in glycogen-, lipid- and protein-content and mitochondrial electron transport system (ETS)] as an ecologically relevant measurement of stress by comparing these responses to physiological and organismal endpoints. Therefore, a 28-day in situ bioassay with zebra mussels (Dreissena polymorpha) was performed in an effluent-dominated stream. Five locations were selected along the pollution gradient and compared with a nearby (reference) site. Cellular Energy Allocation (CEA) served as a biomarker of cellular energetics, while Scope for Growth (SFG) indicated effects on a physiological level and Tissue Condition Index and wet tissue weight/dry tissue weight ratio were used as endpoints of organismal effects. Results indicated that energy budgets at a cellular level of biological organization provided the fastest and most sensitive response and energy budgets are a relevant currency to extrapolate cellular effects to higher levels of biological organization within the exposed mussels. - Exposure of zebra mussels along a pollution gradient has adverse effects on the cellular energy allocation, and results can be linked with higher levels of biological organization

  11. A comparison of SNPs and microsatellites as linkage mapping markers: lessons from the zebra finch (Taeniopygia guttata

    Directory of Open Access Journals (Sweden)

    Birkhead Tim R

    2010-04-01

    Full Text Available Abstract Background Genetic linkage maps are essential tools when searching for quantitative trait loci (QTL. To maximize genome coverage and provide an evenly spaced marker distribution a combination of different types of genetic marker are sometimes used. In this study we created linkage maps of four zebra finch (Taeniopygia guttata chromosomes (1, 1A, 2 and 9 using two types of marker, Single Nucleotide Polymorphisms (SNPs and microsatellites. To assess the effectiveness and accuracy of each kind of marker we compared maps built with each marker type separately and with both types of marker combined. Linkage map marker order was validated by making comparisons to the assembled zebra finch genome sequence. Results We showed that marker order was less reliable and linkage map lengths were inflated for microsatellite maps relative to SNP maps, apparently due to differing error rates between the two types of marker. Guidelines on how to minimise the effects of error are provided. In particular, we show that when combining both types of marker the conventional process of building linkage maps, whereby the most informative markers are added to the map first, has to be modified in order to improve map accuracy. Conclusions When using multiple types and large numbers of markers to create dense linkage maps, the least error prone loci (SNPs rather than the most informative should be used to create framework maps before the addition of other potentially more error prone markers (microsatellites. This raises questions about the accuracy of marker order and predicted recombination rates in previous microsatellite linkage maps which were created using the conventional building process, however, provided suitable error detection strategies are followed microsatellite-based maps can continue to be regarded as reasonably reliable.

  12. Features of the retinotopic representation in the visual wulst of a laterally eyed bird, the zebra finch (Taeniopygia guttata).

    Science.gov (United States)

    Michael, Neethu; Löwel, Siegrid; Bischof, Hans-Joachim

    2015-01-01

    The visual wulst of the zebra finch comprises at least two retinotopic maps of the contralateral eye. As yet, it is not known how much of the visual field is represented in the wulst neuronal maps, how the organization of the maps is related to the retinal architecture, and how information from the ipsilateral eye is involved in the activation of the wulst. Here, we have used autofluorescent flavoprotein imaging and classical anatomical methods to investigate such characteristics of the most posterior map of the multiple retinotopic representations. We found that the visual wulst can be activated by visual stimuli from a large part of the visual field of the contralateral eye. Horizontally, the visual field representation extended from -5° beyond the beak tip up to +125° laterally. Vertically, a small strip from -10° below to about +25° above the horizon activated the visual wulst. Although retinal ganglion cells had a much higher density around the fovea and along a strip extending from the fovea towards the beak tip, these areas were not overrepresented in the wulst map. The wulst area activated from the foveal region of the ipsilateral eye, overlapped substantially with the middle of the three contralaterally activated regions in the visual wulst, and partially with the other two. Visual wulst activity evoked by stimulation of the frontal visual field was stronger with contralateral than with binocular stimulation. This confirms earlier electrophysiological studies indicating an inhibitory influence of the activation of the ipsilateral eye on wulst activity elicited by stimulating the contralateral eye. The lack of a foveal overrepresentation suggests that identification of objects may not be the primary task of the zebra finch visual wulst. Instead, this brain area may be involved in the processing of visual information necessary for spatial orientation. PMID:25853253

  13. Competitive replacement of invasive congeners may relax impact on native species: interactions among zebra, quagga, and native unionid mussels.

    Directory of Open Access Journals (Sweden)

    Lyubov E Burlakova

    Full Text Available Determining when and where the ecological impacts of invasive species will be most detrimental and whether the effects of multiple invaders will be superadditive, or subadditive, is critical for developing global management priorities to protect native species in advance of future invasions. Over the past century, the decline of freshwater bivalves of the family Unionidae has been greatly accelerated by the invasion of Dreissena. The purpose of this study was to evaluate the current infestation rates of unionids by zebra (Dreissena polymorpha and quagga (D. rostriformis bugensis mussels in the lower Great Lakes region 25 years after they nearly extirpated native unionids. In 2011-2012, we collected infestation data for over 4000 unionids from 26 species at 198 nearshore sites in lakes Erie, Ontario, and St. Clair, the Detroit River, and inland Michigan lakes and compared those results to studies from the early 1990 s. We found that the frequency of unionid infestation by Dreissena recently declined, and the number of dreissenids attached to unionids in the lower Great Lakes has fallen almost ten-fold since the early 1990s. We also found that the rate of infestation depends on the dominant Dreissena species in the lake: zebra mussels infested unionids much more often and in greater numbers. Consequently, the proportion of infested unionids, as well as the number and weight of attached dreissenids were lower in waterbodies dominated by quagga mussels. This is the first large-scale systematic study that revealed how minor differences between two taxonomically and functionally related invaders may have large consequences for native communities they invade.

  14. Competitive replacement of invasive congeners may relax impact on native species: Interactions among zebra, quagga, and native unionid mussels

    Science.gov (United States)

    Burlakova, Lyubov E.; Tulumello, Brianne L.; Karatayev, Alexander Y.; Krebs, Robert A.; Schloesser, Donald W.; Paterson, Wendy L.; Griffith, Traci A.; Scott, Mariah W.; Crail, Todd D.; Zanatta, David T

    2014-01-01

    Determining when and where the ecological impacts of invasive species will be most detrimental and whether the effects of multiple invaders will be superadditive, or subadditive, is critical for developing global management priorities to protect native species in advance of future invasions. Over the past century, the decline of freshwater bivalves of the family Unionidae has been greatly accelerated by the invasion of Dreissena. The purpose of this study was to evaluate the current infestation rates of unionids by zebra (Dreissena polymorpha) and quagga (D. rostriformis bugensis) mussels in the lower Great Lakes region 25 years after they nearly extirpated native unionids. In 2011–2012, we collected infestation data for over 4000 unionids from 26 species at 198 nearshore sites in lakes Erie, Ontario, and St. Clair, the Detroit River, and inland Michigan lakes and compared those results to studies from the early 1990s. We found that the frequency of unionid infestation by Dreissena recently declined, and the number of dreissenids attached to unionids in the lower Great Lakes has fallen almost ten-fold since the early 1990s. We also found that the rate of infestation depends on the dominant Dreissena species in the lake: zebra mussels infested unionids much more often and in greater numbers. Consequently, the proportion of infested unionids, as well as the number and weight of attached dreissenids were lower in waterbodies dominated by quagga mussels. This is the first large-scale systematic study that revealed how minor differences between two taxonomically and functionally related invaders may have large consequences for native communities they invade.

  15. Alteration of CaBP expression pattern in the nucleus magnocellularis following unilateral cochlear ablation in adult zebra finches.

    Directory of Open Access Journals (Sweden)

    Jie Li

    Full Text Available Songbirds have the rare ability of auditory-vocal learning and maintenance. Up to now, the organization and function of the nucleus magnocellularis (NM, the first relay of the avian ascending auditory pathway is largely based on studies in non-vocal learning species, such as chickens and owls. To investigate whether NM exhibits different histochemical properties associated with auditory processing in songbirds, we examined the expression patterns of three calcium-binding proteins (CaBPs, including calretinin (CR, parvalbumin (PV and calbindin-D28k (CB, and their relations to auditory inputs in NM in adult zebra finches. We found enriched and co-localized immunostaining of CR, PV and CB in the majority of NM neurons, without neuronal population preference. Furthermore, they were sensitive to adult deafferentation with differential plasticity patterns. After unilateral cochlear removal, CR staining in the ipsilateral NM decreased appreciably at 3 days after surgery, and continued to decline thereafter. PV staining showed down-regulation first at 3 days, but subsequently recovered slightly. CB staining did not significantly decrease until 7 days after surgery. Our findings suggest that the three CaBPs might play distinct roles in association with auditory processing in zebra finches. These results are in contrast to the findings in the NM of chickens where CR is the predominant CaBP and deafferentation had no apparent effect on its expression. Further extended studies in other avian species are required to establish whether the difference in CaBP patterns in NM is functionally related to the different auditory-vocal behaviors.

  16. Group dynamics of zebra and wildebeest in a woodland savanna: effects of predation risk and habitat density.

    Directory of Open Access Journals (Sweden)

    Maria Thaker

    Full Text Available BACKGROUND: Group dynamics of gregarious ungulates in the grasslands of the African savanna have been well studied, but the trade-offs that affect grouping of these ungulates in woodland habitats or dense vegetation are less well understood. We examined the landscape-level distribution of groups of blue wildebeest, Connochaetes taurinus, and Burchell's zebra, Equus burchelli, in a predominantly woodland area (Karongwe Game Reserve, South Africa; KGR to test the hypothesis that group dynamics are a function of minimizing predation risk from their primary predator, lion, Panthera leo. METHODOLOGY/PRINCIPAL FINDINGS: Using generalized linear models, we examined the relative importance of habitat type (differing in vegetation density, probability of encountering lion (based on utilization distribution of all individual lions in the reserve, and season in predicting group size and composition. We found that only in open scrub habitat, group size for both ungulate species increased with the probability of encountering lion. Group composition differed between the two species and was driven by habitat selection as well as predation risk. For both species, composition of groups was, however, dominated by males in open scrub habitats, irrespective of the probability of encountering lion. CONCLUSIONS/SIGNIFICANCE: Distribution patterns of wildebeest and zebra groups at the landscape level directly support the theoretical and empirical evidence from a range of taxa predicting that grouping is favored in open habitats and when predation risk is high. Group composition reflected species-specific social, physiological and foraging constraints, as well as the importance of predation risk. Avoidance of high resource open scrub habitat by females can lead to loss of foraging opportunities, which can be particularly costly in areas such as KGR, where this resource is limited. Thus, landscape-level grouping dynamics are species specific and particular to the

  17. Effects of zebra mussel (Dreissena polymorpha) density on the survival and growth of juvenile fathead minnows (Pimephales promelas): Implications for North American river fishes

    Science.gov (United States)

    Jennings, Cecil A.

    1996-01-01

    I used replicated 37.8 1 aquaria in a factorial design (four densities of zebra mussel, Dreissena polymorpha; two hydrologic regimes) to determine if the survival or growth of juvenile fathead minnows (Pimephales promelas) was affected by the density of zebra mussel or by the retention time of the test system. None of the fathead minnows died during the 30-d experiment. However, growth of fathead minnows was lower (P0.05). These laboratory results suggest that juvenile fish survival will not be affected by low to moderate densities of mussels (0-3000 m super(-2)) but fish growth might be adversely affected at moderate densities of mussels (e.g., 3000 m super(-2)).

  18. Molecular and Physiological Properties Associated with Zebra Complex Disease in Potatoes and Its Relation with Candidatus Liberibacter Contents in Psyllid Vectors

    OpenAIRE

    Alvarado, Veria Y.; Odokonyero, Denis; Duncan, Olivia; Mirkov, T. Erik; Scholthof, Herman B.

    2012-01-01

    Zebra complex (ZC) disease on potatoes is associated with Candidatus Liberibacter solanacearum (CLs), an α-proteobacterium that resides in the plant phloem and is transmitted by the potato psyllid Bactericera cockerelli (Šulc). The name ZC originates from the brown striping in fried chips of infected tubers, but the whole plants also exhibit a variety of morphological features and symptoms for which the physiological or molecular basis are not understood. We determined that compared to health...

  19. Differential coexpression of FoxP1, FoxP2, and FoxP4 in the Zebra Finch (Taeniopygia guttata) song system.

    Science.gov (United States)

    Mendoza, Ezequiel; Tokarev, Kirill; Düring, Daniel N; Retamosa, Eva Camarillo; Weiss, Michael; Arpenik, Nshdejan; Scharff, Constance

    2015-06-15

    Heterozygous disruptions of the Forkhead transcription factor FoxP2 impair acquisition of speech and language. Experimental downregulation in brain region Area X of the avian ortholog FoxP2 disrupts song learning in juvenile male zebra finches. In vitro, transcriptional activity of FoxP2 requires dimerization with itself or with paralogs FoxP1 and FoxP4. Whether this is the case in vivo is unknown. To provide the means for future functional studies we cloned FoxP4 from zebra finches and compared regional and cellular coexpression of FoxP1, FoxP2, and FoxP4 mRNA and protein in brains of juvenile and adult male zebra finches. In the telencephalic song nuclei HVC, RA, and Area X, the three investigated FoxPs were either expressed alone or occurred in specific combinations with each other, as shown by double in situ hybridization and triple immunohistochemistry. FoxP1 and FoxP4 but not FoxP2 were expressed in RA and in the HVCRA and HVCX projection neurons. In Area X and the surrounding striatum the density of neurons expressing all three FoxPs together or FoxP1 and FoxP4 together was significantly higher than the density of neurons expressing other combinations. Interestingly, the proportions of Area X neurons expressing particular combinations of FoxPs remained constant at all ages. In addition, FoxP-expressing neurons in adult Area X express dopamine receptors 1A, 1B, and 2. Together, these data provide the first evidence that Area X neurons can coexpress all avian FoxP subfamily members, thus allowing for a variety of regulatory possibilities via heterodimerization that could impact song behavior in zebra finches. PMID:25556631

  20. Genomic organization and molecular phylogenies of the beta (β) keratin multigene family in the chicken (Gallus gallus) and zebra finch (Taeniopygia guttata): implications for feather evolution

    OpenAIRE

    Sawyer Roger H; Greenwold Matthew J

    2010-01-01

    Abstract Background The epidermal appendages of reptiles and birds are constructed of beta (β) keratins. The molecular phylogeny of these keratins is important to understanding the evolutionary origin of these appendages, especially feathers. Knowing that the crocodilian β-keratin genes are closely related to those of birds, the published genomes of the chicken and zebra finch provide an opportunity not only to compare the genomic organization of their β-keratins, but to study their molecular...

  1. The Influence of Infective Dose on the Virulence of a Generalist Pathogen in Rainbow Trout (Oncorhynchus mykiss) and Zebra Fish (Danio rerio).

    Science.gov (United States)

    Kinnula, Hanna; Mappes, Johanna; Valkonen, Janne K; Sundberg, Lotta-Riina

    2015-01-01

    Pathogen density and genetic diversity fluctuate in the outside-host environment during and between epidemics, affecting disease emergence and the severity and probability of infections. Although the importance of these factors for pathogen virulence and infection probability has been acknowledged, their interactive effects are not well understood. We studied how an infective dose in an environmentally transmitted opportunistic fish pathogen, Flavobacterium columnare, affects its virulence both in rainbow trout, which are frequently infected at fish farms, and in zebra fish, a host that is not naturally infected by F. columnare. We used previously isolated strains of confirmed high and low virulence in a single infection and in a co-infection. Infection success (measured as host morbidity) correlated positively with dose when the hosts were exposed to the high-virulence strain, but no response for the dose increase was found when the hosts were exposed to the low-virulence strain. Interestingly, the co-infection resulted in poorer infection success than the single infection with the high-virulence strain. The rainbow trout were more susceptible to the infection than the zebra fish but, in both species, the effects of the doses and the strains were qualitatively similar. We suggest that as an increase in dose can lead to increased host morbidity, both the interstrain interactions and differences in infectivity in different hosts may influence the severity and consequently the evolution of disease. Our results also confirm that the zebra fish is a good laboratory model to study F. columnare infection. PMID:26421435

  2. Efficacy of Pseudomonas fluorescens strain CL145A spray dried powder for controlling zebra mussels adhering to native unionid mussels within field enclosures

    Science.gov (United States)

    Luoma, James A.; Weber, Kerry L.; Severson, Todd J.; Mayer, Denise A.

    2015-01-01

    The efficacy of a commercially prepared spray dried powder (SDP) formulation of Pseudomonas fluorescens (strain CL145A) was evaluated for removing zebra mussels (Dreissena polymorpha) adhering to a population of unionid mussels in Lake Darling (Alexandria, Minnesota). Two groups of unionid mussels were used in the study. Unionid mussels were collected near the test area, weighed, photographed, individually tagged, and randomly allocated to one of nine test enclosures in equal proportions and then divided into two groups. The first group of unionid mussels (Group 1, n = 5 per test enclosure) were indiscriminately selected from each test enclosure and used to estimate the number of zebra mussels adhering to unionid mussels prior to exposure. The second group of unionid mussels (Group 2, n = 22 per test enclosure) were used to evaluate the efficacy of SDP for removal of adhering zebra mussels. Both Group 1 and Group 2 mussels were used to evaluate the effects of SDP exposure on unionid mussel survival.

  3. Similar but Different: Dynamic Social Network Analysis Highlights Fundamental Differences between the Fission-Fusion Societies of Two Equid Species, the Onager and Grevy's Zebra.

    Science.gov (United States)

    Rubenstein, Daniel I; Sundaresan, Siva R; Fischhoff, Ilya R; Tantipathananandh, Chayant; Berger-Wolf, Tanya Y

    2015-01-01

    Understanding why animal societies take on the form that they do has benefited from insights gained by applying social network analysis to patterns of individual associations. Such analyses typically aggregate data over long time periods even though most selective forces that shape sociality have strong temporal elements. By explicitly incorporating the temporal signal in social interaction data we re-examine the network dynamics of the social systems of the evolutionarily closely-related Grevy's zebras and wild asses that show broadly similar social organizations. By identifying dynamic communities, previously hidden differences emerge: Grevy's zebras show more modularity than wild asses and in wild asses most communities consist of solitary individuals; and in Grevy's zebras, lactating females show a greater propensity to switch communities than non-lactating females and males. Both patterns were missed by static network analyses and in general, adding a temporal dimension provides insights into differences associated with the size and persistence of communities as well as the frequency and synchrony of their formation. Dynamic network analysis provides insights into the functional significance of these social differences and highlights the way dynamic community analysis can be applied to other species. PMID:26488598

  4. Pathology and immunohistochemistry of papillomavirus-associated cutaneous lesions in Cape mountain zebra, giraffe, sable antelope and African buffalo in South Africa

    Directory of Open Access Journals (Sweden)

    J. H. Williams

    2011-04-01

    Full Text Available Skin lesions associated with papillomaviruses have been reported in many animal species and man. Bovine papillomavirus (BVP affects mainly the epidermis, but also the dermis in several species including bovine, the best-known example being equine sarcoid, which is associated with BVP types 1 and 2. This publication describes and illustrates the macroscopic and histological appearance of BPV-associated papillomatous, fibropapillomatous or sarcoid-like lesions in Cape mountain zebra (Equus zebra zebra from the Gariep Dam Nature Reserve, 2 giraffes (Giraffa camelopardalis from the Kruger National Park, and a sable antelope (Hippotragus niger from the Kimberley area of South Africa. An African buffalo (Syncerus caffer cow from Kruger National Park also had papillomatous lesions but molecular characterisation of lesional virus was not done. Immunohistochemical staining using polyclonal rabbit antiserum to chemically disrupted BPV-1, which cross-reacts with the L1 capsid of most known papillomaviruses, was positive in cells of the stratum granulosum of lesions in Giraffe 1, the sable and the buffalo and negative in those of the zebra and Giraffe 2. Fibropapillomatous and sarcoid-like lesions from an adult bovine were used as positive control for the immunohistochemistry and are described and the immunohistochemistry illustrated for comparison. Macroscopically, both adult female giraffe had severely thickened multifocal to coalescing nodular and occasionally ulcerated lesions of the head, neck and trunk with local poorly-circumscribed invasion into the subcutis. Necropsy performed on the 2nd giraffe revealed neither internal metastases nor serious underlying disease. Giraffe 1 had scattered, and Giraffe 2 numerous, large, anaplastic, at times indistinctly multinucleated dermal fibroblasts with bizarre nuclei within the sarcoid-like lesions, which were BPV-1 positive in Giraffe 1 and BPV-1 and -2 positive in Giraffe 2 by RT-PCR. The sable antelope

  5. Polypeptide Fraction from Arca subcrenata Induces Apoptosis and G2/M Phase Arrest in HeLa Cells via ROS-Mediated MAPKs Pathways

    Directory of Open Access Journals (Sweden)

    Xianjing Hu

    2015-01-01

    Full Text Available Arca subcrenata is documented in the literature of marine Traditional Chinese Medicine. Polypeptide fraction from A. subcrenata, coded as P2, was demonstrated to possess significant antitumor activity in our previous study. However, the underlying mechanism remains undefined. The present study was carried out to investigate the underlying antitumor mechanism of P2 in human cervical cancer HeLa cells by MTT, FCM, LSCM, and western blot assays. The results revealed that P2 significantly induced apoptosis of HeLa cells in a concentration- and time-dependent manner. High level of ROS was provoked by P2, which was in turn responsible for induction of apoptosis through activation of intrinsic mitochondrial pathway and JNK1/2, p38 MAPK pathways, as well as inhibition of ERK1/2 pathway, as evidenced by the abrogation of P2’s effect on HeLa cells preincubated with the ROS scavenger NAC. P2 also was observed to display significant effect on G2/M phase arrest by downregulating the expression of cyclin B1/cdc2 complex and upregulating the expression of p21. These findings demonstrate that P2 induces apoptosis and G2/M phase arrest in HeLa cells through ROS-mediated MAPKs pathways, suggesting that P2 would be worth investigating as a promising agent within the scope of marine drugs for treatment of cervical cancer.

  6. Assesment of trace elements and organic pollutants from a marine oil complex into the coral reef system of Cayo Arcas, Mexico.

