WorldWideScience

Sample records for arabidopsis lyrata complex

  1. The evolutionary history of the Arabidopsis lyrata complex: a hybrid in the amphi-Beringian area closes a large distribution gap and builds up a genetic barrier

    Directory of Open Access Journals (Sweden)

    Koch Marcus A

    2010-04-01

    Full Text Available Abstract Background The genomes of higher plants are, on the majority, polyploid, and hybridisation is more frequent in plants than in animals. Both polyploidisation and hybridisation contribute to increased variability within species, and may transfer adaptations between species in a changing environment. Studying these aspects of evolution within a diversified species complex could help to clarify overall spatial and temporal patterns of plant speciation. The Arabidopsis lyrata complex, which is closely related to the model plant Arabidopsis thaliana, is a perennial, outcrossing, herbaceous species complex with a circumpolar distribution in the Northern Hemisphere as well as a disjunct Central European distribution in relictual habitats. This species complex comprises three species and four subspecies, mainly diploids but also several tetraploids, including one natural hybrid. The complex is ecologically, but not fully geographically, separated from members of the closely related species complex of Arabidopsis halleri, and the evolutionary histories of both species compexes have largely been influenced by Pleistocene climate oscillations. Results Using DNA sequence data from the nuclear encoded cytosolic phosphoglucoisomerase and Internal Transcribed Spacers 1 and 2 of the ribosomal DNA, as well as the trnL/F region from the chloroplast genome, we unravelled the phylogeography of the various taxonomic units of the A. lyrata complex. We demonstrate the existence of two major gene pools in Central Europe and Northern America. These two major gene pools are constructed from different taxonomic units. We also confirmed that A. kamchatica is the allotetraploid hybrid between A. lyrata and A. halleri, occupying the amphi-Beringian area in Eastern Asia and Northern America. This species closes the large distribution gap of the various other A. lyrata segregates. Furthermore, we revealed a threefold independent allopolyploid origin of this hybrid

  2. Linkage disequilibrium between incompatibility locus region genes in the plant Arabidopsis lyrata

    DEFF Research Database (Denmark)

    Hagenblad, Jenny; Bechsgaard, Jesper Smærup; Charlesworth, Deborah

    2006-01-01

    We have studied diversity in Arabidopsis lyrata of sequences orthologous to the ARK3 gene of A. thaliana. Our main goal was to test for recombination in the S-locus region. In A. thaliana, the single-copy ARK3 gene is closely linked to the non-functional copies of the self-incompatibility loci, and...... the ortholog in A. lyrata (a self-incompatible species) is in the homologous genome region and is known as Aly8. It is thus of interest to test whether Aly8 sequence diversity is elevated due to close linkage to the highly polymorphic incompatibility locus, as is theoretically predicted. However, Aly8...... linked to the incompatibility locus, one being a pseudogene. We determined the phase of multiple haplotypes in families of plants from Icelandic and other populations. Different Aly8 sequence types are associated with different SRK alleles, while haplotypes with the same SRK sequences tend to have the...

  3. Transmission ratio distortion in Arabidopsis lyrata: effects of population divergence and the S-locus

    DEFF Research Database (Denmark)

    Leppälä, J; Bechsgaard, J S; Schierup, M H;

    2007-01-01

    We investigated transmission ratio distortion within an Icelandic population of Arabidopsis lyrata using 16 molecular markers unlinked to the S-locus. Transmission ratio distortion was found more often than expected by chance at the gametic level, but not at the genotypic or zygotic level. The...... distortion in the interpopulation cross is due to population divergence. It is also substantially lower than previously observed in intrapopulation crosses at the self-incompatibility locus, suggesting inherent fitness differences of the self-incompatibility alleles. We discuss the possible role of...

  4. Using Chloroplast trnF Pseudogenes for Phylogeography in Arabidopsis Lyrata

    Directory of Open Access Journals (Sweden)

    Andrew Tedder

    2010-04-01

    Full Text Available The chloroplast trnL-F region has been extensively utilized for evolutionary analysis in plants. In the Brassicaceae this fragment contains 1–12 tandemly repeated trnF pseudogene copies in addition to the functional trnF gene. Here we assessed the potential of these highly variable, but complexly evolving duplications, to resolve the population history of the model plant Arabidopsis lyrata. While the region 5’ of the duplications had negligible sequence diversity, extensive variation in pseudogene copy number and nucleotide composition revealed otherwise cryptic population structure in eastern North America. Thus structural changes can be phylogeographically informative when pseudogene evolutionary relationships can be resolved.

  5. Genomic analysis of differentiation between soil types reveals candidate genes for local adaptation in Arabidopsis lyrata.

    Directory of Open Access Journals (Sweden)

    Thomas L Turner

    Full Text Available Serpentine soil, which is naturally high in heavy metal content and has low calcium to magnesium ratios, comprises a difficult environment for most plants. An impressive number of species are endemic to serpentine, and a wide range of non-endemic plant taxa have been shown to be locally adapted to these soils. Locating genomic polymorphisms which are differentiated between serpentine and non-serpentine populations would provide candidate loci for serpentine adaptation. We have used the Arabidopsis thaliana tiling array, which has 2.85 million probes throughout the genome, to measure genetic differentiation between populations of Arabidopsis lyrata growing on granitic soils and those growing on serpentinic soils. The significant overrepresentation of genes involved in ion transport and other functions provides a starting point for investigating the molecular basis of adaptation to soil ion content, water retention, and other ecologically and economically important variables. One gene in particular, calcium-exchanger 7, appears to be an excellent candidate gene for adaptation to low CaratioMg ratio in A. lyrata.

  6. The Arabidopsis lyrata genome sequence and the basis of rapid genome size change

    Energy Technology Data Exchange (ETDEWEB)

    Hu, Tina T.; Pattyn, Pedro; Bakker, Erica G.; Cao, Jun; Cheng, Jan-Fang; Clark, Richard M.; Fahlgren, Noah; Fawcett, Jeffrey A.; Grimwood, Jane; Gundlach, Heidrun; Haberer, Georg; Hollister, Jesse D.; Ossowski, Stephan; Ottilar, Robert P.; Salamov, Asaf A.; Schneeberger, Korbinian; Spannagl, Manuel; Wang, Xi; Yang, Liang; Nasrallah, Mikhail E.; Bergelson, Joy; Carrington, James C.; Gaut, Brandon S.; Schmutz, Jeremy; Mayer, Klaus F. X.; Van de Peer, Yves; Grigoriev, Igor V.; Nordborg, Magnus; Weigel, Detlef; Guo, Ya-Long

    2011-04-29

    In our manuscript, we present a high-quality genome sequence of the Arabidopsis thaliana relative, Arabidopsis lyrata, produced by dideoxy sequencing. We have performed the usual types of genome analysis (gene annotation, dN/dS studies etc. etc.), but this is relegated to the Supporting Information. Instead, we focus on what was a major motivation for sequencing this genome, namely to understand how A. thaliana lost half its genome in a few million years and lived to tell the tale. The rather surprising conclusion is that there is not a single genomic feature that accounts for the reduced genome, but that every aspect centromeres, intergenic regions, transposable elements, gene family number is affected through hundreds of thousands of cuts. This strongly suggests that overall genome size in itself is what has been under selection, a suggestion that is strongly supported by our demonstration (using population genetics data from A. thaliana) that new deletions seem to be driven to fixation.

  7. Zinc distribution and speciation in Arabidopsis halleri x Arabidops is lyrata progenies presenting various zinc accumulation capacities

    Energy Technology Data Exchange (ETDEWEB)

    Sarret, Geraldine; Willems, Glenda; Isaure, Marie-Pierre; Marcus, Matthew A.; Fakra, Sirine C.; Frerot, Helene; Pairis, Sebastien; Geoffroy, Nicolas; Manceau, Alain; Saumitou-Laprade, Pierre

    2010-04-08

    - The purpose of this study was to investigate the relationship between the chemical form and localization of zinc (Zn) in plant leaves and their Zn accumulationcapacity. - An interspecific cross between Arabidopsis halleri sp. halleri and Arabidopsis lyrata sp. petrea segregating for Zn accumulation was used. Zinc (Zn) speciation and Zn distribution in the leaves of the parent plants and of selected F1 and F2 progenies were investigated by spectroscopic and microscopic techniques and chemical analyses. - A correlation was observed between the proportion of Zn being in octahedral coordination complexed to organic acids and free in solution (Zn?OAs + Znaq) and Zn content in the leaves. This pool varied between 40percent and 80percent of total leaf Zn depending on the plant studied. Elemental mapping of the leaves revealed different Zn partitioning between the veins and the leaf tissue. The vein : tissue fluorescence ratio was negatively correlated with Zn accumulation. - The higher proportion of Zn?OAs + Znaq and the depletion of the veins in the stronger accumulators are attributed to a higher xylem unloading and vacuolar sequestration in the leaf cells. Elemental distributions in the trichomes were also investigated, and results support the role of carboxyl and⁄ or hydroxyl groups as major Zn ligands in these cells.

  8. Molecular evolutionary analysis of the Alfin-like protein family in Arabidopsis lyrata, Arabidopsis thaliana, and Thellungiella halophila.

    Directory of Open Access Journals (Sweden)

    Yu Song

    Full Text Available In previous studies, the Alfin1 gene, a transcription factor, enhanced salt tolerance in alfalfa, primarily through altering gene expression levels in the root. Here, we examined the molecular evolution of the Alfin-like (AL proteins in two Arabidopsis species (A. lyrata and A. thaliana and a salt-tolerant close relative Thellungiella halophila. These AL-like proteins could be divided into four groups and the two known DUF3594 and PHD-finger domains had co-evolved within each group of genes, irrespective of species, due to gene duplication events in the common ancestor of all three species while gene loss was observed only in T. halophila. To detect whether natural selection acted in the evolution of AL genes, we calculated synonymous substitution ratios (dn/ds and codon usage statistics, finding positive selection operated on four branches and significant differences in biased codon usage in the AL family between T. halophila and A. lyrata or A. thaliana. Distinctively, only the AL7 branch was under positive selection on the PHD-finger domain and the three members on the branch showed the smallest difference when codon bias was evaluated among the seven clusters. Functional analysis based on transgenic overexpression lines and T-DNA insertion mutants indicated that salt-stress-induced AtAL7 could play a negative role in salt tolerance of A. thaliana, suggesting that adaptive evolution occurred in the members of AL gene family.

  9. Validation of Pooled Whole-Genome Re-Sequencing in Arabidopsis lyrata.

    Directory of Open Access Journals (Sweden)

    Marco Fracassetti

    Full Text Available Sequencing pooled DNA of multiple individuals from a population instead of sequencing individuals separately has become popular due to its cost-effectiveness and simple wet-lab protocol, although some criticism of this approach remains. Here we validated a protocol for pooled whole-genome re-sequencing (Pool-seq of Arabidopsis lyrata libraries prepared with low amounts of DNA (1.6 ng per individual. The validation was based on comparing single nucleotide polymorphism (SNP frequencies obtained by pooling with those obtained by individual-based Genotyping By Sequencing (GBS. Furthermore, we investigated the effect of sample number, sequencing depth per individual and variant caller on population SNP frequency estimates. For Pool-seq data, we compared frequency estimates from two SNP callers, VarScan and Snape; the former employs a frequentist SNP calling approach while the latter uses a Bayesian approach. Results revealed concordance correlation coefficients well above 0.8, confirming that Pool-seq is a valid method for acquiring population-level SNP frequency data. Higher accuracy was achieved by pooling more samples (25 compared to 14 and working with higher sequencing depth (4.1× per individual compared to 1.4× per individual, which increased the concordance correlation coefficient to 0.955. The Bayesian-based SNP caller produced somewhat higher concordance correlation coefficients, particularly at low sequencing depth. We recommend pooling at least 25 individuals combined with sequencing at a depth of 100× to produce satisfactory frequency estimates for common SNPs (minor allele frequency above 0.05.

  10. Evidence of various mechanisms of Cd sequestration in the hyperaccumulator Arabidopsis halleri, the non-accumulator Arabidopsis lyrata, and their progenies by combined synchrotron-based techniques.

    Science.gov (United States)

    Isaure, Marie-Pierre; Huguet, Stéphanie; Meyer, Claire-Lise; Castillo-Michel, Hiram; Testemale, Denis; Vantelon, Delphine; Saumitou-Laprade, Pierre; Verbruggen, Nathalie; Sarret, Géraldine

    2015-06-01

    Arabidopsis halleri is a model plant for Zn and Cd hyperaccumulation. The objective of this study was to determine the relationship between the chemical forms of Cd, its distribution in leaves, and Cd accumulation and tolerance. An interspecific cross was carried out between A. halleri and the non-tolerant and non-hyperaccumulating relative A. lyrata providing progenies segregating for Cd tolerance and accumulation. Cd speciation and distribution were investigated using X-ray absorption spectroscopy and microfocused X-ray fluorescence. In A. lyrata and non-tolerant progenies, Cd was coordinated by S atoms only or with a small contribution of O groups. Interestingly, the proportion of O ligands increased in A. halleri and tolerant progenies, and they were predominant in most of them, while S ligands were still present. Therefore, the binding of Cd with O ligands was associated with Cd tolerance. In A. halleri, Cd was mainly located in the xylem, phloem, and mesophyll tissue, suggesting a reallocation process for Cd within the plant. The distribution of the metal at the cell level was further discussed. In A. lyrata, the vascular bundles were also Cd enriched, but the epidermis was richer in Cd as compared with the mesophyll. Cd was identified in trichomes of both species. This work demonstrated that both Cd speciation and localization were related to the tolerance character of the plant. PMID:25873676

  11. Comparative cDNA-AFLP analysis of Cd-tolerant and -sensitive genotypes derived from crosses between the Cd hyperaccumulator Arabidopsis halleri and Arabidopsis lyrata ssp. petraea.

    Science.gov (United States)

    Craciun, Adrian Radu; Courbot, Mikael; Bourgis, Fabienne; Salis, Pietrino; Saumitou-Laprade, Pierre; Verbruggen, Nathalie

    2006-01-01

    Cadmium (Cd) tolerance seems to be a constitutive species-level trait in Arabidopsis halleri. In order to identify genes potentially implicated in Cd tolerance, a backcross (BC1) segregating population was produced from crosses between A. halleri ssp. halleri and its closest non-tolerant relative A. lyrata ssp. petraea. The most sensitive and tolerant genotypes of the BC1 were analysed on a transcriptome-wide scale by cDNA-amplified fragment length polymorphism (AFLP). A hundred and thirty-four genes expressed more in the root of tolerant genotypes than in sensitive genotypes were identified. Most of the identified genes showed no regulation in their expression when exposed to Cd in a hydroponic culture medium and belonged to diverse functional classes, including reactive oxygen species (ROS) detoxification, cellular repair, metal sequestration, water transport, signal transduction, transcription regulation, and protein degradation, which are discussed. PMID:16916885

  12. Tethering Complexes in the Arabidopsis Endomembrane System.

    Science.gov (United States)

    Vukašinović, Nemanja; Žárský, Viktor

    2016-01-01

    Targeting of endomembrane transport containers is of the utmost importance for proper land plant growth and development. Given the immobility of plant cells, localized membrane vesicle secretion and recycling are amongst the main processes guiding proper cell, tissue and whole plant morphogenesis. Cell wall biogenesis and modification are dependent on vectorial membrane traffic, not only during normal development, but also in stress responses and in plant defense against pathogens and/or symbiosis. It is surprising how little we know about these processes in plants, from small GTPase regulation to the tethering complexes that act as their effectors. Tethering factors are single proteins or protein complexes mediating first contact between the target membrane and arriving membrane vesicles. In this review we focus on the tethering complexes of the best-studied plant model-Arabidopsis thaliana. Genome-based predictions indicate the presence of all major tethering complexes in plants that are known from a hypothetical last eukaryotic common ancestor (LECA). The evolutionary multiplication of paralogs of plant tethering complex subunits has produced the massively expanded EXO70 family, indicating a subfunctionalization of the terminal exocytosis machinery in land plants. Interpretation of loss of function (LOF) mutant phenotypes has to consider that related, yet clearly functionally-specific complexes often share some common core subunits. It is therefore impossible to conclude with clarity which version of the complex is responsible for the phenotypic deviations observed. Experimental interest in the analysis of plant tethering complexes is growing and we hope to contribute with this review by attracting even more attention to this fascinating field of plant cell biology. PMID:27243010

  13. 3D gel map of Arabidopsis complex I

    OpenAIRE

    Katrin ePeters; Katharina eBelt; Hans-Peter eBraun

    2013-01-01

    Complex I has a unique structure in plants and includes extra subunits. Here, we present a novel study to define its protein constituents. Mitochondria were isolated from Arabidopsis thaliana cell cultures, leaves and roots. Subunits of complex I were resolved by 3D blue native (BN)/SDS/SDS-PAGE and identified by mass spectrometry. Overall, 55 distinct proteins were found, 7 of which occur in pairs of isoforms. We present evidence that Arabidopsis complex I consists of 49 distinct types of su...

  14. Forms of zinc accumulated in the hyperaccumulator Arabidopsis halleri.

    Science.gov (United States)

    Sarret, Géraldine; Saumitou-Laprade, Pierre; Bert, Valérie; Proux, Olivier; Hazemann, Jean-Louis; Traverse, Agnès; Marcus, Matthew A; Manceau, Alain

    2002-12-01

    The chemical forms of zinc (Zn) in the Zn-tolerant and hyperaccumulator Arabidopsis halleri and in the non-tolerant and nonaccumulator Arabidopsis lyrata subsp. petraea were determined at the molecular level by combining chemical analyses, extended x-ray absorption spectroscopy (EXAFS), synchrotron-based x-ray microfluorescence, and muEXAFS. Plants were grown in hydroponics with various Zn concentrations, and A. halleri specimens growing naturally in a contaminated site were also collected. Zn speciation in A. halleri was independent of the origin of the plants (contaminated or non-contaminated) and Zn exposure. In aerial parts, Zn was predominantly octahedrally coordinated and complexed to malate. A secondary organic species was identified in the bases of the trichomes, which contained elevated Zn concentrations, and in which Zn was tetrahedrally coordinated and complexed to carboxyl and/or hydroxyl functional groups. This species was detected thanks to the good resolution and sensitivity of synchrotron-based x-ray microfluorescence and muEXAFS. In the roots of A. halleri grown in hydroponics, Zn phosphate was the only species detected, and is believed to result from chemical precipitation on the root surface. In the roots of A. halleri grown on the contaminated soil, Zn was distributed in Zn malate, Zn citrate, and Zn phosphate. Zn phosphate was present in both the roots and aerial part of A. lyrata subsp. petraea. This study illustrates the complementarity of bulk and spatially resolved techniques, allowing the identification of: (a) the predominant chemical forms of the metal, and (b) the minor forms present in particular cells, both types of information being essential for a better understanding of the bioaccumulation processes. PMID:12481065

  15. Arabidopsis flower development-of protein complexes, targets, and transport.

    Science.gov (United States)

    Becker, Annette; Ehlers, Katrin

    2016-03-01

    Tremendous progress has been achieved over the past 25 years or more of research on the molecular mechanisms of floral organ identity, patterning, and development. While collections of floral homeotic mutants of Antirrhinum majus laid the foundation already at the beginning of the previous century, it was the genetic analysis of these mutants in A. majus and Arabidopsis thaliana that led to the development of the ABC model of floral organ identity more than 20 years ago. This intuitive model kick-started research focused on the genetic mechanisms regulating flower development, using mainly A. thaliana as a model plant. In recent years, interactions among floral homeotic proteins have been elucidated, and their direct and indirect target genes are known to a large extent. Here, we provide an overview over the advances in understanding the molecular mechanism orchestrating A. thaliana flower development. We focus on floral homeotic protein complexes, their target genes, evidence for their transport in floral primordia, and how these new results advance our view on the processes downstream of floral organ identity, such as organ boundary formation or floral organ patterning. PMID:25845756

  16. Forms of zinc accumulated in the hyperaccumulator Arabidopsis halleri

    OpenAIRE

    Sarret, Geraldine; Saumitou-Laprade, Pierre; Bert, Valerie; Proux, Olivier; Hazemann, Jean-Louis; Traverse, Agnes; Marcus, Matthew,; Manceau, Alain

    2002-01-01

    The chemical forms of zinc (Zn) in the Zn-tolerant and hyperaccumulator Arabidopsis halleri and in the non-tolerant and nonaccumulator Arabidopsis lyrata subsp. petraea were determined at the molecular level by combining chemical analyses, extended x-ray absorption spectroscopy (EXAFS), synchrotron-based x-ray microfluorescence, and micro--EXAFS. Plants weree grown in hydroponics with various Zn concentrations, and A. halleri specimens growing naturally in a contaminated site were also collec...

  17. Reproductive Cycle of Hard Clam, Meretrix lyrata Sowerby, 1851 (Bivalvia: Veneridae) from Sarawak, Malaysia

    OpenAIRE

    Hamli, Hadi; Idris, Mohd Hanafi; Rajaee, Amy Halimah; Kamal, Abu Hena Mustafa

    2015-01-01

    A study of the reproductive cycle of the hard clam, Meretrix lyrata, was documented based on histological observation and Gonad Index (GI). Samples were taken from estuarine waters of the Buntal River in Sarawak, Malaysia. The gonad of M. lyrata started to develop in September 2013. Gametogenesis continued to develop until the maturation and spawning stage from February to April 2014. The GI pattern for a one-year cycle showed a significant correlation with chlorophyll a. The corresponding GI...