    Science.gov (United States)

    Cram, Silke; Ponce De León, Claudia A; Fernández, Pilar; Sommer, Irene; Rivas, Hilda; Morales, Luis Miguel

    2006-10-01

    Possible contaminants produced by the Petroleos Mexicanos (PEMEX) marine oil complex in the vicinity of the Cayo Arcas (Mexico) coral reef ecosystem were evaluated by analyzing sediments and sea water for hydrocarbons and metal elements. We found that the concentrations of aliphatic hydrocarbons in the sea water were generally low, with the highest values detected near the oil station; the concentration of polycyclic aromatic hydrocarbons (PAHs) was generally below the detection limit. The hydrocarbons found in the sediments seem to have a pyrogenic origin, and were probably produced by marine traffic in the study area. The total PAH concentration did not exceed the NOAA criteria, although levels of some individual PAHs did. The only metal detected in the sea water at high concentrations was nickel. The Ni/V ratio in the sediments indicates the contribution of crude oil to the system. The high content of Ni and Zn was attributed to the ballast waters from the oil tankers that load at the station's monobuoys. The presence of fine sediments that commonly originate from terrestrial ecosystems supported this assumption. PMID:16741791

  7. Collective and individual processes of sub-threshold particles production. Pions neutral and η mesons production in the Ar+Ca 180 A MeV reaction

    International Nuclear Information System (INIS)

    The subject of this work is the study of the collective processes and individual nucleon-nucleon collisions Involved in sub-threshold particles production. For this purpose, aad for the first time, neutral pions and etas have been simultaneously measured well below the free nucleon-nucleon threshold, in the reaction Ar+Ca at 180 A MeV. This experiment has been performed at GSI with the multidetector TAPS. The measured eta probability seems to be 20 times lower than expected from the systematics. Surprisingly, the mt scaling law appears to be still valid at so low energy. Experimental results point out that most of the observed pions are mediated by Δ resonances. Finally, the high mt pions multiplicity increases much faster than low mt pion multiplicity with the number of participants. This fact is a strong evidence of the role of collective and cooperative processes for the production of energetic particles beyond the picture of particles produced in first chance nucleon-nucleon collisions. Experimental results have been confronted to the predictions of two dynamical and one statistical models, but these models fail to provide a consistent picture of the processes involved in sub-threshold particle production. (author)

  8. Daily rhythms of lipid metabolic gene expression in zebra fish liver: Response to light/dark and feeding cycles.

    Science.gov (United States)

    Paredes, J F; López-Olmeda, J F; Martínez, F J; Sánchez-Vázquez, F J

    2015-01-01

    Despite numerous studies about fish nutrition and lipid metabolism, very little is known about the daily rhythm expression of lipogenesis and lipolysis genes. This research aimed to investigate the existence of daily rhythm expressions of the genes involved in lipid metabolism and their synchronization to different light/dark (LD) and feeding cycles in zebra fish liver. For this purpose, three groups of zebra fish were submitted to a 12:12 h LD cycle. A single daily meal was provided to each group at various times: in the middle of the light phase (ML); in the middle of the dark phase (MD); at random times. After 20 days of acclimation to these experimental conditions, liver samples were collected every 4 h in one 24-h cycle. The results revealed that most genes displayed a significant daily rhythm with an acrophase of expression in the dark phase. The acrophase of lipolytic genes (lipoprotein lipase - lpl, peroxisome proliferator-activated receptor - pparα and hydroxyacil CoA dehydrogenase - hadh) was displayed between ZT 02:17 h and ZT 18:31 h. That of lipogenic genes (leptin-a - lepa, peroxisome proliferator-activated receptor - pparγ, liver X receptor - lxr, insulin-like growth factor - igf1, sterol regulatory element-binding protein - srebp and fatty acid synthase - fas) was displayed between ZT 15:25 h and 20:06 h (dark phase). Feeding time barely influenced daily expression rhythms, except for lxr in the MD group, whose acrophase shifted by about 14 h compared with the ML group (ZT 04:31 h versus ZT 18:29 h, respectively). These results evidence a strong synchronization to the LD cycle, but not to feeding time, and most genes showed a nocturnal acrophase. These findings highlight the importance of considering light and feeding time to optimize lipid metabolism and feeding protocols in fish farming. PMID:26595085

  9. Crystal structure and potential physiological role of zebra fish thioesterase superfamily member 2 (fTHEM2)

    International Nuclear Information System (INIS)

    Thioesterase superfamily member 2 (THEM2) is an essential protein for mammalian cell proliferation. It belongs to the hotdog-fold thioesterase superfamily and catalyzes hydrolysis of thioester bonds of acyl-CoA in vitro, while its in vivo function remains unrevealed. In this study, Zebra fish was selected as a model organism to facilitate the investigations on THEM2. First, we solved the crystal structure of recombinant fTHEM2 at the resolution of 1.80 Å, which displayed a similar scaffolding as hTHEM2. Second, functional studies demonstrated that fTHEM2 is capable of hydrolyzing palmitoyl-CoA in vitro. In addition, injection of morpholino against fTHEM2 at one-cell stage resulted in distorted early embryo development, including delayed cell division, retarded development and increased death rate. The above findings validated our hypothesis that fTHEM2 could serve as an ideal surrogate for studying the physiological functions of THEM2. - Highlights: • The crystal structure of recombinant fTHEM2 is presented. • fTHEM2 is capable of hydrolyzing palmitoyl-CoA. • The influence of fTHEM2 on early embryo development is demonstrated

  10. Crystal structure and potential physiological role of zebra fish thioesterase superfamily member 2 (fTHEM2).

    Science.gov (United States)

    Yu, Shanshan; Li, Han; Gao, Feng; Zhou, Ying

    2015-08-01

    Thioesterase superfamily member 2 (THEM2) is an essential protein for mammalian cell proliferation. It belongs to the hotdog-fold thioesterase superfamily and catalyzes hydrolysis of thioester bonds of acyl-CoA in vitro, while its in vivo function remains unrevealed. In this study, Zebra fish was selected as a model organism to facilitate the investigations on THEM2. First, we solved the crystal structure of recombinant fTHEM2 at the resolution of 1.80 Å, which displayed a similar scaffolding as hTHEM2. Second, functional studies demonstrated that fTHEM2 is capable of hydrolyzing palmitoyl-CoA in vitro. In addition, injection of morpholino against fTHEM2 at one-cell stage resulted in distorted early embryo development, including delayed cell division, retarded development and increased death rate. The above findings validated our hypothesis that fTHEM2 could serve as an ideal surrogate for studying the physiological functions of THEM2. PMID:26067557

  11. Encoding of naturalistic optic flow by motion sensitive neurons of nucleus rotundus in the zebra finch (Taeniopygia guttata.

    Directory of Open Access Journals (Sweden)

    Dennis Eckmeier

    2013-09-01

    Full Text Available The retinal image changes that occur during locomotion, the optic flow, carry information about self-motion and the three-dimensional structure of the environment. Especially fast moving animals with only little binocular vision depend on these depth cues for manoeuvring. They actively control their gaze to facilitate perception of depth based on cues in the optic flow. In the visual system of birds, nucleus rotundus neurons were originally found to respond to object motion but not to background motion. However, when background and object were both moving, responses increase the more the direction and velocity of object and background motion on the retina differed. These properties may play a role in representing depth cues in the optic flow. We therefore investigated how neurons in nucleus rotundus respond to optic flow that contains depth cues. We presented simplified and naturalistic optic flow on a panoramic LED display while recording from single neurons in nucleus rotundus of anaesthetized zebra finches. Unlike most studies on motion vision in birds, our stimuli included depth information. We found extensive responses of motion selective neurons in nucleus rotundus to optic flow stimuli. Simplified stimuli revealed preferences for optic flow reflecting translational or rotational self-motion. Naturalistic optic flow stimuli elicited complex response modulations, but the presence of objects was signalled by only few neurons. The neurons that did respond to objects in the optic flow, however, show interesting properties.

  12. The influence of temperature, daylength and sucrose concentration on the growth and development of Alstroemeria 'Zebra' in vitro

    Directory of Open Access Journals (Sweden)

    Eleonora Gabryszewska

    2013-12-01

    Full Text Available The influence of temperature, daylength and sucrose concentration on the growth and development of Alstroemeria 'Zebra' in vitro was investigated. Only slightly more lateral rhizomes were formed at 25°C in comparison with 17°C on the medium with BA. Presence of BA in the medium strongly increased number of upright growing shoots and more shoots were formed in temperature 25°C than in temperature 17°C. Rhizome multiplication and formation of upright growing shoots were not significantly influenced by daylength. Sucrose was required for the formation of lateral rhizomes, upright growing shoots and roots. The highest number Of lateral rhizomes was observed on the medium containing 60 and 80 gl-1 sucrose and BA. Presence of BA in the medium with different sucrose concentrations markedly influenced the formation of upright growing shoots; the highest number of shoots was found on the explants cultured on the media with 20 and 30 gl-1 sucrose. Low and high concentrations of sucrose inhibited upright growing shoots formation and their elongation. Rhizogenesis was not observed on rhizomes growing on the medium without sucrose and with 10 gl-1 sucrose, either in the presence or absence of NAA„ The number of roots per plantlet on the medium with NAA increased with increasing sucrose levels. The highest sucrose concentrations slightly inhibited roots formation.

  13. Crystal structure and potential physiological role of zebra fish thioesterase superfamily member 2 (fTHEM2)

    Energy Technology Data Exchange (ETDEWEB)

    Yu, Shanshan; Li, Han; Gao, Feng; Zhou, Ying, E-mail: zhouying@moon.ibp.ac.cn

    2015-08-07

    Thioesterase superfamily member 2 (THEM2) is an essential protein for mammalian cell proliferation. It belongs to the hotdog-fold thioesterase superfamily and catalyzes hydrolysis of thioester bonds of acyl-CoA in vitro, while its in vivo function remains unrevealed. In this study, Zebra fish was selected as a model organism to facilitate the investigations on THEM2. First, we solved the crystal structure of recombinant fTHEM2 at the resolution of 1.80 Å, which displayed a similar scaffolding as hTHEM2. Second, functional studies demonstrated that fTHEM2 is capable of hydrolyzing palmitoyl-CoA in vitro. In addition, injection of morpholino against fTHEM2 at one-cell stage resulted in distorted early embryo development, including delayed cell division, retarded development and increased death rate. The above findings validated our hypothesis that fTHEM2 could serve as an ideal surrogate for studying the physiological functions of THEM2. - Highlights: • The crystal structure of recombinant fTHEM2 is presented. • fTHEM2 is capable of hydrolyzing palmitoyl-CoA. • The influence of fTHEM2 on early embryo development is demonstrated.

  14. Integrated use of biomarkers and bioaccumulation data in Zebra mussel (Dreissena polymorpha) for site-specific quality assessment.

    Science.gov (United States)

    Binelli, A; Ricciardi, F; Riva, C; Provini, A

    2006-01-01

    One of the useful biological tools for environmental management is the measurement of biomarkers whose changes are related to the exposure to chemicals or environmental stress. Since these responses might vary with different contaminants or depending on the pollutant concentration reached in the organism, the support of bioaccumulation data is needed to prevent false conclusions. In this study, several persistent organic pollutants -- 23 polychlorinated biphenyl (PCB) congeners, 11 polycyclic aromatic hydrocarbons (PAHs), six dichlorodiphenyltricholroethane (DDT) relatives, hexachlorobenzene (HCB), chlorpyrifos and its oxidized metabolite -- and some herbicides (lindane and the isomers alpha, beta, delta; terbutilazine; alachlor; metolachlor) were measured in the soft tissues of the freshwater mollusc Zebra mussel (Dreissena polymorpha) from 25 sampling sites in the Italian portions of the sub-alpine great lakes along with the measure of ethoxyresorufin dealkylation (EROD) and acetylcholinesterase (AChE) activity. The linkage between bioaccumulation and biomarker data allowed us to create site-specific environmental quality indexes towards man-made chemicals. This classification highlighted three different degrees of xenobiotic contamination of the Italian sub-alpine great lakes: a high water quality in Lake Lugano with negligible pollutant levels and no effects on enzyme activities, an homogeneous poor quality for Lakes Garda, Iseo and Como, and the presence of some xenobiotic point-sources in Lake Maggiore, whose ecological status could be jeopardized, also due to the heavy DDT contamination revealed since 1996. PMID:16966160

  15. Loop-Mediated Isothermal Amplification Procedure (LAMP) for Detection of the Potato Zebra Chip Pathogen "Candidatus Liberibacter solanacearum".

    Science.gov (United States)

    Ravindran, Aravind; Lévy, Julien; Pierson, Elizabeth; Gross, Dennis C

    2015-01-01

    An efficient loop-mediated isothermal amplification procedure (LAMP) for the detection of "Candidatus Liberibacter solanacearum" (Lso), the bacterial causal agent of potato zebra chip (ZC) disease, is described in this chapter. Similar to the polymerase chain reaction (PCR), the LAMP employs a bacterial polymerase to amplify specific DNA sequences. However, the method differs from conventional PCR in that it uses six primers specific to the target region to generate a loop structure and autocycling strand displacement rather than thermocycling for sequence amplification. Moreover, unlike PCR that requires agarose gel electrophoresis for resolution, the positive LAMP results can be visualized directly as a precipitate within the reaction tubes. The 16S rDNA gene of "Ca. Liberibacter solanacearum" was used as the target for the design of the six LAMP primers. The LAMP technique is a reliable, rapid, and cost-effective method of detecting the "Ca. Liberibacter solanacearum" pathogen in the potato/tomato psyllid, Bactericera cockerelli, and in field-grown potato plants and tubers. PMID:25981248

  16. Multiple Visual Field Representations in the Visual Wulst of a Laterally Eyed Bird, the Zebra Finch (Taeniopygia guttata)

    Science.gov (United States)

    2016-01-01

    The visual wulst is the telencephalic target of the avian thalamofugal visual system. It contains several retinotopically organised representations of the contralateral visual field. We used optical imaging of intrinsic signals, electrophysiological recordings, and retrograde tracing with two fluorescent tracers to evaluate properties of these representations in the zebra finch, a songbird with laterally placed eyes. Our experiments revealed that there is some variability of the neuronal maps between individuals and also concerning the number of detectable maps. It was nonetheless possible to identify three different maps, a posterolateral, a posteromedial, and an anterior one, which were quite constant in their relation to each other. The posterolateral map was in contrast to the two others constantly visible in each successful experiment. The topography of the two other maps was mirrored against that map. Electrophysiological recordings in the anterior and the posterolateral map revealed that all units responded to flashes and to moving bars. Mean directional preferences as well as latencies were different between neurons of the two maps. Tracing experiments confirmed previous reports on the thalamo-wulst connections and showed that the anterior and the posterolateral map receive projections from separate clusters within the thalamic nuclei. Maps are connected to each other by wulst intrinsic projections. Our experiments confirm that the avian visual wulst contains several separate retinotopic maps with both different physiological properties and different thalamo-wulst afferents. This confirms that the functional organization of the visual wulst is very similar to its mammalian equivalent, the visual cortex. PMID:27139912

  17. Multiple Visual Field Representations in the Visual Wulst of a Laterally Eyed Bird, the Zebra Finch (Taeniopygia guttata).

    Science.gov (United States)

    Bischof, Hans-Joachim; Eckmeier, Dennis; Keary, Nina; Löwel, Siegrid; Mayer, Uwe; Michael, Neethu

    2016-01-01

    The visual wulst is the telencephalic target of the avian thalamofugal visual system. It contains several retinotopically organised representations of the contralateral visual field. We used optical imaging of intrinsic signals, electrophysiological recordings, and retrograde tracing with two fluorescent tracers to evaluate properties of these representations in the zebra finch, a songbird with laterally placed eyes. Our experiments revealed that there is some variability of the neuronal maps between individuals and also concerning the number of detectable maps. It was nonetheless possible to identify three different maps, a posterolateral, a posteromedial, and an anterior one, which were quite constant in their relation to each other. The posterolateral map was in contrast to the two others constantly visible in each successful experiment. The topography of the two other maps was mirrored against that map. Electrophysiological recordings in the anterior and the posterolateral map revealed that all units responded to flashes and to moving bars. Mean directional preferences as well as latencies were different between neurons of the two maps. Tracing experiments confirmed previous reports on the thalamo-wulst connections and showed that the anterior and the posterolateral map receive projections from separate clusters within the thalamic nuclei. Maps are connected to each other by wulst intrinsic projections. Our experiments confirm that the avian visual wulst contains several separate retinotopic maps with both different physiological properties and different thalamo-wulst afferents. This confirms that the functional organization of the visual wulst is very similar to its mammalian equivalent, the visual cortex. PMID:27139912

  18. Systemic Amyloidosis and Testicular Interstitial Tumor in a Zebra Finch (Taeniopygia guttata: a Case Report in Iran

    Directory of Open Access Journals (Sweden)

    Mehrnoush Moeini Jazani

    2011-09-01

    Full Text Available Abstract Systemic amyloidosis and testicular interstitial tumor are rare conditions in birds and this is the first report in Iran. A male zebra finch was presented because of white diarrhea, anorexia, loss of weight and lethargy. At necropsy, the small intestine was edematous and congested. The spleen appeared pale. The liver was large, firm and brown. One testis was cystic and neoplastic and the remaining testis was atrophic. Histologically, amyloid materials were seen predominantly in the liver and spleen. Hyaline substances were deposited in the Disse space and in the media of blood vessels of the liver. In spleen, marked deposits thickened the basement membranes of blood vessels and extended into the surrounding parenchyma. In addition, there were lesser degrees of amyloidosis in other organs such as small intestine. Amyloid stained positively with Congo red. In testis, there was encapsulated unilateral interstitial cell tumor, with multiple foci of necrosis and hemorrhage. The neoplastic cells were round to polyhedral, with small round hyperchromatic nuclei and finely vacuolated cytoplasm. Signs of feminization were observed. The cause of amyloidosis in this study was not conclusively identified.

  19. RELAXATION OF MAGNETIC FIELD RELATIVE TO PLASMA DENSITY REVEALED FROM MICROWAVE ZEBRA PATTERNS ASSOCIATED WITH SOLAR FLARES

    International Nuclear Information System (INIS)

    It is generally considered that the emission of microwave zebra pattern (ZP) structures requires high density and high temperature, which is similar to the situation of the flaring region where primary energy is released. Therefore, a parameter analysis of ZPs may reveal the physical conditions of the flaring source region. This work investigates the variations of 74 microwave ZP structures observed by the Chinese Solar Broadband Radio Spectrometer (SBRS/Huairou) at 2.6-3.8 GHz in nine solar flares, and we find that the ratio between the plasma density scale height LN and the magnetic field scale height LB in emission sources displays a tendency to decrease during the flaring processes. The ratio LN /LB is about 3-5 before the maximum of flares. It decreases to about 2 after the maximum. The detailed analysis of three typical X-class flares implies that the variation of LN /LB during the flaring process is most likely due to topological changes of the magnetic field in the flaring source region, and the stepwise decrease of LN /LB possibly reflects the magnetic field relaxation relative to the plasma density when the flaring energy is released. This result may also constrain solar flare modeling to some extent.

  20. Characterization of synaptically connected nuclei in a potential sensorimotor feedback pathway in the zebra finch song system.

    Directory of Open Access Journals (Sweden)

    Shayna M Williams

    Full Text Available Birdsong is a learned behavior that is controlled by a group of identified nuclei, known collectively as the song system. The cortical nucleus HVC (used as a proper name is a focal point of many investigations as it is necessary for song production, song learning, and receives selective auditory information. HVC receives input from several sources including the cortical area MMAN (medial magnocellular nucleus of the nidopallium. The MMAN to HVC connection is particularly interesting as it provides potential sensorimotor feedback to HVC. To begin to understand the role of this connection, we investigated the physiological relation between MMAN and HVC activity with simultaneous multiunit extracellular recordings from these two nuclei in urethane anesthetized zebra finches. As previously reported, we found similar timing in spontaneous bursts of activity in MMAN and HVC. Like HVC, MMAN responds to auditory playback of the bird's own song (BOS, but had little response to reversed BOS or conspecific song. Stimulation of MMAN resulted in evoked activity in HVC, indicating functional excitation from MMAN to HVC. However, inactivation of MMAN resulted in no consistent change in auditory responses in HVC. Taken together, these results indicate that MMAN provides functional excitatory input to HVC but does not provide significant auditory input to HVC in anesthetized animals. We hypothesize that MMAN may play a role in motor reinforcement or coordination, or may provide modulatory input to the song system about the internal state of the animal as it receives input from the hypothalamus.

  1. Characterization of synaptically connected nuclei in a potential sensorimotor feedback pathway in the zebra finch song system.

    Science.gov (United States)

    Williams, Shayna M; Nast, Alexis; Coleman, Melissa J

    2012-01-01

    Birdsong is a learned behavior that is controlled by a group of identified nuclei, known collectively as the song system. The cortical nucleus HVC (used as a proper name) is a focal point of many investigations as it is necessary for song production, song learning, and receives selective auditory information. HVC receives input from several sources including the cortical area MMAN (medial magnocellular nucleus of the nidopallium). The MMAN to HVC connection is particularly interesting as it provides potential sensorimotor feedback to HVC. To begin to understand the role of this connection, we investigated the physiological relation between MMAN and HVC activity with simultaneous multiunit extracellular recordings from these two nuclei in urethane anesthetized zebra finches. As previously reported, we found similar timing in spontaneous bursts of activity in MMAN and HVC. Like HVC, MMAN responds to auditory playback of the bird's own song (BOS), but had little response to reversed BOS or conspecific song. Stimulation of MMAN resulted in evoked activity in HVC, indicating functional excitation from MMAN to HVC. However, inactivation of MMAN resulted in no consistent change in auditory responses in HVC. Taken together, these results indicate that MMAN provides functional excitatory input to HVC but does not provide significant auditory input to HVC in anesthetized animals. We hypothesize that MMAN may play a role in motor reinforcement or coordination, or may provide modulatory input to the song system about the internal state of the animal as it receives input from the hypothalamus. PMID:22384172

  2. Short-term and long-term effects of vocal distortion on song maintenance in zebra finches.

    Science.gov (United States)

    Hough, Gerald E; Volman, Susan F

    2002-02-01

    Adult zebra finch song is irreversibly altered when birds are deprived of correct feedback by deafening or denervation of the syrinx. To clarify the role of feedback in song maintenance, we developed a reversible technique to distort vocal output without damaging the auditory or vocal systems. We implanted flexible beads adjacent to the syrinx to alter its biomechanics. Immediate song aberrations included low volume, frequency shifts, missing harmonics, and production of click-like syllables. After a few weeks, seven of nine birds stopped producing some syllables. In six of these birds, the gaps left by the silenced syllables gradually shortened, and the lost syllables did not return when beads were removed 16 weeks after treatment began. The nondeleted syllables of all birds regained their preimplant morphology, insofar as could be detected, within 9 d after bead removal. In four other birds, we removed the beads as soon as syllables were deleted, when the silent intervals were still full length. In these birds, all deleted syllables returned within 1 week. Our results indicate that both silenced syllables and syllable morphology can recover as long as the song's temporal structure is maintained, but once altered, changes in the song sequence can be permanent. A hierarchical organization of the song production system has recently been described (Margoliash, 1997). Reversible disruption of song production by our method appears to permanently alter the higher levels of the system that encode song sequence, but not the lower levels that encode individual syllable structure. PMID:11826147

  3. Histological Changes Induced in Gonads, Liver and Kidney of Zebra Fish (Danio Rerio Under the Effect Octylphenol (OP

    Directory of Open Access Journals (Sweden)

    Gabi Dumitrescu

    2010-05-01

    Full Text Available World-wide researches during the last years are focused upon the negative effects caused by the natural chemical compounds and anthropogenic compounds, already being demonstrated that a great part of them change the endocrine control over reproduction at different species. The issue studied by our team is concerned with the histological changes that appear within liver, kidney and gonadal development at the zebra fish (Danio rerio, exposed to octylphenol from 21-115 days, and within 21-75 days of life. In order to achieve the histological preparations, for each period under study, fishes were divided into three groups of 30 individuals, namely: Lot 1 - Control, respectively lots 2 and 3, at which the administrated octylphenol concentrations were of 60 μg L-1, respectively 100 μg L-1. Fishes of the six groups were raised in 30-liters aquariums (30 fish / aquarium. Fragments of liver, kidney and gonads were processed histologically, colored with the Mallory thrichromic staining method and examined with the optical microscope. Histopathological study revealed changes in the three organs, namely this fine granulation hepatocytes, peritubular edema and vascular ectasia in renal parenchyma and their differentiation in the gonads to sex predominantly female, issues that demonstrate the estrogenic effect of the octylphenol. Those microscopical aspects observed in the kidney and liver of the specimens exposed to action of octhylphenol, suggest that the octhlyphenol is bind to the estrogenic receptors on the membrane of hepatic cells, inducing vitellogenin synthesis.

  4. The Influence of Infective Dose on the Virulence of a Generalist Pathogen in Rainbow Trout (Oncorhynchus mykiss and Zebra Fish (Danio rerio.

    Directory of Open Access Journals (Sweden)

    Hanna Kinnula

    Full Text Available Pathogen density and genetic diversity fluctuate in the outside-host environment during and between epidemics, affecting disease emergence and the severity and probability of infections. Although the importance of these factors for pathogen virulence and infection probability has been acknowledged, their interactive effects are not well understood. We studied how an infective dose in an environmentally transmitted opportunistic fish pathogen, Flavobacterium columnare, affects its virulence both in rainbow trout, which are frequently infected at fish farms, and in zebra fish, a host that is not naturally infected by F. columnare. We used previously isolated strains of confirmed high and low virulence in a single infection and in a co-infection. Infection success (measured as host morbidity correlated positively with dose when the hosts were exposed to the high-virulence strain, but no response for the dose increase was found when the hosts were exposed to the low-virulence strain. Interestingly, the co-infection resulted in poorer infection success than the single infection with the high-virulence strain. The rainbow trout were more susceptible to the infection than the zebra fish but, in both species, the effects of the doses and the strains were qualitatively similar. We suggest that as an increase in dose can lead to increased host morbidity, both the interstrain interactions and differences in infectivity in different hosts may influence the severity and consequently the evolution of disease. Our results also confirm that the zebra fish is a good laboratory model to study F. columnare infection.

  5. Mercury levels and trends (1993-2009) in bream (Abramis brama L.) and zebra mussels (Dreissena polymorpha) from German surface waters.

    Science.gov (United States)

    Lepom, Peter; Irmer, Ulrich; Wellmitz, Jörg

    2012-01-01

    Mercury concentrations have been analysed in bream (Abramis brama L.) and zebra mussels (Dreissena polymorpha) collected at 17 freshwater sites in Germany from 1993-2009 and 1994-2009, respectively, within the German Environmental Specimen programme. Mercury concentrations in bream ranged from 21 to 881 ng g(-1) wet weight with lowest concentrations found at the reference site Lake Belau and highest in fish from the river Elbe and its tributaries. Statistical analysis revealed site-specific differences and significant decreasing temporal trends in mercury concentrations at most of the sampling sites. The decrease in mercury levels in bream was most pronounced in fish from the river Elbe and its tributary Mulde, while in fish from the river Saale mercury levels increased. Temporal trends seem to level off in recent years. Mercury concentrations in zebra mussels were much lower than those in bream according to their lower trophic position and varied by one order of magnitude from 4.1 to 42 ng g(-1) wet weight (33-336 ng g(-1) dry weight). For zebra mussels, trend analyses were performed for seven sampling sites at the rivers Saar and Elbe of which three showed significant downward trends. There was a significant correlation of the geometric mean concentrations in bream and zebra mussel over the entire study period at each sampling site (Pearson's correlation coefficient=0.892, p=0.00002). A comparison of the concentrations in bream with the environmental quality standard (EQS) of 20 ng g(-1) wet weight set for mercury in biota by the EU showed that not a single result was in compliance with this limit value, not even those from the reference site. Current mercury levels in bream from German rivers exceed the EQS by a factor 4.5-20. Thus, piscivorous top predators are still at risk of secondary poisoning by mercury exposure via the food chain. It was suggested focusing monitoring of mercury in forage fish (trophic level 3 or 4) for compliance checking with the EQS for

  6. Prox1 Is a Novel Coregulator of Ff1b and Is Involved in the Embryonic Development of the Zebra Fish Interrenal Primordium

    OpenAIRE

    Liu, Yi-Wen; Gao, Wei; Teh, Hui-Ling; Tan, Jee-Hian; Chan, Woon-Khiong

    2003-01-01

    Steroidogenic factor 1 (SF-1) plays an essential role in adrenal development, although the exact molecular mechanisms are unclear. Our previous work established that Ff1b is the zebra fish homologue of SF-1 and that its disruption by antisense morpholinos leads to a complete ablation of the interrenal organ. In this study, results of biochemical analyses suggest that Ff1b and other Ff1 members interact with Prox1, a homeodomain protein. Fine mapping using site-directed mutants showed that thi...

  7. Cholinesterase activity in the tissues of bivalves Noah's ark shell (Arca noae) and warty venus (Venus verrucosa): characterisation and in vitro sensitivity to organophosphorous pesticide trichlorfon.

    Science.gov (United States)

    Perić, Lorena; Ribarić, Luka; Nerlović, Vedrana

    2013-08-01

    Cholinesterase (ChE, EC 3.1.1.7) activity was investigated in gills and adductor muscle of two bivalve species: Arca noae and Venus verrucosa. The properties of ChEs were investigated using acetylcholine iodide (ASCh), butyrylcholine iodide (BSCh) and propionylcholine iodide (PrSCh) as substrates and eserine, BW254c51 and iso-OMPA as specific inhibitors. The highest level of ChE activity in crude tissue extracts was detected with PrSCh followed by ASCh, while values obtained with BSCh were apparently low, except in A. noae adductor muscle. The enzyme activity in A. noae gills and V. verrucosa gills and adductor muscle was significantly inhibited by BW254c51, but not with iso-OMPA. ChE activity in adductor muscle of A. noae was significantly reduced by both diagnostic inhibitors. The effect of organophosphorous pesticide trichlorfon on ChE activity was investigated in vitro in both species as well as in the gills of mussels Mytilus galloprovincialis. The highest sensitivity of ChE to trichlorfon was observed in A. noae gills and adductor muscle (IC50 1.6×10(-7)M and 1.1×10(-7)M, respectively), followed by M. galloprovincialis gills (IC50 1.0×10(-6)M) and V. verrucosa gills and adductor muscle (IC50 1.7×10(-5)M and 0.9×10(-5)M, respectively). The results of this study suggest the potential of ChE activity measurement in the tissues of A. noae as effective biomarker of OP exposure in marine environment. PMID:23701992

  8. Inhibition of the thioredoxin system in the brain and liver of zebra-seabreams exposed to waterborne methylmercury

    International Nuclear Information System (INIS)

    Mercury compounds were recently found to interact in vitro with the thioredoxin system, inhibiting both Thioredoxin (Trx) and Thioredoxin reductase (TrxR). In order to evaluate if Trx and TrxR are affected in vivo by methylmercury (MeHg), we exposed juvenile zebra-seabreams to different concentrations of this toxicant in water for 28 days followed by a 14-day depuration period. Methylmercury accumulated to a larger extent in the kidney and liver of fishes, but decreased significantly during the depuration. During the exposure, MeHg percentage in the liver reached levels above 90% of total mercury (HgT) decreasing to 60% of HgT by the end of the depuration period. In the kidney, MeHg accounted for 50-70% of HgT. In the brain and muscle, mercury accumulated throughout the exposure with all mercury being MeHg. The total mercury kept increasing in these organs during the depuration period. However, in the brain, this increase in HgT was accompanied by a decrease in the MeHg percentage (∼ 10%). In the liver, both Trx and TrxR activities were significantly reduced (TrxR - 40%; Trx - 70%) by the end of the exposure, but recovered to control levels (100%) during the depuration. In the brain, both enzymes where inhibited during the depuration period (TrxR - 75%; Trx - 70%) when some production of inorganic mercury was detected. Activity of glutathione reductase showed increased levels when TrxR activity was low, suggesting complementarity between both systems. These results indicate that in vivo the thioredoxin system is a toxicological target for MeHg with TrxR being particularly affected.

  9. Study of the biological effects of uranium exposure on zebra fish (D. rerio). Impact on life stages

    International Nuclear Information System (INIS)

    This work is part of an ongoing project (ENVIRHOM) started at IRSN in 2000, which consists in studying the environmental effects of radioactive substances at chronic low level of exposure. In this general frame, our aim was two fold: (i) to identify sensitivity of different critical life stages of zebra fish (fish of fresh water frequently used for tests standards in ecotoxicology) to uranium exposure and (ii) to evaluate underlying mechanisms. Experiments were conducted with eggs, larvae and genitors exposed to uranium at environmentally relevant concentrations (from 20 to 500 μg/L) in order to study survival, hatching of eggs, growth of larvae and reproduction of genitors. Bio-markers of exposure (i.e. U bioaccumulation) and bio-markers of effects at molecular level (i.e. genotoxic effects, reproductive-toxicity) were also measured. Sensitivity of fish to uranium was dependent of the life stage of development with the early life stage being the most sensitive to U either directly or maternally exposed. It underlines the relevance of including pro-larval stages for toxicity assessments in fish. Moreover drastic effects of uranium on reproductive success and DNA damages in the germ cells foretell a strong impact on the population for low concentration of exposure (20 μg/L). As it is increasingly recognized that population-level effects of toxic substances are more relevant in terms of ecological risk assessment, this study points out the need to include different life stages of organisms in eco-toxicological studies, especially the sensitive early stages. Moreover, it appears, through the comparative study of the radiological effects or by another isotope of the uranium of stronger radioactivity (233U or by an irradiation with 137Cs), that the effects of the uranium are due to its chemo-toxicity. (author)

  10. Food for song: expression of c-Fos and ZENK in the zebra finch song nuclei during food aversion learning.

    Directory of Open Access Journals (Sweden)

    Kirill Tokarev

    Full Text Available BACKGROUND: Specialized neural pathways, the song system, are required for acquiring, producing, and perceiving learned avian vocalizations. Birds that do not learn to produce their vocalizations lack telencephalic song system components. It is not known whether the song system forebrain regions are exclusively evolved for song or whether they also process information not related to song that might reflect their 'evolutionary history'. METHODOLOGY/PRINCIPAL FINDINGS: To address this question we monitored the induction of two immediate-early genes (IEGs c-Fos and ZENK in various regions of the song system in zebra finches (Taeniopygia guttata in response to an aversive food learning paradigm; this involves the association of a food item with a noxious stimulus that affects the oropharyngeal-esophageal cavity and tongue, causing subsequent avoidance of that food item. The motor response results in beak and head movements but not vocalizations. IEGs have been extensively used to map neuro-molecular correlates of song motor production and auditory processing. As previously reported, neurons in two pallial vocal motor regions, HVC and RA, expressed IEGs after singing. Surprisingly, c-Fos was induced equivalently also after food aversion learning in the absence of singing. The density of c-Fos positive neurons was significantly higher than that of birds in control conditions. This was not the case in two other pallial song nuclei important for vocal plasticity, LMAN and Area X, although singing did induce IEGs in these structures, as reported previously. CONCLUSIONS/SIGNIFICANCE: Our results are consistent with the possibility that some of the song nuclei may participate in non-vocal learning and the populations of neurons involved in the two tasks show partial overlap. These findings underscore the previously advanced notion that the specialized forebrain pre-motor nuclei controlling song evolved from circuits involved in behaviors related to feeding.

  11. Pre and post-natal antigen exposure can program the stress axis of adult zebra finches: evidence for environment matching.

    Science.gov (United States)

    Merrill, Loren; Grindstaff, Jennifer L

    2015-03-01

    Both maternal exposure to stressors and exposure of offspring to stressors during early life can have lifelong effects on the physiology and behavior of offspring. Stress exposure can permanently shape an individual's phenotype by influencing the development of the hypothalamic-pituitary-adrenal (HPA) axis, which is responsible for the production and regulation of glucocorticoids such as corticosterone (CORT). In this study we used captive zebra finches (Taeniopygia guttata) to examine the effects of matching and mismatching maternal and early post-natal exposure to one of two types of antigens or a control on HPA axis reactivity in adult offspring. Prior to breeding, adult females were injected with lipopolysaccharide (LPS), keyhole limpet hemocyanin (KLH) or a control. Offspring of females in each of the three treatments were themselves exposed to LPS, KLH or a control injection at 5 and 28days post-hatch. When offspring were at least 18months of age, standardized capture and restraint stress tests were conducted to determine the impact of the treatments on adult stress responsiveness. We found significant interaction effects between maternal and offspring treatments on stress-induced CORT levels, and evidence in support of the environment matching hypothesis for KLH-treated birds, not LPS-treated birds. KLH-treated offspring of KLH-treated mothers exhibited reduced stress-induced CORT levels, whereas LPS-treated or control offspring of KLH-treated mothers exhibited elevated stress-induced CORT levels. Although the treatment effects on baseline CORT were non-significant, the overall pattern was similar to the effects observed on stress-induced CORT levels. Our results highlight the complex nature of HPA axis programming, and to our knowledge, provide the first evidence that a match or mismatch between pre and post-natal antigen exposure can have life-long consequences for HPA axis function. PMID:25535860

  12. Interactive effects of early and later nutritional conditions on the adult antioxidant defence system in zebra finches.

    Science.gov (United States)

    Noguera, José C; Monaghan, Pat; Metcalfe, Neil B

    2015-07-01

    In vertebrates, antioxidant defences comprise a mixture of endogenously produced components and exogenously obtained antioxidants that are derived mostly from the diet. It has been suggested that early-life micronutritional conditions might influence the way in which the antioxidant defence system operates, which could enable individuals to adjust the activity of the endogenous and exogenous components in line with their expected intake of dietary antioxidants if the future environment resembles the past. We investigated this possibility by experimentally manipulating the micronutrient content of the diet during different periods of postnatal development in the zebra finch (Taeniopygia guttata). Birds that had a low micronutrient diet during the growth phase initially had a lower total antioxidant capacity (TAC) than those reared under a high micronutrient diet, but then showed a compensatory response, so that by the end of the growth phase, the TAC of the two groups was the same. Interestingly, we found an interactive effect of micronutrient intake early and late in development: only those birds that continued with the same dietary treatment (low or high) throughout development showed a significant increase in their TAC during the period of sexual maturation. A similar effect was also found in the level of enzymatic antioxidant defences (glutathione peroxidase; GPx). No significant effects were found in the level of oxidative damage in lipids [malondialdehyde (MDA) levels]. These findings demonstrate the importance of early and late developmental conditions in shaping multiple aspects of the antioxidant system. Furthermore, they suggest that young birds may adjust their antioxidant defences to enable them to 'thrive' on diets rich or poor in micronutrients later in life. PMID:25987737

  13. No Trade-Offs between Lipid Stores and Structural Growth in Juvenile Zebra Finches Undergoing Nutritional Stress during Development.

    Science.gov (United States)

    Kriengwatana, Buddhamas; MacDougall-Shackleton, Scott A

    2015-01-01

    Nutritional conditions during development can affect both structural growth and body fat deposition. Body size and body fat each have significant consequences for fitness, yet few studies have investigated how young birds balance resource allocation between structural growth and fat reserves. We raised zebra finches (Taeniopygia guttata) in consistently high- or low-food conditions until posthatch day 35 (PHD 35). From this age until PHD 62, half of the birds in each condition were switched to the other treatment, while the rest were maintained on the same conditions. Body mass, lean mass, body fat, and tarsus length were measured before (PHD 25) and after (PHD 55) nutritional independence. Precise measures of body composition were obtained noninvasively at both ages using quantitative magnetic resonance analysis. At PHD 25, birds in the high treatment had more body mass and lean mass than birds in the low treatment, but nutritional treatments did not affect body fat at this age. Unexpectedly, the strategic response of birds that experienced deteriorating food availability was to maintain body mass by increasing body fat and decreasing lean mass. Birds that experienced an improvement in food availability significantly increased body mass by increasing lean mass and not body fat. Birds maintained on a low diet throughout did not significantly increase body mass, lean mass, or body fat. Tarsus length was not affected by nutritional manipulations. These findings indicate that nutritional stress did not affect the relationship between skeletal growth and body fat deposition because lean mass, body fat, and tarsus length can be independently regulated at different developmental periods depending on nutritional conditions. PMID:25730275

  14. Acute embryotoxic effects but no long-term reproductive effects of in ovo methylmercury exposure in zebra finches (Taeniopygia guttata).

    Science.gov (United States)

    Yu, Maria S; Eng, Margaret L; Williams, Tony D; Basu, Niladri; Elliott, John E

    2016-06-01

    Mercury bioaccumulates in terrestrial ecosystems as methylmercury (MeHg), yet little is known about its effects on terrestrial organisms, including songbirds. The authors used a model songbird species, the zebra finch (Taeniopygia guttata), to assess short-term embryotoxic effects of in ovo MeHg exposure on hatching success and posthatching growth and nestling survival, as well as longer-term effects on mating behavior and reproduction. Egg treatment groups included a low-MeHg dose of 0.2 μg Hg g(-1) egg (n = 36), a high-MeHg dose of 3.2 μg Hg g(-1) egg (n = 49), and a control (n = 34). Doses were dissolved in nanopure filtered water and injected into the albumen on the day eggs showed signs of viability (3 d incubation). In ovo exposure to MeHg significantly reduced hatching success (53% in the high-MeHg dose group vs 94% in vehicle controls). Among hatched chicks, however, no effects of MeHg on growth, hematological variables, or nestling survival were detected. While the in ovo injection method resulted in a dose-dependent pattern of MeHg concentrations in blood of surviving chicks at 15 d and 30 d posthatching, there was evidence of rapid excretion of MeHg with nestling age during that growth period. At reproductive maturity (90 d of age), no long-term effects of in ovo exposure to MeHg on female mating behavior, reproductive effort (egg or clutch size), or growth and survivorship of offspring were observed. Environ Toxicol Chem 2016;35:1534-1540. © 2015 SETAC. PMID:26573953

  15. The songbird syrinx morphome: a three-dimensional, high-resolution, interactive morphological map of the zebra finch vocal organ

    Directory of Open Access Journals (Sweden)

    Düring Daniel N

    2013-01-01

    Full Text Available Abstract Background Like human infants, songbirds learn their species-specific vocalizations through imitation learning. The birdsong system has emerged as a widely used experimental animal model for understanding the underlying neural mechanisms responsible for vocal production learning. However, how neural impulses are translated into the precise motor behavior of the complex vocal organ (syrinx to create song is poorly understood. First and foremost, we lack a detailed understanding of syringeal morphology. Results To fill this gap we combined non-invasive (high-field magnetic resonance imaging and micro-computed tomography and invasive techniques (histology and micro-dissection to construct the annotated high-resolution three-dimensional dataset, or morphome, of the zebra finch (Taeniopygia guttata syrinx. We identified and annotated syringeal cartilage, bone and musculature in situ in unprecedented detail. We provide interactive three-dimensional models that greatly improve the communication of complex morphological data and our understanding of syringeal function in general. Conclusions Our results show that the syringeal skeleton is optimized for low weight driven by physiological constraints on song production. The present refinement of muscle organization and identity elucidates how apposed muscles actuate different syringeal elements. Our dataset allows for more precise predictions about muscle co-activation and synergies and has important implications for muscle activity and stimulation experiments. We also demonstrate how the syrinx can be stabilized during song to reduce mechanical noise and, as such, enhance repetitive execution of stereotypic motor patterns. In addition, we identify a cartilaginous structure suited to play a crucial role in the uncoupling of sound frequency and amplitude control, which permits a novel explanation of the evolutionary success of songbirds.

  16. Food, stress, and circulating testosterone: Cue integration by the testes, not the brain, in male zebra finches (Taeniopygia guttata).