  18. Life without complex I: proteome analyses of an Arabidopsis mutant lacking the mitochondrial NADH dehydrogenase complex

    Science.gov (United States)

    Fromm, Steffanie; Senkler, Jennifer; Eubel, Holger; Peterhänsel, Christoph; Braun, Hans-Peter

    2016-01-01

    The mitochondrial NADH dehydrogenase complex (complex I) is of particular importance for the respiratory chain in mitochondria. It is the major electron entry site for the mitochondrial electron transport chain (mETC) and therefore of great significance for mitochondrial ATP generation. We recently described an Arabidopsis thaliana double-mutant lacking the genes encoding the carbonic anhydrases CA1 and CA2, which both form part of a plant-specific ‘carbonic anhydrase domain’ of mitochondrial complex I. The mutant lacks complex I completely. Here we report extended analyses for systematically characterizing the proteome of the ca1ca2 mutant. Using various proteomic tools, we show that lack of complex I causes reorganization of the cellular respiration system. Reduced electron entry into the respiratory chain at the first segment of the mETC leads to induction of complexes II and IV as well as alternative oxidase. Increased electron entry at later segments of the mETC requires an increase in oxidation of organic substrates. This is reflected by higher abundance of proteins involved in glycolysis, the tricarboxylic acid cycle and branched-chain amino acid catabolism. Proteins involved in the light reaction of photosynthesis, the Calvin cycle, tetrapyrrole biosynthesis, and photorespiration are clearly reduced, contributing to the significant delay in growth and development of the double-mutant. Finally, enzymes involved in defense against reactive oxygen species and stress symptoms are much induced. These together with previously reported insights into the function of plant complex I, which were obtained by analysing other complex I mutants, are integrated in order to comprehensively describe ‘life without complex I’. PMID:27122571

  19. Life without complex I: proteome analyses of an Arabidopsis mutant lacking the mitochondrial NADH dehydrogenase complex.

    Science.gov (United States)

    Fromm, Steffanie; Senkler, Jennifer; Eubel, Holger; Peterhänsel, Christoph; Braun, Hans-Peter

    2016-05-01

    The mitochondrial NADH dehydrogenase complex (complex I) is of particular importance for the respiratory chain in mitochondria. It is the major electron entry site for the mitochondrial electron transport chain (mETC) and therefore of great significance for mitochondrial ATP generation. We recently described an Arabidopsis thaliana double-mutant lacking the genes encoding the carbonic anhydrases CA1 and CA2, which both form part of a plant-specific 'carbonic anhydrase domain' of mitochondrial complex I. The mutant lacks complex I completely. Here we report extended analyses for systematically characterizing the proteome of the ca1ca2 mutant. Using various proteomic tools, we show that lack of complex I causes reorganization of the cellular respiration system. Reduced electron entry into the respiratory chain at the first segment of the mETC leads to induction of complexes II and IV as well as alternative oxidase. Increased electron entry at later segments of the mETC requires an increase in oxidation of organic substrates. This is reflected by higher abundance of proteins involved in glycolysis, the tricarboxylic acid cycle and branched-chain amino acid catabolism. Proteins involved in the light reaction of photosynthesis, the Calvin cycle, tetrapyrrole biosynthesis, and photorespiration are clearly reduced, contributing to the significant delay in growth and development of the double-mutant. Finally, enzymes involved in defense against reactive oxygen species and stress symptoms are much induced. These together with previously reported insights into the function of plant complex I, which were obtained by analysing other complex I mutants, are integrated in order to comprehensively describe 'life without complex I'. PMID:27122571

  20. Protein (Viridiplantae): 297792861 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 81972:4104 hypothetical protein ARALYDRAFT_918544 Arabidopsis lyrata subsp. lyrata MGSFKLLVAFTLVVMMTISYDLFSGIGISARTVPPTCYESCNATFQNPECNKMCVGLAYKDGSCIYPPPEVDGLPPKRPYFPRCCCNPIILSPPSP ...

  1. Protein (Viridiplantae): 297819616 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 53 81972:1953 predicted protein Arabidopsis lyrata subsp. lyrata MMIMEEEDQNECNSVGSFYVKVNMEGVPIGRKIDLLSLNGYHDLITTLDYMFNASILYQNLLYYVSLRPKLMAIKNCENRAEEEEMCSEKSHVLTYADKEGDWMMVGDVPWE ...

  2. The Five AhMTP1 Zinc Transporters Undergo Different Evolutionary Fates towards Adaptive Evolution to Zinc Tolerance in Arabidopsis halleri

    OpenAIRE

    Shahzad, Zaigham; Gosti, Françoise; Frérot, Hélène; Lacombe, Eric; Roosens, Nancy; Saumitou-Laprade, Pierre; Berthomieu, Pierre

    2010-01-01

    Gene duplication is a major mechanism facilitating adaptation to changing environments. From recent genomic analyses, the acquisition of zinc hypertolerance and hyperaccumulation characters discriminating Arabidopsis halleri from its zinc sensitive/non-accumulator closest relatives Arabidopsis lyrata and Arabidopsis thaliana was proposed to rely on duplication of genes controlling zinc transport or zinc tolerance. Metal Tolerance Protein 1 (MTP1) is one of these genes. It encodes a Zn2+/H+ an...

  3. Arabidopsis MSI1 connects LHP1 to PRC2 complexes

    OpenAIRE

    Derkacheva, Maria; Steinbach, Yvonne; Wildhaber, Thomas; Mozgová, Iva; Mahrez, Walid; Nanni, Paolo; Bischof, Sylvain; Gruissem, Wilhelm; Hennig, Lars

    2013-01-01

    Polycomb group (PcG) proteins form essential epigenetic memory systems for controlling gene expression during development in plants and animals. However, the mechanism of plant PcG protein functions remains poorly understood. Here, we probed the composition and function of plant Polycomb repressive complex 2 (PRC2). This work established the fact that all known plant PRC2 complexes contain MSI1, a homologue of Drosophila p55. While p55 is not essential for the in vitro enzymatic activity of P...

  4. Arabidopsis MSI1 connects LHP1 to PRC2 complexes.

    Science.gov (United States)

    Derkacheva, Maria; Steinbach, Yvonne; Wildhaber, Thomas; Mozgová, Iva; Mahrez, Walid; Nanni, Paolo; Bischof, Sylvain; Gruissem, Wilhelm; Hennig, Lars

    2013-07-17

    Polycomb group (PcG) proteins form essential epigenetic memory systems for controlling gene expression during development in plants and animals. However, the mechanism of plant PcG protein functions remains poorly understood. Here, we probed the composition and function of plant Polycomb repressive complex 2 (PRC2). This work established the fact that all known plant PRC2 complexes contain MSI1, a homologue of Drosophila p55. While p55 is not essential for the in vitro enzymatic activity of PRC2, plant MSI1 was required for the functions of the EMBRYONIC FLOWER and the VERNALIZATION PRC2 complexes including trimethylation of histone H3 Lys27 (H3K27) at the target chromatin, as well as gene repression and establishment of competence to flower. We found that MSI1 serves to link PRC2 to LIKE HETEROCHROMATIN PROTEIN 1 (LHP1), a protein that binds H3K27me3 in vitro and in vivo and is required for a functional plant PcG system. The LHP1-MSI1 interaction forms a positive feedback loop to recruit PRC2 to chromatin that carries H3K27me3. Consequently, this can provide a mechanism for the faithful inheritance of local epigenetic information through replication. PMID:23778966

  5. Dual Fatty Acid Elongase Complex Interactions in Arabidopsis.

    Science.gov (United States)

    Morineau, Céline; Gissot, Lionel; Bellec, Yannick; Hematy, Kian; Tellier, Frédérique; Renne, Charlotte; Haslam, Richard; Beaudoin, Frédéric; Napier, Johnathan; Faure, Jean-Denis

    2016-01-01

    Very long chain fatty acids (VLCFAs) are involved in plant development and particularly in several cellular processes such as membrane trafficking, cell division and cell differentiation. However, the precise role of VLCFAs in these different cellular processes is still poorly understood in plants. In order to identify new factors associated with the biosynthesis or function of VLCFAs, a yeast multicopy suppressor screen was carried out in a yeast mutant strain defective for fatty acid elongation. Loss of function of the elongase 3 hydroxyacyl-CoA dehydratase PHS1 in yeast and PASTICCINO2 in plants prevents growth and induces cytokinesis defects. PROTEIN TYROSIN PHOSPHATASE-LIKE (PTPLA) previously characterized as an inactive dehydratase was able to restore yeast phs1 growth and VLCFAs elongation but not the plant pas2-1 defects. PTPLA interacted with elongase subunits in the Endoplasmic Reticulum (ER) and its absence induced the accumulation of 3-hydroxyacyl-CoA as expected from a dehydratase involved in fatty acid (FA) elongation. However, loss of PTPLA function increased VLCFA levels, an effect that was dependent on the presence of PAS2 indicating that PTPLA activity repressed FA elongation. The two dehydratases have specific expression profiles in the root with PAS2, mostly restricted to the endodermis, while PTPLA was confined in the vascular tissue and pericycle cells. Comparative ectopic expression of PTPLA and PAS2 in their respective domains confirmed the existence of two independent elongase complexes based on PAS2 or PTPLA dehydratase that are functionally interacting. PMID:27583779

  6. Centromere-targeted de novo integrations of an LTR retrotransposon of Arabidopsis lyrata

    OpenAIRE

    Tsukahara, Sayuri; Kawabe, Akira; Kobayashi, Akie; Ito, Tasuku; Aizu, Tomoyuki; Shin-I, Tadasu; Toyoda, Atsushi; Fujiyama, Asao; Tarutani, Yoshiaki; Kakutani, Tetsuji

    2012-01-01

    Transposons contribute to heterochromatin formation, cohesion, and chromosomal segregation. Centromeres in many eukaryotes—including vertebrates, insects, and plants—contain a high proportion of repeats and transposons, suggesting targeted integration of these transposons to centromeres. However, no transposons targeted to centromeres have been identified. In this study, Kakutani and colleagues demonstrate that a mobile LTR retrotransposon, Tal1, integrates almost exclusively into centromeres...

  7. INVOLVED IN DE NOVO 2-containing complex involved in RNA-directed DNA methylation in Arabidopsis

    Energy Technology Data Exchange (ETDEWEB)

    Ausin, Israel; Greenberg, Maxim V.C.; Simanshu, Dhirendra K.; Hale, Christopher J.; Vashisht, Ajay A.; Simon, Stacey A.; Lee, Tzuu-fen; Feng, Suhua; Española, Sophia D.; Meyers, Blake C.; Wohlschlegel, James A.; Patel, Dinshaw J.; Jacobsen, Steven E. (UCLA); (MSKCC); (Delaware)

    2012-10-23

    At least three pathways control maintenance of DNA cytosine methylation in Arabidopsis thaliana. However, the RNA-directed DNA methylation (RdDM) pathway is solely responsible for establishment of this silencing mark. We previously described INVOLVED IN DE NOVO 2 (IDN2) as being an RNA-binding RdDM component that is required for DNA methylation establishment. In this study, we describe the discovery of two partially redundant proteins that are paralogous to IDN2 and that form a stable complex with IDN2 in vivo. Null mutations in both genes, termed IDN2-LIKE 1 and IDN2-LIKE 2 (IDNL1 and IDNL2), result in a phenotype that mirrors, but does not further enhance, the idn2 mutant phenotype. Genetic analysis suggests that this complex acts in a step in the downstream portion of the RdDM pathway. We also have performed structural analysis showing that the IDN2 XS domain adopts an RNA recognition motif (RRM) fold. Finally, genome-wide DNA methylation and expression analysis confirms the placement of the IDN proteins in an RdDM pathway that affects DNA methylation and transcriptional control at many sites in the genome. Results from this study identify and describe two unique components of the RdDM machinery, adding to our understanding of DNA methylation control in the Arabidopsis genome.

  8. Interspecific and interploidal gene flow in Central European Arabidopsis (Brassicaceae

    Directory of Open Access Journals (Sweden)

    Jørgensen Marte H

    2011-11-01

    Full Text Available Abstract Background Effects of polyploidisation on gene flow between natural populations are little known. Central European diploid and tetraploid populations of Arabidopsis arenosa and A. lyrata are here used to study interspecific and interploidal gene flow, using a combination of nuclear and plastid markers. Results Ploidal levels were confirmed by flow cytometry. Network analyses clearly separated diploids according to species. Tetraploids and diploids were highly intermingled within species, and some tetraploids intermingled with the other species, as well. Isolation with migration analyses suggested interspecific introgression from tetraploid A. arenosa to tetraploid A. lyrata and vice versa, and some interploidal gene flow, which was unidirectional from diploid to tetraploid in A. arenosa and bidirectional in A. lyrata. Conclusions Interspecific genetic isolation at diploid level combined with introgression at tetraploid level indicates that polyploidy may buffer against negative consequences of interspecific hybridisation. The role of introgression in polyploid systems may, however, differ between plant species, and even within the small genus Arabidopsis, we find very different evolutionary fates when it comes to introgression.

  9. Transposed genes in Arabidopsis are often associated with flanking repeats.

    Directory of Open Access Journals (Sweden)

    Margaret R Woodhouse

    2010-05-01

    Full Text Available Much of the eukaryotic genome is known to be mobile, largely due to the movement of transposons and other parasitic elements. Recent work in plants and Drosophila suggests that mobility is also a feature of many nontransposon genes and gene families. Indeed, analysis of the Arabidopsis genome suggested that as many as half of all genes had moved to unlinked positions since Arabidopsis diverged from papaya roughly 72 million years ago, and that these mobile genes tend to fall into distinct gene families. However, the mechanism by which single gene transposition occurred was not deduced. By comparing two closely related species, Arabidopsis thaliana and Arabidopsis lyrata, we sought to determine the nature of gene transposition in Arabidopsis. We found that certain categories of genes are much more likely to have transposed than others, and that many of these transposed genes are flanked by direct repeat sequence that was homologous to sequence within the orthologous target site in A. lyrata and which was predominantly genic in identity. We suggest that intrachromosomal recombination between tandemly duplicated sequences, and subsequent insertion of the circular product, is the predominant mechanism of gene transposition.

  10. Arabidopsis CML38, a Calcium Sensor That Localizes to Ribonucleoprotein Complexes under Hypoxia Stress.

    Science.gov (United States)

    Lokdarshi, Ansul; Conner, W Craig; McClintock, Carlee; Li, Tian; Roberts, Daniel M

    2016-02-01

    During waterlogging and the associated oxygen deprivation stress, plants respond by the induction of adaptive programs, including the redirected expression of gene networks toward the synthesis of core hypoxia-response proteins. Among these core response proteins in Arabidopsis (Arabidopsis thaliana) is the calcium sensor CML38, a protein related to regulator of gene silencing calmodulin-like proteins (rgsCaMs). CML38 transcripts are up-regulated more than 300-fold in roots within 6 h of hypoxia treatment. Transfer DNA insertional mutants of CML38 show an enhanced sensitivity to hypoxia stress, with lowered survival and more severe inhibition of root and shoot growth. By using yellow fluorescent protein (YFP) translational fusions, CML38 protein was found to be localized to cytosolic granule structures similar in morphology to hypoxia-induced stress granules. Immunoprecipitation of CML38 from the roots of hypoxia-challenged transgenic plants harboring CML38pro::CML38:YFP followed by liquid chromatography-tandem mass spectrometry analysis revealed the presence of protein targets associated with messenger RNA ribonucleoprotein (mRNP) complexes including stress granules, which are known to accumulate as messenger RNA storage and triage centers during hypoxia. This finding is further supported by the colocalization of CML38 with the mRNP stress granule marker RNA Binding Protein 47 (RBP47) upon cotransfection of Nicotiana benthamiana leaves. Ruthenium Red treatment results in the loss of CML38 signal in cytosolic granules, suggesting that calcium is necessary for stress granule association. These results confirm that CML38 is a core hypoxia response calcium sensor protein and suggest that it serves as a potential calcium signaling target within stress granules and other mRNPs that accumulate during flooding stress responses. PMID:26634999

  11. A Protein Complex Required for Polymerase V Transcripts and RNA- Directed DNA Methylation in Arabidopsis

    KAUST Repository

    Law, Julie A.

    2010-05-01

    DNA methylation is an epigenetic modification associated with gene silencing. In Arabidopsis, DNA methylation is established by DOMAINS REARRANGED METHYLTRANSFERASE 2 (DRM2), which is targeted by small interfering RNAs through a pathway termed RNA-directed DNA methylation (RdDM) [1, 2]. Recently, RdDM was shown to require intergenic noncoding (IGN) transcripts that are dependent on the Pol V polymerase. These transcripts are proposed to function as scaffolds for the recruitment of downstream RdDM proteins, including DRM2, to loci that produce both siRNAs and IGN transcripts [3]. However, the mechanism(s) through which Pol V is targeted to specific genomic loci remains largely unknown. Through affinity purification of two known RdDM components, DEFECTIVE IN RNA-DIRECTED DNA METHYLATION 1 (DRD1) [4] and DEFECTIVE IN MERISTEM SILENCING 3 (DMS3) [5, 6], we found that they copurify with each other and with a novel protein, RNA-DIRECTED DNA METHYLATION 1 (RDM1), forming a complex we term DDR. We also found that DRD1 copurified with Pol V subunits and that RDM1, like DRD1 [3] and DMS3 [7], is required for the production of Pol V-dependent transcripts. These results suggest that the DDR complex acts in RdDM at a step upstream of the recruitment or activation of Pol V. © 2010 Elsevier Ltd. All rights reserved.

  12. The CA domain of the respiratory complex I is required for normal embryogenesis in Arabidopsis thaliana.

    Science.gov (United States)

    Córdoba, Juan Pablo; Marchetti, Fernanda; Soto, Débora; Martin, María Victoria; Pagnussat, Gabriela Carolina; Zabaleta, Eduardo

    2016-03-01

    The NADH-ubiquinone oxidoreductase [complex I (CI), EC 1.6.5.3] of the mitochondrial respiratory chain is the principal entry point of electrons, and vital in maintaining metabolism and the redox balance. In a variety of eukaryotic organisms, except animal and fungi (Opisthokonta), it contains an extra domain composed of putative gamma carbonic anhydrases subunits, named the CA domain, which was proposed to be essential for complex I assembly. There are two kinds of carbonic anhydrase subunits: CAs (of which there are three) and carbonic anhydrase-like proteins (CALs) (of which there are two). In plants, the CA domain has been linked to photorespiration. In this work, we report that Arabidopsis mutant plants affected in two specific CA subunits show a lethal phenotype. Double homozygous knockouts ca1ca2 embryos show a significant developmental delay compared to the non-homozygous embryos, which show a wild-type (WT) phenotype in the same silique. Mutant embryos show impaired mitochondrial membrane potential and mitochondrial reactive oxygen species (ROS) accumulation. The characteristic embryo greening does not take place and fewer but larger oil bodies are present. Although seeds look dark brown and wrinkled, they are able to germinate 12 d later than WT seeds. However, they die immediately, most likely due to oxidative stress.Since the CA domain is required for complex I biogenesis, it is predicted that in ca1ca2 mutants no complex I could be formed, triggering the lethal phenotype. The in vivo composition of a functional CA domain is proposed. PMID:26721503

  13. Arabidopsis COMPASS-like complexes mediate histone H3 lysine-4 trimethylation to control floral transition and plant development.

    Directory of Open Access Journals (Sweden)

    Danhua Jiang

    2011-03-01

    Full Text Available Histone H3 lysine-4 (H3K4 methylation is associated with transcribed genes in eukaryotes. In Drosophila and mammals, both di- and tri-methylation of H3K4 are associated with gene activation. In contrast to animals, in Arabidopsis H3K4 trimethylation, but not mono- or di-methylation of H3K4, has been implicated in transcriptional activation. H3K4 methylation is catalyzed by the H3K4 methyltransferase complexes known as COMPASS or COMPASS-like in yeast and mammals. Here, we report that Arabidopsis homologs of the COMPASS and COMPASS-like complex core components known as Ash2, RbBP5, and WDR5 in humans form a nuclear subcomplex during vegetative and reproductive development, which can associate with multiple putative H3K4 methyltransferases. Loss of function of ARABIDOPSIS Ash2 RELATIVE (ASH2R causes a great decrease in genome-wide H3K4 trimethylation, but not in di- or mono-methylation. Knockdown of ASH2R or the RbBP5 homolog suppresses the expression of a crucial Arabidopsis floral repressor, FLOWERING LOCUS C (FLC, and FLC homologs resulting in accelerated floral transition. ASH2R binds to the chromatin of FLC and FLC homologs in vivo and is required for H3K4 trimethylation, but not for H3K4 dimethylation in these loci; overexpression of ASH2R causes elevated H3K4 trimethylation, but not H3K4 dimethylation, in its target genes FLC and FLC homologs, resulting in activation of these gene expression and consequent late flowering. These results strongly suggest that H3K4 trimethylation in FLC and its homologs can activate their expression, providing concrete evidence that H3K4 trimethylation accumulation can activate eukaryotic gene expression. Furthermore, our findings suggest that there are multiple COMPASS-like complexes in Arabidopsis and that these complexes deposit trimethyl but not di- or mono-methyl H3K4 in target genes to promote their expression, providing a molecular explanation for the observed coupling of H3K4 trimethylation (but not H3

  14. TNL-mediated immunity in Arabidopsis requires complex regulation of the redundant ADR1 gene family.

    Science.gov (United States)

    Dong, Oliver Xiaoou; Tong, Meixuezi; Bonardi, Vera; El Kasmi, Farid; Woloshen, Virginia; Wünsch, Lisa K; Dangl, Jeffery L; Li, Xin

    2016-05-01

    Nucleotide-binding leucine-rich repeat proteins (NLRs) serve as intracellular immune receptors in animals and plants. Sensor NLRs perceive pathogen-derived effector molecules and trigger robust host defense. Recent studies revealed the role of three coiled-coil-type NLRs (CNLs) of the ADR1 family - ADR1, ADR1-L1 and ADR1-L2 - as redundant helper NLRs, whose function is required for defense mediated by multiple sensor NLRs. From a mutant snc1-enhancing (MUSE) forward genetic screen in Arabidopsis targeted to identify negative regulators of snc1 that encodes a TIR-type NLR (TNL), we isolated two alleles of muse15, both carrying mutations in ADR1-L1. Interestingly, loss of ADR1-L1 also enhances immunity-related phenotypes in other autoimmune mutants including cpr1, bal and lsd1. This immunity-enhancing effect is not mediated by increased SNC1 protein stability, nor is it fully dependent on the accumulation of the defense hormone salicylic acid (SA). Transcriptional analysis revealed an upregulation of ADR1 and ADR1-L2 in the adr1-L1 background, which may overcompensate the loss of ADR1-L1, resulting in enhanced immunity. Interestingly, autoimmunity of snc1 and chs2, which encode typical TNLs, is fully suppressed by the adr1 triple mutant, suggesting that the ADRs are required for TNL downstream signaling. This study extends our knowledge on the interplay among ADRs and reveals their complexity in defense regulation. PMID:27074399

  15. MicroProtein-mediated recruitment of CONSTANS into a TOPLESS trimeric complex represses flowering in Arabidopsis

    DEFF Research Database (Denmark)

    Graeff, Moritz; Straub, Daniel; Eguen, Tenai E.;

    2016-01-01

    Arabidopsis thaliana microProteins, miP1a and miP1b, physically interact with CONSTANS (CO) a potent regulator of flowering time. The miP1a/b-type microProteins evolved in dicotyledonous plants and have an additional carboxy-terminal PF(V/L)FL motif. This motif enables miP1a/b microProteins to interact with...... TOPLESS/TOPLESS-RELATED (TPL/TPR) proteins. Interaction of CO with miP1a/b/TPL causes late flowering due to a failure in the induction of FLOWERING LOCUS T (FT) expression under inductive long day conditions. Both miP1a and miP1b are expressed in vascular tissue, where CO and FT are active. Genetically......MicroProteins are short, single domain proteins that act by sequestering larger, multi-domain proteins into non-functional complexes. MicroProteins have been identified in plants and animals, where they are mostly involved in the regulation of developmental processes. Here we show that two...