    Science.gov (United States)

    Lynn, Sharon E; Perfito, Nicole; Guardado, Daisy; Bentley, George E

    2015-05-01

    Food abundance is closely associated with reproductive readiness in vertebrates. Food scarcity can activate the hypothalamo-pituitary-adrenal axis, decrease sex steroid secretion, and dampen reproductive behavior. However, the mechanisms underlying these transient effects are unclear. Gonadotropin inhibitory hormone (GnIH), a neuropeptide present in the brain and gonads, is also influenced by glucocorticoids and fasting in some species. We investigated whether fasting stress activated the GnIH system in zebra finches (Taeniopygia guttata), with the potential for downstream effects on reproductive physiology and behavior. We fasted or fed males ad libitum for 10h. Fasting increased corticosterone and decreased testosterone in circulation. To assess whether the decrease in testosterone was mediated by changes in the hypothalamus and/or the gonads, we (1) quantified GnRH- and GnIH-positive neurons in the hypothalamus, (2) assessed hypothalamic gene expression for GnRH and GnIH, and (3) examined gene expression for proteins involved in testosterone synthesis in fasted and control birds. No measure of hypothalamic neuropeptides was related to treatment or circulating steroids. However, birds with higher corticosterone had higher testicular GnIH expression and lower testosterone. StAR and LHR expression were lower in the testes of fasted birds than controls. Thus, the decrease in testosterone was not likely mediated by hypothalamic GnIH, but rather by direct actions of fasting and/or corticosterone on the testes, indicating that the testes can integrate and respond to cues of stress directly. Such local inhibition of testosterone synthesis may allow for rapid and reversible changes in physiology and behavior when conditions are inappropriate for breeding. PMID:25849310

  17. Characterization of uranium effects on the zebra fish Danio rerio. Stress mechanisms, neuro-toxicity and mitochondrial metabolism

    International Nuclear Information System (INIS)

    This research explored several biological effects of uranium (U) in zebra fish exposed to low waterborne uranium concentrations (20 and 100 microgram/L). In tissue specific study (brain, liver, skeletal muscles and gills) of transcriptional responses in 20 genes identified the nature of the potential U effects during 28 days of exposure followed by an 8-day depuration phase in connection with U bioaccumulation. Liver and gills accumulate high concentrations of U and the depuration is efficient contrary to the brain and muscles. U exposure induced a later response in liver (inflammatory process, apoptosis and detoxification) and gills (oxidative balance) and an early one in brain (neuronal response) and muscles (mitochondrial metabolism). Brain and muscles appear sensitive since defence mechanisms are inefficient above low concentrations. A further study on these two organs examined the function and protein content of the respiratory mitochondrial chain following U exposure. An inhibition of the respiratory control ratio for the lowest concentration, variation in the protein synthesis of the complex IV (induction of cytochrome c oxidase sub-unit I and IV) and histological damage (dilatation in brain and vacuolisation in muscles) were observed. Another study focused on the early effects on the brain and was accomplished through a large transcriptional analysis coupled with examinations of the olfactory bulb ultrastructure. A depression of genes encoding olfactory receptor or111-7 and or102-5 was observed as rapidly as 3 days post-exposure to the lowest concentration of U. These responses and histological injuries suggest that the olfactory system could be sensitive to U exposure. (author)

  18. Avaliação farmacognóstica e microbiológica da droga vegetal camomila (Chamomilla recutita L. comercializada como alimento em Cascavel - Paraná Pharmacognostic and microbiological evaluation of the medicinal plant chamomile (Chamomilla recutita L. commercialized as food in Cascavel Municipality, Paraná State, Brazil

    Directory of Open Access Journals (Sweden)

    P.S.R Lucca

    2010-06-01

    Full Text Available As plantas medicinais, dentre elas a camomila, têm sido muito utilizadas na forma de droga vegetal pela população em geral, como importantes alternativas alimentícias e terapêuticas. Considerando que a fiscalização sanitária destes produtos é precária, este quadro torna-se preocupante, visto que, um produto em condições inadequadas para consumo pode acarretar vários riscos ao consumidor. Diante disso, este trabalho teve por objetivo realizar avaliação farmacognóstica e microbiológica em quinze amostras de chá de camomila comercializadas na cidade de Cascavel, Paraná. A metodologia adotada para a realização dos testes foi a preconizada pela Farmacopéia Brasileira (1988, 1996, 1998. O estudo de autenticidade revelou que todas as amostras eram constituídas por Chamomilla recutita L., porém na maioria das amostras os capítulos florais apresentavam-se excessivamente destruídos. Seis amostras apresentaram teor de materiais estranhos acima de 5%. Quanto ao doseamento de óleo essencial, todas as amostras foram insatisfatórias, visto que, apresentaram apenas traços de óleos essenciais, ou seja, valores abaixo de 0,4%, sendo este valor o mínimo exigido pela Farmacopéia. Com relação às análises de bolores e leveduras foi verificado que quatro amostras apresentaram valores acima do limite de 10(4 UFC mL-1, conforme preconizado pela Organização Mundial de Saúde. A partir dos dados obtidos concluiu-se que a camomila comercializada na cidade de Cascavel - Paraná apresenta problemas com relação à qualidade, sendo necessário definir medidas adequadas de controle higiênico sanitário ao longo da cadeia de produção, para garantir a qualidade e segurança destes produtos.Medicinal plants, including chamomile, have been largely used by the general population as important food and therapeutic alternatives. Considering that the sanitary control of such products is precarious, this situation becomes worrisome since a

  19. Análise da contaminação fúngica em amostras de Cassia acutifolia Delile (sene e Peumus boldus (Molina Lyons (boldo-do-Chile comercializadas na cidade de Campinas, Brasil Analysis of the fungal contamination in Cassia acutifolia Delile (sene and Peumus boldus (Molina Lyons (boldo-do-Chile sold in Campinas, Brazil

    Directory of Open Access Journals (Sweden)

    Liliana de O. Rocha

    2004-12-01

    Full Text Available A sociedade atual tem buscado a fitoterapia como um importante recurso terapêutico, sendo a avaliação da qualidade microbiológica destes produtos um requisito essencial, considerando a sua origem. Deste modo, o objetivo da pesquisa foi realizar a contagem e a identificação de fungos filamentosos em 20 amostras de folhas de Cassia acutifolia Delile (sene e de Peumus boldus (Molina Lyons (boldo-do-Chile comercializadas em farmácias de manipulação e mercados da cidade de Campinas, Brasil, usando as técnicas microbiológicas clássicas. Os resultados obtidos evidenciaram que 45% das amostras analisadas se situavam fora dos padrões estabelecidos pela Organização Mundial da Saúde (OMS. Não foram observadas diferenças significativas na análise quantitativa da contaminação fúngica entre amostras comercializadas em farmácias de manipulação e mercados, tanto para o boldo-do-Chile como para a sene. Os fungos identificados nestas amostras foram: Aspergillus, Penicillium, Phoma, Cladosporium, Trichoderma, Rhizopus, Mucor, Aureobasidium pullulans, Mycelia sterilia, Acremonium e Monilia sitophila. Estes resultados demonstraram o baixo nível de qualidade desses fitoterápicos, pois, além do elevado número de amostras contaminadas, foram identificados fungos de gêneros produtores de micotoxinas, como o Aspergillus e o Penicillium. Verifica-se a urgência na realização de adequado controle de qualidade microbiológico dos fitoterápicos e de implantação de fiscalização efetiva, para garantir a segurança e eficácia destes produtos.The consumption of medicinal plants has increased during the last years. The purpose of this study was to evaluate and identify fungi specimens present in samples of Cassia acutifolia Delile (20 (sene and Peumus boldus (Molina Lyons (Boldo-do-Chile (20, that were purchased in drugstores and markets of Campinas, Brazil, by usual methods. The results showed that 45% of samples did not fit the minimum

  20. Caracterização socio-econômico-cultural de raizeiros e procedimentos pós-colheita de plantas medicinais comercializadas em Maceió, AL Cultural, economic and social characterization of herb sellers and post-harvest procedures of medicinal plants commercialized in Maceió, Alagoas State, Brazil

    Directory of Open Access Journals (Sweden)

    A.C. Araújo

    2009-01-01

    Full Text Available Objetivou-se, com este trabalho, estabelecer o perfil sócio-econômico-cultural de raizeiros, bem como executar um levantamento dos procedimentos pós-colheita para as plantas medicinais comercializadas em feiras e mercados ao ar livre na cidade de Maceió, AL. Foram abordados aspectos sociais, econômicos e culturais de 46 raizeiros, bem como os procedimentos pós-colheita adotados para a conservação das plantas medicinais comercializadas no município. Os raizeiros entrevistados eram, na maioria, naturais de Maceió, católicos, casados e arrecadavam, em geral, mais de um salário mínimo por mês, predominando, com relação à raça, indivíduos pardos e negros. A maior parte trabalhava com ervas medicinais há mais de 10 anos e adquiriram conhecimento sobre as plantas, principalmente através de informações passadas pelos pais e/ou avós. Cerca de 30,43% concluíram o ensino fundamental. A forma de secagem mais adotada foi a exposição ao sol e à sobra, alternadamente. Os tempos máximos de secagem e armazenamento mais encontrados foram quatro dias e um ano, respectivamente. A secagem e o armazenamento geralmente ocorriam na própria barraca, bem como o acondicionamento após o expediente de trabalho. Há falhas no tocante as práticas adotadas, o que pode comprometer a eficicácia dos princípios curativos das plantas.The aim of this work was to establish the cultural, economic and social profile of herb sellers, as well as to survey postharvest procedures for medicinal plants commercialized in open-air markets from Maceió, Alagoas State, Brazil. Social, economic and cultural aspects from 46 herb sellers were evaluated, as well as the postharvest procedures adopted for conservation of medicinal plants commercialized in Maceió. Most of the interviewed herb sellers were born in Maceió, catholic, married, predominantly mulatto and black, and usually received more than one minimum wage per month. The majority of them had been working

  1. Helminthes and protozoa occurrence in raw vegetable from commercial establishments in Guarapuava County, Paraná, Brazil/ Ocorrência de helmintos e protozoários em hortaliças cruas comercializadas no município de Guarapuava, Paraná, Brasil

    Directory of Open Access Journals (Sweden)

    João Luis Garcia

    2005-06-01

    Full Text Available Vegetables are the most important transmission source of enteroparasites to human beings. The objective of this paper was to evaluate enteroparasites occurrence in vegetables from commercial establishments of Guarapuava County, Paraná State, Brazil. Forty two samples (44.7% out of 94 were positive, being 15 /21 (71.4% from smooth lettuce, 21 /55 from rough lettuce and 6 /18 (33.3% from watercress. Smooth lettuce samples have shown a higher contamination risk than rough lettuce (OR= 4, pO consumo de hortaliças é uma das principais vias de transmissão de enteroparasitas para os seres humanos. Considerando este fato, o presente trabalho teve como objetivo avaliar a ocorrência de enteroparasitas em hortaliças comercializadas no município de Guarapuava, Paraná, Brasil. Amostras de alface lisa, alface crespa e agrião foram processadas e analisadas para verificar a presença de enteroparasitas. Das 94 amostras colhidas (55 de alface crespa, 21 de alface lisa e 18 de agrião, 42 (44,7% foram positivas para a presença de algum tipo de enteroparasita. As amostras de alface lisa apresentaram um risco de contaminação maior do que as de alface crespa (OR = 4, p < 0,05 e as de agrião (OR = 5, p < 0,05. Os principais helmintos e protozoários observados foram Ancylostomatidae (85,7%, Strongyloides sp. (28,5%, Giardia sp. (4,7% e Enterobius sp. (2,3%. Considerando os resultados obtidos, ressalta-se a necessidade da realização de medidas preventivas para melhorar a qualidade higiênica sanitária das hortaliças, tanto pelas autoridades sanitárias como pelos consumidores.

  2. Concentração de flúor em águas engarrafadas comercializadas no município de São Paulo Fluoride concentration in bottled water on the market in the municipality of São Paulo

    Directory of Open Access Journals (Sweden)

    Roberto Henrique da Costa Grec

    2008-02-01

    Full Text Available O objetivo do estudo foi avaliar a concentração de flúor na água engarrafada comercializada, comparando-a aos valores impressos no rótulo da embalagem. Foram coletadas 229 amostras de água das 35 marcas disponíveis em diversos supermercados, mercearias e lanchonetes de grande circulação nas diferentes regiões do município de São Paulo, em 2006. A concentração de flúor foi determinada por análise em duplicata, utilizando o eletrodo íon-específico. A concentração de flúor variou entre 0,01 e 2,04 mg/l, com diferenças significantes entre os valores estipulados nos rótulos e os encontrados com a análise. Esses resultados reforçam a importância do controle dos níveis de flúor na água engarrafada por parte da vigilância sanitária.The objective of the study was to evaluate the fluoride concentration in bottled water available on the market, in comparison with the values printed on the bottle label. Two hundred and twenty-nine water samples were collected from 35 brands available in several supermarkets, grocery stores and snack bars with high turnover in different regions of the municipality of São Paulo, Southeastern Brazil, in 2006. Fluoride concentrations were determined by duplicate analysis using an ion-specific electrode. The fluoride concentrations ranged from 0.01 to 2.04 mg/l, with significant differences between the values stipulated on labels and those found in the analyses. These results emphasize the importance of controls over fluoride levels in bottled water enforced by the sanitary surveillance agency.

  3. The vocal repertoire of the domesticated zebra finch: a data-driven approach to decipher the information-bearing acoustic features of communication signals.

    Science.gov (United States)

    Elie, Julie E; Theunissen, Frédéric E

    2016-03-01

    Although a universal code for the acoustic features of animal vocal communication calls may not exist, the thorough analysis of the distinctive acoustical features of vocalization categories is important not only to decipher the acoustical code for a specific species but also to understand the evolution of communication signals and the mechanisms used to produce and understand them. Here, we recorded more than 8000 examples of almost all the vocalizations of the domesticated zebra finch, Taeniopygia guttata: vocalizations produced to establish contact, to form and maintain pair bonds, to sound an alarm, to communicate distress or to advertise hunger or aggressive intents. We characterized each vocalization type using complete representations that avoided any a priori assumptions on the acoustic code, as well as classical bioacoustics measures that could provide more intuitive interpretations. We then used these acoustical features to rigorously determine the potential information-bearing acoustical features for each vocalization type using both a novel regularized classifier and an unsupervised clustering algorithm. Vocalization categories are discriminated by the shape of their frequency spectrum and by their pitch saliency (noisy to tonal vocalizations) but not particularly by their fundamental frequency. Notably, the spectral shape of zebra finch vocalizations contains peaks or formants that vary systematically across categories and that would be generated by active control of both the vocal organ (source) and the upper vocal tract (filter). PMID:26581377

  4. Two-photon deep imaging through skin and skull of Zebra finches: preliminary studies for in-vivo brain metabolism monitoring

    Science.gov (United States)

    Abi-Haidar, D.; Olivier, T.; Mottin, S.; Vignal, C.; Mathevon, N.

    2007-02-01

    Zebra Finches are songbirds which constitute a model for neuro-ethologists to study the neuro-mechanisms of vocal recognition. For this purpose, in vivo and non invasive monitoring of brain activity is required during acoustical stimulation. MRI (Magnetic Resonance Imaging) or NIRS (Near InfraRed Spectroscopy) are suitable methods for these measurements, even though MRI is difficult to link quantitatively with neural activity and NIRS suffers from a poor resolution. In the particular case of songbirds (whose skin is thin and quite transparent and whose skull structure is hollow), two-photon microscopy enables a quite deep penetration in tissues and could be an alternative. We present here preliminary studies on the feasability of two-photon microscopy in these conditions. To do so, we chose to image hollow fibers, filled with Rhodamine B, through the skin of Zebra finches in order to evaluate the spatial resolution we may expect in future in vivo experiments. Moreover, we used the reflectance-mode confocal configuration to evaluate the exponential decrease of backreflected light in skin and in skull samples. Following this procedure recently proposed by S.L. Jacques and co-workers, we planned to determine the scattering coefficient μ s and the anisotropy g of these tissues and make a comparison between fixed and fresh skin and skull samples for future Monte Carlo simulations of the scattering in our particular multi-layered structure.

  5. Metabolic programming of zebra fish Danio rerio uncovered. Physiological performance as explained by dynamic energy budget theory and life-cycle consequence of uranium induced perturbations

    International Nuclear Information System (INIS)

    The aim of this dissertation is to characterize the toxicity of uranium on the metabolism of zebra fish, nio rerio. The first three chapters of this manuscript are dedicated to characterizing the blank metabolism of zebra fish. I used the Dynamic Energy Budget (deb) theory for this characterisation; it is presently the only theory that covers the full life cycle of the organism and quantifies feeding, assimilation, growth, reproduction, maturation, maintenance and ageing. Any metabolic effect of uranium should appear as effects on one or more of these fundamental processes. Since the life span of zebra fish is some four and a half years, and larger individuals respond slower to chemical stress, the focus was on the early life stages. Considerable breakthroughs in the quantification of zebra fish development, growth and reproduction have been made. It turned out the zebra fish accelerates its metabolism after birth till metamorphosis, when acceleration ceases. This process is seen in some, but not all, species of fish. Another striking conclusion was that somatic maintenance was much higher than is typical for fish. We don't yet have an explanation for this funding. Further it turned out that the details of reproduction matter: allocation to reproduction (in adults) accumulates in a reproduction buffer and this buffer is used to prepare batches of eggs. We needed to detail this preparation process to understand how zebra fish can eliminate uranium via eggs. Deb theory specifies that a particular developmental stage (birth, metamorphosis, puberty) is reached at specified levels of maturity. For different temperatures and food levels, that can occur at different ages and body sizes. We extended this idea to include all the described morphologically defined developmental stages of the zebra fish in the literature; the observed variations in ages and body sizes can now be explained by deb theory. To test if deb theory can also explain perturbations of maturation, we

  6. Studies on the antitumor activities of the water extract of Arca subcrenata Lischke%毛蚶水提物对人肿瘤细胞生长的抑制作用研究

    Institute of Scientific and Technical Information of China (English)

    冯婷; 田佳鑫; 李子木; 林华英; 孙震晓

    2013-01-01

    目的 考察毛蚶水提物体外抗肿瘤活性,研究其抗肿瘤作用机制.方法 MTT法检测毛蚶水提物对9种人肿瘤细胞系生长的影响,并通过Giemsa染色光学显微镜下观察肿瘤细胞核的变化;流式细胞术及TUNEL染色检测毛蚶水提物对HT-29细胞周期的影响和凋亡情况;Western blotting检测凋亡相关蛋白Caspaes-3的表达情况.结果 毛蚶水提物对人结直肠癌HT-29、HCT-116细胞,肝癌HepG-2、BEL-7402细胞及肺癌A549细胞具有较强的抑制作用,抑制作用呈作用时间和剂量依赖性.流式细胞术结合细胞Giemsa染色结果显示,毛蚶水提物能引起人结直肠癌HT-29细胞G2-M期阻滞,多核细胞增加.TUNEL染色显示毛蚶水提物有一定诱导细胞凋亡的作用.400 μg·mL-1毛蚶水提物对HT-29细胞Caspase-3蛋白的表达具有下调作用.结论 毛蚶水提物体外具有广谱抗癌活性;毛蚶水提物抑制人结直肠癌HT-29细胞生长的主要机制为诱导细胞凋亡及引起肿瘤细胞G2-M期阻滞,进而形成多核细胞,最终导致肿瘤细胞死亡.%Objects To investigate the antitumor activities of the water extract of Arca subcrenata Lischke in vitro and disclose its antitumor mechanisms.Methods The effect of the water extract of Arca subcrenata Lischke on the growth of 9 different kinds of human tumor cell lines were detected by MTT assay,so the sensitive cell lines were picked up and their antitumor effects of dependence on dose and time were studied.Growth state and morphological changes of human colon rectal carcinoma HT-29 cells treated with the water extract of Arca subcrenata Lischke were observed under the inverted phase contrast microscope,the nucleus feature was analyzed by Giemsa staining.Flow cytometry and TUNEL assay were used to detect the cell cycle and apoptosis of HT-29 cells treated with the water extract.Apoptosis related casepase-3 protein expression was analyzed by Western blotting.Results Cell viability was

  7. Boat ramp locations within the Columbia River Basin with associated recreational use, water quality measurements, and risk assessment data for zebra and quagga mussels

    Science.gov (United States)

    Hardiman, Jill M.; Holmberg, Glen S.; Elder, Nancy E.

    2015-01-01

    Aquatic invasive species are often transported between water bodies on boats or boat trailers, thus they are considered one of the primary vectors for new introductions of invasive species to a water body. This data set contains geographic positioning system locational data for boater access points, use data (i.e. recreational, fishing), water quality measurements (e.g. calcium concentrations, pH), risk assessment data, and other physical attributes (i.e. size, elevation) where available within the Columbia and Snake Rivers and throughout the Columbia River Basin. This work builds on an earlier body of work by Wells et al. 2011, Prioritizing Zebra and Quagga Mussel Monitoring in the Columbia River Basin (PDF link below), which provided much of the initial water quality, use information, and risk assessment data (categorical values for the risk of introduction and the risk of establishment). Updated information has been added by collecting additional data on use of water bodies, as well as combined categorical ranking methodology for identifying water bodies that may be high risk for both introduction and establishment of zebra and quagga mussels. This data is also related to a regional effort to contribute to the coordination of monitoring efforts for early detection of zebra and quagga mussels in the context of risk assessment data (CRBAIS weblink below). Data sets provided here include a service definition file, provided with a few reference layers within the region for viewing and an online map ( http://arcg.is/1LrNmBj) with some query options, a GIS shapefile (Child Item), and a tabular data set (csv file; Child Item). It is recommended that all users of this data thoroughly read the metadata files for data definitions, sources, and data limitations. It is recommended to use the online map link ( http://arcg.is/1LrNmBj) for a quick view of the data set and some basic query options.  Once on the ArcGIS online map, to view all the data layers click the show

  8. Uptake and release kinetics of 134Cs by goldfish (Carassius auratus) and 137Cs by zebra fish (Brachydanio rerio) in controlled aquatic environment

    International Nuclear Information System (INIS)

    The uptake and release kinetics of 134Cs by Goldfish (Carassius auratus) and 137Cs by Zebra Fish (Brachydanio rerio) from aquatic media of different ionic compositions and temperature was studied in controlled laboratory conditions. The accumulation of radiocesium in the case of Brachydanio rerio is observed to be strongly dependent on the potassium ion concentration of the aquatic medium, but in the case of Carassius auratus this dependence is quite weak. The biological half-lives of the cesium isotopes incorporated into the fish investigated in the present work vary from 19 to 80 days and are influenced by the temperature and the ionic composition of the aquatic medium. (author) 19 refs.; 1 fig.; 3 tabs

  9. A water soluble and fast response fluorescent turn-on copper complex probe for H2S detection in zebra fish.

    Science.gov (United States)

    Palanisamy, Sathyadevi; Lee, Lu-Ying; Wang, Yu-Liang; Chen, Yu-Jen; Chen, Chiao-Yun; Wang, Yun-Ming

    2016-01-15

    According to the displacement method, herein we reported a water soluble copper complex [Cu(MaT-cyclen)2] as a fluorescent probe for the detection of H2S. For this, 1-((1-((10-methylanthracen-9-yl)methyl)-1H-1,2,3-triazol-4-yl)methyl)-1,4,7,10-tetraazacyclododecane (MaT-cyclen) was synthesized first. To improve its solubility in aqueous media, sodium acetate group was introduced into 8-hydroxy-2-quinoline successfully. MaT-cyclen was chelated with Cu(II) to form [Cu(MaT-cyclen)2] complex, which displayed high sensitivity and selectivity for H2S over the other possible competitive substances on the basis of forming CuS. Meanwhile, [Cu(MaT-cyclen)2] displayed rapid response (zebra fish. PMID:26592631

  10. Effects of the bioaccumulative polybrominated diphenyl ether flame retardant congener BDE-47 on growth, development, and reproductive success in zebra finches.

    Science.gov (United States)

    Currier, Heidi A; Letcher, Robert J; Williams, Tony D; Elliott, John E

    2015-02-01

    This study investigated the effects of the polybrominated diphenyl ether congener, 2,2',4,4'-tetrabromodiphenyl ether (BDE-47) on the growth and development, and subsequent breeding success of exposed zebra finches (Taeniopygia guttata). Using oral dosing procedures and treatments adjusted by weight, we treated newly hatched chicks daily for the first 20-days-post-hatch (dph) with varying treatments of BDE-47 (0, 5, 50, and 500 ng/g bw/day). Weight and tarsal measurements were monitored from hatch to 90 dph, but no differences were observed between treatment groups at any age. Treated females that reached sexual maturity were mated with untreated males; however, again no treatment effects were observed on breeding success. Analysis of tissue samples at 21 dph did indicate that debromination of BDE-47 had occurred resulting in BDE-28 and BDE-17 metabolites. PMID:25283367

  11. The Black Cuckoo-Shrike Campephaga flava: A new record for the Mountain Zebra National Park and the Cradock district, Cape Province

    Directory of Open Access Journals (Sweden)

    I.A.W Macdonald

    1984-12-01

    Full Text Available The avifauna of the Mountain Zebra National Park (MZNP has been recorded over a period of some two decades (Skead 1965, Koedoe 8: 1-40; Penzhorn & Bronkhorst 1976, Koedoe 19: 171-174; Penzhorn 1977, Koedoe 20: 205-207; Grobler & Bronkhorst 1981, Koedoe 24: 199-203. Collett (1982 Southern Birds 9: 1-65 has summarised all the available information on the avifauna of the Cradock district assembled since the turn of the century. Although 203 species are recorded from the MZNP by these authors (and a further four in the roneoed checklist for the park (Anon, updated, National Parks Board of Trustees, roneod, 15 pp no mention is made of the Black Cuckoo-Shrike Campephaga flava. Collett (1982 does not list it for the Cradock district.

  12. Study of the microbiological conditions of marketing of cassava (Manihot esculenta Crantz flour in supply center of Alagoinhas, Bahia Estudo das condições microbiológicas de farinhas de mandioca (Manihot esculenta Crantz comercializadas no centro de abastecimento de Alagoinhas, Bahia

    Directory of Open Access Journals (Sweden)

    Joelza Silva Carvalho

    2012-06-01

    Full Text Available In the city of Alagoinhas, Bahia, and in most Northeastern states, the cassava (Manihot esculenta Crantz flour is produced in a craft house, most often located in the place of production. This study aimed to evaluate the microbiological conditions of cassava flours marketed Supply Centre in Alagoinhas, Bahia. We collected 30 samples of cassava flour, 100 grams, which were placed in sterile, insulated container. The samples were tested for heterotrophic bacteria using the method of standard plate count, followed by Gram staining, the search for total and fecal coliforms was performed by the Most Probable Number (MPN. The results indicate that the samples that the samples are in accordance with current legislation regarding the analysis of total coliforms and thermotolerant (No município de Alagoinhas, Bahia, e na maioria dos estados do Nordeste, a farinha de mandioca (Manihot esculenta Crantz é produzida de forma artesanal em casas-de-farinha, na maioria das vezes localizadas no próprio local de plantio da mandioca. Este trabalho teve como objetivo avaliar as condições microbiológicas de farinhas de mandioca comercializadas no Centro de Abastecimento em Alagoinhas-Bahia. Foram coletadas 100 gramas de 30 amostras de farinha de mandioca, as quais foram acondicionadas em frascos estéreis, em recipiente isotérmico. As amostras foram submetidas à pesquisa de bactérias heterotróficas empregando-se o método de contagem padrão em placas, seguido da coloração de Gram, e a pesquisa para coliformes totais e termotolerantes foi realizada pela técnica do Número Mais Provável (NMP. Os resultados indicam que as amostras estão em conformidade com a legislação vigente em relação à análise de coliformes totais e termotolerantes (<3NMPg-1, na contagem de bactérias heterotróficas algumas amostras mostraram-se fora dos padrões aceitáveis. Na coloração de Gram foram observados bacilos, diplobacilos e estreptobacilos Gram positivos e Gram

  13. Carotenos e provitamina A em bertalha e ervas aromáticas comercializadas em Viçosa, Estado de Minas Gerais, durante as quatro estações do ano = Carotenes and provitamin A in basella and aromatic herbs marketed in Viçosa, Minas Gerais State, during the four seasons of the year

    Directory of Open Access Journals (Sweden)

    Marina Andrade Batista

    2006-01-01

    Full Text Available Este estudo teve como objetivos investigar o teor de a-caroteno, b-caroteno e calcular o valor de vitamina A em hortaliças comercializadas no mercado formal e informal de Viçosa, Estado de Minas Gerais, bem como avaliar a influência das quatro estações doano e do local de comercialização sobre o conteúdo desses nutrientes. As hortaliças (bertalha, cebolinha, coentro, manjericão e salsa foram analisadas utilizando-se a cromatografia líquida de alta eficiência (CLAE. Devido ao conteúdo inexpressivo de a-caroteno em todas as amostras, foi possível quantificar apenas o b-caroteno. Não se verificou diferença estatisticamente significativa (a = 0,05 no conteúdo de b-caroteno das hortaliças entre os diferentes estabelecimentos, nem entre as estações do ano. As hortaliçasmostraram-se excelentes fontes de provitamina A, e se consumidas regularmente, contribuem de forma importante na adequação diária de vitamina A para adultos e crianças. Além disso, esses alimentos são acessíveis à população por apresentarem baixo custo e serem facilmente encontrados.This study aimed to investigate the level of a-carotene, b-carotene and to calculate the value of vitamin A in vegetables sold at local markets and informal markets of Viçosa, Minas Gerais State, as wellas to evaluate the seasonal and commercial effects on the content of these pigments. The vegetables (basella, green onion, cilantro, sweet basil and parsley were analyzed through high-performance liquid chromatography (HPLC, being b-carotene the only pigment present in all the analyzed samples. No significant statistical differences (a = 0.05 were found in the contents of b-carotene of the vegetables either among the different stores, or among the different seasons. The vegetables analyzed are great provitamin A sources and, ifeaten on a regular basis, they can fit the daily requirements of vitamin A for adults and children. Besides, these foods are very accessible due to their

  14. Avaliação física e química da polpa de maracujá congelada comercializada na região de Bauru Physical-chemical evaluation of the frozen passion fruit pulp traded in the Bauru region

    Directory of Open Access Journals (Sweden)

    Kátia Raimundo

    2009-06-01

    Full Text Available A indústria de polpa de maracujá tem como objetivo a obtenção de produtos com características sensoriais e nutricionais próximas da fruta in natura. O objetivo deste trabalho foi avaliar as informações nutricionais das embalagens e as características físico-químicas das polpas de maracujá congeladas. Foram analisadas 25 amostras, de 07 marcas diferentes, adquiridas em supermercados de Bauru-SP, e região. Apenas uma das marcas analisadas (14,3% encontra-se em acordo com a legislação vigente, sendo que as demais apresentam tabelas ultrapassadas ou incompletas. As características físico-químicas diferem entre as marcas comercializadas, principalmente quanto ao teor de ácido ascórbico, sendo que 64,0% das amostras se encontram em desarcordo com o Regulamento Técnico para Fixação dos Padrões de Identidade e Qualidade (PIQ para polpa de maracujá do Ministério da Agricultura. As variações observadas entre a polpa in natura e a congelada são menores nos itens: densidade, pH, sólidos solúveis totais, acidez em ácido cítrico e ratio, mas altas quanto ao teor de ácido ascórbico.The purpose of passion fruit pulp industry is to keep the taste and nutritional characteristics as close as possible to the natural fruit. The objective of this work was to evaluate the packing nutritional information and the physical-chemical characteristics of the frozen passion fruit pulp. It was analyzed 25 pulp samples of the 07 different brand names found in Bauru and nearby cities in the State of São Paulo. Just one of the analyzed brand names (14.3 % was according to the current Brazilian Food Legislation, the others had exceeded or incomplete tables. The variations of the physical-chemical characteristics for the traded brands were mainly due to the rate of ascorbic acid (vitamin C and 64% of the samples also don't follow the rules of the Technical Regulation for Identity and Quality Standards (PIQ for passion fruit pulp of the

  15. 剑麻抗斑马纹病鉴定技术研究%Identification technology for agave resistance to zebra disease

    Institute of Scientific and Technical Information of China (English)

    赵艳龙; 常金梅; 何衍彪; 李国平; 周文钊

    2012-01-01

    To promote a set of identification technology for agave resistance to zebra disease, the most appropriate inoculating conditions of agave zebra disease pathogen were explored, and in vivo inoculation in glasshouses and in vitro in artificial climate chambers were performed with 8 agave germplasms for checking disease resistance. The results were compared with those obtained from open fields. The results showed that needle penetration inoculation, 25 - 30 °C and moisture retention were the most appropriate inoculating conditions. Both inoculating methods could identify the disease resistance and in vivo inoculation was more accurate.%为了促进形成一套剑麻抗斑马纹病的鉴定技术,本研究对剑麻斑马纹病最适宜接种条件进行了探讨,并利用活体叶片接种和离体叶片接种两种方式,以抗性不同的8个剑麻种质为试验材料,在人工气候箱和恒温室中进行剑麻抗斑马纹病接种试验,并与大田抗病性进行比较.结果表明:针刺法接种,25~30℃保湿培养是该病最适宜的发病条件;两种接种方法都能比较准确地鉴定剑麻种质对斑马纹病的抗病性,而活体叶片接种较离体叶片接种鉴定抗病性更加准确.

  16. Functional genomic analysis and neuroanatomical localization of miR-2954, a song-responsive sex-linked microRNA in the zebra finch

    Directory of Open Access Journals (Sweden)

    David F Clayton

    2014-12-01

    Full Text Available Natural experience can cause complex changes in gene expression in brain centers for cognition and perception, but the mechanisms that link perceptual experience and neurogenomic regulation are not understood. MicroRNAs (miRNAs or miRs have the potential to regulate large gene expression networks, and a previous study showed that a natural perceptual stimulus (hearing the sound of birdsong in zebra finches triggers rapid changes in expression of several miRs in the auditory forebrain. Here we evaluate the functional potential of one of these, miR-2954, which has been found so far only in birds and is encoded on the Z sex chromosome. Using fluorescence in situ hybridization and immunohistochemistry, we show that miR-2954 is present in subsets of cells in the sexually dimorphic brain regions involved in song production and perception, with notable enrichment in cell nuclei. We then probe its regulatory function by inhibiting its expression in a zebra finch cell line (G266 and measuring effects on endogenous gene expression using Illumina RNA sequencing (RNA-seq. Approximately 1000 different mRNAs change in expression by 1.5-fold or more (adjusted p<0.01, with increases in some but not all of the targets that had been predicted by Targetscan. The population of RNAs that increase after miR-2954 inhibition is notably enriched for ones involved in the MAP Kinase (MAPK pathway, whereas the decreasing population is dominated by genes involved in ribosomes and mitochondrial function. Since song stimulation itself triggers a decrease in miR-2954 expression followed by a delayed decrease in genes encoding ribosomal and mitochondrial functions, we suggest that miR-2954 may mediate some of the neurogenomic effects of song habituation.

  17. The combined effect of lead exposure and high or low dietary calcium on health and immunocompetence in the zebra finch (Taeniopygia guttata)

    International Nuclear Information System (INIS)

    The widespread contamination by lead and the acidification of the environment ask for a better understanding of the effects of the interaction between lead and calcium on various aspects of health, including disease defense, in wildlife. Here, we investigated the effects of chronic exposure to sublethal levels of lead, combined with high or low dietary calcium, on health and several components of immunity in male and female zebra finches (Taeniopygia guttata). Thirty individuals of each sex were randomly assigned to three groups: a control group, a group exposed to lead with an additional calcium source (i.e. grit) and a group exposed to lead without access to an extra calcium source. Lead was administered as lead acetate via the drinking water (20 ppm) for 38 consecutive days. Exposure to lead increased significantly the concentrations of lead in kidney and bone in individuals of the experimental groups. Furthermore, the lack of a calcium supplement significantly enhanced the uptake of lead. Lead did not affect health indices such as hematocrit, spleen mass and body mass, nor the adrenal stress response. Cell-mediated immune responsiveness, assessed by a delayed-type hypersensitivity response to phytohaemagglutinin, was also not affected by lead exposure. On the other hand, lead exposure did significantly suppress the secondary humoral immune response towards sheep red blood cells in females, but only when the additional calcium source was not available. This effect was not found in males, suggesting sexual differences in susceptibility of humoral immunity to lead treatment in zebra finches. - Male and female finches may respond to lead differently

  18. Genomic organization and molecular phylogenies of the beta (β keratin multigene family in the chicken (Gallus gallus and zebra finch (Taeniopygia guttata: implications for feather evolution

    Directory of Open Access Journals (Sweden)

    Sawyer Roger H

    2010-05-01

    Full Text Available Abstract Background The epidermal appendages of reptiles and birds are constructed of beta (β keratins. The molecular phylogeny of these keratins is important to understanding the evolutionary origin of these appendages, especially feathers. Knowing that the crocodilian β-keratin genes are closely related to those of birds, the published genomes of the chicken and zebra finch provide an opportunity not only to compare the genomic organization of their β-keratins, but to study their molecular evolution in archosaurians. Results The subfamilies (claw, feather, feather-like, and scale of β-keratin genes are clustered in the same 5' to 3' order on microchromosome 25 in chicken and zebra finch, although the number of claw and feather genes differs between the species. Molecular phylogenies show that the monophyletic scale genes are the basal group within birds and that the monophyletic avian claw genes form the basal group to all feather and feather-like genes. Both species have a number of feather clades on microchromosome 27 that form monophyletic groups. An additional monophyletic cluster of feather genes exist on macrochromosome 2 for each species. Expression sequence tag analysis for the chicken demonstrates that all feather β-keratin clades are expressed. Conclusions Similarity in the overall genomic organization of β-keratins in Galliformes and Passeriformes suggests similar organization in all Neognathae birds, and perhaps in the ancestral lineages leading to modern birds, such as the paravian Anchiornis huxleyi. Phylogenetic analyses demonstrate that evolution of archosaurian epidermal appendages in the lineage leading to birds was accompanied by duplication and divergence of an ancestral β-keratin gene cluster. As morphological diversification of epidermal appendages occurred and the β-keratin multigene family expanded, novel β-keratin genes were selected for novel functions within appendages such as feathers.

  19. Hydrothermal zebra dolomite in the Great Basin, Nevada--attributes and relation to Paleozoic stratigraphy, tectonics, and ore deposits

    Science.gov (United States)

    Diehl, S.F.; Hofstra, A.H.; Koenig, A.E.; Emsbo, P.; Christiansen, W.; Johnson, Chad

    2010-01-01

    In other parts of the world, previous workers have shown that sparry dolomite in carbonate rocks may be produced by the generation and movement of hot basinal brines in response to arid paleoclimates and tectonism, and that some of these brines served as the transport medium for metals fixed in Mississippi Valley-type (MVT) and sedimentary exhalative (Sedex) deposits of Zn, Pb, Ag, Au, or barite. Numerous occurrences of hydrothermal zebra dolomite (HZD), comprised of alternating layers of dark replacement and light void-filling sparry or saddle dolomite, are present in Paleozoic platform and slope carbonate rocks on the eastern side of the Great Basin physiographic province. Locally, it is associated with mineral deposits of barite, Ag-Pb-Zn, and Au. In this paper the spatial distribution of HZD occurrences, their stratigraphic position, morphological characteristics, textures and zoning, and chemical and stable isotopic compositions were determined to improve understanding of their age, origin, and relation to dolostone, ore deposits, and the tectonic evolution of the Great Basin. In northern and central Nevada, HZD is coeval and cogenetic with Late Devonian and Early Mississippian Sedex Au, Zn, and barite deposits and may be related to Late Ordovician Sedex barite deposits. In southern Nevada and southwest California, it is cogenetic with small MVT Ag-Pb-Zn deposits in rocks as young as Early Mississippian. Over Paleozoic time, the Great Basin was at equatorial paleolatitudes with episodes of arid paleoclimates. Several occurrences of HZD are crosscut by Mesozoic or Cenozoic intrusions, and some host younger pluton-related polymetallic replacement and Carlin-type gold deposits. The distribution of HZD in space (carbonate platform, margin, and slope) and stratigraphy (Late Neoproterozoic Ediacaran-Mississippian) roughly parallels that of dolostone and both are prevalent in Devonian strata. Stratabound HZD is best developed in Ediacaran and Cambrian units, whereas

  20. Conservação pós-colheita de banana cv. nanicão climatizada e comercializada em Cuiabá - MT e região Postharvest of banana 'nanicão' produced in the states of Mato Grosso and Santa Catarina, marketed in Cuiabá -MT

    Directory of Open Access Journals (Sweden)

    Raquel Pires Campos

    2003-04-01

    Full Text Available A banana cv. Nanicão é a principal cultivar comercializada nos mercados brasileiro e mundial. A maior parte dessa cultivar comercializada no Estado de Mato Grosso vem de outros Estados, embora existam condições edafoclimáticas para ser auto-suficiente na produção dessa cultivar e inclusive atender a outros mercados. O objetivo deste trabalho foi verificar as condições da climatização da banana cv. Nanicão e sua influência na conservação pós-colheita de frutos produzidos no Estado de Mato Grosso (MT e procedentes do Estado de Santa Catarina (SC. Foram acompanhadas 12 caixas de banana cv. Nanicão, pesando em torno de 21 kg cada, colhidas em pomar comercial do município de Campo Verde-MT, e também 12 caixas oriundas de SC. Anteriormente à climatização e durante todo o período de vida útil dos frutos, foram monitoradas diariamente a temperatura e a umidade relativa do ambiente, a evolução da coloração dos frutos e a perda de peso destes, assim como o teor de sólidos solúveis totais e de acidez potenciométrica nos frutos verdes e maduros. Verificou-se o maior período de vida útil da banana de SC, 3 dias após a retirada da câmara de climatização, apresentando-se totalmente amarela e com valor máximo de 7,07% de perda de peso dos frutos. A banana cv. Nanicão produzida no MT atingiu valores de perda de peso 5,69% no 2º dia, quando após esse período, não estaria mais própria para a comercialização, atingindo coloração amarelo-pálida. Altos índices de perdas foram detectados no período pós-colheita da banana-'Nanicão', representados principalmente por danos mecânicos na procedente de SC e por danos fisiológicos (despencamento na banana de MT. O despencamento pode estar relacionado com a falta de circulação eficiente do etileno, da exaustão e umidade relativa baixa, 65% em média, durante a climatização. Nos teores de açúcares e de acidez dos frutos, a banana do MT apresentou valores levemente

  1. ARCA: Traffic Classification Method Based on Automatic Reverse and Cluster Analysis%融合自动化逆向和聚类分析的协议识别方法

    Institute of Scientific and Technical Information of China (English)

    李城龙; 薛一波; 汪东升

    2012-01-01

    网络流分类与协议识别是网络管理的前提和必要条件,但是越来越多加密协议的出现,使得传统的流分类方法失效.针对加密协议的协议识别问题,提出了一种融合自动化逆向分析技术和网络消息聚类分析技术的新型分类方法(automatic reverse and message analysis,ARCA).该方法通过自动化逆向分析技术获得网络协议的结构特征;再利用网络消息聚类分析技术,获得网络协议的交互过程;最后将网络协议的结构特征与交互过程用于加密协议流量的识别和分类检测.该方法不依赖于网络包的内容检测,能够解决协议加密带来的识别问题.通过对多个加密协议(如迅雷、BT、QQ和GYalk等)真实流量的实验,其准确率和召回率分别高于96.9%和93.1%,而且只需要检测流量中0.9%的字节内容即可.因此,ARCA方法能够对各类加密协议流量进行有效和快速的识别.%Traffic classification and protocol identification are the premise and the essential condition to effective network management. However, more and more encrypted protocols make traditional traffic classification methods less effective. To address the issue, this paper proposes an automatic reverse and message analysis (ARCA) method to identify encryption protocols. Different from traditional classification approaches, the proposed method exploits the protocol structure by automatically and reversely analyzing the target protocol, obtains the protocol interactive process by clustering messages, then identifies the protocol using the protocol structure and interactive process together. This method does not need to check payload, so it can classify the encrypted protocols. The paper evaluates the efficacy and accuracy of ARCA with real world traffic, such as encryption protocols Thunder, BitTorrent, QQ and GTalk. The experimental results show that the accuracy rates and the recall rates are over 96.9% and 93.1% respectively and

  2. Estudo da ocorrência de enteroparasitas em hortaliças comercializadas na região metropolitana de São Paulo, SP, Brasil: I - Pesquisa de helmintos Study on the occurrence of intestinal parasites on vegetables commercially traded in the metropolitan area of S.Paulo, SP, Brazil: I - Search for helminths

    Directory of Open Access Journals (Sweden)

    Carlos Augusto Fernandes de Oliveira

    1992-08-01

    Full Text Available Hortaliças in natura, comercializadas na região metropolitana de São Paulo, SP (Brasil, foram analisadas através de metodologia própria, visando à pesquisa e à identificação de formas de transmissão de helmintos intestinais de interesse médico. As hortaliças examinadas, constituídas de 50 amostras de cada variedade, foram de: alface (Lactuca sativa, variedades lisa e crespa, escarola (Chichorium sp e agrião (Nasturtium officinale. Os resultados evidenciaram elevados percentuais de contaminação em todas as variedades analisadas, porém, as freqüências de helmintos foram maiores no agrião. A escarola apresentou valores médios, geralmente situados entre as alfaces e o agrião. Os números médios de ovos e larvas por 100 gramas de amostra, embora elevados, não apresentaram diferenças estatisticamente significantes entre as quatro variedades de hortaliças estudadas. Uma grande variedade de helmintos, de ocorrência freqüente na população residente na Região Metropolitana de São Paulo, foi observada nas amostras. Os mais freqüentes, no entanto, foram: ancilostomídeos e Ascaris sp. Recuperaram-se também ovos de Toxocara sp, Fasciola sp e de tricostrongilídeos, comprovando a ocorrência de contaminação das hortaliças por fezes de animais domésticos. Considerando-se os resultados obtidos, ressalta-se a importância das hortaliças na transmissão de helmintíases intestinais, bem como a necessidade de medidas que propiciem uma melhoria na qualidade higiênico-sanitária destes alimentos.Vegetables in natura, commercially traded in the metropolitan area of S. Paulo, were analysed by the appropriate methodology with a view to discovering an identifying the paths of transmission of enteroparasites of medical interest. The vegetables under study consisted of 50 samples of each variety listed below: lettuce (Lactuca sativa -oily leaves and crisphead varieties, endive (Chicorium sp and water-cress (Nasturtium Officinale