  16. Protein (Viridiplantae): 297825487 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 273 81972:1273 hypothetical protein ARALYDRAFT_901062 Arabidopsis lyrata subsp. lyrata MAKPAKGKNKSLLDCSPLLEELPQSPDC...RNRGNPEANPRKCNMAKPAKDKNKSLLDCSPLLEELPQSPDCRNRGNPEANPRKCNMAKPAKDKNKSLLDCSPLLEELPQSPDC

  17. Protein (Viridiplantae): 297835204 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 21 predicted protein Arabidopsis lyrata subsp. lyrata MSSEKEEKESSKNPTTPPIAVPPTATPPIAKPPVATPPTTKPPVATPPVATPPIATPPITKPPVTTPPVATPP...IAKPPVATPPTATPPVATPPIAKPPVATPPIATPPIAKPPVVTPPIATPPIATPPIAIPPIATPPVSKPPVATPPVATPP...TAMPPVATPPIAKPPVVTPPVATPPIAKPPVATPPIATPPVSKPPVATPPVATPPTTMPPVATPPIAKPPVATPPVATPPIAKPPVATPPIATPPVSKPPVATPPVATPP...TIMPPVATPPIAKPPVATPPVATPPIAKPPIATPPVATPPIAKPPIATPPIAKPPIATPPVATPPIAKPPIATPPIAKPPTATPPTSIPPVATPPITTPPVATPPIATPP...VAKPPVATPPVASPPVAKPPIATPPIAKPPVATPPIAKPPVATPPVATPPVATPPISTPP

  18. Protein (Viridiplantae): 297796879 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available PVKTIKTNVIGTLNMLGLAKRVGARILLTSTSEVYGDPLIHPQPESYWGNVNPIGVRSCYDEGKRVAETLMFDYHRQHGIEIRIARIFNTYGPRMNIDDGRVVSNFIA...972:1201 UDP-glucuronic acid decarboxylase Arabidopsis lyrata subsp. lyrata MAATSEKQNSTKPPPSPSPLRNSKFCQSNMRILI...SGGAGFIGSHLVDKLMENEKNEVIVADNYFTGSKENLKKWIGHPRFELIRHDVTEPLLIEVDRIYHLACPASPIFYKYN...QALRGEALTVQKPGTQTRSFCYVSDMVDGLIRLMEGDDTGPINIGNPGEFTMVELAETVKELINPSIEIKMVENTPDDPRQRKPDISKAKEVLGWEPKVKLREGLPLMEEDFRLRLNVPKN ...

  19. Protein (Viridiplantae): 297822109 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available GTKDWRVEKTNARLSGQLNEIVSKRAKEAETDSKDFLSLILKARESDPFAKKIFTPDYISAVTYEHLLAGSATTAFTLSSVLYLVSGHLEVEKRLLQEIDGFGGRNLIPTA...AKYGPDVFSVLAKQYGPIFRFQMGRQPLIIIAEAELCREVGIKKFKDLPNRSIPSPISASPLHKKGLFFTRDKRWSKMRNTILSLYQPSHLTSLIPT...:689 CYP711A1 Arabidopsis lyrata subsp. lyrata MKTQHLWWEVLDPLLIQHEALVAFLIFAVVVIVVYLYRPSWSVRNVPGPTAMPLVGHLPLM...MHNFITSATHNLDSKPRDIVFSNLFLKLTTDIIGQAAFGVNFGLSGKKPVKDVEVADFINQHVYSTTQLKMDLSGSLSIILGLLIPILQEPFRQVLKRIP...HDLQYKFPYLDQVIKEAMRFYMVSPLVARETAKEVEIGGYLLPKGTWVWLALGVLAKDPKNFPEPEKFRPERFDPNGEEEKLRHPYAFIP

  20. Mutations in exocyst complex subunit SEC6 gene impaired polar auxin transport and PIN protein recycling in Arabidopsis primary root.

    Science.gov (United States)

    Tan, Xiaoyun; Feng, Yihong; Liu, Yulong; Bao, Yiqun

    2016-09-01

    Polar auxin transport, which is critical for land plant pattern formation and directional growth, is largely depended on asymmetric distribution of PIN proteins at the plasma membrane (PM). Endocytosis and recycling processes play important roles in regulating PIN protein distribution and abundance at the PM. Two subunits (SEC8, EXO70A1) of exocyst, an octameric vesicle-tethering complex, have been reported to be involved in PIN protein recycling in Arabidopsis. However, the function of exocyst complex in PIN protein recycling and polar auxin transport remains incompletely understood. In this study, we utilized two SEC6 down-regulation mutants (PRsec6-1 and PRsec6-2) to investigate the role of exocyst subunit SEC6 in the primary root development, polar auxin transport and PIN proteins recycling. We found that in PRsec6 mutants: 1. Primary root growth was retarded, and lateral root initiation were compromised. 2. Primary roots were sensitive to exogenous auxin 1-napthalene acetic acid (NAA) but not 2,4-dichlorophenoxy (2.4-D). 3. Recycling of PIN1 and PIN2 proteins from the Brefeldin A (BFA) compartment to the PM was delayed. 4. Vesicles accumulated in the primary root tip cells, especially accumulated in the cytosol closed to the PM. These results further demonstrated that the exocyst complex plays an important role in PIN protein recycling and polar auxin transport in Arabidopsis primary root. PMID:27457987

  1. A Microarray Based Genomic Hybridization Method for Identification of New Genes in Plants: Case Analyses of Arabidopsis and Oryza

    Institute of Scientific and Technical Information of China (English)

    Chuanzhu Fan; Maria D. Vibranovski; Ying Chen; Manyuan Long

    2007-01-01

    To systematically estimate the gene duplication events in closely related species, we have to use comparative genomic approaches, either through genomic sequence comparison or comparative genomic hybridization (CGH). Given the scarcity of complete genomic sequences of plant species, in the present study we adopted an array based CGH to investigate gene duplications in the genus Arabidopsis. Fragment genomic DNA from four species, namely Arabidopsis thaliana, A. lyrata subsp. lyrata, A. lyrata subsp. petraea, and A. halleri, was hybridized to Affymetrix (Santa Clara, CA, USA) tiling arrays that are designed from the genomic sequences of A. thaliana. Pairwise comparisons of signal intensity were made to infer the potential duplicated candidates along each phylo-genetic branch. Ninety-four potential candidates of gene duplication along the genus were identified. Among them, the majority (69 of 94) were A. thaliana lineage specific. This result indicates that the array based CGH approach may be used to identify candidates of duplication in other plant genera containing closely related species, such as Oryza, particularly for the AA genome species. We compared the degree of gene duplication through retrotransposon between O. sativa and A. thaliana and found a strikingly higher number of chimera retroposed genes in rice. The higher rate of gene duplication through retroposition and other mechanisms may indicate that the grass species is able to adapt to more diverse environments.

  2. Multiple receptor complexes assembled for transmitting CLV3 signaling in Arabidopsis

    OpenAIRE

    Zhu, Yingfang; Wan, Yinglang; Lin, Jinxing

    2010-01-01

    In Arabidopsis, the feedback regulatory loop between CLAVATA3 (CLV3) signaling pathway and transcription factor, WUSCHEL (WUS) plays a significant role in shoot apical meristems (SAM) maintenance. Previously, CLV1/CLV2 heterodimers were supposed to perceive and transmit CLV3 signaling. Recent genetic analysis isolated a novel receptor kinase, CORYNE (CRN), which was found to be involved in the CLV3 pathway. Therefore, new hypothesis was put forward that CRN probably acts with CLV2 to transmit...

  3. CATION EXCHANGER1 Cosegregates with Cadmium Tolerance in the Metal Hyperaccumulator Arabidopsis halleri and Plays a Role in Limiting Oxidative Stress in Arabidopsis Spp.

    Science.gov (United States)

    Baliardini, Cecilia; Meyer, Claire-Lise; Salis, Pietrino; Saumitou-Laprade, Pierre; Verbruggen, Nathalie

    2015-09-01

    Arabidopsis halleri is a model species for the study of plant adaptation to extreme metallic conditions. In this species, cadmium (Cd) tolerance seems to be constitutive, and the mechanisms underlying the trait are still poorly understood. A previous quantitative trait loci (QTL) analysis performed on A. halleri × Arabidopsis lyrata backcross population1 identified the metal-pump gene Heavy Metal ATPase4 as the major genetic determinant for Cd tolerance. However, although necessary, Heavy Metal ATPase4 alone is not sufficient for determining this trait. After fine mapping, a gene encoding a calcium(2+)/hydrogen(+) antiporter, cation/hydrogen(+) exchanger1 (CAX1), was identified as a candidate gene for the second QTL of Cd tolerance in A. halleri. Backcross population1 individuals displaying the A. halleri allele for the CAX1 locus exhibited significantly higher CAX1 expression levels compared with the ones with the A. lyrata allele, and a positive correlation between CAX1 expression and Cd tolerance was observed. Here, we show that this QTL is conditional and that it is only detectable at low external Ca concentration. CAX1 expression in both roots and shoots was higher in A. halleri than in the close Cd-sensitive relative species A. lyrata and Arabidopsis thaliana. Moreover, CAX1 loss of function in A. thaliana led to higher Cd sensitivity at low concentration of Ca, higher sensitivity to methylviologen, and stronger accumulation of reactive oxygen species after Cd treatment. Overall, this study identifies a unique genetic determinant of Cd tolerance in the metal hyperaccumulator A. halleri and offers a new twist for the function of CAX1 in plants. PMID:26162428

  4. CATION EXCHANGER1 Cosegregates with Cadmium Tolerance in the Metal Hyperaccumulator Arabidopsis halleri and Plays a Role in Limiting Oxidative Stress in Arabidopsis Spp.1[OPEN

    Science.gov (United States)

    Baliardini, Cecilia; Meyer, Claire-Lise; Salis, Pietrino; Saumitou-Laprade, Pierre; Verbruggen, Nathalie

    2015-01-01

    Arabidopsis halleri is a model species for the study of plant adaptation to extreme metallic conditions. In this species, cadmium (Cd) tolerance seems to be constitutive, and the mechanisms underlying the trait are still poorly understood. A previous quantitative trait loci (QTL) analysis performed on A. halleri × Arabidopsis lyrata backcross population1 identified the metal-pump gene Heavy Metal ATPase4 as the major genetic determinant for Cd tolerance. However, although necessary, Heavy Metal ATPase4 alone is not sufficient for determining this trait. After fine mapping, a gene encoding a calcium2+/hydrogen+ antiporter, cation/hydrogen+ exchanger1 (CAX1), was identified as a candidate gene for the second QTL of Cd tolerance in A. halleri. Backcross population1 individuals displaying the A. halleri allele for the CAX1 locus exhibited significantly higher CAX1 expression levels compared with the ones with the A. lyrata allele, and a positive correlation between CAX1 expression and Cd tolerance was observed. Here, we show that this QTL is conditional and that it is only detectable at low external Ca concentration. CAX1 expression in both roots and shoots was higher in A. halleri than in the close Cd-sensitive relative species A. lyrata and Arabidopsis thaliana. Moreover, CAX1 loss of function in A. thaliana led to higher Cd sensitivity at low concentration of Ca, higher sensitivity to methylviologen, and stronger accumulation of reactive oxygen species after Cd treatment. Overall, this study identifies a unique genetic determinant of Cd tolerance in the metal hyperaccumulator A. halleri and offers a new twist for the function of CAX1 in plants. PMID:26162428

  5. Recruitment of Arabidopsis RNA Helicase AtRH9 to the Viral Replication Complex by Viral Replicase to Promote Turnip Mosaic Virus Replication.

    Science.gov (United States)

    Li, Yinzi; Xiong, Ruyi; Bernards, Mark; Wang, Aiming

    2016-01-01

    Positive-sense RNA viruses have a small genome with very limited coding capacity and are highly dependent on host components to fulfill their life cycle. Recent studies have suggested that DEAD-box RNA helicases play vital roles in many aspects of RNA metabolism. To explore the possible role of the RNA helicases in viral infection, we used the Turnip mosaic virus (TuMV)-Arabidopsis pathosystem. The Arabidopsis genome encodes more than 100 putative RNA helicases (AtRH). Over 41 Arabidopsis T-DNA insertion mutants carrying genetic lesions in the corresponding 26 AtRH genes were screened for their requirement in TuMV infection. TuMV infection assays revealed that virus accumulation significantly decreased in the Arabidopsis mutants of three genes, AtRH9, AtRH26, and PRH75. In the present work, AtRH9 was further characterized. Yeast two-hybrid and bimolecular fluorescence complementation (BiFC) assays showed that AtRH9 interacted with the TuMV NIb protein, the viral RNA-dependent RNA polymerase. Moreover, the subcellular distribution of AtRH9 was altered in the virus-infected cells, and AtRH9 was recruited to the viral replication complex. These results suggest that Arabidopsis AtRH9 is an important component of the TuMV replication complex, possibly recruited via its interaction with NIb. PMID:27456972

  6. Gene Coexpression Analysis Reveals Complex Metabolism of the Monoterpene Alcohol Linalool in Arabidopsis Flowers[W][OPEN

    Science.gov (United States)

    Ginglinger, Jean-François; Boachon, Benoit; Höfer, René; Paetz, Christian; Köllner, Tobias G.; Miesch, Laurence; Lugan, Raphael; Baltenweck, Raymonde; Mutterer, Jérôme; Ullmann, Pascaline; Beran, Franziska; Claudel, Patricia; Verstappen, Francel; Fischer, Marc J.C.; Karst, Francis; Bouwmeester, Harro; Miesch, Michel; Schneider, Bernd; Gershenzon, Jonathan; Ehlting, Jürgen; Werck-Reichhart, Danièle

    2013-01-01

    The cytochrome P450 family encompasses the largest family of enzymes in plant metabolism, and the functions of many of its members in Arabidopsis thaliana are still unknown. Gene coexpression analysis pointed to two P450s that were coexpressed with two monoterpene synthases in flowers and were thus predicted to be involved in monoterpenoid metabolism. We show that all four selected genes, the two terpene synthases (TPS10 and TPS14) and the two cytochrome P450s (CYP71B31 and CYP76C3), are simultaneously expressed at anthesis, mainly in upper anther filaments and in petals. Upon transient expression in Nicotiana benthamiana, the TPS enzymes colocalize in vesicular structures associated with the plastid surface, whereas the P450 proteins were detected in the endoplasmic reticulum. Whether they were expressed in Saccharomyces cerevisiae or in N. benthamiana, the TPS enzymes formed two different enantiomers of linalool: (−)-(R)-linalool for TPS10 and (+)-(S)-linalool for TPS14. Both P450 enzymes metabolize the two linalool enantiomers to form different but overlapping sets of hydroxylated or epoxidized products. These oxygenated products are not emitted into the floral headspace, but accumulate in floral tissues as further converted or conjugated metabolites. This work reveals complex linalool metabolism in Arabidopsis flowers, the ecological role of which remains to be determined. PMID:24285789

  7. Gene coexpression analysis reveals complex metabolism of the monoterpene alcohol linalool in Arabidopsis flowers.

    OpenAIRE

    Ginglinger, J.-F.; Boachon, B.; Hofer, R.; Paetz, C.; Kollner, T. G.; Miesch, L.; Lugan, R.; Baltenweck, R.; Mutterer, J.; Ullmann, P.; Beran, F.; Claudel, P.; Verstappen, F.; Fischer, M. J. C.; Karst, F

    2013-01-01

    The cytochrome P450 family encompasses the largest family of enzymes in plant metabolism, and the functions of many of its members in Arabidopsis thaliana are still unknown. Gene coexpression analysis pointed to two P450s that were coexpressed with two monoterpene synthases in flowers and were thus predicted to be involved in monoterpenoid metabolism. We show that all four selected genes, the two terpene synthases (TPS10 and TPS14) and the two cytochrome P450s (CYP71B31 and CYP76C3), are simu...

  8. The Arabidopsis Cellulose Synthase Complex: A Proposed Hexamer of CESA Trimers in an Equimolar Stoichiometry

    Energy Technology Data Exchange (ETDEWEB)

    Hill, Joseph L. [Pennsylvania State Univ., University Park, PA (United States); Hammudi, Mustafa B. [Pennsylvania State Univ., University Park, PA (United States); Tien, Ming [Pennsylvania State Univ., University Park, PA (United States)

    2014-12-01

    In this study, we show a 1:1:1 stoichiometry between the three Arabidopsis thaliana secondary cell wall isozymes: CESA4, CESA7, and CESA8. This ratio was determined utilizing a simple but elegant method of quantitative immunoblotting using isoform-specific antibodies and 35S-labeled protein standards for each CESA. Additionally, the observed equimolar stoichiometry was found to be fixed along the axis of the stem, which represents a developmental gradient. Our results complement recent spectroscopic analyses pointing toward an 18-chain cellulose microfibril. Taken together, we propose that the CSC is composed of a hexamer of catalytically active CESA trimers, with each CESA in equimolar amounts. This finding is a crucial advance in understanding how CESAs integrate to form higher order complexes, which is a key determinate of cellulose microfibril and cell wall properties.

  9. Functional characterization of mutants affected in the carbonic anhydrase domain of the respiratory complex I in Arabidopsis thaliana.

    Science.gov (United States)

    Soto, Débora; Córdoba, Juan Pablo; Villarreal, Fernando; Bartoli, Carlos; Schmitz, Jessica; Maurino, Veronica G; Braun, Hans Peter; Pagnussat, Gabriela C; Zabaleta, Eduardo

    2015-09-01

    The NADH-ubiquinone oxidoreductase complex (complex I) (EC 1.6.5.3) is the main entrance site of electrons into the respiratory chain. In a variety of eukaryotic organisms, except animals and fungi (Opisthokonta), it contains an extra domain comprising trimers of putative γ-carbonic anhydrases, named the CA domain, which has been proposed to be essential for assembly of complex I. However, its physiological role in plants is not fully understood. Here, we report that Arabidopsis mutants defective in two CA subunits show an altered photorespiratory phenotype. Mutants grown in ambient air show growth retardation compared to wild-type plants, a feature that is reversed by cultivating plants in a high-CO2 atmosphere. Moreover, under photorespiratory conditions, carbon assimilation is diminished and glycine accumulates, suggesting an imbalance with respect to photorespiration. Additionally, transcript levels of specific CA subunits are reduced in plants grown under non-photorespiratory conditions. Taken together, these results suggest that the CA domain of plant complex I contributes to sustaining efficient photosynthesis under ambient (photorespiratory) conditions. PMID:26148112

  10. Comparison of in vitro antioxidant properties of extracts from three plants used for medical purpose in Cameroon:Acalypha racemosa, Garcinia lucida and Hymenocardia lyrata

    Institute of Scientific and Technical Information of China (English)

    Djacbou D Sylvie; Pieme Constant Anatole; Biapa Prosper Cabral; Penlap Beng Veronique

    2014-01-01

    Objective:To investigate the in vitro antiradical and antioxidant properties of methanol extracts of Garcinia lucida, Hymenocardia lyrata (H. lyrata) and Acalypha racemosa. Methods: We determined the in vitro antioxidant activity and the total phenolic content, and performed the phytochemical screening of the extracts from fruits, barks, leaves, roots and stems of these plants using standard procedures. Results:The results of the antioxidant properties showed that more than 60%of DPPH., NO. and HO. radicals were inhibited by the extracts. The radical scavenging activity, the total antioxidant capacity as well as the reducing power increased with the concentration of the extracts. The 50%inhibitory concentration (IC50) varied from 1.46 to 21.65 µg/mL depending of the type of extract and the antioxidant tests. The results indicated that all the extracts exhibited antioxidant properties and the roots of H. lyrata showed the best antioxidant activity [(217.17±9.45) mg Equivalent catechin/g of extract] while the highest total phenol content was found in its barks [(169.782±3.025) mg Eq cat/g of extract]. Conclusions:The methanol extract of H. lyrata possess the most antioxidant property among the three extracts.

  11. Genome-Wide Analysis of Gene Regulatory Networks of the FVE-HDA6-FLD Complex in Arabidopsis

    Science.gov (United States)

    Yu, Chun-Wei; Chang, Kao-Yuan; Wu, Keqiang

    2016-01-01

    FVE/MSI4 is a homolog of the mammalian RbAp48 protein. We found that FVE regulates flowering time by repressing FLC through decreasing histone H3K4 trimethylation and H3 acetylation. Furthermore, FVE interacts with the histone deacetylase HDA6 and the histone demethylase FLD, suggesting that these proteins may form a protein complex to regulate flowering time. To further investigate the function of the FVE-FLD-HDA6 complex, we compared the gene expression profiles of fve, fld, and hda6 mutant plants by using RNA-seq analysis. Among the mis-regulated genes found in fve plants, 51.8 and 36.5% of them were also mis-regulated in fld and hda6 plants, respectively, suggesting that FVE, HDA6, and FLD may regulate the gene expression in the same developmental processes in Arabidopsis. Gene ontology analysis revealed that among 383 genes co-regulated by FVE, HDA6, and FLD, 15.6% of them are involved in transcription, 8.2% in RNA metabolic process, 7.7% in response to abiotic stress, and 6.3% in hormone stimulus. Taken together, these results indicate that HDA6, FVE, and FLD co-regulate the gene expression in multiple development processes and pathways. PMID:27200029

  12. The Arabidopsis Wave Complex: Mechanisms Of Localized Actin Polymerization And Growth

    Energy Technology Data Exchange (ETDEWEB)

    Daniel Szymanski

    2012-10-23

    The objective of this project was to discover the protein complexes and control mechanisms that determine the location of actin filament roadways in plant cells. Our work provided the first molecular description of protein complexes that are converted from inactive complexes to active actin filament nucleators in the cell. These discoveries provided a conceptual framework to control to roadways in plant cells that determine the location and delivery of plant metabolites and storage molecules that are relevant to the bioenergy economy.