  3. Estudo da ocorrência de enteroparasitas em hortaliças comercializadas na região metropolitana de São Paulo - SP, Brasil: II - Pesquisa de protozoários intestinais Study of the occurrence of intestinal parasites os vegetables comercially traded in the metropolitan area of S.Paulo, SP - Brazil: II - Research into protozoan cysts

    Directory of Open Access Journals (Sweden)

    Carlos Augusto Fernandes de Oliveira

    1992-10-01

    Full Text Available Foram analisadas hortaliças "in natura", comercializadas na Região Metropolitana de São Paulo, SP-Brasil, visando à pesquisa e à identificação de cistos de protozoários de interesse médico. As hortaliças, constituídas de 50 amostras de cada variedade, consistiram em: alface (Lactuca sativa, variedades lisa e crespa, escarola (Chichorium sp e agrião (Nasturtium officinale. Os resultados evidenciaram elevados percentuais de contaminação em todas as variedades de hortaliças analisadas, porém as freqüências de protozoários foram maiores no agrião. As amostras de alfaces apresentaram os menores percentuais de contaminação, enquanto que a escarola apresentou valores geralmente situados entre o agrião e as alfaces. Observou-se uma grande variedade de protozoários, cujas freqüências de ocorrência na população residente na Região Metropolitana de São Paulo são igualmente elevadas. Os mais freqüentes foram Entamoeba sp (com 4 e 8 núcleos e Giardia sp. Foram também isolados cistos de Iodamoeba sp, Endolimax sp e Chilomastix sp. Os elevados níveis de contaminação fecal encontrados nas amostras analisadas apontam para a importância dos alimentos na transmissão de protozoários intestinais.Vegetables in natura , commercially traded in the metropolitan area of S.Paulo, Brazil, were analised by means of the appropriate methodology with a view to discovering and identifying protozoan cysts of medical interest. The vegetables under study consisted of 50 samples of each of the variaties listed bel ow: lettuce (Lactuca sativa - oily leaves and crisphead varieties, endive (Chicorium sp and water-cress (Nasturtium officinale. Results showed high rates of contamination in all the varieties of vegetable analysed. However, the water-cress was the one which presented the highest frequencies of enteroparasites. Both the oily leafes and crisphead varieties of lettuce presented the lowest rates of contamination, whereas endive

  4. Composição nutricional e avaliação de rótulo de rações secas para cães comercializadas em Jaboticabal-SP Nutritional composition and label evaluation of dry dog foods sold in Jaboticabal-SP

    Directory of Open Access Journals (Sweden)

    A.C. Carciofi

    2006-06-01

    Full Text Available Avaliaram-se 49 marcas de rações para cães adultos e filhotes comercializadas em Jaboticabal-SP. Os alimentos foram divididos em três segmentos: econômico, standard e super-premium. Nessa ordem, as rações para cães adultos apresentaram, em média, 16,9%, 20,9% e 27,8% de proteína, 9,7%, 10,5% e 15% de gordura, 6,4%, 2,9% e 1,1% de fibra e 1,9%, 1,9% e 1,4% de Ca. Para filhotes, os produtos standard e super-premium apresentaram, respectivamente, 26,1% e 31,0% de proteína, 10,8% e 15,2% de gordura, 2,6% e 2,4% de fibra, 2,1% e 1,7% de Ca e 1,6% e 1,3% de P. A porcentagem de rações cujos teores nutricionais declarados no rótulo não estavam de acordo com os encontrados nas análises de laboratório foi, para os produtos super-premium para filhotes, 80,0% para o Ca e 60,0% para a gordura; para os produtos standard para filhotes, 28,6% para proteína e 57,2% para o cálcio; para os produtos econômicos para cães adultos, 44,0% para a fibra e 33,0% para a proteína; para os produtos standard para cães adultos de 33,0% para a gordura e 50,0% para o Ca; e para os produtos super-premium para cães adultos, 50,0% para o cálcio e 33,0% para a gordura. Foram encontradas inadequações nutricionais em produtos, como teores insuficientes de proteína e altas concentrações de fibra, cálcio e fósforo.Fortynine food products for adult or juvenile dogs, commercially available in Jaboticabal, São Paulo, Brazil, were tested for nutrient composition. The products were divided into three categories: low-cost, standard and super-premium. In that order, average compositions for adult foods were 16.9%, 20.9% and 27.8% protein, 9.7%, 10.5% and 15% fat, 6.4%, 2.9% and 1.1% fiber, and 1.9%, 1.9% and 1.4% calcium. For puppy foods, the average compositions of standard and super-premium foods were 26.1% and 31% protein, 10.8% and 15.2% fat, 2.6% and 2.4% fiber, 2.1% and 1.7% Ca, and 1.6% and 1.3% P, respectively. The percentages of products whose

  5. Importancia de los ácidos grasos poliinsaturados de cadena larga en la alimentación del lactante: cuantificación de éstos en algunas fórmulas lácteas para bebés de 0 a 6 meses, comercializadas en la ciudad de Medellín, 2012

    Directory of Open Access Journals (Sweden)

    Diana L. Cárdenas S.

    2014-09-01

    Full Text Available Resumen Objetivo: comparar el contenido de ácidos grasos poliinsaturados (lcpufa reportados en las etiquetas nutricionales de las fórmulas lácteas infantiles, comercializadas en supermercados de la ciudad de Medellín frente a la cantidad determinada experimentalmente. Metodología: se estudiaron trece fórmulas infantiles de iniciación, recolectadas del stand donde se encontraban exhibidas. El procedimiento para la extracción, cuantificación y análisis de los ácidos grasos de las muestras se realizaron según métodos desarrollados por el laboratorio. Resultados: al comparar el contenido de los lcpufa de la etiqueta de cada fórmula láctea con los datos obtenidos experimentalmente, se encontró que los productos contenían menos del 30% de lo reportado, aspecto que no fue atribuible a la fecha de vencimiento pero sí posiblemente a la temperatura de almacenamiento. Discusión: los hallazgos del estudio son preocupantes, porque los profesionales de la salud, recomiendan dichos productos, por su similitud en la composición nutricional con la leche materna esperando que su contenido en lcpufa sea como mínimo, igual o equivalente al de ésta, proporcionando al bebé su adecuado desarrollo. Por lo anterior, es necesario que los expertos en alimentación infantil reglamenten de manera estricta la adición de estos ácidos grasos en alimentos para lactantes. Abstract Objective: to compare the content of polyunsaturated fatty acids (pufas appearing in the nutrition facts labels of infant milk formulas sold in supermarkets of Medellin city against an experimentally determined quantity. Methodology: the researchers studied a total of 13 infant initiation formulas collected from the stands where they were displayed at the supermarkets. The procedure for extracting and quantifying the fatty acids in the samples was performed in compliance with the methods developed in the laboratory. Results: upon comparing the content of the pufas displayed in

  6. Informação nutricional de fórmulas infantis comercializadas no Estado de São Paulo: avaliação dos teores de lipídeos e ácidos graxos Nutrition facts of infant formulas sold in São Paulo state: assessment of fat and fatty acid contents

    Directory of Open Access Journals (Sweden)

    Mahyara Markievicz Mancio Kus

    2011-04-01

    Full Text Available OBJETIVO: Este trabalho teve como objetivo avaliar a informação nutricional fornecida pelos fabricantes de fórmulas infantis, comparando-as quanto aos teores obtidos na análise, ao conteúdo de lipídeos, ácidos graxos saturados, ácidos graxos trans, ácido linoleico, ácido alfa-linolênico, ácido araquidônico e ácido docosahexaenoico. MÉTODOS: Foram analisadas 14 amostras de seis marcas diferentes de fórmulas infantis comercializadas no Estado de São Paulo. A extração e a quantificação dos lipídeos foram realizadas pelo método oficial (Roese Gottlieb, e a quantificação dos ácidos graxos, pela cromatografia em fase gasosa pelo método de adição de padrão interno. As análises foram realizadas em triplicata. RESULTADOS: De acordo com os resultados, todas as amostras estavam em conformidade com a rotulagem para gordura total, uma estava em desacordo para ácidos graxos saturados, seis para ácidos graxos trans, quatro para ácido linoleico, dez para ácido alfa-linolênico, dois para ácido araquidônico e três para o ácido docosahexaenoico. As fórmulas infantis para lactentes de zero a seis meses foram as que revelaram as maiores diferenças em relação à informação nutricional fornecida pelo fabricante. CONCLUSÃO: Os resultados obtidos apontam a necessidade de um contínuo monitoramento desses produtos por meio de programas de vigilância sanitária, uma vez que a inadequação dos nutrientes da fração lipídica e outros pode afetar de maneira significativa o desenvolvimento infantil.OBJECTIVE: This study determined the contents of fats, saturated fatty acids, trans fatty acids, linoleic acid, alpha-linolenic acid, arachidonic acid and docosahexaenoic acid in infant formulas and compared them with the nutrition facts reported on the respective packaging. METHODS: Fourteen samples of six different infant formula brands sold in the state of São Paulo were analyzed. The extraction and quantification of fats were

  7. Activity in a premotor cortical nucleus of zebra finches is locally organized and exhibits auditory selectivity in neurons but not in glia.

    Directory of Open Access Journals (Sweden)

    Michael H Graber

    Full Text Available Motor functions are often guided by sensory experience, most convincingly illustrated by complex learned behaviors. Key to sensory guidance in motor areas may be the structural and functional organization of sensory inputs and their evoked responses. We study sensory responses in large populations of neurons and neuron-assistive cells in the songbird motor area HVC, an auditory-vocal brain area involved in sensory learning and in adult song production. HVC spike responses to auditory stimulation display remarkable preference for the bird's own song (BOS compared to other stimuli. Using two-photon calcium imaging in anesthetized zebra finches we measure the spatio-temporal structure of baseline activity and of auditory evoked responses in identified populations of HVC cells. We find strong correlations between calcium signal fluctuations in nearby cells of a given type, both in identified neurons and in astroglia. In identified HVC neurons only, auditory stimulation decorrelates ongoing calcium signals, less for BOS than for other sound stimuli. Overall, calcium transients show strong preference for BOS in identified HVC neurons but not in astroglia, showing diversity in local functional organization among identified neuron and astroglia populations.

  8. Evidence for cholinergic participation in the control of bird song; acetylcholinesterase distribution and muscarinic receptor autoradiography in the zebra finch brain

    International Nuclear Information System (INIS)

    Brain regions thought to be involved in the control of song in the zebra finch (Poephila guttata), were examined histochemically using the Karnovsky and Roots direct-coloring method for the detection of acetylcholinesterase (AChE) and the autoradiographic method for the localization of muscarinic cholinergic receptors following injection of tritiated quinuclidinyl benzilate (3H QNB). All presently identified vocal control nuclei in both males and females contain AChE. These nuclei include Area X, magnocellular nucleus of the anterior neostriatum (MAN), nucleus interface (NIF), caudal nucleus of the hyperstriatum ventrale (HVc), intercollicular nucleus (ICo), nucleus uva, robust nucleus of the archistriatum (RA), and tracheosyringeal portion of the hypoglossal nerve nucleus (nXIIts). All nuclei except Area X contain mostly AChE-synthesizing cell bodies. All of these nuclei contain some AChE in the neuropil, with particularly intense staining in Area X, the surrounding LPO, and the dorsomedial portion of ICo. In agreement with this description are very high concentrations of 3H QNB in both Area X and the dorsomedial ICo. HVc also appears specifically labeled. Evidence from these two histological technique suggests that efferent projections of most vocal control area may utilize acetylcholine, and that several of the vocal control nuclei may themselves receive muscarinic cholinergic projection. In Area X, there are sex differences of AChE neuropil staining. This evidence suggesting that sexually dimorphic projections to or within Area X are cholinergic or cholinoceptive

  9. SK channels modulate the excitability and firing precision of projection neurons in the robust nucleus of the arcopallium in adult male zebra finches

    Institute of Scientific and Technical Information of China (English)

    Guo-Qiang Hou; Xuan Pan; Cong-Shu Liao; Song-Hua Wang; Dong-Feng Li

    2012-01-01

    [Objective] Motor control is encoded by neuronal activity.Small conductance Ca2+-activated Kˉ channels (SK channels) maintain the regularity and precision of firing by contributing to the afterhyperpolarization (AHP) of the action potential in mammals.However,it is not clear how SK channels regulate the output of the vocal motor system in songbirds.The premotor robust nucleus of the arcopallium (RA) in the zebra finch is responsible for the output of song information.The temporal pattern of spike bursts in RA projection neurons is associated with the timing of the acoustic features of birdsong.[Methods] The firing properties of RA projection neurons were analyzed using patch clamp wholecell and cell-attached recording techniques.[Results] SK channel blockade by apamin decreased the AHP amplitude and increased the evoked firing rate in RA projection neurons.It also caused reductions in the regularity and precision of firing.RA projection neurons displayed regular spontaneous action potentials,while apamin caused irregular spontaneous firing but had no effect on the firing rate.In the absence of synaptic inputs,RA projection neurons still had spontaneous firing,and apamin had an evident effect on the firing rate,but caused no significant change in the firing regularity,compared with apamin application in the presence of synaptic inputs.[Conclusion]SK channels contribute to the maintenance of firing regularity in RA projection neurons whichrequires synaptic activity,and consequently ensures the precision of song encoding.

  10. Uptake and bioaccumulation of platinum group metals (Pd, Pt, Rh) from automobile catalytic converter materials by the zebra mussel (Dreissena polymorpha).

    Science.gov (United States)

    Zimmermann, Sonja; Messerschmidt, Jürgen; von Bohlen, Alex; Sures, Bernd

    2005-06-01

    The uptake and bioaccumulation of the platinum group metals (PGM) platinum (Pt), palladium (Pd), and rhodium (Rh) by the zebra mussel (Dreissena polymorpha) were investigated in exposure studies using ground material from unused automobile catalytic converters as metal source. The mussels were exposed to the metals in tap water or humic water. In the soft tissue samples of exposed mussels mean Pt levels ranged in dependence on the type of tank water and the exposure period (6, 9, or 18 weeks) between 780 and 4300 ng/g, the Pd levels ranged between 720 and 6300 ng/g, and the Rh levels ranged between 270 and 1900 ng/g. In contrast, the control mussels had metal concentrations of <20 ng/g (Pt), <50 ng/g (Pd), and <40 ng/g (Rh). Considerably higher PGM levels were found in the exposed mussels of the humic water group than in those of the tap water group. Although there is a cumulative increase of the PGM concentrations in the environment since the introduction of the automobile catalyst more than 20 years ago, only little information about the PGM contamination in the biosphere, especially the fauna, is available. Due to the high capacity of D. polymorpha to accumulate PGM, this bivalve could be used as a potential sentinel for monitoring the noble metals in aquatic ecosystems. PMID:15820726

  11. Towards a validation of a cellular biomarker suite in native and transplanted zebra mussels: A 2-year integrative field study of seasonal and pollution-induced variations

    International Nuclear Information System (INIS)

    Two of the questions raised in the validation process of biomarkers are their relevance in the identification and discrimination of environmental perturbations, and the influence of seasonal factors on these biological endpoints. Determining the advantages and restrictions associated with the use of native or transplanted animals and comparing their responses is also needed. To obtain this information, a 2-year integrative field study was conducted in the vicinity of a nuclear power plant in northeastern France. A station was located in the reservoir receiving the cooling waters of the plant, and two other sites were studied 2 km upstream and 5 km downstream from the reservoir's discharge in the Moselle river. Elevated temperatures, copper contamination and a 1.4-fold-concentration factor of dissolved salts affected water quality of the reservoir. Native and transplanted zebra mussels (Dreissena polymorpha) were collected monthly and their digestive glands were processed for histochemical determinations of the lysosomal and peroxisomal systems and of the lipofuscin and neutral lipid contents. The responses were quantified using automated image analysis and stereology. Apart from neutral lipid contents, there were no systematic seasonal patterns in mussel populations or from 1 year to another. Principal Component Analyses showed a general higher discrimination potential of biological responses in transplanted organisms compared to native ones. They also pointed out the relationships between the cellular and physiological markers and abiotic factors. The present multiple biomarker integrative approach in transplanted D. polymorpha brings promising elements in their validation process as relevant biomonitoring tools

  12. In vivo synaptic transmission in the zebra finch high vocal center and robust nucleus of the arcopallium after different stimulus patterns

    Institute of Scientific and Technical Information of China (English)

    Suqun Liao; Wenxiao Liu; Peng Xiao; Dongfeng Li

    2008-01-01

    BACKGROUND: Electrophysiological studies using brain slices have revealed that the developmental regulation of synaptic plasticity in vocal learning pathway is essential for song learning in zebra finches. Publications reporting in vivo electrophysiological investigation are scarce. Many aspects of neural mechanisms underlying song learning and production still remain uncertain.OBJECTIVE: To observe the efficacy of paired pulses and the effect on synaptic transmission induced by low-frequency stimulations, high-frequency stimulations, and theta-burst stimulations.DESIGN, TIME AND SETTING: A comparative observation. The experiment was conducted from October 2006 to October 2007 in the Neurophysiology Laboratory of South-China Normal University.MATERIALS: Twenty-four adult male zebra finches were supplied by the Department of Animal Experiment of College of Life Sciences, South China Normal University. A SEN-7203 stimulator (NIHON KOHDEN), as well as a DSJ-731WF microelectrode amplifier and DSJ-F amplifier (provided by South-China Normal University), were used to stimulate and record, respectively.METHODS: Animals were randomly divided into low-frequency, high-frequency, and theta-burst frequency stimulation groups. After recording evoked potentials, an input-output curve was evaluated. Subsequently, the efficacy of paired pulses with different stimulus intensity (1/3, 1/2, 2/3, or 3/4 of the value that induced the largest synaptic response), as well as interpulse intervals (50, 75, and 100ms), was measured in each group. The test stimulus intensity was set to a level that evoked 1/2 or 1/3 amplitude of the maximum response.MAIN OUTCOME MEASURES: Changes in amplitude, slope, and area of evoked potentials elicited by different stimulus patterns.RESULTS: (1) Efficacy of paired pulses: there was significant paired-pulse facilitation in the high vocal center and robust nucleus of the arcopallium (HVC-RA) synapse. Efficacy decreased when paired-pulse intervals or stimulus

  13. Influence of body size on Cu bioaccumulation in zebra mussels Dreissena polymorpha exposed to different sources of particle-associated Cu

    Energy Technology Data Exchange (ETDEWEB)

    Zhong, Huan, E-mail: huanzhong1982@hotmail.com [Environmental and Resource Studies Program, Trent University, Peterborough, Ontario (Canada); Nanjing University, School of Environment, State Key Laboratory of Pollution Control and Resource Reuse, Nanjing, Jiangsu Province (China); Kraemer, Lisa; Evans, Douglas [Environmental and Resource Studies Program, Trent University, Peterborough, Ontario (Canada)

    2013-10-15

    Highlights: • Mussels exposed to algal/sediment-Cu have different size-related Cu accumulation. • Size-related Cu accumulation in mussels could be more dependant on algal-Cu uptake. • Importance of algal/sediment-Cu to Cu bioaccumulation varies with mussel body size. • Cu sources (algae and sediments) should be considered in “mussel watch” programs. • Cu stable isotope offers many advantages in Cu bioaccumulation studies. -- Abstract: Size of organisms is critical in controlling metal bioavailability and bioaccumulation, while mechanisms of size-related metal bioaccumulation are not fully understood. To investigate the influences of different sources of particle-associated Cu on body size-related Cu bioavailability and bioaccumulation, zebra mussels (Dreissena polymorpha) of different sizes were exposed to stable Cu isotope ({sup 65}Cu) spiked algae (Chlorella vulgaris) or sediments in the laboratory and the Cu tissue concentration-size relationships were compared with that in unexposed mussels. Copper tissue concentrations decreased with mussel size (tissue or shell dry weight) in both unexposed and algal-exposed mussels with similar decreasing patterns, but were independent of size in sediment-exposed mussels. Furthermore, the relative contribution of Cu uptake from algae (65–91%) to Cu bioaccumulation is always higher than that from sediments (9–35%), possibly due to the higher bioavailability of algal-Cu. Therefore, the size-related ingestion of algae could be more important in influencing the size-related variations in Cu bioaccumulation. However, the relative contribution of sediment-Cu to Cu bioaccumulation increased with body size and thus sediment ingestion may also affect the size-related Cu variations in larger mussels (tissue weight >7.5 mg). This study highlights the importance of considering exposure pathways in normalization of metal concentration variation when using bivalves as biomonitors.

  14. Influence of body size on Cu bioaccumulation in zebra mussels Dreissena polymorpha exposed to different sources of particle-associated Cu

    International Nuclear Information System (INIS)

    Highlights: • Mussels exposed to algal/sediment-Cu have different size-related Cu accumulation. • Size-related Cu accumulation in mussels could be more dependant on algal-Cu uptake. • Importance of algal/sediment-Cu to Cu bioaccumulation varies with mussel body size. • Cu sources (algae and sediments) should be considered in “mussel watch” programs. • Cu stable isotope offers many advantages in Cu bioaccumulation studies. -- Abstract: Size of organisms is critical in controlling metal bioavailability and bioaccumulation, while mechanisms of size-related metal bioaccumulation are not fully understood. To investigate the influences of different sources of particle-associated Cu on body size-related Cu bioavailability and bioaccumulation, zebra mussels (Dreissena polymorpha) of different sizes were exposed to stable Cu isotope (65Cu) spiked algae (Chlorella vulgaris) or sediments in the laboratory and the Cu tissue concentration-size relationships were compared with that in unexposed mussels. Copper tissue concentrations decreased with mussel size (tissue or shell dry weight) in both unexposed and algal-exposed mussels with similar decreasing patterns, but were independent of size in sediment-exposed mussels. Furthermore, the relative contribution of Cu uptake from algae (65–91%) to Cu bioaccumulation is always higher than that from sediments (9–35%), possibly due to the higher bioavailability of algal-Cu. Therefore, the size-related ingestion of algae could be more important in influencing the size-related variations in Cu bioaccumulation. However, the relative contribution of sediment-Cu to Cu bioaccumulation increased with body size and thus sediment ingestion may also affect the size-related Cu variations in larger mussels (tissue weight >7.5 mg). This study highlights the importance of considering exposure pathways in normalization of metal concentration variation when using bivalves as biomonitors

  15. Zebra chip disease incidence on potato is influenced by timing of potato psyllid infestation,but not by the host plants on which they were reared

    Institute of Scientific and Technical Information of China (English)

    Feng Gao; John Jifon; Xiangbing Yang; Tong-Xian Liu

    2009-01-01

    The Zebra chip (ZC) syndrome is an emerging disease of potato and a major threat to the potato industry.The potato psyllid,Bactericerca cockerelli (Sulc) is believed to be a vector of the ZC pathogen,which is now thought to be Candidatus Liberibacter,a bacterium.To further understand the relationship between potato psyllid infestation and ZC disease expression,healthy potato plants at different growth stages (4,6 and 10 weeks after germination) were exposed separately to potato psyllids that were separately reared on four solanaceons hosts plants (potato,tomato,eggplant or bell pepper) for more than 1 year.ZC symptoms,leaf rates and total nonstructural carbohydrate accumulation in leaves and tubers of healthy and psyllid-infested plants were monitored and recorded.Typical ZC symptoms were observed in leaves and tubers of all plants exposed to potato psyllids regardless of the host plant on which they were reared.This was also accompanied by significant reductions in net photosynthetic rate.Caged potato plants without exposure to potato psyllids (uninfested controls) did not show any ZC symptom in both foliage and in harvested tubers.Foliage damage and ZC expression were most severe in the potato plants that were exposed to potato psyllids 4 weeks after germination compared to plants infested at later growth stages.Tubers from potato psyllid-infested plants had significantly higher levels of reducing sugars (glucose) and lower levels of starch than those in healthy plants,indicating that potato psyllid infestation interfered with carbohydrate metabolism in either leaves or tubers,resulting in ZC expression.

  16. Cocaine- and amphetamine-regulated transcript peptide (CART) in the brain of zebra finch, Taeniopygia guttata: Organization, interaction with neuropeptide Y, and response to changes in energy status.

    Science.gov (United States)

    Singh, Omprakash; Kumar, Santosh; Singh, Uday; Kumar, Vinod; Lechan, Ronald M; Singru, Praful S

    2016-10-15

    Cocaine- and amphetamine-regulated transcript (CART) has emerged as a potent anorectic agent. CART is widely distributed in the brain of mammals, amphibians, and teleosts, but the relevant information in avian brain is not available. In birds, CART inhibits food intake, whereas neuropeptide Y (NPY), a well-known orexigenic peptide, stimulates it. How these neuropeptides interact in the brain to regulate energy balance is not known. We studied the distribution of CART-immunoreactivity in the brain of zebra finch, Taeniopygia guttata, its interaction with NPY, and their response to dynamic energy states. CART-immunoreactive fibers were found in the subpallium, hypothalamus, midbrain, and brainstem. Conspicuous CART-immunoreactive cells were observed in the bed nucleus of the stria terminalis, hypothalamic paraventricular, supraoptic, dorsomedial, infundibular (IN), lateral hypothalamic, Edinger-Westphal, and parabrachial nuclei. Hypothalamic sections of fed, fasted, and refed animals were immunostained with cFos, NPY, and CART antisera. Fasting dramatically increased cFos- and NPY-immunoreactivity in the IN, followed by rapid reduction by 2 hours and restoration to normal fed levels 6-10 hours after refeeding. CART-immunoreactive fibers in IN showed a significant reduction during fasting and upregulation with refeeding. Within the IN, double immunofluorescence revealed that 94 ± 2.1% of NPY-immunoreactive neurons were contacted by CART-immunoreactive fibers and 96 ± 2.8% NPY-immunoreactive neurons expressed cFos during fasting. Compared to controls, superfused hypothalamic slices of fasted birds treated with CART-peptide showed a significant reduction (P brain of T. guttata may perform several functions, and has a particularly important role in the hypothalamic regulation of energy homeostasis. J. Comp. Neurol. 524:3014-3041, 2016. © 2016 Wiley Periodicals, Inc. PMID:27018984

  17. Molecular and physiological properties associated with zebra complex disease in potatoes and its relation with Candidatus Liberibacter contents in psyllid vectors.

    Directory of Open Access Journals (Sweden)

    Veria Y Alvarado

    Full Text Available Zebra complex (ZC disease on potatoes is associated with Candidatus Liberibacter solanacearum (CLs, an α-proteobacterium that resides in the plant phloem and is transmitted by the potato psyllid Bactericera cockerelli (Šulc. The name ZC originates from the brown striping in fried chips of infected tubers, but the whole plants also exhibit a variety of morphological features and symptoms for which the physiological or molecular basis are not understood. We determined that compared to healthy plants, stems of ZC-plants accumulate starch and more than three-fold total protein, including gene expression regulatory factors (e.g. cyclophilin and tuber storage proteins (e.g., patatins, indicating that ZC-affected stems are reprogrammed to exhibit tuber-like physiological properties. Furthermore, the total phenolic content in ZC potato stems was elevated two-fold, and amounts of polyphenol oxidase enzyme were also high, both serving to explain the ZC-hallmark rapid brown discoloration of air-exposed damaged tissue. Newly developed quantitative and/or conventional PCR demonstrated that the percentage of psyllids in laboratory colonies containing detectable levels of CLs and its titer could fluctuate over time with effects on colony prolificacy, but presumed reproduction-associated primary endosymbiont levels remained stable. Potato plants exposed in the laboratory to psyllid populations with relatively low-CLs content survived while exposure of plants to high-CLs psyllids rapidly culminated in a lethal collapse. In conclusion, we identified plant physiological biomarkers associated with the presence of ZC and/or CLs in the vegetative potato plant tissue and determined that the titer of CLs in the psyllid population directly affects the rate of disease development in plants.

  18. Sex and age differences in brain-derived neurotrophic factor and vimentin in the zebra finch song system: Relationships to newly generated cells.

    Science.gov (United States)

    Tang, Yu Ping; Wade, Juli

    2016-04-01

    The neural song circuit is enhanced in male compared with female zebra finches due to differential rates of incorporation and survival of cells between the sexes. Two double-label immunohistochemical experiments were conducted to increase the understanding of relationships between newly generated cells (marked with bromodeoxyuridine [BrdU]) and those expressing brain-derived neurotrophic factor (BDNF) and vimentin, a marker for radial glia. The song systems of males and females were investigated at posthatching day 25 during a heightened period of sexual differentiation (following BrdU injections on days 6-10) and in adulthood (following a parallel injection paradigm). In both HVC (proper name) and the robust nucleus of the arcopallium (RA), about half of the BrdU-positive cells expressed BDNF across sexes and ages. Less than 10% of the BDNF-positive cells expressed BrdU, but this percentage was greater in juveniles than adults. Across both brain regions, more BDNF-positive cells were detected in males compared with females. In RA, the number of these cells was also greater in juveniles than adults. In HVC, the average cross-sectional area covered by the vimentin labeling was greater in males than females and in juveniles compared with adults. In RA, more vimentin was detected in juveniles than adults, and within adults it was greater in females. In juveniles only, BrdU-positive cells appeared in contact with vimentin-labeled fibers in HVC, RA, and Area X. Collectively, the results are consistent with roles of BDNF- and vimentin-labeled cells influencing sexually differentiated plasticity of the song circuit. PMID:26355496

  19. Problemas associados ao uso de plantas medicinais comercializadas no Mercadão de Madureira, município do Rio de Janeiro, Brasil Problems associated with the use of medicinal plants commercialized in "Mercadão de Madureira", Rio de Janeiro City, Brazil

    Directory of Open Access Journals (Sweden)

    R. Bochner

    2012-01-01

    Full Text Available O uso de plantas medicinais pela população brasileira é prática tradicional, sendo muitas vezes o único recurso utilizado na atenção básica de saúde. O uso terapêutico dessas plantas envolve várias etapas da cadeia produtiva, sendo a procedência, coleta, secagem, armazenamento, comércio, modo de preparo pelo usuário e uso. O objetivo desse trabalho documental, de caráter exploratório, foi levantar a produção científica existente sobre os problemas associados a cada uma dessas etapas e discutir as questões relacionadas à carência de estudos para comprovar a eficácia farmacológica e a ausência de riscos toxicológicos, bem como a prática de autodiagnóstico. As vinte plantas mais comercializadas em grande mercado do município do Rio de Janeiro em agosto de 2007 serviram de base para o levantamento documental do presente estudo. Dessas, seis apresentaram propriedades tóxicas comprovadas dependendo do preparo e uso, a arnica (Solidago chilensis Meyen, aroeira (Shinus terebinthifolius Raddi., arruda (Ruta graveolens L., babosa (Aloe vera L., confrei (Symphytum officinale L. e poejo (Mentha pulegium Lam. & DC.. A Agência Nacional de Vigilância Sanitária aponta contra indicações para boldo-do-Chile (Peumus boldus Molina, chapéu-de-couro (Echinodorus macrophyllus Micheli, erva-cidreira (Lippia alba N.E.Br., erva-de-bicho (Polygonum spp., espinheira-santa (Maytenus spp., picão (Bidens pilosa L., poejo (Mentha pulegium Lam. e tanchagem (Plantago major L.. O abajerú, arnica, boldo-do-Chile, confrei, erva-de-bicho e espinheira-santa tiveram relato de problemas de identificação na coleta e comercialização frente a outras morfologicamente semelhantes. Plantas cultivadas e silvestres apresentam variabilidade de princípios ativos influenciados por fatores ambientais e genéticos, como chapéu-de-couro (Echinodorus macrophyllus Micheli, erva-cidreira (Lippia alba N.E.Br. e erva-de-bicho (Polygonum spp.. A contaminação e

  20. Comparison of acute toxicity of process chemicals used in the oil refinery industry, tested with the diatom Chaetoceros gracilis, the flagellate Isochrysis galbana, and the zebra fish, Brachydanio rerio

    International Nuclear Information System (INIS)

    Chemicals under the trade names Nalco 537-DA, Nalco 625, Nalco 7607, Nalco 5165, Ivamin, and technical monoethanolamine are used extensively in the oil refinery industry. Aquatic toxicity tests were conducted using zebra fish fry (Brachydanio rerio) and the unicellular algae Isochrysis galbana (a flagellate) and Chaetoceros gracilis (a diatom). Inhibition of cell division, chlorophyll content, and 14CO2 uptake in the algae were sensitive end points. The effective concentrations (EC50s) of growth inhibition were 0.1 mg/L (Ivamin; I. galbana), 0.8 mg/L (Nalco 7607; I. galbana), 6 mg/L (Nalco 625; I. galbana), 10 mg/L (Nalco 5165; C. gracilis), and 15 mg/L (Nalco 537-DA; C. gracilis). The lethal concentrations (LC50s) (96 h) toward zebra fish fry was 1 mg/L for Nalco 7607, 6.5 mg/L for Nalco 537-DA, 7.1 mg/L for Nalco 625, and 20 mg/L for Ivamin 803. Monoethanolamine had an LC50 higher than 5,000 mg/L. Nalco 5165 was not tested on fish fry. The heartbeat frequency of fish embryos was reduced by 2.5 mg/L Nalco 537-DA, but this was an insensitive end point for the other chemicals

  1. Applicational progress of zebra fish in the aquatic ecotoxicology researches%斑马鱼在水生生态毒理学研究中的应用进展

    Institute of Scientific and Technical Information of China (English)

    曹秀明; 梁荣朝; 王珊珊; 宋冬雪

    2013-01-01

    As a new model animal,zebra fish,because of its excellent biological characteristics and highly similar genome to the human,it plays an important role in the researches of aquatic ecological toxicology recent years.This review summarized the application of the zebra fish in the general toxicology experiments,evaluation the toxicity of environmental pollutants including of nanoparticles and environmental hormones and effects of these pollutants on the aquatic organisms.Finally,the prospect in this research field was discussed.%  由于斑马鱼优异的生物学特点,其基因组与人类基因组的相似度高,斑马鱼越来越多的用于生态毒理学研究中。对斑马鱼在常规的毒理学实验,评价纳米粒子、环境激素等环境污染物对水生生物影响等方面的应用进行了综述,并展望了斑马鱼在未来生态毒理学领域发挥的作用。

  2. Carotenos e provitamina A em bertalha e ervas aromáticas comercializadas em Viçosa, Estado de Minas Gerais, durante as quatro estações do ano - DOI: 10.4025/actascihealthsci.v28i1.1122 Carotenes and provitamin A in basella and aromatic herbs marketed in Viçosa, Minas Gerais State, during the four seasons of the year - DOI: 10.4025/actascihealthsci.v28i1.1122

    Directory of Open Access Journals (Sweden)

    José Benício Paes Chaves

    2006-03-01

    Full Text Available Este estudo teve como objetivos investigar o teor de α-caroteno, β-caroteno e calcular o valor de vitamina A em hortaliças comercializadas no mercado formal e informal de Viçosa, Estado de Minas Gerais, bem como avaliar a influência das quatro estações do ano e do local de comercialização sobre o conteúdo desses nutrientes. As hortaliças (bertalha, cebolinha, coentro, manjericão e salsa foram analisadas utilizando-se a cromatografia líquida de alta eficiência (CLAE. Devido ao conteúdo inexpressivo de α-caroteno em todas as amostras, foi possível quantificar apenas o β-caroteno. Não se verificou diferença estatisticamente significativa (α = 0,05 no conteúdo de β-caroteno das hortaliças entre os diferentes estabelecimentos, nem entre as estações do ano. As hortaliças mostraram-se excelentes fontes de provitamina A, e se consumidas regularmente, contribuem de forma importante na adequação diária de vitamina A para adultos e crianças. Além disso, esses alimentos são acessíveis à população por apresentarem baixo custo e serem facilmente encontrados.This study aimed to investigate the level of α-carotene, β-carotene and to calculate the value of vitamin A in vegetables sold at local markets and informal markets of Viçosa, Minas Gerais State, as well as to evaluate the seasonal and commercial effects on the content of these pigments. The vegetables (basella, green onion, cilantro, sweet basil and parsley were analyzed through high-performance liquid chromatography (HPLC, being β-carotene the only pigment present in all the analyzed samples. No significant statistical differences (α = 0.05 were found in the contents of β-carotene of the vegetables either among the different stores, or among the different seasons. The vegetables analyzed are great provitamin A sources and, if eaten on a regular basis, they can fit the daily requirements of vitamin A for adults and children. Besides, these foods are very

  3. Gonadotropin releasing hormone (GnRH) and gonadotropin inhibitory hormone (GnIH) in the songbird hippocampus: regional and sex differences in adult zebra finches.

    Science.gov (United States)

    McGuire, Nicolette; Ferris, Jennifer K; Arckens, Lutgarde; Bentley, George E; Soma, Kiran K

    2013-08-01

    Hypothalamic gonadotropin releasing hormone (GnRH) and gonadotropin inhibitory hormone (GnIH) are vital to reproduction in all vertebrates. These neuropeptides are also present outside of the hypothalamus, but the roles of extra-hypothalamic GnRH and GnIH remain enigmatic and widely underappreciated. We used immunohistochemistry and PCR to examine whether multiple forms of GnRH (chicken GnRH-I (GnRH1), chicken GnRH-II (GnRH2) and lamprey GnRH-III (GnRH4)) and GnIH are present in the hippocampus (Hp) of adult zebra finches (Taeniopygia guttata). Using immunohistochemistry, we provide evidence that GnRH1, GnRH2 and GnRH4 are present in hippocampal cell bodies and/or fibers and that GnIH is present in hippocampal fibers only. There are regional differences in hippocampal GnRH immunoreactivity, and these vary across the different forms of GnRH. There are also sex differences in hippocampal GnRH immunoreactivity, with generally more GnRH1 and GnRH2 in the female Hp. In addition, we used PCR to examine the presence of GnRH1 mRNA and GnIH mRNA in micropunches of Hp. PCR and subsequent product sequencing demonstrated the presence of GnRH1 mRNA and the absence of GnIH mRNA in the Hp, consistent with the pattern of immunohistochemical results. To our knowledge, this is the first study in any species to systematically examine multiple forms of GnRH in the Hp or to quantify sex or regional differences in hippocampal GnRH. Moreover, this is the first demonstration of GnIH in the avian Hp. These data shed light on an important issue: the sites of action and possible functions of GnRH and GnIH outside of the HPG axis. PMID:23727031

  4. Poly(N-isopropylacrylamide)-coated thermo-responsive nanoparticles for controlled delivery of sulfonated Zn-phthalocyanine in Chinese hamster ovary cells in vitro and zebra fish in vivo

    Science.gov (United States)

    He, Jia; Chen, Ji-Yao; Wang, Pu; Wang, Pei-Nan; Guo, Jia; Yang, Wu-Li; Wang, Chang-Chun; Peng, Qian

    2007-10-01

    Poly(N-isopropylacrylamide) (PNIPAM)-coated Fe3O4@SiO2@CdTe multifunctional nanoparticles with photoluminescent (PL), thermosensitive and magnetic properties, were investigated as carriers to deliver water-soluble, fluorescent sulfonated Zn-phthalocyanine (ZnPcS), a photosensitizing drug for photodynamic therapy of cancer, in Chinese hamster ovary (CHO) cells in vitro and zebra fish in vivo. PNIPAM is a well-known thermo-responsive polymer with a volume phase transition temperature. This property allows it to be swollen in water at temperatures lower than 32-34 °C to take up ZnPcS and shrunken to expel the drug at higher temperatures. Since the PL band of CdTe quantum dots (QDs) as indicators for the nanoparticles is at 585 nm and the emission band of ZnPcS is at 680 nm, it is possible to study the temperature-dependent release of ZnPcS from the nanoparticles by fluorescence measurements. ZnPcS was embedded in the PNIPAM of the nanoparticles at 25 °C in phosphate buffered saline (PBS) solution and released at 37 °C, measured with a spectrophotometer. When CHO cells had been incubated with the ZnPcS-loaded nanoparticles at 27 °C, a similar intracellular localization pattern of CdTe QDs and ZnPcS was seen by multichannel measurements in confocal laser scanning microscopy (CLSM), but a diffuse pattern of only ZnPcS fluorescence was detected in the cytoplasm of the cells at 37 °C, indicating a release of ZnPcS from the nanoparticles. Similar results were also found in the intestinal tract of zebra fish in vivo after intake of the nanoparticles. Since the nanoparticles contain magnetic (Fe3O4) material, the nanoparticles could also be manipulated to change their location in the intestinal tract of the zebra fish with an external magnetic field gradient of 300 G mm-1. The results presented suggest that such multifunctional nanoparticles may have combined potential for temperature-dependent drug delivery, QD photodetection and magnetic manipulation in diagnosis and

  5. Poly(N-isopropylacrylamide)-coated thermo-responsive nanoparticles for controlled delivery of sulfonated Zn-phthalocyanine in Chinese hamster ovary cells in vitro and zebra fish in vivo

    Energy Technology Data Exchange (ETDEWEB)

    He Jia [Surface Physics Laboratory (National Key Laboratory) and Department of Physics, Fudan University, Shanghai (China); Chen Jiyao [Surface Physics Laboratory (National Key Laboratory) and Department of Physics, Fudan University, Shanghai (China); Wang Pu [Surface Physics Laboratory (National Key Laboratory) and Department of Physics, Fudan University, Shanghai (China); Wang Peinan [State Key Laboratory for Advanced Photonic Materials and Devices, Fudan University, Shanghai (China); Guo Jia [Department of Macromolecular Science and Key Laboratory of Molecular Engineering of Polymers, Fudan University, Shanghai (China); Yang Wuli [Department of Macromolecular Science and Key Laboratory of Molecular Engineering of Polymers, Fudan University, Shanghai (China); Wang Changchun [Department of Macromolecular Science and Key Laboratory of Molecular Engineering of Polymers, Fudan University, Shanghai (China); Peng Qian [State Key Laboratory for Advanced Photonic Materials and Devices, Fudan University, Shanghai (China)

    2007-10-17

    Poly(N-isopropylacrylamide) (PNIPAM)-coated Fe{sub 3}O{sub 4} - SiO{sub 2} - CdTe multifunctional nanoparticles with photoluminescent (PL), thermosensitive and magnetic properties, were investigated as carriers to deliver water-soluble, fluorescent sulfonated Zn-phthalocyanine (ZnPcS), a photosensitizing drug for photodynamic therapy of cancer, in Chinese hamster ovary (CHO) cells in vitro and zebra fish in vivo. PNIPAM is a well-known thermo-responsive polymer with a volume phase transition temperature. This property allows it to be swollen in water at temperatures lower than 32-34 deg. C to take up ZnPcS and shrunken to expel the drug at higher temperatures. Since the PL band of CdTe quantum dots (QDs) as indicators for the nanoparticles is at 585 nm and the emission band of ZnPcS is at 680 nm, it is possible to study the temperature-dependent release of ZnPcS from the nanoparticles by fluorescence measurements. ZnPcS was embedded in the PNIPAM of the nanoparticles at 25 deg. C in phosphate buffered saline (PBS) solution and released at 37 deg. C, measured with a spectrophotometer. When CHO cells had been incubated with the ZnPcS-loaded nanoparticles at 27 deg. C, a similar intracellular localization pattern of CdTe QDs and ZnPcS was seen by multichannel measurements in confocal laser scanning microscopy (CLSM), but a diffuse pattern of only ZnPcS fluorescence was detected in the cytoplasm of the cells at 37 deg. C, indicating a release of ZnPcS from the nanoparticles. Similar results were also found in the intestinal tract of zebra fish in vivo after intake of the nanoparticles. Since the nanoparticles contain magnetic (Fe{sub 3}O{sub 4}) material, the nanoparticles could also be manipulated to change their location in the intestinal tract of the zebra fish with an external magnetic field gradient of 300 G mm{sup -1}. The results presented suggest that such multifunctional nanoparticles may have combined potential for temperature-dependent drug delivery, QD

  6. Poly(N-isopropylacrylamide)-coated thermo-responsive nanoparticles for controlled delivery of sulfonated Zn-phthalocyanine in Chinese hamster ovary cells in vitro and zebra fish in vivo

    International Nuclear Information System (INIS)