  13. Light-harvesting complexes in photosystem II regulate glutathione-induced sensitivity of Arabidopsis guard cells to abscisic acid.

    Science.gov (United States)

    Jahan, Md Sarwar; Nozulaidi, Mohd; Khairi, Mohd; Mat, Nashriyah

    2016-05-20

    Light-harvesting complexes (LHCs) in photosystem II (PSII) regulate glutathione (GSH) functions in plants. To investigate whether LHCs control GSH biosynthesis that modifies guard cell abscisic acid (ABA) sensitivity, we evaluated GSH content, stomatal aperture, reactive oxygen species (ROS), weight loss and plant growth using a ch1-1 mutant that was defective of LHCs and compared this with wild-type (WT) Arabidopsis thaliana plants. Glutathione monoethyl ester (GSHmee) increased but 1-chloro-2,4 dinitrobenzene (CDNB) decreased the GSH content in the guard cells. The guard cells of the ch1-1 mutants accumulated significantly less GSH than the WT plants. The guard cells of the ch1-1 mutants also showed higher sensitivity to ABA than the WT plants. The CDNB treatment increased but the GSHmee treatment decreased the ABA sensitivity of the guard cells without affecting ABA-induced ROS production. Dark and light treatments altered the GSH content and stomatal aperture of the guard cells of ch1-1 and WT plants, irrespective of CDNB and GSHmee. The ch1-1 mutant contained fewer guard cells and displayed poor growth, late flowering and stumpy weight loss compared with the WT plants. This study suggests that defective LHCs reduced the GSH content in the guard cells and increased sensitivity to ABA, resulting in stomatal closure. PMID:26970687

  14. Data on the identification of protein interactors with the Evening Complex and PCH1 in Arabidopsis using tandem affinity purification and mass spectrometry (TAP-MS).

    Science.gov (United States)

    Huang, He; Alvarez, Sophie; Nusinow, Dmitri A

    2016-09-01

    Tandem affinity purification coupled with mass spectrometry (TAP-MS) analysis is a powerful biochemical approach to identify protein-protein associations. Here we describe two datasets generated by a series of TAP-MS analyses to co-purify proteins associated with either ELF3 or ELF4 of the Evening Complex (EC) ("Identification of Evening Complex Associated Proteins in Arabidopsis by Affinity Purification and Mass Spectrometry" (Huang et al., 2016a) [1]) or proteins associated with PCH1, which is a newly identified output of the circadian clock to regulate photoperiodic growth in Arabidopsis thaliana ("PCH1 integrates circadian and light-signaling pathways to control photoperiod-responsive growth in Arabidopsis" (Huang et al. 2016b) [2]). We used either ELF3, ELF4 or PCH1 fused to a C-terminal tandem affinity tag (6xHis-3xFLAG) as baits and conducted purifications in various genetic mutant backgrounds. These data are discussed in recent publications [1,2], and are deposited at the ProteomeXchange Consortium via the PRIDE partner repository with the dataset identifier PRIDE: PXD002606 (for EC) and PRIDE: PXD003352 (for PCH1). PMID:27274533

  15. The GIP gamma-tubulin complex-associated proteins are involved in nuclear architecture in Arabidopsis thaliana.

    Directory of Open Access Journals (Sweden)

    Morgane eBatzenschlager

    2013-11-01

    Full Text Available During interphase, the microtubular cytoskeleton of cycling plant cells is organized in both cortical and perinuclear arrays. Perinuclear microtubules (MTs are nucleated from γ-Tubulin Complexes (γ-TuCs located at the surface of the nucleus. The molecular mechanisms of γ-TuC association to the nuclear envelope are currently unknown. The γ-TuC Protein 3 (GCP3-Interacting Protein 1 (GIP1 is the smallest γ-TuC component identified so far. AtGIP1 and its homologous protein AtGIP2 participate in the localization of active γ-TuCs at interphasic and mitotic MT nucleation sites. Arabidopsis gip1gip2 mutants are impaired in establishing a fully functional mitotic spindle and exhibit severe developmental defects.In this study, gip1gip2 knock down mutants were further characterized at the cellular level. In addition to defects in both the localization of γ-TuC core proteins and MT fibre robustness, gip1gip2 mutants exhibited a severe alteration of the nuclear shape associated with an abnormal distribution of the nuclear pore complexes. Simultaneously, they showed a misorganization of the inner nuclear membrane protein AtSUN1. Furthermore, AtGIP1 was identified as an interacting partner of AtTSA1 which was detected, like the AtGIP proteins, at the nuclear envelope.These results provide the first evidence for the involvement of a γ-TuC component in both nuclear shaping and nuclear envelope organization. Functional hypotheses are discussed in order to propose a model for a GIP-dependent nucleo-cytoplasmic continuum.

  16. The AP-3 adaptor complex is required for vacuolar function in Arabidopsis

    NARCIS (Netherlands)

    Zwiewka, M.; Feraru, E.; Moller, B.K.; Hwang, I.; Feraru, M.I.; Kleine-Vehn, J.; Weijers, D.; Friml, J.

    2011-01-01

    Subcellular trafficking is required for a multitude of functions in eukaryotic cells. It involves regulation of cargo sorting, vesicle formation, trafficking and fusion processes at multiple levels. Adaptor protein (AP) complexes are key regulators of cargo sorting into vesicles in yeast and mammals

  17. Complex Genetics Control Natural Variation in Arabidopsis thaliana Resistance to Botrytis cinerea

    OpenAIRE

    Rowe, Heather C.; Daniel J Kliebenstein

    2008-01-01

    The genetic architecture of plant defense against microbial pathogens may be influenced by pathogen lifestyle. While plant interactions with biotrophic pathogens are frequently controlled by the action of large-effect resistance genes that follow classic Mendelian inheritance, our study suggests that plant defense against the necrotrophic pathogen Botrytis cinerea is primarily quantitative and genetically complex. Few studies of quantitative resistance to necrotrophic pathogens have used larg...

  18. The AP-3 adaptor complex is required for vacuolar function in Arabidopsis

    Institute of Scientific and Technical Information of China (English)

    Maria Zwiewka; Elena Feraru; Barbara M(o)ller; Inhwan Hwang; Mugurel I Feraru; Jürgen Kleine-Vehn; Dolf Weijers; Ji(n) Friml

    2011-01-01

    Subcellular trafficking is required for a multitude of functions in eukaryotic cells.It involves regulation of cargo sorting,vesicle formation,trafficking and fusion processes at multiple levels.Adaptor protein (AP) complexes are key regulators of cargo sorting into vesicles in yeast and mammals but their existence and function in plants have not been demonstrated.Here we report the identification of the protein-affected trafficking 4 (pat4) mutant defective in the putative δ subunit of the AP-3 complex.pat4 and pat2,a mutant isolated from the same GFP imaging-based forward genetic screen that lacks a functional putative AP-3 β,as well as dominant negative AP-3 μ transgenic lines display undistinguishable phenotypes characterized by largely normal morphology and development,but strong intracellular accumulation of membrane proteins in aberrant vacuolar structures.All mutants are defective in morphology and function of lytic and protein storage vacuoles (PSVs) but show normal sorting of reserve proteins to PSVs.Immunoprecipitation experiments and genetic studies revealed tight functional and physical associations of putative AP-3 β and AP-3 δ subunits.Furthermore,both proteins are closely linked with putative AP-3 μ and σ subunits and several components of the clathrin and dynamin machineries.Taken together,these results demonstrate that AP complexes,similar to those in other eukaryotes,exist in plants,and that AP-3 plays a specific role in the regulation of biogenesis and function of vacuoles in plant cells.

  19. Nitric oxide participates in the complex interplay of defense-related signaling pathways controlling disease resistance to Sclerotinia sclerotiorum in Arabidopsis thaliana.

    Science.gov (United States)

    Perchepied, Laure; Balagué, Claudine; Riou, Catherine; Claudel-Renard, Clotilde; Rivière, Nathalie; Grezes-Besset, Bruno; Roby, Dominique

    2010-07-01

    Studies of the interaction between Arabidopsis thaliana and the necrotrophic fungal pathogen Sclerotinia sclerotiorum have been hampered by the extreme susceptibility of this model plant to the fungus. In addition, analyses of the plant defense response suggested the implication of a complex interplay of hormonal and signaling pathways. To get a deeper insight into this host-pathogen interaction, we first analyzed the natural variation in Arabidopsis for resistance to S. sclerotiorum. The results revealed a large variation of resistance and susceptibility in Arabidopsis, with some ecotypes, such as Ws-4, Col-0, and Rbz-1, being strongly resistant, and others, such as Shahdara, Ita-0, and Cvi-0, exhibiting an extreme susceptibility. The role of different signaling pathways in resistance was then determined by assessing the symptoms of mutants affected in the perception, production, or transduction of hormonal signals after inoculation with S. sclerotiorum. This analysis led to the conclusions that i) signaling of inducible defenses is predominantly mediated by jasmonic acid and abscisic acid, influenced by ethylene, and independent of salicylic acid; and ii) nitric oxide (NO) and reactive oxygen species are important signals required for plant resistance to S. sclerotiorum. Defense gene expression analysis supported the specific role of NO in defense activation. PMID:20521948

  20. Photosynthate Regulation of the Root System Architecture Mediated by the Heterotrimeric G Protein Complex in Arabidopsis.

    Science.gov (United States)

    Mudgil, Yashwanti; Karve, Abhijit; Teixeira, Paulo J P L; Jiang, Kun; Tunc-Ozdemir, Meral; Jones, Alan M

    2016-01-01

    Assimilate partitioning to the root system is a desirable developmental trait to control but little is known of the signaling pathway underlying partitioning. A null mutation in the gene encoding the Gβ subunit of the heterotrimeric G protein complex, a nexus for a variety of signaling pathways, confers altered sugar partitioning in roots. While fixed carbon rapidly reached the roots of wild type and agb1-2 mutant seedlings, agb1 roots had more of this fixed carbon in the form of glucose, fructose, and sucrose which manifested as a higher lateral root density. Upon glucose treatment, the agb1-2 mutant had abnormal gene expression in the root tip validated by transcriptome analysis. In addition, PIN2 membrane localization was altered in the agb1-2 mutant. The heterotrimeric G protein complex integrates photosynthesis-derived sugar signaling incorporating both membrane-and transcriptional-based mechanisms. The time constants for these signaling mechanisms are in the same range as photosynthate delivery to the root, raising the possibility that root cells are able to use changes in carbon fixation in real time to adjust growth behavior. PMID:27610112

  1. Cell edges accumulate gamma tubulin complex components and nucleate microtubules following cytokinesis in Arabidopsis thaliana.

    Directory of Open Access Journals (Sweden)

    Chris Ambrose

    Full Text Available Microtubules emanate from distinct organizing centers in fungal and animal cells. In plant cells, by contrast, microtubules initiate from dispersed sites in the cell cortex, where they then self-organize into parallel arrays. Previous ultrastructural evidence suggested that cell edges participate in microtubule nucleation but so far there has been no direct evidence for this. Here we use live imaging to show that components of the gamma tubulin nucleation complex (GCP2 and GCP3 localize at distinct sites along the outer periclinal edge of newly formed crosswalls, and that microtubules grow predominantly away from these edges. These data confirm a role for cell edges in microtubule nucleation, and suggest that an asymmetric distribution of microtubule nucleation factors contributes to cortical microtubule organization in plants, in a manner more similar to other kingdoms than previously thought.

  2. Golgi-localized STELLO proteins regulate the assembly and trafficking of cellulose synthase complexes in Arabidopsis.

    Science.gov (United States)

    Zhang, Yi; Nikolovski, Nino; Sorieul, Mathias; Vellosillo, Tamara; McFarlane, Heather E; Dupree, Ray; Kesten, Christopher; Schneider, René; Driemeier, Carlos; Lathe, Rahul; Lampugnani, Edwin; Yu, Xiaolan; Ivakov, Alexander; Doblin, Monika S; Mortimer, Jenny C; Brown, Steven P; Persson, Staffan; Dupree, Paul

    2016-01-01

    As the most abundant biopolymer on Earth, cellulose is a key structural component of the plant cell wall. Cellulose is produced at the plasma membrane by cellulose synthase (CesA) complexes (CSCs), which are assembled in the endomembrane system and trafficked to the plasma membrane. While several proteins that affect CesA activity have been identified, components that regulate CSC assembly and trafficking remain unknown. Here we show that STELLO1 and 2 are Golgi-localized proteins that can interact with CesAs and control cellulose quantity. In the absence of STELLO function, the spatial distribution within the Golgi, secretion and activity of the CSCs are impaired indicating a central role of the STELLO proteins in CSC assembly. Point mutations in the predicted catalytic domains of the STELLO proteins indicate that they are glycosyltransferases facing the Golgi lumen. Hence, we have uncovered proteins that regulate CSC assembly in the plant Golgi apparatus. PMID:27277162

  3. Golgi-localized STELLO proteins regulate the assembly and trafficking of cellulose synthase complexes in Arabidopsis

    Science.gov (United States)

    Zhang, Yi; Nikolovski, Nino; Sorieul, Mathias; Vellosillo, Tamara; McFarlane, Heather E.; Dupree, Ray; Kesten, Christopher; Schneider, René; Driemeier, Carlos; Lathe, Rahul; Lampugnani, Edwin; Yu, Xiaolan; Ivakov, Alexander; Doblin, Monika S.; Mortimer, Jenny C.; Brown, Steven P.; Persson, Staffan; Dupree, Paul

    2016-01-01

    As the most abundant biopolymer on Earth, cellulose is a key structural component of the plant cell wall. Cellulose is produced at the plasma membrane by cellulose synthase (CesA) complexes (CSCs), which are assembled in the endomembrane system and trafficked to the plasma membrane. While several proteins that affect CesA activity have been identified, components that regulate CSC assembly and trafficking remain unknown. Here we show that STELLO1 and 2 are Golgi-localized proteins that can interact with CesAs and control cellulose quantity. In the absence of STELLO function, the spatial distribution within the Golgi, secretion and activity of the CSCs are impaired indicating a central role of the STELLO proteins in CSC assembly. Point mutations in the predicted catalytic domains of the STELLO proteins indicate that they are glycosyltransferases facing the Golgi lumen. Hence, we have uncovered proteins that regulate CSC assembly in the plant Golgi apparatus. PMID:27277162

  4. Characterization of MADS-domain transcription factor complexes in Arabidopsis flower development

    Science.gov (United States)

    Smaczniak, Cezary; Immink, Richard G. H.; Muiño, Jose M.; Blanvillain, Robert; Busscher, Marco; Busscher-Lange, Jacqueline; Dinh, Q. D. (Peter); Liu, Shujing; Westphal, Adrie H.; Boeren, Sjef; Parcy, François; Xu, Lin; Carles, Cristel C.; Angenent, Gerco C.; Kaufmann, Kerstin

    2012-01-01

    Floral organs are specified by the combinatorial action of MADS-domain transcription factors, yet the mechanisms by which MADS-domain proteins activate or repress the expression of their target genes and the nature of their cofactors are still largely unknown. Here, we show using affinity purification and mass spectrometry that five major floral homeotic MADS-domain proteins (AP1, AP3, PI, AG, and SEP3) interact in floral tissues as proposed in the “floral quartet” model. In vitro studies confirmed a flexible composition of MADS-domain protein complexes depending on relative protein concentrations and DNA sequence. In situ bimolecular fluorescent complementation assays demonstrate that MADS-domain proteins interact during meristematic stages of flower development. By applying a targeted proteomics approach we were able to establish a MADS-domain protein interactome that strongly supports a mechanistic link between MADS-domain proteins and chromatin remodeling factors. Furthermore, members of other transcription factor families were identified as interaction partners of floral MADS-domain proteins suggesting various specific combinatorial modes of action. PMID:22238427

  5. Crystal Structures of DNA-Whirly Complexes and Their Role in Arabidopsis Organelle Genome Repair

    Energy Technology Data Exchange (ETDEWEB)

    Cappadocia, Laurent; Maréchal, Alexandre; Parent, Jean-Sébastien; Lepage, Étienne; Sygusch, Jurgen; Brisson, Normand (Montreal)

    2010-09-07

    DNA double-strand breaks are highly detrimental to all organisms and need to be quickly and accurately repaired. Although several proteins are known to maintain plastid and mitochondrial genome stability in plants, little is known about the mechanisms of DNA repair in these organelles and the roles of specific proteins. Here, using ciprofloxacin as a DNA damaging agent specific to the organelles, we show that plastids and mitochondria can repair DNA double-strand breaks through an error-prone pathway similar to the microhomology-mediated break-induced replication observed in humans, yeast, and bacteria. This pathway is negatively regulated by the single-stranded DNA (ssDNA) binding proteins from the Whirly family, thus indicating that these proteins could contribute to the accurate repair of plant organelle genomes. To understand the role of Whirly proteins in this process, we solved the crystal structures of several Whirly-DNA complexes. These reveal a nonsequence-specific ssDNA binding mechanism in which DNA is stabilized between domains of adjacent subunits and rendered unavailable for duplex formation and/or protein interactions. Our results suggest a model in which the binding of Whirly proteins to ssDNA would favor accurate repair of DNA double-strand breaks over an error-prone microhomology-mediated break-induced replication repair pathway.

  6. Expression of GFP-mTalin reveals an actin-related role for the Arabidopsis Class II formin AtFH12

    OpenAIRE

    Cvrčková, F.; Grunt, M.; Žárský, V.

    2012-01-01

    Formins (FH2 proteins) are implicated in F-actin nucleation and other aspects of cytoskeletal organization. Plants possess two formin clades, relatively well-described Class I formins and so far poorly characterized Class II formins. Comparison of Class II formin genes of two Arabidopsis species, A. thaliana and A. lyrata, indicates dynamic evolution within the Class II formin clade. Disruption of an outlier A. thaliana Class II formin gene, AtFH12 (At1g42980), whose expression is induced by ...

  7. Protein (Viridiplantae): 297848026 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 01:9525 59689:9736 81972:9736 predicted protein Arabidopsis lyrata subsp. lyrata MVEKAKECWTMLQNWKSIHVLQRYQKQ...HFSSTSNKELSWATSNKEHKKADHFPVLHRRSFHHLRLSPPYNCVTRNLCKSCGPASISVIAFPSTVFMAYFTEASSSPFD

  8. Protein (Viridiplantae): 297845652 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available RSSLGPKGMDKMLQGPDGDITITNDGATILEQMDVDNQIAKLMVELSRSQDYEIGDGTTGVVVMAGALLEQAERQLDRGIHPIRIA...EGYEMASRVAVDHLERIAQKFEFDVNNFEPLVQTCMTTLSSKIVNRCKRSLAEIAVKAVLAVADLERRDVNLDLIKVEGKVGGKLEDTELIYGILI...DKDMSHPQMPKQIEDAHIAILTCPFEPPKPKTKHKVDIDTVEKFETLRKQEQQYFDEMVQKCKDVGATLVICQWGFDDEANHLLMHRNLPAVRWVGGVELELIAIATGGRI...VPRFQELTPEKLGKAGVVREKSFGTTKERMLYIEHCANSKAVTVFIRGGNKMMIEETKRSIHDALCVARNLIRNKSIVYGGGAAEIA...81972:883 hypothetical protein ARALYDRAFT_472896 Arabidopsis lyrata subsp. lyrata MALAFDEFGRPFIILREQDQKTRLRGIDAQKANIAAGKAVARIL

  9. Identification, duplication, evolution and expression analyses of caleosins in Brassica plants and Arabidopsis subspecies.

    Science.gov (United States)

    Shen, Yue; Liu, Mingzhe; Wang, Lili; Li, Zhuowei; Taylor, David C; Li, Zhixi; Zhang, Meng

    2016-04-01

    Caleosins are a class of Ca(2+) binding proteins that appear to be ubiquitous in plants. Some of the main proteins embedded in the lipid monolayer of lipid droplets, caleosins, play critical roles in the degradation of storage lipids during germination and in lipid trafficking. Some of them have been shown to have histidine-dependent peroxygenase activity, which is believed to participate in stress responses in Arabidopsis. In the model plant Arabidopsis thaliana, caleosins have been examined extensively. However, little is known on a genome-wide scale about these proteins in other members of the Brassicaceae. In this study, 51 caleosins in Brassica plants and Arabidopsis lyrata were investigated and analyzed in silico. Among them, 31 caleosins, including 7 in A. lyrata, 11 in Brassica oleracea and 13 in Brassica napus, are herein identified for the first time. Segmental duplication was the main form of gene expansion. Alignment, motif and phylogenetic analyses showed that Brassica caleosins belong to either the H-family or the L-family with different motif structures and physicochemical properties. Our findings strongly suggest that L-caleosins are evolved from H-caleosins. Predicted phosphorylation sites were differentially conserved in H-caleosin and L-caleosins, respectively. 'RY-repeat' elements and phytohormone-related cis-elements were identified in different caleosins, which suggest diverse physiological functions. Gene structure analysis indicated that most caleosins (38 out of 44) contained six exons and five introns and their intron phases were highly conserved. Structurally integrated caleosins, such as BrCLO3-3 and BrCLO4-2, showed high expression levels and may have important roles. Some caleosins, such as BrCLO2 and BoCLO8-2, lost motifs of the calcium binding domain, proline knot, potential phosphorylation sites and haem-binding sites. Combined with their low expression, it is suggested that these caleosins may have lost function. PMID:26786939

  10. A Complex Molecular Interplay of Auxin and Ethylene Signaling Pathways Is Involved in Arabidopsis Growth Promotion by Burkholderia phytofirmans PsJN

    Science.gov (United States)

    Poupin, María J.; Greve, Macarena; Carmona, Vicente; Pinedo, Ignacio

    2016-01-01

    Modulation of phytohormones homeostasis is one of the proposed mechanisms to explain plant growth promotion induced by beneficial rhizobacteria (PGPR). However, there is still limited knowledge about the molecular signals and pathways underlying these beneficial interactions. Even less is known concerning the interplay between phytohormones in plants inoculated with PGPR. Auxin and ethylene are crucial hormones in the control of plant growth and development, and recent studies report an important and complex crosstalk between them in the regulation of different plant developmental processes. The objective of this work was to study the role of both hormones in the growth promotion of Arabidopsis thaliana plants induced by the well-known PGPR Burkholderia phytofirmans PsJN. For this, the spatiotemporal expression patterns of several genes related to auxin biosynthesis, perception and response and ethylene biosynthesis were studied, finding that most of these genes showed specific transcriptional regulations after inoculation in roots and shoots. PsJN-growth promotion was not observed in Arabidopsis mutants with an impaired ethylene (ein2-1) or auxin (axr1–5) signaling. Even, PsJN did not promote growth in an ethylene overproducer (eto2), indicating that a fine regulation of both hormones signaling and homeostasis is necessary to induce growth of the aerial and root tissues. Auxin polar transport is also involved in growth promotion, since PsJN did not promote primary root growth in the pin2 mutant or under chemical inhibition of transport in wild type plants. Finally, a key role for ethylene biosynthesis was found in the PsJN-mediated increase in root hair number. These results not only give new insights of PGPR regulation of plant growth but also are also useful to understand key aspects of Arabidopsis growth control.