    Poly(N-isopropylacrylamide) (PNIPAM)-coated Fe3O4 - SiO2 - CdTe multifunctional nanoparticles with photoluminescent (PL), thermosensitive and magnetic properties, were investigated as carriers to deliver water-soluble, fluorescent sulfonated Zn-phthalocyanine (ZnPcS), a photosensitizing drug for photodynamic therapy of cancer, in Chinese hamster ovary (CHO) cells in vitro and zebra fish in vivo. PNIPAM is a well-known thermo-responsive polymer with a volume phase transition temperature. This property allows it to be swollen in water at temperatures lower than 32-34 deg. C to take up ZnPcS and shrunken to expel the drug at higher temperatures. Since the PL band of CdTe quantum dots (QDs) as indicators for the nanoparticles is at 585 nm and the emission band of ZnPcS is at 680 nm, it is possible to study the temperature-dependent release of ZnPcS from the nanoparticles by fluorescence measurements. ZnPcS was embedded in the PNIPAM of the nanoparticles at 25 deg. C in phosphate buffered saline (PBS) solution and released at 37 deg. C, measured with a spectrophotometer. When CHO cells had been incubated with the ZnPcS-loaded nanoparticles at 27 deg. C, a similar intracellular localization pattern of CdTe QDs and ZnPcS was seen by multichannel measurements in confocal laser scanning microscopy (CLSM), but a diffuse pattern of only ZnPcS fluorescence was detected in the cytoplasm of the cells at 37 deg. C, indicating a release of ZnPcS from the nanoparticles. Similar results were also found in the intestinal tract of zebra fish in vivo after intake of the nanoparticles. Since the nanoparticles contain magnetic (Fe3O4) material, the nanoparticles could also be manipulated to change their location in the intestinal tract of the zebra fish with an external magnetic field gradient of 300 G mm-1. The results presented suggest that such multifunctional nanoparticles may have combined potential for temperature-dependent drug delivery, QD photodetection and magnetic manipulation

  7. Entre o sentido da colonização e o arcaísmo como projeto: a superação de um dilema através do conceito de capital escravista-mercantil

    Directory of Open Access Journals (Sweden)

    João Paulo A. de Souza

    2008-03-01

    Full Text Available Neste artigo, discute-se a proposta de Pires e Costa (1995, 2000 segundo a qual a economia brasileira no período escravista teria estado sujeita a uma forma específica do capital: o capital escravista-mercantil. Ela permite a superação da dicotomia entre o modelo interpretativo do Sentido da Colonização, proposto originalmente por Caio Prado Júnior, e o modelo do Arcaísmo como Projeto, proposto por Fragoso e Florentino (2001. O primeiro, por retratar a sociedade colonial como uma projeção imediata da expansão comercial européia, tem enfrentado dificuldades em acomodar as recentes evidências empíricas de que a economia colonial podia apresentar uma relativa autonomia, realizando acumulação endógena. O segundo, ao tentar de forma explícita acomodar essas evidências, acaba recusando a existência de um sentido da colonização tal como originalmente formulado. Para explicitar como o modelo do capital escravista-mercantil supera esse dilema, apresentamos uma analogia com o desenvolvimento da teoria do valor de Marx em O Capital.This paper discusses Pires and Costa's (1995, 2000 claim that the Brazilian economy during the slavery period functioned under the direction of a specific form of capital, called mercantile slavery capital. Their proposal allows us to overcome a dichotomy between the traditional interpretive model of the Meaning of Colonization, originally proposed by Caio Prado Júnior in the 1940's, and the new model of Archaism as a Project, proposed by Fragoso and Florentino (2001. The former, by depicting the Brazilian colonial society as an immediate result of the European commercial expansion, has had difficulties in explaining recent empirical evidence that the colonial economy was relatively autonomous, being able to carry out endogenous capital accumulation. The latter, however, in trying to explicitly accommodate this evidence turns out to reject the original formulation of the Meaning of Colonization as a

  8. The zebras come to CERN

    CERN Multimedia

    Laëtitia Pedroso

    2010-01-01

    From 23 to 26 November CERN played host to an unusual group of visitors, who arrived in a red-and-white striped camper. On the tenth anniversary of "Les Zèbres”, a children’s broadcast on Swiss radio, the show’s makers invited 8th and 9th grade pupils from Swiss schools to conduct a live broadcast from CERN.   Students in the cryogenic hall: cryolab. Popular Franco-Swiss host Jean-Marc Richard brought Les Zèbres to the Laboratory with a live broadcast. The idea was to let the children themselves host the broadcast. Accompanied by their physics teachers, pupils from junior secondary schools in Golette, Colombières and Drize were given the opportunity to spend half a day at CERN. Each day, one class came to find out about a particular aspect of the Laboratory and then conduct a live broadcast with Jean-Marc Richard from 12:10 to 12:30. The young people, aged 13 to 15, had a chance to explore the Universe of Particles exhibitio...

  9. Avaliação parasitológica de alfaces (Lactuca sativa comercializadas em feiras livres e supermercados do município de Campo Mourão, Estado do Paraná - DOI: 10.4025/actascibiolsci.v26i4.1514 Occurence of parasites in lettuce (Lactuca sativa commercializaed in the street markets and supermarkets of Campo Mourão, state of Paraná, Brazil - DOI: 10.4025/actascibiolsci.v26i4.1514

    Directory of Open Access Journals (Sweden)

    Sandra Maria Simonelli

    2004-04-01

    Full Text Available Este estudo investigou e comparou a contaminação por enteroparasitas em alfaces (Lactuca sativa comercializadas em supermercados e feiras livres do município de Campo Mourão, Estado do Paraná. Foram analisadas 150 amostras de alfaces, pelo método de sedimentação espontânea (Hoffmann, sendo 75 amostras provenientes de supermercados e 75 amostras de feiras livres. O sedimento foi analisado em microscópio óptico. Das amostras analisadas, 56% (42/75 e 58,7% (44/75 apresentaram contaminação por parasitas, dos supermercados e feiras livres, respectivamente. Os principais parasitas encontrados em supermercados foram: Ascaris spp 54,7%, Toxocara spp 2,4%, Strongyloides spp 4,8%, Entamoeba spp 35,7% e Taenia spp 2,4%; e em feiras livres foram: Ascaris spp 13,6%, Strongyloides spp 11,4%, Entamoeba spp 47,7%, Ancylostoma spp 9,1%, /em>Taenia spp 2,3%, Fasciola hepatica 6,8% e Trichuris spp 9,1%. Esses resultados indicam que as amostras de alfaces estão em desacordo com a legislação vigente e salientam a necessidade de aplicação de um programa de educação sanitária direcionado a horticultores e manipuladores de hortaliçasThis work researched and compared the contamination by enteroparasites in lettuce (Lactuca sativa commercialized in the supermarkets and street markets of Campo Mourão, State of Paraná. 150 samples of lettuce were analyzed through sedimentation method (Hoffmam, being 75 samples from supermarkets and 75 from street markets. The sediment was analyzed in optic microscope. The supermarkets samples showed contamination by parasites of 56% (42/75; while contamination of street markets samples showed 58.7% (44/75. The principal parasites observed in supermarkets samples were: Ascaris spp 54.7%, Toxocara spp 2.4%, Strongyloides spp 4.8%, Entamoeba spp 35.7% and Taenia spp 2.4%. Important parasites observed in street markets were: Ascaris spp 13.6%, Strongyloides spp 11.4%, Entamoeba spp 47.7%, Ancylostoma spp 9.1%, Taenia

  10. Induction of heat shock proteins (hsp70) in the zebra mussel (Dreissena polymorpha) following exposure to platinum group metals (platinum, palladium and rhodium): Comparison with lead and cadmium exposures

    International Nuclear Information System (INIS)

    An increasing number of papers concentrate on the availability and uptake of platinum group elements (PGE) by different organisms. These metals are discharged into the environment from different anthropogenic sources, such as automobile catalytic converters, hospitals and other medical institutions. As the effects of these precious metals on organisms remain unclear, the induction of heat shock proteins (hsp70) in zebra mussels (Dreissena polymorpha) following exposure to soluble salts of platinum, palladium and rhodium was compared with the hsp70 induction in mussels following exposure to cadmium and lead. Mussels were sampled weekly during a period of 10 weeks and analyzed for their metal concentration and their hsp70 level. Highest metal uptake was found for Cd, followed by Pt, Pb and Pd. Rh demonstrated the lowest uptake rate. A clear time-dependent increase of hsp70 levels occurred in all exposed mussels. Concentrations of hsp70 started to rise between days 18 and 25, except for the Pt-exposed group, where the initial increase was between days 25 and 32. All groups reached maximal hsp70 concentrations at day 39. Subsequently, hsp70 levels decreased to initial levels for the remaining exposure period. Threshold metal levels for the hsp70 induction varied among the metals and increased in the order: Rh < Pd ≤ Pb < Pt < Cd. Highest hsp70 values were found for mussels exposed to Pd, with a 25-fold higher level than in the controls, followed by Pt- and Rh-exposed mussels, which showed a 19-fold increase. The hsp70 levels of the mussels exposed to Cd and Pb were much lower, showing 6- and 12-fold higher values than the control, respectively. The clear induction of hsp70 due to exposure to Pt, Pd and Rh gives evidence for strong cellular effects of these metals, especially, when compared with lead and cadmium. Among the metals tested, Pd seems to have the highest potential as inducer for hsp70 production due to its low threshold level in combination with the

  11. Fisiologia do amadurecimento de mamões de variedades comercializadas no Brasil

    Directory of Open Access Journals (Sweden)

    Anderson Fernandes Souza

    2014-06-01

    Full Text Available A emissão de etileno, a respiração e as transformações físicas e químicas em mamões da cv Golden e dos híbridos Tainung 01 e UENF/CALIMAN01 (UC01, colhidos no estádio 0 de maturação (fruto maturo com casca 100% verde e mantidos a 25ºCº e 80% % UR foram avaliados durante a fase de amadurecimento. Os resultados mostram diferenças significativas entre os genótipos, em todas as características avaliadas. O mamão 'Golden'apresentou taxasrespiratória e de emissão de etileno bastante superiores às registradas para o Tainung 01 e UC01, indicando climatério característico. O mamão UC01 foi o que manteve a coloração verde de casca por mais tempo e apresentou a menor firmeza do fruto no estádio 0. Os resultados também mostram a relação entre os picos respiratório e de etileno, com a perda de firmeza. Houve aumento no teor de sólidos solúveis (SS no mamão UC01, não observado nos demais. A acidez titulável (AT e a razão SS/ AT variaram durante o amadurecimento apenas na cv Golden. Os resultados indicam que os três genótipos mais comercializados no Brasil diferem fisiológica e bioquimicamente durante o amadurecimento, com os hibridos Tainung 01 e UC01 mostrando-se mais sensíveis à ação do etileno do que a cv. Golden, o que é importante ao manejo pós-colheita destes frutos.

  12. La cola de caballo (Equisetum, Equisetaceae) comercializada y exportada del Perú

    OpenAIRE

    Blanca León

    2013-01-01

    Varios productos derivados de plantas se exportan del Perú como suplementos nutricionales, condimentos y otros usos, entre estos últimos tipos se encuentra el helecho “cola de caballo”. Tres nombres se emplean en el comercio: Equisetum arvense, E. bogotensey “E. hiemale”, los cuales no corresponden a las plantas exportadas, las que en cambio son E. giganteum, una especie reconocible por detalles morfológicos en sus ejes, ornamentación y distribución de sus estomas.

  13. La cola de caballo (Equisetum, Equisetaceae comercializada y exportada del Perú

    Directory of Open Access Journals (Sweden)

    Blanca León

    2013-06-01

    Full Text Available Varios productos derivados de plantas se exportan del Perú como suplementos nutricionales, condimentos y otros usos, entre estos últimos tipos se encuentra el helecho “cola de caballo”. Tres nombres se emplean en el comercio: Equisetum arvense, E. bogotensey “E. hiemale”, los cuales no corresponden a las plantas exportadas, las que en cambio son E. giganteum, una especie reconocible por detalles morfológicos en sus ejes, ornamentación y distribución de sus estomas.

  14. Metabolic ageing in individual zebra finches

    NARCIS (Netherlands)

    Moe, Borge; Ronning, Bernt; Verhulst, Simon; Bech, Claus; Moe, Børge; Rønning, Bernt

    2009-01-01

    Oxidative stress is suggested as a contributor to the ageing process. Knowledge of the relationship between age and energy expenditure may contribute to our understanding of ageing patterns, due to the link between oxygen consumption and free radical production. However, studies on basal metabolic r

  15. 预置斑马导丝在输尿管镜处理输尿管上段病变中的作用(附1500例体会)%Presetting zebra guidewire for ureteral upper segments diseases in ureteroscopic operations(1 500 cases reported)

    Institute of Scientific and Technical Information of China (English)

    孙伟桂; 郑奇传; 储旭; 蒋堃

    2013-01-01

    目的 总结输尿管硬镜处理输尿管上段病变的经验及输尿管常见损伤因素,并探讨预置斑马导丝的价值及意义.方法 统计1994-2012年期间经尿道输尿管硬镜手术共3 000余例,其中输尿管上段病变1 500例,均为术前已确诊的单侧输尿管上段结石或结石伴狭窄患者.其中男979例(65.27%),女521例(34.73%),平均年龄40.5(18~67)岁.结石平均长径约1.19(0.6~3.5)cm;单发结石1119例(74.60%),多发结石381例(25.40%).行气压弹道碎石652例(43.47%),钬激光碎石536例(35.73%),超声EMS清石312例(20.80%).所有病例随机分为两组,A组(912例,60.80%)在碎石前先预置斑马导丝越过狭窄和结石旁间隙达肾盂内,将斑马导丝妥善固定于会阴部,再继续完成狭窄扩张和碎石操作.B组(588例,39.20%)不预置斑马导丝直接碎石并完成所有操作.结果 A组一次性手术成功率和平均手术操作时间明显优于B组(P<0.05),分别为873例(95.72%)和31.33(15~65)min,521例(88.61%)和46.15(18~115)min.两组发生输尿管各类损伤共63例(4.20%),文章对预置斑马导丝的8个优点及有效预防输尿管损伤的9个高危因素分别作了阐述.结论 预置斑马导丝法可提高输尿管镜处理输尿管上段结石伴狭窄的手术成功率,减少输尿管损伤及二期后续治疗机率,是安全可行且有效的方法.%Objective To summarize some experiences of ureteroscopic treatments of the upper ureteral lesions and common factors of ureter injury,and to study the value of presetting zebra guidewire. Methods Since 1994 ,1 500 patients of upper ureteral calculi or stones with stenosis had undergone transurethral ureteroscopic surgeries,including 979 male patients(65. 27% ) ,521 female cases(34. 73% ) ,with an average of about 40.5 (18 ~ 67) years old. The average length of calculi was about 1. 19(0. 6 ~3.5)cm. 1119 cases(74. 60% ) had a single stone, while 381 cases (25. 40% ) had several stones. 652 cases (43. 47% ) had been

  16. 姜黄素类似物EF24对HepG2及斑马鱼胚胎发育的影响%The impact of curcumin analogs EF24 on HepG2 and the development of zebra fish embryo

    Institute of Scientific and Technical Information of China (English)

    徐昌志; 汪宇; 袁媛; 黄蓓

    2011-01-01

    To explore the impact of curcumin analogs EF24 on HHC (hepatoma carcinoma cell)and the toxicity on vertebrate, we use EF24 to deal with HepG2 and zebra fish embryo. We found that EF24 shows fine depression effect to zebra fish embryo in lower concentration, and its IC50 is 29.38umol/L. It is the best sensitive time when fertilized ovum has developed at 6 hours. EF24 is still safe to embryos in the concentration of less than 100mg/L, while it can lead to malformation and death in high concentration for more than 400 mg/L, such as yolk diffusion, embryo death in epiboly stage, animal pole diffusion, backbone bending and hypoplasia. We conclude that FE24 is a potential drug owning good inhibition effect on tumor cells and lower toxicity.%为探讨姜黄素类似物EF24对肝癌细胞的影响以及对脊椎动物的毒性,以EF24对HepG2和斑马鱼胚胎进行处理,发现低浓度的EF24对HepG2达到较好的杀伤效果,IC50为29.38 umol/L.对斑马鱼胚胎当受精卵发育6 h为敏感期,EF24的安全浓度达100 mg/L.而从400 mg/L高浓度开始出现畸形和死亡,如卵黄弥散、胚胎在外包期死亡、囊胚期胚胎动物极弥散、脊柱弯曲、发育不全等现象.EF24是一种对肝癌细胞有较强的杀伤效果且安全的潜在药物.

  17. Study of the biological effects of uranium exposure on zebra fish (D. rerio). Impact on life stages; Etude des effets biologiques de l'exposition a l'uranium chez le poisson zebre (D. rerio). Impact sur les stades de vie

    Energy Technology Data Exchange (ETDEWEB)

    Bourrachot, St.

    2009-05-15

    This work is part of an ongoing project (ENVIRHOM) started at IRSN in 2000, which consists in studying the environmental effects of radioactive substances at chronic low level of exposure. In this general frame, our aim was two fold: (i) to identify sensitivity of different critical life stages of zebra fish (fish of fresh water frequently used for tests standards in ecotoxicology) to uranium exposure and (ii) to evaluate underlying mechanisms. Experiments were conducted with eggs, larvae and genitors exposed to uranium at environmentally relevant concentrations (from 20 to 500 {mu}g/L) in order to study survival, hatching of eggs, growth of larvae and reproduction of genitors. Bio-markers of exposure (i.e. U bioaccumulation) and bio-markers of effects at molecular level (i.e. genotoxic effects, reproductive-toxicity) were also measured. Sensitivity of fish to uranium was dependent of the life stage of development with the early life stage being the most sensitive to U either directly or maternally exposed. It underlines the relevance of including pro-larval stages for toxicity assessments in fish. Moreover drastic effects of uranium on reproductive success and DNA damages in the germ cells foretell a strong impact on the population for low concentration of exposure (20 {mu}g/L). As it is increasingly recognized that population-level effects of toxic substances are more relevant in terms of ecological risk assessment, this study points out the need to include different life stages of organisms in eco-toxicological studies, especially the sensitive early stages. Moreover, it appears, through the comparative study of the radiological effects or by another isotope of the uranium of stronger radioactivity ({sup 233}U or by an irradiation with {sup 137}Cs), that the effects of the uranium are due to its chemo-toxicity. (author)

  18. Autonomous Reconfigurable Control Allocation (ARCA) for Reusable Launch Vehicles

    Science.gov (United States)

    Hodel, A. S.; Callahan, Ronnie; Jackson, Scott (Technical Monitor)

    2002-01-01

    The role of control allocation (CA) in modern aerospace vehicles is to compute a command vector delta(sub c) is a member of IR(sup n(sub a)) that corresponding to commanded or desired body-frame torques (moments) tou(sub c) = [L M N](sup T) to the vehicle, compensating for and/or responding to inaccuracies in off-line nominal control allocation calculations, actuator failures and/or degradations (reduced effectiveness), or actuator limitations (rate/position saturation). The command vector delta(sub c) may govern the behavior of, e.g., acrosurfaces, reaction thrusters, engine gimbals and/or thrust vectoring. Typically, the individual moments generated in response to each of the n(sub a) commands does not lie strictly in the roll, pitch, or yaw axes, and so a common practice is to group or gang actuators so that a one-to-one mapping from torque commands tau(sub c) actuator commands delta(sub c) may be achieved in an off-line computed CA function.

  19. ARCA DWARAPALA PADA CANDI-CANDI BUDDHA DI JAWA TENGAH

    Directory of Open Access Journals (Sweden)

    Sri Wahyu Sarjanawati

    2011-10-01

    Full Text Available Temple as a product of the culture of Hindu-Buddhist period is the building that describes the concept of cosmogony and a replica of Mount Mahameru the place of the gods. Dwarapala statue is one of the guards in almost Javanese temple. The existence of this statue in the temple (depiction microcosm has a meaning. Problems which will be solved, namely: (1 where the statue Dwarapala placed in the temple Plaosan and the temple Sewu (2 how is the depiction of Dwarapala statues in the temple Palosan and the temple Sewu? Gana figure that became the object of the study were analyzed with hermeneutical analysis. Hermeneutical analysis of the statue Dwarapala can only be done if the information about these statues is known. From the results of research and discussion can be seen that the meaning of the statue at Buddhist temple Dwarapala not be separated from the concept of cosmogony. Portrayal system was adapted to the function of these statues at the temple. So it can be said that the statues have meaning that Dwarapala is a portrayal of religious situation in the Hindu-Buddhist and the symbol of the world above (heaven. The placement of temple statues Dwarapala complement cosmogony concept representations, thus building meaning of worship into a whole. Keywords:  Dwarapala, temple, hermeneutic   Candi sebagai produk dari budaya masa Hindu-Buddha adalah bangunan yang menggambarkan konsep kosmogoni dan replika Gunung Mahameru tempat para dewa. Patung Dwarapala adalah salah satu penjaga di kuil hampir Jawa. Keberadaan patung ini di candi (mikrokosmos penggambaran memiliki arti. Masalah yang akan dipecahkan, yaitu: (1 bagaimana patung Dwarapala ditempatkan di candi Plaosan dan candi Sewu (2 bagaimana penggambaran patung Dwarapala di candi Palosan dan candi Sewu? Gana sosok yang menjadi objek penelitian dianalisis dengan analisis hermeneutis. Analisis hermeneutis patung Dwarapala hanya dapat dilakukan jika informasi tentang patung-patung ini dikenal. Dari hasil penelitian dan pembahasan dapat dilihat bahwa arti dari patung pada candi Budha Dwarapala tidak lepas dari konsep kosmogoni. Penggambaran sistem adalah disesuaikan dengan fungsi dari patung-patung di candi. Jadi dapat dikatakan bahwa patung-patung memiliki makna bahwa Dwarapala adalah gambaran situasi agama di Hindu-Buddha dan simbol dunia atas (surga. Penempatan patung Dwarapala candi melengkapi representasi konsep kosmogoni, demikian membangun makna ibadah menjadi keseluruhan.   Kata kunci: Dwarapala, candi, hermeneutik  

  20. Estudio del contenido de mercurio en zamburiña y almeja comercializadas en España

    OpenAIRE

    M. García; García, M.A.; J. Alonso; M.J. Melgar

    2005-01-01

    Los moluscos, debido a su capacidad filtrante, pueden acumular metales llegando a contaminar los alimentos y como consecuencia pueden tener una repercusión negativa sobre la salud de los consumidores. Entre estos metales se encuentra el mercurio, considerado como no esencial por su elevada toxicidad a concentraciones bajas y por su carácter acumulativo. En este estudio se ha determinado el contenido de mercurio en muestras en conserva de zamburiña (Chlamys varia) y almeja (M...