  11. A complex molecular interplay of auxin and ethylene signaling pathways is involved in Arabidopsis growth promotion by Burkholderia phytofirmans PsJN

    Directory of Open Access Journals (Sweden)

    María Josefina Poupin

    2016-04-01

    Full Text Available Modulation of phytohormones homeostasis is one of the proposed mechanisms to explain plant growth promotion induced by beneficial rhizobacteria (PGPR. However, there is still limited knowledge about the molecular signals and pathways underlying these beneficial interactions. Even less is known concerning the interplay between phytohormones in plants inoculated with PGPR. Auxin and ethylene are crucial hormones in the control of plant growth and development, and recent studies report an important and complex crosstalk between them in the regulation of different plant developmental processes. The objective of this work was to study the role of both hormones in the growth promotion of Arabidopsis thaliana plants induced by the well-known PGPR Burkholderia phytofirmans PsJN. For this, the spatiotemporal expression patterns of several genes related to auxin biosynthesis, perception and response and ethylene biosynthesis were studied, finding that most of these genes showed specific transcriptional regulations after inoculation in roots and shoots. PsJN-growth promotion was not observed in Arabidopsis mutants with an impaired ethylene (ein2-1 or auxin (axr1-5 signaling. Even, PsJN did not promote growth in an ethylene overproducer (eto2, indicating that a fine regulation of both hormones signaling and homeostasis is necessary to induce growth of the aerial and root tissues. Auxin polar transport is also involved in growth promotion, since PsJN did not promote primary root growth in the pin2 mutant or under chemical inhibition of transport in wild type plants. Finally, a key role for ethylene biosynthesis was found in the PsJN-mediated increase in root hair number. These results not only give new insights of PGPR regulation of plant growth but also are also useful to understand key aspects of Arabidopsis growth control.

  12. A Complex Molecular Interplay of Auxin and Ethylene Signaling Pathways Is Involved in Arabidopsis Growth Promotion by Burkholderia phytofirmans PsJN.

    Science.gov (United States)

    Poupin, María J; Greve, Macarena; Carmona, Vicente; Pinedo, Ignacio

    2016-01-01

    Modulation of phytohormones homeostasis is one of the proposed mechanisms to explain plant growth promotion induced by beneficial rhizobacteria (PGPR). However, there is still limited knowledge about the molecular signals and pathways underlying these beneficial interactions. Even less is known concerning the interplay between phytohormones in plants inoculated with PGPR. Auxin and ethylene are crucial hormones in the control of plant growth and development, and recent studies report an important and complex crosstalk between them in the regulation of different plant developmental processes. The objective of this work was to study the role of both hormones in the growth promotion of Arabidopsis thaliana plants induced by the well-known PGPR Burkholderia phytofirmans PsJN. For this, the spatiotemporal expression patterns of several genes related to auxin biosynthesis, perception and response and ethylene biosynthesis were studied, finding that most of these genes showed specific transcriptional regulations after inoculation in roots and shoots. PsJN-growth promotion was not observed in Arabidopsis mutants with an impaired ethylene (ein2-1) or auxin (axr1-5) signaling. Even, PsJN did not promote growth in an ethylene overproducer (eto2), indicating that a fine regulation of both hormones signaling and homeostasis is necessary to induce growth of the aerial and root tissues. Auxin polar transport is also involved in growth promotion, since PsJN did not promote primary root growth in the pin2 mutant or under chemical inhibition of transport in wild type plants. Finally, a key role for ethylene biosynthesis was found in the PsJN-mediated increase in root hair number. These results not only give new insights of PGPR regulation of plant growth but also are also useful to understand key aspects of Arabidopsis growth control. PMID:27148317

  13. HYPER RECOMBINATION1 of the THO/TREX complex plays a role in controlling transcription of the REVERSION-TO-ETHYLENE SENSITIVITY1 gene in Arabidopsis.

    Directory of Open Access Journals (Sweden)

    Congyao Xu

    2015-02-01

    Full Text Available Arabidopsis REVERSION-TO-ETHYLENE SENSITIVITY1 (RTE1 represses ethylene hormone responses by promoting ethylene receptor ETHYLENE RESPONSE1 (ETR1 signaling, which negatively regulates ethylene responses. To investigate the regulation of RTE1, we performed a genetic screening for mutations that suppress ethylene insensitivity conferred by RTE1 overexpression in Arabidopsis. We isolated HYPER RECOMBINATION1 (HPR1, which is required for RTE1 overexpressor (RTE1ox ethylene insensitivity at the seedling but not adult stage. HPR1 is a component of the THO complex, which, with other proteins, forms the TRanscription EXport (TREX complex. In yeast, Drosophila, and humans, the THO/TREX complex is involved in transcription elongation and nucleocytoplasmic RNA export, but its role in plants is to be fully determined. We investigated how HPR1 is involved in RTE1ox ethylene insensitivity in Arabidopsis. The hpr1-5 mutation may affect nucleocytoplasmic mRNA export, as revealed by in vivo hybridization of fluorescein-labeled oligo(dT45 with unidentified mRNA in the nucleus. The hpr1-5 mutation reduced the total and nuclear RTE1 transcript levels to a similar extent, and RTE1 transcript reduction rate was not affected by hpr1-5 with cordycepin treatment, which prematurely terminates transcription. The defect in the THO-interacting TEX1 protein of TREX but not the mRNA export factor SAC3B also reduced the total and nuclear RTE1 levels. SERINE-ARGININE-RICH (SR proteins are involved mRNA splicing, and we found that SR protein SR33 co-localized with HPR1 in nuclear speckles, which agreed with the association of human TREX with the splicing machinery. We reveal a role for HPR1 in RTE1 expression during transcription elongation and less likely during export. Gene expression involved in ethylene signaling suppression was not reduced by the hpr1-5 mutation, which indicates selectivity of HPR1 for RTE1 expression affecting the consequent ethylene response. Thus

  14. Unravelling the shape and structural assembly of the photosynthetic GAPDH-CP12-PRK complex from Arabidopsis thaliana by small-angle X-ray scattering analysis.

    Science.gov (United States)

    Del Giudice, Alessandra; Pavel, Nicolae Viorel; Galantini, Luciano; Falini, Giuseppe; Trost, Paolo; Fermani, Simona; Sparla, Francesca

    2015-12-01

    Oxygenic photosynthetic organisms produce sugars through the Calvin-Benson cycle, a metabolism that is tightly linked to the light reactions of photosynthesis and is regulated by different mechanisms, including the formation of protein complexes. Two enzymes of the cycle, glyceraldehyde-3-phosphate dehydrogenase (GAPDH) and phosphoribulokinase (PRK), form a supramolecular complex with the regulatory protein CP12 with the formula (GAPDH-CP122-PRK)2, in which both enzyme activities are transiently inhibited during the night. Small-angle X-ray scattering analysis performed on both the GAPDH-CP12-PRK complex and its components, GAPDH-CP12 and PRK, from Arabidopsis thaliana showed that (i) PRK has an elongated, bent and screwed shape, (ii) the oxidized N-terminal region of CP12 that is not embedded in the GAPDH-CP12 complex prefers a compact conformation and (iii) the interaction of PRK with the N-terminal region of CP12 favours the approach of two GAPDH tetramers. The interaction between the GAPDH tetramers may contribute to the overall stabilization of the GAPDH-CP12-PRK complex, the structure of which is presented here for the first time. PMID:26627646

  15. Evolutionary Fates and Dynamic Functionalization of Young Duplicate Genes in Arabidopsis Genomes.

    Science.gov (United States)

    Wang, Jun; Tao, Feng; Marowsky, Nicholas C; Fan, Chuanzhu

    2016-09-01

    Gene duplication is a primary means to generate genomic novelties, playing an essential role in speciation and adaptation. Particularly in plants, a high abundance of duplicate genes has been maintained for significantly long periods of evolutionary time. To address the manner in which young duplicate genes were derived primarily from small-scale gene duplication and preserved in plant genomes and to determine the underlying driving mechanisms, we generated transcriptomes to produce the expression profiles of five tissues in Arabidopsis thaliana and the closely related species Arabidopsis lyrata and Capsella rubella Based on the quantitative analysis metrics, we investigated the evolutionary processes of young duplicate genes in Arabidopsis. We determined that conservation, neofunctionalization, and specialization are three main evolutionary processes for Arabidopsis young duplicate genes. We explicitly demonstrated the dynamic functionalization of duplicate genes along the evolutionary time scale. Upon origination, duplicates tend to maintain their ancestral functions; but as they survive longer, they might be likely to develop distinct and novel functions. The temporal evolutionary processes and functionalization of plant duplicate genes are associated with their ancestral functions, dynamic DNA methylation levels, and histone modification abundances. Furthermore, duplicate genes tend to be initially expressed in pollen and then to gain more interaction partners over time. Altogether, our study provides novel insights into the dynamic retention processes of young duplicate genes in plant genomes. PMID:27485883

  16. The complex between SOS3 and SOS2 regulatory domain from Arabidopsis thaliana: cloning, expression, purification, crystallization and preliminary X-ray analysis

    International Nuclear Information System (INIS)

    Recombinant SOS3 and SOS2 regulatory domain from A. thaliana have been coexpressed in E. coli, purified and crystallized by the hanging-drop vapour-diffusion method. An X-ray data set has been collected at 2.0 Å resolution. The salt-tolerance genes SOS3 (salt overly sensitive 3) and SOS2 (salt overly sensitive 2) regulatory domain of Arabidopsis thaliana were cloned into a polycistronic plasmid and the protein complex was expressed in Escherichia coli, allowing purification to homogeneity in three chromatographic steps. Crystals were grown using vapour-diffusion techniques. The crystals belonged to space group P212121, with unit-cell parameters a = 44.14, b = 57.39, c = 141.90 Å

  17. Nucleotide sequence of psbQ gene for 16-kDa protein of oxygen-evolving complex from Arabidopsis thaliana and regulation of its expression.

    Science.gov (United States)

    Grover, M; Gaur, T; Kochhar, A; Maheshwari, S C; Tyagi, A K

    1999-06-30

    The psbQ gene encoding a 16-kDa polypeptide of the oxygen-evolving complex of photosystem II has been isolated from Arabidopsis thaliana and characterized. The gene consists of a 28 nucleotide long leader sequence, two introns and three exons encoding a 223-amino-acid precursor polypeptide. The first 75 amino acids act as a transit peptide for the translocation of the polypeptide into the thylakoid lumen. Expression studies show that the gene is light-inducible and expresses only in green tissues with high steady-state mRNA levels in leaves. Using this gene as a probe, restriction fragment length polymorphism between two ecotypes, Columbia and Estland, has also been detected. PMID:10470848

  18. Depletion of the "gamma-type carbonic anhydrase-like" subunits of complex I affects central mitochondrial metabolism in Arabidopsis thaliana.

    Science.gov (United States)

    Fromm, Steffanie; Göing, Jennifer; Lorenz, Christin; Peterhänsel, Christoph; Braun, Hans-Peter

    2016-01-01

    "Gamma-type carbonic anhydrase-like" (CAL) proteins form part of complex I in plants. Together with "gamma carbonic anhydrase" (CA) proteins they form an extra domain which is attached to the membrane arm of complex I on its matrix exposed side. In Arabidopsis two CAL and three CA proteins are present, termed CAL1, CAL2, CA1, CA2 and CA3. It has been proposed that the carbonic anhydrase domain of complex I is involved in a process mediating efficient recycling of mitochondrial CO2 for photosynthetic carbon fixation which is especially important during growth conditions causing increased photorespiration. Depletion of CAL proteins has been shown to significantly affect plant development and photomorphogenesis. To better understand CAL function in plants we here investigated effects of CAL depletion on the mitochondrial compartment. In mutant lines and cell cultures complex I amount was reduced by 90-95% but levels of complexes III and V were unchanged. At the same time, some of the CA transcripts were less abundant. Proteome analysis of CAL depleted cells revealed significant reduction of complex I subunits as well as proteins associated with photorespiration, but increased amounts of proteins participating in amino acid catabolism and stress response reactions. Developmental delay of the mutants was slightly alleviated if plants were cultivated at high CO2. Profiling of selected metabolites revealed defined changes in intermediates of the citric acid cycle and amino acid catabolism. It is concluded that CAL proteins are essential for complex I assembly and that CAL depletion specifically affects central mitochondrial metabolism. PMID:26482706

  19. ARS5 is a component of the 26S proteasome complex, and negatively regulates thiol biosynthesis and arsenic tolerance in Arabidopsis.

    Science.gov (United States)

    Sung, Dong-Yul; Kim, Tae-Houn; Komives, Elizabeth A; Mendoza-Cózatl, David G; Schroeder, Julian I

    2009-09-01

    A forward-genetic screen in Arabidopsis led to the isolation of several arsenic tolerance mutants. ars5 was the strongest arsenate- and arsenite-resistant mutant identified in this genetic screen. Here, we report the characterization and cloning of the ars5 mutant gene. ars5 is shown to exhibit an increased accumulation of arsenic and thiol compounds during arsenic stress. Rough mapping together with microarray-based expression mapping identified the ars5 mutation in the alpha subunit F (PAF1) of the 26S proteasome complex. Characterization of an independent paf1 T-DNA insertion allele and complementation by PAF1 confirmed that paf1 mutation is responsible for the enhanced thiol accumulation and arsenic tolerance phenotypes. Arsenic tolerance was not observed in a knock-out mutant of the highly homologous PAF2 gene. However, genetic complementation of ars5 by the overexpression of PAF2 suggests that the PAF2 protein is functionally equivalent to PAF1 when expressed at high levels. No detectible difference was observed in total ubiquitinylated protein profiles between ars5 and wild-type (WT) Arabidopsis, suggesting that the arsenic tolerance observed in ars5 is not derived from a general impairment in proteasome-mediated protein degradation. Quantitative RT-PCR showed that arsenic induces the enhanced transcriptional activation of several key genes that function in glutathione and phytochelatin biosynthesis in the WT, and this arsenic induction of gene expression is more dramatic in ars5. The enhanced transcriptional response to arsenic and the increased accumulation of thiol compounds in ars5, compared with WT, suggest the presence of a positive regulation pathway for thiol biosynthesis that is enhanced in the ars5 background. PMID:19453443

  20. Natural variation in small molecule-induced TIR-NB-LRR signaling induces root growth arrest via EDS1- and PAD4-complexed R protein VICTR in Arabidopsis.

    Science.gov (United States)

    Kim, Tae-Houn; Kunz, Hans-Henning; Bhattacharjee, Saikat; Hauser, Felix; Park, Jiyoung; Engineer, Cawas; Liu, Amy; Ha, Tracy; Parker, Jane E; Gassmann, Walter; Schroeder, Julian I

    2012-12-01

    In a chemical genetics screen we identified the small-molecule [5-(3,4-dichlorophenyl)furan-2-yl]-piperidine-1-ylmethanethione (DFPM) that triggers rapid inhibition of early abscisic acid signal transduction via PHYTOALEXIN DEFICIENT4 (PAD4)- and ENHANCED DISEASE SUSCEPTIBILITY1 (EDS1)-dependent immune signaling mechanisms. However, mechanisms upstream of EDS1 and PAD4 in DFPM-mediated signaling remain unknown. Here, we report that DFPM generates an Arabidopsis thaliana accession-specific root growth arrest in Columbia-0 (Col-0) plants. The genetic locus responsible for this natural variant, VICTR (VARIATION IN COMPOUND TRIGGERED ROOT growth response), encodes a TIR-NB-LRR (for Toll-Interleukin1 Receptor-nucleotide binding-Leucine-rich repeat) protein. Analyses of T-DNA insertion victr alleles showed that VICTR is necessary for DFPM-induced root growth arrest and inhibition of abscisic acid-induced stomatal closing. Transgenic expression of the Col-0 VICTR allele in DFPM-insensitive Arabidopsis accessions recapitulated the DFPM-induced root growth arrest. EDS1 and PAD4, both central regulators of basal resistance and effector-triggered immunity, as well as HSP90 chaperones and their cochaperones RAR1 and SGT1B, are required for the DFPM-induced root growth arrest. Salicylic acid and jasmonic acid signaling pathway components are dispensable. We further demonstrate that VICTR associates with EDS1 and PAD4 in a nuclear protein complex. These findings show a previously unexplored association between a TIR-NB-LRR protein and PAD4 and identify functions of plant immune signaling components in the regulation of root meristematic zone-targeted growth arrest. PMID:23275581

  1. DELLA Proteins Promote Anthocyanin Biosynthesis via Sequestering MYBL2 and JAZ Suppressors of the MYB/bHLH/WD40 Complex in Arabidopsis thaliana.

    Science.gov (United States)

    Xie, Ye; Tan, Huijuan; Ma, Zhaoxue; Huang, Jirong

    2016-05-01

    Anthocyanin accumulation is recognized as a visible biomarker of plants that have suffered from environmental stresses. However, the molecular mechanisms underlying stress-induced anthocyanin biosynthesis remain unclear. Expression of anthocyanin-specific genes is regulated by the conserved MBW complex, which is composed of the MYB, bHLH, and WD40 subunits in higher plants. MBW activity is repressed by MYBL2 and the JAZ family proteins, which bind competitively to bHLH and MYB/bHLH, respectively. Here, we found that MYBL2 and JAZs mediate gibberellic acid-inhibited anthocyanin biosynthesis in Arabidopsis. Competitive pull-down and dual-luciferase assays showed that DELLA proteins directly sequester MYBL2 and JAZ repressors, leading to the release of bHLH/MYB subunits and subsequently to the formation of active MBW complex, which then activates the anthocyanin biosynthetic pathway. The JAZ-DELLA-MYBL2 module also plays an important role in abiotic stress-induced anthocyanin biosynthesis. Furthermore, we found that the DELLA protein RGA accumulates upon plant exposure to abiotic stresses. Altogether, our data reveal that DELLA-promoted anthocyanin biosynthesis is mediated at least in part by MYBL2 and JAZ regulatory proteins, providing new insights into the coordinated regulation of plant growth and defense through metabolic pathway regulation. PMID:26854848

  2. The Arabidopsis mediator complex subunits MED16, MED14, and MED2 regulate mediator and RNA polymerase II recruitment to CBF-responsive cold-regulated genes.

    Science.gov (United States)

    Hemsley, Piers A; Hurst, Charlotte H; Kaliyadasa, Ewon; Lamb, Rebecca; Knight, Marc R; De Cothi, Elizabeth A; Steele, John F; Knight, Heather

    2014-01-01

    The Mediator16 (MED16; formerly termed SENSITIVE TO FREEZING6 [SFR6]) subunit of the plant Mediator transcriptional coactivator complex regulates cold-responsive gene expression in Arabidopsis thaliana, acting downstream of the C-repeat binding factor (CBF) transcription factors to recruit the core Mediator complex to cold-regulated genes. Here, we use loss-of-function mutants to show that RNA polymerase II recruitment to CBF-responsive cold-regulated genes requires MED16, MED2, and MED14 subunits. Transcription of genes known to be regulated via CBFs binding to the C-repeat motif/drought-responsive element promoter motif requires all three Mediator subunits, as does cold acclimation-induced freezing tolerance. In addition, these three subunits are required for low temperature-induced expression of some other, but not all, cold-responsive genes, including genes that are not known targets of CBFs. Genes inducible by darkness also required MED16 but required a different combination of Mediator subunits for their expression than the genes induced by cold. Together, our data illustrate that plants control transcription of specific genes through the action of subsets of Mediator subunits; the specific combination defined by the nature of the stimulus but also by the identity of the gene induced. PMID:24415770

  3. The RPT2 subunit of the 26S proteasome directs complex assembly, histone dynamics, and gametophyte and sporophyte development in Arabidopsis.

    Science.gov (United States)

    Lee, Kwang-Hee; Minami, Atsushi; Marshall, Richard S; Book, Adam J; Farmer, Lisa M; Walker, Joseph M; Vierstra, Richard D

    2011-12-01

    The regulatory particle (RP) of the 26S proteasome contains a heterohexameric ring of AAA-ATPases (RPT1-6) that unfolds and inserts substrates into the core protease (CP) for degradation. Through genetic analysis of the Arabidopsis thaliana gene pair encoding RPT2, we show that this subunit plays a critical role in 26S proteasome assembly, histone dynamics, and plant development. rpt2a rpt2b double null mutants are blocked in both male and female gamete transmission, demonstrating that the subunit is essential. Whereas rpt2b mutants are phenotypically normal, rpt2a mutants display a range of defects, including impaired leaf, root, trichome, and pollen development, delayed flowering, stem fasciation, hypersensitivity to mitomycin C and amino acid analogs, hyposensitivity to the proteasome inhibitor MG132, and decreased 26S complex stability. The rpt2a phenotype can be rescued by both RPT2a and RPT2b, indicative of functional redundancy, but not by RPT2a mutants altered in ATP binding/hydrolysis or missing the C-terminal hydrophobic sequence that docks the RPT ring onto the CP. Many rpt2a phenotypes are shared with mutants lacking the chromatin assembly factor complex CAF1. Like caf1 mutants, plants missing RPT2a or reduced in other RP subunits contain less histones, thus implicating RPT2 specifically, and the 26S proteasome generally, in plant nucleosome assembly. PMID:22158466

  4. PBR1 selectively controls biogenesis of photosynthetic complexes by modulating translation of the large chloroplast gene Ycf1 in Arabidopsis.

    Science.gov (United States)

    Yang, Xiao-Fei; Wang, Yu-Ting; Chen, Si-Ting; Li, Ji-Kai; Shen, Hong-Tao; Guo, Fang-Qing

    2016-01-01

    The biogenesis of photosystem I (PSI), cytochrome b 6 f (Cytb 6 f) and NADH dehydrogenase (NDH) complexes relies on the spatially and temporally coordinated expression and translation of both nuclear and chloroplast genes. Here we report the identification of photosystem biogenesis regulator 1 (PBR1), a nuclear-encoded chloroplast RNA-binding protein that regulates the concerted biogenesis of NDH, PSI and Cytb 6 f complexes. We identified Ycf1, one of the two largest chloroplast genome-encoded open reading frames as the direct downstream target protein of PBR1. Biochemical and molecular analyses reveal that PBR1 regulates Ycf1 translation by directly binding to its mRNA. Surprisingly, we further demonstrate that relocation of the chloroplast gene Ycf1 fused with a plastid-transit sequence to the nucleus bypasses the requirement of PBR1 for Ycf1 translation, which sufficiently complements the defects in biogenesis of NDH, PSI and Cytb 6 f complexes in PBR1-deficient plants. Remarkably, the nuclear-encoded PBR1 tightly controls the expression of the chloroplast gene Ycf1 at the translational level, which is sufficient to sustain the coordinated biogenesis of NDH, PSI and Cytb 6 f complexes as a whole. Our findings provide deep insights into better understanding of how a predominant nuclear-encoded factor can act as a migratory mediator and undergoes selective translational regulation of the target plastid gene in controlling biogenesis of photosynthetic complexes. PMID:27462450

  5. Unique nucleotide polymorphism of ankyrin gene cluster in Arabidopsis

    Indian Academy of Sciences (India)

    Jianchang Du; Xingna Wang; Mingsheng Zhang; Dacheng Tian; Yong-Hua Yang

    2007-01-01

    The ankyrin (ANK) gene cluster is a part of a multigene family encoding ANK transmembrane proteins in Arabidopsis thaliana, and plays an important role in protein–protein interactions and in signal pathways. In contrast to other regions of a genome, the ANK gene cluster exhibits an extremely high level of DNA polymorphism in an ∼5-kb region, without apparent decay. Phylogenetic analysis detects two clear, deeply differentiated haplotypes (dimorphism). The divergence between haplotypes of accession Col-0 and Ler-0 (Hap-C and Hap-L) is estimated to be 10.7%, approximately equal to the 10.5% average divergence between A. thaliana and A. lyrata. Sequence comparisons for the ANK gene cluster homologues in Col-0 indicate that the members evolve independently, and that the similarity among paralogues is lower than between alleles. Very little intralocus recombination or gene conversion is detected in ANK regions. All these characteristics of the ANK gene cluster are consistent with a tandem gene duplication and birth-and-death process. The possible mechanisms for and implications of this elevated nucleotide variation are also discussed, including the suggestion of balancing selection.

  6. Evolutionary origins of Brassicaceae specific genes in Arabidopsis thaliana

    Directory of Open Access Journals (Sweden)

    Keshavaiah Channa

    2011-02-01

    Full Text Available Abstract Background All sequenced genomes contain a proportion of lineage-specific genes, which exhibit no sequence similarity to any genes outside the lineage. Despite their prevalence, the origins and functions of most lineage-specific genes remain largely unknown. As more genomes are sequenced opportunities for understanding evolutionary origins and functions of lineage-specific genes are increasing. Results This study provides a comprehensive analysis of the origins of lineage-specific genes (LSGs in Arabidopsis thaliana that are restricted to the Brassicaceae family. In this study, lineage-specific genes within the nuclear (1761 genes and mitochondrial (28 genes genomes are identified. The evolutionary origins of two thirds of the lineage-specific genes within the Arabidopsis thaliana genome are also identified. Almost a quarter of lineage-specific genes originate from non-lineage-specific paralogs, while the origins of ~10% of lineage-specific genes are partly derived from DNA exapted from transposable elements (twice the proportion observed for non-lineage-specific genes. Lineage-specific genes are also enriched in genes that have overlapping CDS, which is consistent with such novel genes arising from overprinting. Over half of the subset of the 958 lineage-specific genes found only in Arabidopsis thaliana have alignments to intergenic regions in Arabidopsis lyrata, consistent with either de novo origination or differential gene loss and retention, with both evolutionary scenarios explaining the lineage-specific status of these genes. A smaller number of lineage-specific genes with an incomplete open reading frame across different Arabidopsis thaliana accessions are further identified as accession-specific genes, most likely of recent origin in Arabidopsis thaliana. Putative de novo origination for two of the Arabidopsis thaliana-only genes is identified via additional sequencing across accessions of Arabidopsis thaliana and closely

  7. Arabidopsis CDS blastp result: AK065851 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK065851 J013041L15 At1g79010.1 NADH-ubiquinone oxidoreductase 23 kDa subunit, mitochondrial (TY ... ursor (EC 1.6.5.3) (EC 1.6.99.3) (Complex I-23KD) (CI -23KD) (Complex I- 28.5KD) (CI -28.5KD) {Arabidopsis ...

  8. Arabidopsis CDS blastp result: AK119532 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK119532 001-203-F01 At1g79010.1 NADH-ubiquinone oxidoreductase 23 kDa subunit, mitochondrial (T ... ursor (EC 1.6.5.3) (EC 1.6.99.3) (Complex I-23KD) (CI -23KD) (Complex I- 28.5KD) (CI -28.5KD) {Arabidopsis ...

  9. A Specialized Histone H1 Variant Is Required for Adaptive Responses to Complex Abiotic Stress and Related DNA Methylation in Arabidopsis.

    Science.gov (United States)

    Rutowicz, Kinga; Puzio, Marcin; Halibart-Puzio, Joanna; Lirski, Maciej; Kotliński, Maciej; Kroteń, Magdalena A; Knizewski, Lukasz; Lange, Bartosz; Muszewska, Anna; Śniegowska-Świerk, Katarzyna; Kościelniak, Janusz; Iwanicka-Nowicka, Roksana; Buza, Krisztián; Janowiak, Franciszek; Żmuda, Katarzyna; Jõesaar, Indrek; Laskowska-Kaszub, Katarzyna; Fogtman, Anna; Kollist, Hannes; Zielenkiewicz, Piotr; Tiuryn, Jerzy; Siedlecki, Paweł; Swiezewski, Szymon; Ginalski, Krzysztof; Koblowska, Marta; Archacki, Rafał; Wilczynski, Bartek; Rapacz, Marcin; Jerzmanowski, Andrzej

    2015-11-01

    Linker (H1) histones play critical roles in chromatin compaction in higher eukaryotes. They are also the most variable of the histones, with numerous nonallelic variants cooccurring in the same cell. Plants contain a distinct subclass of minor H1 variants that are induced by drought and abscisic acid and have been implicated in mediating adaptive responses to stress. However, how these variants facilitate adaptation remains poorly understood. Here, we show that the single Arabidopsis (Arabidopsis thaliana) stress-inducible variant H1.3 occurs in plants in two separate and most likely autonomous pools: a constitutive guard cell-specific pool and a facultative environmentally controlled pool localized in other tissues. Physiological and transcriptomic analyses of h1.3 null mutants demonstrate that H1.3 is required for both proper stomatal functioning under normal growth conditions and adaptive developmental responses to combined light and water deficiency. Using fluorescence recovery after photobleaching analysis, we show that H1.3 has superfast chromatin dynamics, and in contrast to the main Arabidopsis H1 variants H1.1 and H1.2, it has no stable bound fraction. The results of global occupancy studies demonstrate that, while H1.3 has the same overall binding properties as the main H1 variants, including predominant heterochromatin localization, it differs from them in its preferences for chromatin regions with epigenetic signatures of active and repressed transcription. We also show that H1.3 is required for a substantial part of DNA methylation associated with environmental stress, suggesting that the likely mechanism underlying H1.3 function may be the facilitation of chromatin accessibility by direct competition with the main H1 variants. PMID:26351307

  10. A Specialized Histone H1 Variant Is Required for Adaptive Responses to Complex Abiotic Stress and Related DNA Methylation in Arabidopsis1[OPEN

    Science.gov (United States)

    Rutowicz, Kinga; Puzio, Marcin; Halibart-Puzio, Joanna; Lirski, Maciej; Kotliński, Maciej; Kroteń, Magdalena A.; Knizewski, Lukasz; Lange, Bartosz; Muszewska, Anna; Śniegowska-Świerk, Katarzyna; Kościelniak, Janusz; Iwanicka-Nowicka, Roksana; Buza, Krisztián; Janowiak, Franciszek; Żmuda, Katarzyna; Jõesaar, Indrek; Laskowska-Kaszub, Katarzyna; Fogtman, Anna; Kollist, Hannes; Zielenkiewicz, Piotr; Tiuryn, Jerzy; Siedlecki, Paweł; Swiezewski, Szymon; Ginalski, Krzysztof; Koblowska, Marta; Archacki, Rafał; Wilczynski, Bartek; Rapacz, Marcin; Jerzmanowski, Andrzej

    2015-01-01

    Linker (H1) histones play critical roles in chromatin compaction in higher eukaryotes. They are also the most variable of the histones, with numerous nonallelic variants cooccurring in the same cell. Plants contain a distinct subclass of minor H1 variants that are induced by drought and abscisic acid and have been implicated in mediating adaptive responses to stress. However, how these variants facilitate adaptation remains poorly understood. Here, we show that the single Arabidopsis (Arabidopsis thaliana) stress-inducible variant H1.3 occurs in plants in two separate and most likely autonomous pools: a constitutive guard cell-specific pool and a facultative environmentally controlled pool localized in other tissues. Physiological and transcriptomic analyses of h1.3 null mutants demonstrate that H1.3 is required for both proper stomatal functioning under normal growth conditions and adaptive developmental responses to combined light and water deficiency. Using fluorescence recovery after photobleaching analysis, we show that H1.3 has superfast chromatin dynamics, and in contrast to the main Arabidopsis H1 variants H1.1 and H1.2, it has no stable bound fraction. The results of global occupancy studies demonstrate that, while H1.3 has the same overall binding properties as the main H1 variants, including predominant heterochromatin localization, it differs from them in its preferences for chromatin regions with epigenetic signatures of active and repressed transcription. We also show that H1.3 is required for a substantial part of DNA methylation associated with environmental stress, suggesting that the likely mechanism underlying H1.3 function may be the facilitation of chromatin accessibility by direct competition with the main H1 variants. PMID:26351307

  11. 温度、盐度、pH和饵料密度对皱肋文蛤清滤率的影响%Effects of temperature, salinity, pH, and microalgae density on clearance rates of Meretrix lyrata

    Institute of Scientific and Technical Information of China (English)

    栗志民; 刘志刚; 徐法军; 李明昊

    2011-01-01

    The farming of the clam Meretrix lyrata has been successfully developed since 1987 and brought high economic and social benefits to the coastal communities. As a highly valued fishery resource especially in Vietnam, recently M. Lyrata has become another new aqua-culture species with a potential for large-scale farming in the South China Sea and a good market prospects. In this study, by adopting the ecology experimental methods, the effects of seawater temperatures, salinities, pH, and microalgae densities on the clearance rates of M. Lyrata were investigated, which are expected to provide insight on culturing capacity, feeding behavior and energy of M. Lyrata and references for healthy culturing and extension of M. Lyrata. The results showed that the clearance rates of M. Lyrata (P<0. 01) at three sizes were significantly affected by varied temperature (13~33℃), salinity (13~33), pH (7~9), and diet density (2. 5×104~10×104 cell/ml). The maximum clearance rates of the large, medium, and small sized M. Lyrata were 1. 06, 1. 78 and 2. 42 L/g ? H at 28℃ respectively, 0. 35, 0. 65 and 1. 05 L/g ? H at salinity 23, 1. 26, 1. 67 and 2. 02 L/g ? H at pH 8,1. 29, 2. 07 and 2. 29 L/g ? H at microalgae density of 10 × 104 cell/ml. These results indicate that the optimum feeding environ mental conditions were: temperature 28℃, salinity 23, pH 8 and microalgae density 10 × 104 cell/ml. These results indicate that the sensitivity of the large, medium and small sized M. Lyrata to temperature, salinity, pH or microalgae density appeared in the following order: large size<[medium size

  12. Modulation of biosynthesis of photosynthetic pigments and light-harvesting complex in wild-type and gun5 mutant of Arabidopsis thaliana during impaired chloroplast development.

    Science.gov (United States)

    Pattanayak, Gopal K; Tripathy, Baishnab C

    2016-05-01

    Plants in response to different environmental cues need to modulate the expression of nuclear and chloroplast genomes that are in constant communication. To understand the signals that are responsible for inter-organellar communication, levulinic acid (LA), an inhibitor of 5-aminolevulinic acid dehydratase, was used to suppress the synthesis of pyrrole-derived tetrapyrroles chlorophylls. Although, it does not specifically inhibit carotenoid biosynthesis enzymes, LA reduced the carotenoid contents during photomorphogenesis of etiolated Arabidopsis seedlings. The expression of nuclear genes involved in carotenoid biosynthesis, i.e., geranylgeranyl diphosphate synthase, phytoene synthase, and phytoene desaturase, was downregulated in LA-treated seedlings. Similarly, the transcript abundance of nuclear genes, i.e., Lhcb1, PsbO, and RcbS, coding for chloroplastic proteins was severely attenuated in LA-treated samples. In contrast, LA treatment did not affect the transcript abundance of chalcone synthase, a marker gene for cytoplasm, and β-ATP synthase, a marker gene for mitochondria. This demonstrates the retrograde signaling from chloroplast to nucleus to suppress chloroplastic proteins during impaired chloroplast development. However, under identical conditions in LA-treated tetrapyrrole-deficient gun5 mutant, retrograde signal continued. The tetrapyrrole biosynthesis inhibitor LA suppressed formation of all tetrapyrroles both in WT and gun5. This rules out the role of tetrapyrroles as signaling molecules in WT and gun5. The removal of LA from the Arabidopsis seedlings restored the chlorophyll and carotenoid contents and expression of nuclear genes coding for chloroplastic proteins involved in chloroplast biogenesis. Therefore, LA could be used to modulate chloroplast biogenesis at a desired phase of chloroplast development. PMID:27001427

  13. Protease gene families in Populus and Arabidopsis

    Directory of Open Access Journals (Sweden)

    Jansson Stefan

    2006-12-01

    Full Text Available Abstract Background Proteases play key roles in plants, maintaining strict protein quality control and degrading specific sets of proteins in response to diverse environmental and developmental stimuli. Similarities and differences between the proteases expressed in different species may give valuable insights into their physiological roles and evolution. Results We have performed a comparative analysis of protease genes in the two sequenced dicot genomes, Arabidopsis thaliana and Populus trichocarpa by using genes coding for proteases in the MEROPS database 1 for Arabidopsis to identify homologous sequences in Populus. A multigene-based phylogenetic analysis was performed. Most protease families were found to be larger in Populus than in Arabidopsis, reflecting recent genome duplication. Detailed studies on e.g. the DegP, Clp, FtsH, Lon, rhomboid and papain-Like protease families showed the pattern of gene family expansion and gene loss was complex. We finally show that different Populus tissues express unique suites of protease genes and that the mRNA levels of different classes of proteases change along a developmental gradient. Conclusion Recent gene family expansion and contractions have made the Arabidopsis and Populus complements of proteases different and this, together with expression patterns, gives indications about the roles of the individual gene products or groups of proteases.

  14. Divergent evolutionary and expression patterns between lineage specific new duplicate genes and their parental paralogs in Arabidopsis thaliana.

    Directory of Open Access Journals (Sweden)

    Jun Wang

    Full Text Available Gene duplication is an important mechanism for the origination of functional novelties in organisms. We performed a comparative genome analysis to systematically estimate recent lineage specific gene duplication events in Arabidopsis thaliana and further investigate whether and how these new duplicate genes (NDGs play a functional role in the evolution and adaption of A. thaliana. We accomplished this using syntenic relationship among four closely related species, A. thaliana, A. lyrata, Capsella rubella and Brassica rapa. We identified 100 NDGs, showing clear origination patterns, whose parental genes are located in syntenic regions and/or have clear orthologs in at least one of three outgroup species. All 100 NDGs were transcribed and under functional constraints, while 24% of the NDGs have differential expression patterns compared to their parental genes. We explored the underlying evolutionary forces of these paralogous pairs through conducting neutrality tests with sequence divergence and polymorphism data. Evolution of about 15% of NDGs appeared to be driven by natural selection. Moreover, we found that 3 NDGs not only altered their expression patterns when compared with parental genes, but also evolved under positive selection. We investigated the underlying mechanisms driving the differential expression of NDGs and their parents, and found a number of NDGs had different cis-elements and methylation patterns from their parental genes. Overall, we demonstrated that NDGs acquired divergent cis-elements and methylation patterns and may experience sub-functionalization or neo-functionalization influencing the evolution and adaption of A. thaliana.

  15. The Arabidopsis glutamyl-tRNA reductase (GluTR) forms a ternary complex with FLU and GluTR-binding protein.

    Science.gov (United States)

    Fang, Ying; Zhao, Shun; Zhang, Feilong; Zhao, Aiguo; Zhang, Wenxia; Zhang, Min; Liu, Lin

    2016-01-01

    Tetrapyrrole biosynthesis is an essential and tightly regulated process, and glutamyl-tRNA reductase (GluTR) is a key target for multiple regulatory factors at the post-translational level. By binding to the thylakoid membrane protein FLUORESCENT (FLU) or the soluble stromal GluTR-binding protein (GBP), the activity of GluTR is down- or up-regulated. Here, we reconstructed a ternary complex composed of the C-terminal tetratricopepetide-repeat domain of FLU, GBP, and GluTR, crystallized and solved the structure of the complex at 3.2 Å. The overall structure resembles the shape of merged two binary complexes as previously reported, and shows a large conformational change within GluTR. We also demonstrated that GluTR binds tightly with GBP but does not bind to GSAM under the same condition. These findings allow us to suggest a biological role of the ternary complex for the regulation of plant GluTR. PMID:26794057

  16. A Novel Nucleus-encoded Chloroplast Protein, PIFI, Is Involved in NAD(P)H Dehydrogenase Complex Mediated Chlororespiratory and Possibly Cyclic Electron Transport in Arabidopsis

    Science.gov (United States)

    A transient rise in chlorophyll fluorescence after a light-to-dark transition reflects non-photochemical reduction of the plastoquinone pool. This process is dependent on the activity of the chloroplast NAD(P)H-dehydrogease complex (NDH) which mediates electron flow from stromal reductants to the pl...

  17. Arabidopsis DELLA and JAZ proteins bind the WD-repeat/bHLH/MYB complex to modulate gibberellin and jasmonate signaling synergy.

    Science.gov (United States)

    Qi, Tiancong; Huang, Huang; Wu, Dewei; Yan, Jianbin; Qi, Yijun; Song, Susheng; Xie, Daoxin

    2014-03-01

    Integration of diverse environmental and endogenous signals to coordinately regulate growth, development, and defense is essential for plants to survive in their natural habitat. The hormonal signals gibberellin (GA) and jasmonate (JA) antagonistically and synergistically regulate diverse aspects of plant growth, development, and defense. GA and JA synergistically induce initiation of trichomes, which assist seed dispersal and act as barriers to protect plants against insect attack, pathogen infection, excessive water loss, and UV irradiation. However, the molecular mechanism underlying such synergism between GA and JA signaling remains unclear. In this study, we revealed a mechanism for GA and JA signaling synergy and identified a signaling complex of the GA pathway in regulation of trichome initiation. Molecular, biochemical, and genetic evidence showed that the WD-repeat/bHLH/MYB complex acts as a direct target of DELLAs in the GA pathway and that both DELLAs and JAZs interacted with the WD-repeat/bHLH/MYB complex to mediate synergism between GA and JA signaling in regulating trichome development. GA and JA induce degradation of DELLAs and JASMONATE ZIM-domain proteins to coordinately activate the WD-repeat/bHLH/MYB complex and synergistically and mutually dependently induce trichome initiation. This study provides deep insights into the molecular mechanisms for integration of different hormonal signals to synergistically regulate plant development. PMID:24659329

  18. TaABC1, a member of the activity of bc 1 complex protein kinase family from common wheat, confers enhanced tolerance to abiotic stresses in Arabidopsis

    OpenAIRE

    Wang, Caixiang; Jing, Ruilian; Mao, Xinguo; Chang, Xiaoping; Li, Ang

    2010-01-01

    Abiotic stresses such as drought, salinity, and low temperature have drastic effects on plant growth and development. However, the molecular mechanisms regulating biochemical and physiological changes in response to stresses are not well understood. Protein kinases are major signal transduction factors among the reported molecular mechanisms mediating acclimation to environmental changes. Protein kinase ABC1 (activity of bc 1 complex) is involved in regulating coenzyme Q biosynthesis in mitoc...

  19. The role of the GA signaling SLY1 in Arabidopsis seed germination

    Science.gov (United States)

    Seed dormancy, afterripening, and germination are complex developmental process regulated by phytohormones. The phytohormone abscisic acid (ABA) is needed to set up seed dormancy during embryo maturation whereas gibberellin (GA) stimulates seed germination. In tomato and Arabidopsis, GA is clearly ...

  20. Arabidopsis in Wageningen

    OpenAIRE

    Koornneef, M

    2013-01-01

    Arabidopsis thaliana is the plant species that in the past 25 years has developed into the major model species in plant biology research. This was due to its properties such as short generation time, its small genome and its easiness to be transformed. Wageningen University has played an important role in the development of this model, based on interdisciplinary collaborations using genetics as a major tool to investigate aspects of physiology, development, plant-microbe interactions and evol...

  1. Complexity

    CERN Document Server

    Gershenson, Carlos

    2011-01-01

    The term complexity derives etymologically from the Latin plexus, which means interwoven. Intuitively, this implies that something complex is composed by elements that are difficult to separate. This difficulty arises from the relevant interactions that take place between components. This lack of separability is at odds with the classical scientific method - which has been used since the times of Galileo, Newton, Descartes, and Laplace - and has also influenced philosophy and engineering. In recent decades, the scientific study of complexity and complex systems has proposed a paradigm shift in science and philosophy, proposing novel methods that take into account relevant interactions.

  2. Identification and Evolution of Functional Alleles of the Previously Described Pollen Specific Myrosinase Pseudogene AtTGG6 in Arabidopsis thaliana

    Directory of Open Access Journals (Sweden)

    Lili Fu

    2016-02-01

    Full Text Available Myrosinases are β-thioglucoside glucohydrolases and serve as defense mechanisms against insect pests and pathogens by producing toxic compounds. AtTGG6 in Arabidopsis thaliana was previously reported to be a myrosinase pseudogene but specifically expressed in pollen. However, we found that AlTGG6, an ortholog to AtTGG6 in A. lyrata (an outcrossing relative of A. thaliana was functional, suggesting that functional AtTGG6 alleles may still exist in A. thaliana. AtTGG6 alleles in 29 A. thaliana ecotypes were cloned and sequenced. Results indicate that ten alleles were functional and encoded Myr II type myrosinase of 512 amino acids, and myrosinase activity was confirmed by overexpressing AtTGG6 in Pichia pastoris. However, the 19 other ecotypes had disabled alleles with highly polymorphic frame-shift mutations and diversified sequences. Thirteen frame-shift mutation types were identified, which occurred independently many times in the evolutionary history within a few thousand years. The functional allele was expressed specifically in pollen similar to the disabled alleles but at a higher expression level, suggesting its role in defense of pollen against insect pests such as pollen beetles. However, the defense function may have become less critical after A. thaliana evolved to self-fertilization, and thus resulted in loss of function in most ecotypes.

  3. An Arabidopsis callose synthase

    DEFF Research Database (Denmark)

    Ostergaard, Lars; Petersen, Morten; Mattsson, Ole;

    2002-01-01

    unclear whether callose synthases can also produce cellulose and whether plant cellulose synthases may also produce beta-1,3-glucans. We describe here an Arabidopsis gene, AtGsl5, encoding a plasma membrane-localized protein homologous to yeast beta-1,3-glucan synthase whose expression partially......Beta-1,3-glucan polymers are major structural components of fungal cell walls, while cellulosic beta-1,4-glucan is the predominant polysaccharide in plant cell walls. Plant beta-1,3-glucan, called callose, is produced in pollen and in response to pathogen attack and wounding, but it has been...

  4. Microsynteny and phylogenetic analysis of tandemly organised miRNA families across five members of Brassicaceae reveals complex retention and loss history.

    Science.gov (United States)

    Rathore, Priyanka; Geeta, R; Das, Sandip

    2016-06-01

    Plant genomes are characterized by the presence of large miRNA gene families which are few in number. The expansion of miRNA families is thought to be driven by gene and genome duplication. Some members of these miRNA gene families are tandemly arranged and their analysis is of interest because such organisation may indicate origin through tandem duplication and also to investigate whether some such tandem clusters have similar expression patterns, and whether these are regulated through a common set of cis-regulatory elements (eg. promoters and enhancers). As a first step, we undertake a comprehensive study using micro-synteny analyses of tandemly organised miRNA families across the Brassicaceae spanning an evolutionary time scale of ca. 45 million years, among Arabidopsis, Capsella, Brassica and Thellungiella species, to address the following questions: Are most miRNA gene families present as tandem clusters? To what extent are these tandem patterns retained? To what extent can family sizes be ascribed to genome duplication? Our analysis of thirteen tandemly organised miRNA families revealed that synteny is largely conserved among Arabidopsis thaliana, A. lyrata and Capsella rubella, which form a clade spanning approximately between 6.2-9.8 my (Acarkan et al., 2000) [1]. On the other hand, comparison of sequences from these species with Brassica rapa, B. oleracea and Thellungiella halophila, which form a separate clade spanning 31 my (Franzke et al., 2011)[2] reveals many differences. The latter clade reveals several paralogous duplications that probably resulted from whole genome duplication, as well as disrupted synteny. Phylogenetic analyses of precursor sequences generally support the history inferred from synteny analysis. Synteny and phylogenetic analysis of six members of the tandemly organised miR169 family suggest that the Brassicaceae ancestral state consisted of a "dimer as a unit" which may have undergone direct local duplication to retain the

  5. Photorepair mutants of Arabidopsis

    International Nuclear Information System (INIS)

    UV radiation induces two major DNA damage products, the cyclobutane pyrimidine dimer (CPD) and, at a lower frequency, the pyrimidine (6-4) pyrimidinone dimer (6-4 product). Although Escherichia coli and Saccharomyces cerevisiae produce a CPD-specific photolyase that eliminates only this class of dimer, Arabidopsis thaliana, Drosophila melanogaster, Crotalus atrox, and Xenopus laevis have recently been shown to photoreactivate both CPDs and 6-4 products. We describe the isolation and characterization of two new classes of mutants of Arabidopsis, termed uvr2 and uvr3, that are defective in the photoreactivation of CPDs and 6-4 products, respectively. We demonstrate that the CPD photolyase mutation is genetically linked to a DNA sequence encoding a type II (metazoan) CPD photolyase. In addition, we are able to generate plants in which only CPDs or 6-4 products are photoreactivated in the nuclear genome by exposing these mutants to UV light and then allowing them to repair one or the other class of dimers. This provides us with a unique opportunity to study the biological consequences of each of these two major UV-induced photoproducts in an intact living system

  6. Transgenic Arabidopsis Gene Expression System

    Science.gov (United States)

    Ferl, Robert; Paul, Anna-Lisa

    2009-01-01

    The Transgenic Arabidopsis Gene Expression System (TAGES) investigation is one in a pair of investigations that use the Advanced Biological Research System (ABRS) facility. TAGES uses Arabidopsis thaliana, thale cress, with sensor promoter-reporter gene constructs that render the plants as biomonitors (an organism used to determine the quality of the surrounding environment) of their environment using real-time nondestructive Green Fluorescent Protein (GFP) imagery and traditional postflight analyses.

  7. Mitogen-activated protein kinase phosphatase is required for genotoxic stress relief in Arabidopsis

    OpenAIRE

    Ulm, Roman; Revenkova, Ekaterina; Di Sansebastiano, Gian-Pietro; Bechtold, Nicole; Paszkowski, Jerzy

    2001-01-01

    Genotoxic stress activates complex cellular responses allowing for the repair of DNA damage and proper cell recovery. Although plants are exposed constantly to increasing solar UV irradiation, the signaling cascades activated by genotoxic environments are largely unknown. We have identified an Arabidopsis mutant (mkp1) hypersensitive to genotoxic stress treatments (UV-C and methyl methanesulphonate) due to disruption of a gene that encodes an Arabidopsis homolog of mitogen-activated protein k...

  8. Protein Interaction Network of Arabidopsis thaliana Female Gametophyte Development Identifies Novel Proteins and Relations

    OpenAIRE

    Hosseinpour, Batool; HajiHoseini, Vahid; Kashfi, Rafieh; Ebrahimie, Esmaeil; Hemmatzadeh, Farhid

    2012-01-01

    Although the female gametophyte in angiosperms consists of just seven cells, it has a complex biological network. In this study, female gametophyte microarray data from Arabidopsis thaliana were integrated into the Arabidopsis interactome database to generate a putative interaction map of the female gametophyte development including proteome map based on biological processes and molecular functions of proteins. Biological and functional groups as well as topological characteristics of the net...

  9. Intraspecific variability of cadmium tolerance and accumulation, and cadmium-induced cell wall modifications in the metal hyperaccumulator Arabidopsis halleri.

    Science.gov (United States)

    Meyer, Claire-Lise; Juraniec, Michal; Huguet, Stéphanie; Chaves-Rodriguez, Elena; Salis, Pietro; Isaure, Marie-Pierre; Goormaghtigh, Erik; Verbruggen, Nathalie

    2015-06-01

    Certain molecular mechanisms of Cd tolerance and accumulation have been identified in the model species Arabidopsis halleri, while intraspecific variability of these traits and the mechanisms of shoot detoxification were little addressed. The Cd tolerance and accumulation of metallicolous and non-metallicolous A. halleri populations from different genetic units were tested in controlled conditions. In addition, changes in shoot cell wall composition were investigated using Fourier transform infrared spectroscopy. Indeed, recent works on A. halleri suggest Cd sequestration both inside cells and in the cell wall/apoplast. All A. halleri populations tested were hypertolerant to Cd, and the metallicolous populations were on average the most tolerant. Accumulation was highly variable between and within populations, and populations that were non-accumulators of Cd were identified. The effect of Cd on the cell wall composition was quite similar in the sensitive species A. lyrata and in A. halleri individuals; the pectin/polysaccharide content of cell walls seems to increase after Cd treatment. Nevertheless, the changes induced by Cd were more pronounced in the less tolerant individuals, leading to a correlation between the level of tolerance and the extent of modifications. This work demonstrated that Cd tolerance and accumulation are highly variable traits in A. halleri, suggesting adaptation at the local scale and involvement of various molecular mechanisms. While in non-metallicolous populations drastic modifications of the cell wall occur due to higher Cd toxicity and/or Cd immobilization in this compartment, the increased tolerance of metallicolous populations probably involves other mechanisms such as vacuolar sequestration. PMID:25873677

  10. Does Arabidopsis thaliana DREAM of cell cycle control?

    Science.gov (United States)

    Fischer, Martin; DeCaprio, James A

    2015-08-01

    Strict temporal control of cell cycle gene expression is essential for all eukaryotes including animals and plants. DREAM complexes have been identified in worm, fly, and mammals, linking several distinct transcription factors to coordinate gene expression throughout the cell cycle. In this issue of The EMBO Journal, Kobayashi et al (2015) identify distinct activator and repressor complexes for genes expressed during the G2 and M phases in Arabidopsis that can be temporarily separated during proliferating and post‐mitotic stages of development. The complexes incorporate specific activator and repressor MYB and E2F transcription factors and indicate the possibility of the existence of multiple DREAM complexes in plants. PMID:26089020

  11. Oxylipin Pathway in Rice and Arabidopsis

    Institute of Scientific and Technical Information of China (English)

    E. Wassim Chehab; John V. Perea; Banu Gopalan; Steve Theg; Katayoon Dehesh

    2007-01-01

    Plants have evolved complex signaling pathways to coordinate responses to developmental and environmental information. The oxylipin pathway is one pivotal lipid-based signaling network, composed of several competing branch pathways, that determines the plant's ability to adapt to various stimuli. Activation of the oxylipin pathway induces the de novo synthesis of biologically active metabolltes called "oxylipins". The relative levels of these metabolltes are a distinct indicator of each plant species and determine the ability of plants to adapt to different stimuli. The two major branches of the oxylipln pathway, allene oxide synthase (AOS) and hydroperoxide lyase (HPL) are responsible for production of the signaling compounds,jasmonates and aldehydes respectively. Here, we compare and contrast the regulation of AOS and HPL branch pathways in rice and Arabidopsis as model monocotyledonous and dicotyledonous systems. These analyses provide new Insights into the evolution of JAs and aldehydes signaling pathways, and the complex network of processes responsible for stress adaptations in monocots and dicots.

  12. Seed germination of GA-insensitive sleepy1 mutants does not require RGL2 protein disappearance in Arabidopsis

    Science.gov (United States)

    Seed germination is a complex developmental process regulated by phytohormones. The phytohormone abscisic acid (ABA) inhibits seed germination, whereas gibberellin (GA) stimulates seed germination. In tomato and Arabidopsis, GA is clearly required for seed germination. Recent evidence suggests tha...

  13. THE ROLE OF THE SLEEPY1 (SLY1) F-BOX GENE IN GA REGULATION OF SEED GERMINATION IN ARABIDOPSIS

    Science.gov (United States)

    17th International Conference on Arabidopsis Research, June 28-July 2, 2006, Madison, WI. Abstract #378. Seed germination is a complex developmental process regulated by phytohormones. The phytohormone abscisic acid (ABA) inhibits seed germination, whereas gibberellin (GA) stimulates seed germinat...

  14. Multidimensional fluorescence microscopy of multiple organelles in Arabidopsis seedlings

    Directory of Open Access Journals (Sweden)

    Morales Andrea

    2008-05-01

    Full Text Available Abstract Background The isolation of green fluorescent protein (GFP and the development of spectral variants over the past decade have begun to reveal the dynamic nature of protein trafficking and organelle motility. In planta analyses of this dynamic process have typically been limited to only two organelles or proteins at a time in only a few cell types. Results We generated a transgenic Arabidopsis plant that contains four spectrally different fluorescent proteins. Nuclei, plastids, mitochondria and plasma membranes were genetically tagged with cyan, red, yellow and green fluorescent proteins, respectively. In addition, methods to track nuclei, mitochondria and chloroplasts and quantify the interaction between these organelles at a submicron resolution were developed. These analyzes revealed that N-ethylmaleimide disrupts nuclear-mitochondrial but not nuclear-plastids interactions in root epidermal cells of live Arabidopsis seedlings. Conclusion We developed a tool and associated methods for analyzing the complex dynamic of organelle-organelle interactions in real time in planta. Homozygous transgenic Arabidopsis (Kaleidocell is available through Arabidopsis Biological Resource Center.

  15. The Metabolic Response of Arabidopsis Roots to Oxidative Stress is Distinct from that of Heterotrophic Cells in Culture and Highlights a Complex Relationship between the Levels of Transcripts,Metabolites,and Flux

    Institute of Scientific and Technical Information of China (English)

    Martin Lehmann; Markus Schwarzl(a)inder; Toshihiro Obata; Supaart Sirikantaramas; Meike Burow; Carl Erik Olsen; Takayuki Tohge; Mark D.Fricker; Birger Lindberg Mφller; Alisdair R.Fernie; Lee J.Sweetloveb; Miriam Laxa

    2009-01-01

    Metabolic adjustments are a significant,but poorly understood,part of the response of plants to oxidative stress.In a previous study (Baxter et al.,2007),the metabolic response of Arabidopsis cells in culture to induction of ox-idative stress by menadione was characterized.An emergency survival strategy was uncovered in which anabolic primary metabolism was largely down-regulated in favour of catabolic and antioxidant metabolism.The response in whole plant tissues may be different and we have therefore investigated the response of Arabidopsis roots to menadione treatment,analyzing the transcriptome,metabolome and key metabolic fluxes with focus on primary as well as secondary metab-olism.Using a redox-sensitive GFP,it was also shown that menadione causes redox perturbation,not just in the mitochon-drion,but also in the cytosol and plastids of roots.In the first 30 min of treatment,the response was similar to the cell culture:there was a decrease in metabolites of the TCA cycle and amino acid biosynthesis and the transcriptomic response was dominated by up-regulation of DNA regulatory proteins.After 2 and 6 h of treatment,the response of the roots was different to the cell culture.Metabolite levels did not remain depressed,but instead recovered and,in the case of pyruvate,some amino acids and aliphatic glucosinolates showed a steady increase above control levels.However,no major changes in fluxes of central carbon metabolism were observed and metabolic transcripts changed largely independently of the corresponding metabolites.Together,the results suggest that root tissues can recover metabolic activity after oxidative inhibition and highlight potentially important roles for glycolysis and the oxidative pentose phosphate pathway.

  16. Histone Deacetylase Genes in Arabidopsis Development

    Institute of Scientific and Technical Information of China (English)

    Courtney Hollender; Zhongchi Liu

    2008-01-01

    Histone acetylatlon and deacetylation are directly connected with transcriptional activation and silencing in eukaryotas.Gene families for enzymes that accomplish these histone modifications show surprising complexity in domain organization,tissue-specific expression, and function. This review is focused on the family of histone deacetylases (HDACs) that remove the acetyl group from core histone tails, resulting in a "closed" chromatin and transcriptional repression. In Arabidopsis,18 HDAC genes are divided in to three different types - RPD3-1ike, HD-tuin and sirtuin - with two or more members ineach type. The structural feature of each HDAC class, the expression profile of each HDAC gene during development and functional insights of important family members are summarized here. It is clear that HDACs are an important class of global transcriptional regulators that play crucial roles in plant development, defense, and adaptation.

  17. Rapid endocytosis is triggered upon imbibition in Arabidopsis seeds.

    Science.gov (United States)

    Pagnussat, Luciana; Burbach, Christian; Baluška, František; de la Canal, Laura

    2012-03-01

    During seed imbibition and embryo activation, rapid change from a metabolically resting state to the activation of diverse extracellular and/or membrane bound molecules is essential and, hence, endocytosis could be activated too. In fact, we have documented endocytic internalization of the membrane impermeable endocytic tracer FM4-64 already upon 30 min of imbibition of Arabidopsis seeds. This finding suggest that endocytosis is activated early during seed imbibition in Arabidopsis. Immunolocalization of rhamnogalacturonan-II (RG-II) complexed with boron showed that whereas this pectin is localized only in the cell walls of dry seed embryos, it starts to be intracellular once the imbibition started. Brefeldin A (BFA) exposure resulted in recruitment of the intracellular RG-II pectin complexes into the endocytic BFA-induced compartments, confirming the endocytic origin of the RG-II signal detected intracellularly. Finally, germination was significantly delayed when Arabidopsis seeds were germinated in the presence of inhibitors of endocytic pathways, suggesting that trafficking of extracellular molecules might play an important role in the overcome of germination. This work constitutes the first demonstration of endocytic processes during germination and opens new perspectives about the role of the extracellular matrix and membrane components in seed germination. PMID:22476454

  18. A reference map of the Arabidopsis thaliana mature pollen proteome

    International Nuclear Information System (INIS)

    The male gametophyte (or pollen) plays an obligatory role during sexual reproduction of higher plants. The extremely reduced complexity of this organ renders pollen a valuable experimental system for studying fundamental aspects of plant biology such as cell fate determination, cell-cell interactions, cell polarity, and tip-growth. Here, we present the first reference map of the mature pollen proteome of the dicotyledonous model plant species, Arabidopsis thaliana. Based on two-dimensional gel electrophoresis, matrix-assisted laser desorption/ionization time-of-flight, and electrospray quadrupole time-of-flight mass spectrometry, we reproducibly identified 121 different proteins in 145 individual spots. The presence, subcellular localization, and functional classification of the identified proteins are discussed in relation to the pollen transcriptome and the full protein complement encoded by the nuclear Arabidopsis genome

  19. Prediction of anther-expressed gene resulation in Arabidopsis

    Institute of Scientific and Technical Information of China (English)

    HUANG JiFeng; YANG JingJin; WANG Guan; YU QingBo; YANG ZhongNan

    2008-01-01

    Anther development in Arabidopsis, a popular model plant for plant biology and genetics, is controlled by a complex gene network. Despite the extensive use of this genus for genetic research, little is known about its regulatory network. In this paper, the direct transcriptional regulatory relationships between genes expressed in Arabidopsis anther development were predicted with an integrated bioinformatic method that combines mining of microarray data with promoter analysis. A total of 7710 transcription factor-gene pairs were obtained. The 80 direct regulatory relationships demonstrating the highest con-fidence were screened from the initial 7710 pairs; three of the 80 were validated by previous experi-ments. The results indicate that our predicted results were reliable. The regulatory relationships re-vealed by this research and described in this paper may facilitate further investigation of the molecular mechanisms of anther development. The bioinformatic method used in this work can also be applied to the prediction of gene regulatory relationships in other organisms.

  20. Composition and function of P bodies in Arabidopsis thaliana

    Directory of Open Access Journals (Sweden)

    Luis David Maldonado-Bonilla

    2014-05-01

    Full Text Available mRNA accumulation is tightly regulated by diverse molecular pathways. The identification and characterization of enzymes and regulatory proteins involved in controlling the fate of mRNA offers the possibility to broaden our understanding of posttranscriptional gene regulation. Processing bodies (P bodies, PB are cytoplasmic protein complexes involved in degradation and translational arrest of mRNA. Composition and dynamics of these subcellular structures have been studied in animal systems, yeasts and in the model plant Arabidopsis. Their assembly implies the aggregation of specific factors related to decapping, deadenylation and exoribonucleases that operate synchronously to regulate certain mRNA targets during development and adaptation to stress. Although the general function of PB along with the flow of genetic information is understood, several questions still remain open. This review summarizes data on the composition, potential molecular roles, and biological significance of PB and potentially related proteins in Arabidopsis.

  1. Arabidopsis thaliana—Aphid Interaction

    OpenAIRE

    Louis, Joe; Singh, Vijay,; Shah, Jyoti

    2012-01-01

    Aphids are important pests of plants that use their stylets to tap into the sieve elements to consume phloem sap. Besides the removal of photosynthates, aphid infestation also alters source-sink patterns. Most aphids also vector viral diseases. In this chapter, we will summarize on recent significant findings in plant-aphid interaction, and how studies involving Arabidopsis thaliana and Myzus persicae (Sülzer), more commonly known as the green peach aphid (GPA), are beginning to provide impor...

  2. Selenium Speciation in Arabidopsis Thaliana

    OpenAIRE

    Wang, Xiaoou

    2011-01-01

    Selenium has been proved as an essential micronutrient and is beneficial to animals and humans. It is a structural component of the important antioxidant enzyme, glutathione peroxidase, which catalyzes reactions to detoxify reactive oxygen species. However, the essentiality of Se in plants remains controversial and the protective role of Se in plants has rarely been investigated. In this study, Arabidopsis thaliana was grown in controlled environments having selenate or selenite enriched medi...

  3. Stem cell organization in Arabidopsis

    OpenAIRE

    Wendrich, J.R.

    2016-01-01

    Growth of plant tissues and organs depends on continuous production of new cells, by niches of stem cells. Stem cells typically divide to give rise to one differentiating daughter and one non-differentiating daughter. This constant process of self-renewal ensures that the niches of stem cells or meristems stay active throughout plant-life. Specification of stem cells occurs very early during development of the emrbyo and they are maintained during later stages. The Arabidopsis embryo is a hig...

  4. Strigolactones suppress adventitious rooting in Arabidopsis and pea.

    Science.gov (United States)

    Rasmussen, Amanda; Mason, Michael Glenn; De Cuyper, Carolien; Brewer, Philip B; Herold, Silvia; Agusti, Javier; Geelen, Danny; Greb, Thomas; Goormachtig, Sofie; Beeckman, Tom; Beveridge, Christine Anne

    2012-04-01

    Adventitious root formation is essential for the propagation of many commercially important plant species and involves the formation of roots from nonroot tissues such as stems or leaves. Here, we demonstrate that the plant hormone strigolactone suppresses adventitious root formation in Arabidopsis (Arabidopsis thaliana) and pea (Pisum sativum). Strigolactone-deficient and response mutants of both species have enhanced adventitious rooting. CYCLIN B1 expression, an early marker for the initiation of adventitious root primordia in Arabidopsis, is enhanced in more axillary growth2 (max2), a strigolactone response mutant, suggesting that strigolactones restrain the number of adventitious roots by inhibiting the very first formative divisions of the founder cells. Strigolactones and cytokinins appear to act independently to suppress adventitious rooting, as cytokinin mutants are strigolactone responsive and strigolactone mutants are cytokinin responsive. In contrast, the interaction between the strigolactone and auxin signaling pathways in regulating adventitious rooting appears to be more complex. Strigolactone can at least partially revert the stimulatory effect of auxin on adventitious rooting, and auxin can further increase the number of adventitious roots in max mutants. We present a model depicting the interaction of strigolactones, cytokinins, and auxin in regulating adventitious root formation. PMID:22323776

  5. An International Bioinformatics Infrastructure to Underpin the Arabidopsis Community

    Science.gov (United States)

    The future bioinformatics needs of the Arabidopsis community as well as those of other scientific communities that depend on Arabidopsis resources were discussed at a pair of recent meetings held by the Multinational Arabidopsis Steering Committee (MASC) and the North American Arabidopsis Steering C...

  6. Arabidopsis CDS blastp result: AK106750 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK106750 002-115-C09 At4g15560.1 1-deoxy-D-xylulose 5-phosphate synthase, putative / 1-deoxyxylu ... phate synthase, putative / DXP-synthase, putative (DEF ) (CLA1) identical to SP|Q38854 Probable 1-deoxy-D- ... (DXPS). [Mouse-ear cress] {Arabidopsis thaliana}, DEF ... (def icient in photosynthesis) protein [Arabidopsis ...

  7. Arabidopsis CDS blastp result: AK104851 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK104851 001-043-A10 At4g15560.1 1-deoxy-D-xylulose 5-phosphate synthase, putative / 1-deoxyxylu ... phate synthase, putative / DXP-synthase, putative (DEF ) (CLA1) identical to SP|Q38854 Probable 1-deoxy-D- ... (DXPS). [Mouse-ear cress] {Arabidopsis thaliana}, DEF ... (def icient in photosynthesis) protein [Arabidopsis ...

  8. Arabidopsis CDS blastp result: AK100909 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK100909 J023132G24 At4g15560.1 1-deoxy-D-xylulose 5-phosphate synthase, putative / 1-deoxyxylul ... phate synthase, putative / DXP-synthase, putative (DEF ) (CLA1) identical to SP|Q38854 Probable 1-deoxy-D- ... (DXPS). [Mouse-ear cress] {Arabidopsis thaliana}, DEF ... (def icient in photosynthesis) protein [Arabidopsis ...

  9. Arabidopsis CDS blastp result: AK058950 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK058950 001-020-A07 At4g15560.1 1-deoxy-D-xylulose 5-phosphate synthase, putative / 1-deoxyxylu ... phate synthase, putative / DXP-synthase, putative (DEF ) (CLA1) identical to SP|Q38854 Probable 1-deoxy-D- ... (DXPS). [Mouse-ear cress] {Arabidopsis thaliana}, DEF ... (def icient in photosynthesis) protein [Arabidopsis ...

  10. Arabidopsis CDS blastp result: AK059821 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK059821 006-205-D11 At4g15560.1 1-deoxy-D-xylulose 5-phosphate synthase, putative / 1-deoxyxylu ... phate synthase, putative / DXP-synthase, putative (DEF ) (CLA1) identical to SP|Q38854 Probable 1-deoxy-D- ... (DXPS). [Mouse-ear cress] {Arabidopsis thaliana}, DEF ... (def icient in photosynthesis) protein [Arabidopsis ...

  11. Arabidopsis CDS blastp result: AK064944 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK064944 J013000P14 At4g15560.1 1-deoxy-D-xylulose 5-phosphate synthase, putative / 1-deoxyxylul ... phate synthase, putative / DXP-synthase, putative (DEF ) (CLA1) identical to SP|Q38854 Probable 1-deoxy-D- ... (DXPS). [Mouse-ear cress] {Arabidopsis thaliana}, DEF ... (def icient in photosynthesis) protein [Arabidopsis ...

  12. Arabidopsis CDS blastp result: AK068400 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK068400 J013151M04 At3g45810.1 ferric reductase-like transmembrane component family protein sim ... ilar to respiratory burst ... oxidase protein D RbohD from Arabidopsis thaliana, ... EMBL:AF055357 [gi:3242789], similar to respiratory burst ... oxidase protein D RbohD from Arabidopsis thaliana, ...

  13. Arabidopsis CDS blastp result: AK066013 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK066013 J013047I12 At3g45810.1 ferric reductase-like transmembrane component family protein sim ... ilar to respiratory burst ... oxidase protein D RbohD from Arabidopsis thaliana, ... EMBL:AF055357 [gi:3242789], similar to respiratory burst ... oxidase protein D RbohD from Arabidopsis thaliana, ...

  14. Arabidopsis CDS blastp result: AK100241 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK100241 J023054P13 At3g45810.1 ferric reductase-like transmembrane component family protein sim ... ilar to respiratory burst ... oxidase protein D RbohD from Arabidopsis thaliana, ... EMBL:AF055357 [gi:3242789], similar to respiratory burst ... oxidase protein D RbohD from Arabidopsis thaliana, ...

  15. Arabidopsis CDS blastp result: AK318553 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK318553 J075145A22 At3g45810.1 68416.m04958 ferric reductase-like transmembrane component famil ... y protein similar to respiratory burst ... oxidase protein D RbohD from Arabidopsis thaliana, ... EMBL:AF055357 [gi:3242789], similar to respiratory burst ... oxidase protein D RbohD from Arabidopsis thaliana, ...

  16. Using "Arabidopsis" Genetic Sequences to Teach Bioinformatics

    Science.gov (United States)

    Zhang, Xiaorong

    2009-01-01

    This article describes a new approach to teaching bioinformatics using "Arabidopsis" genetic sequences. Several open-ended and inquiry-based laboratory exercises have been designed to help students grasp key concepts and gain practical skills in bioinformatics, using "Arabidopsis" leucine-rich repeat receptor-like kinase (LRR RLK) genetic…

  17. Tracking transcription factor mobility and interaction in arabidopsis roots with fluorescence correlation spectroscopy

    NARCIS (Netherlands)

    Clark, Natalie M.; Hinde, Elizabeth; Hinde, Elizabeth; Fisher, Adam P.; Crosti, Giuseppe; Blilou, Ikram; Gratton, Enrico; Benfey, Philip N.; Sozzani, Rosangela

    2016-01-01

    To understand complex regulatory processes in multicellular organisms, it is critical to be able to quantitatively analyze protein movement and protein-protein interactions in time and space. During Arabidopsis development, the intercellular movement of SHORTROOT (SHR) and subsequent interaction

  18. Effects of Preconditioning and Temperature During Germination of 73 Natural Accessions of Arabidopsis thaliana

    OpenAIRE

    Schmuths, Heike; BACHMANN, KONRAD; WEBER, W. EBERHARD; Horres, Ralf; Matthias H Hoffmann

    2006-01-01

    • Background and Aims Germination and establishment of seeds are complex traits affected by a wide range of internal and external influences. The effects of parental temperature preconditioning and temperature during germination on germination and establishment of Arabidopsis thaliana were examined.

  19. Does Arabidopsis thaliana DREAM of cell cycle control?

    Science.gov (United States)

    Fischer, Martin; DeCaprio, James A

    2015-01-01

    Strict temporal control of cell cycle gene expression is essential for all eukaryotes including animals and plants. DREAM complexes have been identified in worm, fly, and mammals, linking several distinct transcription factors to coordinate gene expression throughout the cell cycle. In this issue of The EMBO Journal, Kobayashi et al (2015) identify distinct activator and repressor complexes for genes expressed during the G2 and M phases in Arabidopsis that can be temporarily separated during proliferating and post-mitotic stages of development. The complexes incorporate specific activator and repressor MYB and E2F transcription factors and indicate the possibility of the existence of multiple DREAM complexes in plants. PMID:26089020

  20. An early nodulin-like protein accumulates in the sieve element plasma membrane of Arabidopsis

    DEFF Research Database (Denmark)

    Khan, Junaid A.; Wang, Qi; Sjölund, Richard D.;

    2007-01-01

    ) tissue cultures, recognizes an antigen in the Arabidopsis (Arabidopsis thaliana) ecotype Columbia that is associated specifically with the plasma membrane of sieve elements, but not companion cells, and accumulates at the earliest stages of sieve element differentiation. The identity of the RS6 antigen...... cleaved from the precursor protein, resulting in a mature peptide of approximately 15 kD that is attached to the sieve element plasma membrane via a carboxy-terminal glycosylphosphatidylinositol membrane anchor. Many of the Arabidopsis ENOD-like proteins accumulate in gametophytic tissues, whereas in both......Membrane proteins within the sieve element-companion cell complex have essential roles in the physiological functioning of the phloem. The monoclonal antibody line RS6, selected from hybridomas raised against sieve elements isolated from California shield leaf (Streptanthus tortuosus; Brassicaceae...

  1. Genome wide association mapping for the tolerance to the polyamine oxidase inhibitor guazatine in Arabidopsis thaliana

    Directory of Open Access Journals (Sweden)

    Kostadin Evgeniev eAtanasov

    2016-04-01

    Full Text Available Guazatine is a potent inhibitor of polyamine oxidase (PAO activity. In agriculture, guazatine is used as non-systemic contact fungicide efficient in the protection of cereals and citrus fruits against disease. The composition of guazatine is complex, mainly constituted by a mixture of synthetic guanidated polyamines (polyaminoguanidines. Here we have studied the effects from exposure to guazatine in the weed Arabidopsis thaliana. We report that micromolar concentrations of guazatine are sufficient to inhibit growth of Arabidopsis seedlings and induce chlorosis, whereas germination is barely affected. We observed the occurrence of quantitative variation in the response to guazatine between 107 randomly chosen Arabidopsis accessions. This enabled us to undertake genome-wide association (GWA mapping that identified a locus on chromosome one associated with guazatine tolerance. CHLOROPHYLLASE 1 (CLH1 within this locus was studied as candidate gene, together with its paralog (CLH2. The analysis of independent clh1-2, clh1-3, clh2-3, clh2-2 and double clh1-2 clh2-3 mutant alleles indicated that CLH1 and/or CLH2 loss-of-function or expression down-regulation promote guazatine tolerance in Arabidopsis. We report a natural mechanism by which Arabidopsis populations can overcome toxicity by the fungicide guazatine.

  2. Genome Wide Association Mapping for the Tolerance to the Polyamine Oxidase Inhibitor Guazatine in Arabidopsis thaliana.

    Science.gov (United States)

    Atanasov, Kostadin E; Barboza-Barquero, Luis; Tiburcio, Antonio F; Alcázar, Rubén

    2016-01-01

    Guazatine is a potent inhibitor of polyamine oxidase (PAO) activity. In agriculture, guazatine is used as non-systemic contact fungicide efficient in the protection of cereals and citrus fruits against disease. The composition of guazatine is complex, mainly constituted by a mixture of synthetic guanidated polyamines (polyaminoguanidines). Here, we have studied the effects from exposure to guazatine in the weed Arabidopsis thaliana. We report that micromolar concentrations of guazatine are sufficient to inhibit growth of Arabidopsis seedlings and induce chlorosis, whereas germination is barely affected. We observed the occurrence of quantitative variation in the response to guazatine between 107 randomly chosen Arabidopsis accessions. This enabled us to undertake genome-wide association (GWA) mapping that identified a locus on chromosome one associated with guazatine tolerance. CHLOROPHYLLASE 1 (CLH1) within this locus was studied as candidate gene, together with its paralog (CLH2). The analysis of independent clh1-2, clh1-3, clh2-3, clh2-2, and double clh1-2 clh2-3 mutant alleles indicated that CLH1 and/or CLH2 loss-of-function or expression down-regulation promote guazatine tolerance in Arabidopsis. We report a natural mechanism by which Arabidopsis populations can overcome toxicity by the fungicide guazatine. PMID:27092150

  3. Protein (Viridiplantae): 297827267 [

    Lifescience Database Archive (English)

    Full Text Available XP_002881516.1 33090:14975 35493:14487 131221:14487 3193:14487 58023:10069 78536:8383 58024:8383 ... 83:5566 3701:5566 59689:6118 81972:6118 sodium-and lithium -tolerant 1 Arabidopsis lyrata subsp. lyrata MENHHP ...

  4. Protein (Viridiplantae): 297852222 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 24:3181 3398:3181 71240:3723 91827:3723 71275:1324 91836:455 3699:455 3700:455 980083:455 3701:455 59689:256 81972:256 universa...l stress protein family protein Arabidopsis lyrata subsp. lyrata MQFSRNSILRQLSRKEGWRSASKR

  5. Protein (Viridiplantae): 297830956 [

    Lifescience Database Archive (English)

    Full Text Available XP_002883360.1 33090:13671 35493:12750 131221:12750 3193:12750 58023:9989 78536:6448 58024:6448 ... 0083:2818 3701:2818 59689:5429 81972:5429 time for coffee ... Arabidopsis lyrata subsp. lyrata MAAAGNGLSRRRHRAGS ...

  6. Protein (Viridiplantae): 297822433 [

    Lifescience Database Archive (English)

    Full Text Available XP_002879099.1 33090:21008 35493:15650 131221:15650 3193:15650 58023:14656 78536:14697 58024:146 ... 0:5639 980083:5639 3701:5639 59689:7788 81972:7788 sand ... family protein Arabidopsis lyrata subsp. lyrata MA ...

  7. Proteolysis in Plastids of Arabidopsis Thaliana: Functional Analysis of ClpS1,2,T and their Physical and Genetic Interactions with the ClpPR Protease Core Complex and Clp Chaperones

    Energy Technology Data Exchange (ETDEWEB)

    van Wijk, Klaas

    2009-01-12

    Chloroplasts are essential organelles required for plant growth and biomass production. They synthesize many essential secondary metabolites (e.g. hormones, isoprenoids, amino acids, etc.) and house the photosynthetic apparatus needed for conversion of light energy and CO2 into chemical energy [in the form of reduced carbohydrates, ATP and NADPH]. Thus chloroplasts are essential for life on earth and essential for production of bioenergy. Formation and maintenance of a functional chloroplast requires an extensive investment in the biogenesis and homeostasis apparatus. Protease and proteolysis play a critical role in these processes, with the Clp gene family being particularly central. Proteolysis of proteins and protein complexes in plastids is poorly understood, and is not only critical for biogenesis, adaptation and maintenance but is also important for plant development. Several years ago, the vanWijk lab identified a large and relatively abundant ClpP/R/S complex, along with ClpC1,C2 and ClpD chaperones and a putative Clp affinity modulator in plastids. So far, no substrate recognition mechanism has been determined for any Clp complex in plants. The purpose of this grant was to initiate functional analysis of three members of the Clp family.

  8. Arabidopsis CDS blastp result: AK119708 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK119708 002-157-E08 At1g28330.1 dormancy-associated protein, putative (DRM1) identical to dormancy...-associated protein [Arabidopsis thaliana] GI:2995990; similar to dormancy-associated protei

  9. Arabidopsis CDS blastp result: AK060981 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK060981 006-202-H08 At1g28330.1 dormancy-associated protein, putative (DRM1) identical to dormancy...-associated protein [Arabidopsis thaliana] GI:2995990; similar to dormancy-associated protei

  10. Arabidopsis CDS blastp result: AK111736 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK111736 J023047L09 At1g68370.1 gravity -responsive protein / altered response to gravity ... protein ... (ARG1) identical to Altered Response to Gravity ... [Arabidopsis thaliana] GI:4249662; contains Pfam p ...

  11. Arabidopsis CDS blastp result: AK070093 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK070093 J023041M10 At2g39290.1 phosphatidylglycerolphosphate synthase (PGS1) identical to phosphati...dylglycerolphosphate synthase GI:13365519 from [Arabidopsis thaliana] 7e-78 ...

  12. Arabidopsis CDS blastp result: AK060009 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK060009 006-302-D03 At2g39290.1 phosphatidylglycerolphosphate synthase (PGS1) identical to phosphati...dylglycerolphosphate synthase GI:13365519 from [Arabidopsis thaliana] 8e-71 ...

  13. Arabidopsis CDS blastp result: AK058419 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK058419 001-015-D06 At4g16280.3 flowering time ... control protein / FCA gamma (FCA) identical to S ... P|O04425 Flowering time ... control protein FCA {Arabidopsis thaliana}; four a ...

  14. Arabidopsis CDS blastp result: AK073225 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK073225 J033023C04 At4g16280.3 flowering time ... control protein / FCA gamma (FCA) identical to SP ... |O04425 Flowering time ... control protein FCA {Arabidopsis thaliana}; four a ...

  15. Arabidopsis CDS blastp result: AK102695 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK102695 J033103F21 At5g16910.1 cellulose synthase family protein similar to gi:2827143 cellulose... synthase catalytic subunit, Arabidopsis thaliana, gi:9622886 cellulose synthase-7 from Zea mays 0.0 ...

  16. Arabidopsis CDS blastp result: AK102134 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK102134 J033085F12 At5g16910.1 cellulose synthase family protein similar to gi:2827143 cellulose... synthase catalytic subunit, Arabidopsis thaliana, gi:9622886 cellulose synthase-7 from Zea mays 0.0 ...

  17. Arabidopsis CDS blastp result: AK066835 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK066835 J013087I16 At5g16910.1 cellulose synthase family protein similar to gi:2827143 cellulose... synthase catalytic subunit, Arabidopsis thaliana, gi:9622886 cellulose synthase-7 from Zea mays 1e-171 ...

  18. Arabidopsis CDS blastp result: AK065259 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK065259 J013002J18 At5g16910.1 cellulose synthase family protein similar to gi:2827143 cellulose... synthase catalytic subunit, Arabidopsis thaliana, gi:9622886 cellulose synthase-7 from Zea mays 0.0 ...

  19. Arabidopsis CDS blastp result: AK100523 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK100523 J023100P04 At5g16910.1 cellulose synthase family protein similar to gi:2827143 cellulose... synthase catalytic subunit, Arabidopsis thaliana, gi:9622886 cellulose synthase-7 from Zea mays 0.0 ...

  20. Arabidopsis CDS blastp result: AK288065 [KOME

    Lifescience Database Archive (English)

    Full Text Available al to sulfate tansporter Sultr1;3 [Arabidopsis thaliana] GI:10716805; contains Pfam profile PF00916: Sulfate... transporter family; contains Pfam profile PF01740: STAS domain; contains TIGRfam profile TIGR00815: sulfate permease 1e-145 ...

  1. Arabidopsis CDS blastp result: AK288002 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK288002 J075110B01 At1g68510.1 68414.m07826 LOB domain protein 42 ... / lateral organ boundaries do ... main protein 42 ... (LBD42 ) identical to LOB DOMAIN 42 ... [Arabidopsis th ...

  2. Arabidopsis CDS blastp result: AK241043 [KOME

    Lifescience Database Archive (English)

    Full Text Available upted by a stop codon, creating non-consensus donor and acceptor splice sites. 2e-41 ... ...tical to SP|P92997 Germin-like protein subfamily 1 member 13 precursor {Arabidopsis thaliana}; exon 2 interr

  3. Arabidopsis CDS blastp result: AK243135 [KOME

    Lifescience Database Archive (English)

    Full Text Available upted by a stop codon, creating non-consensus donor and acceptor splice sites. 7e-43 ... ...tical to SP|P92997 Germin-like protein subfamily 1 member 13 precursor {Arabidopsis thaliana}; exon 2 interr

  4. Arabidopsis CDS blastp result: AK111785 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK111785 J023089N11 At5g62310.1 incomplete root hair ... elongation (IRE) / protein kinase, putative ... nearly identical to IRE (incomplete root hair ... elongation) [Arabidopsis thaliana] gi|6729346|dbj| ...

  5. Arabidopsis CDS blastp result: AK243050 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243050 J100011E04 At5g62310.1 68418.m07822 incomplete root hair ... elongation (IRE) / protein kin ... putative nearly identical to IRE (incomplete root hair ... elongation) [Arabidopsis thaliana] gi|6729346|dbj| ...

  6. Arabidopsis CDS blastp result: AK242758 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242758 J090051H03 At5g62310.1 68418.m07822 incomplete root hair ... elongation (IRE) / protein kin ... putative nearly identical to IRE (incomplete root hair ... elongation) [Arabidopsis thaliana] gi|6729346|dbj| ...

  7. Arabidopsis CDS blastp result: AK242717 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242717 J090043H19 At5g62310.1 68418.m07822 incomplete root hair ... elongation (IRE) / protein kin ... putative nearly identical to IRE (incomplete root hair ... elongation) [Arabidopsis thaliana] gi|6729346|dbj| ...

  8. Arabidopsis CDS blastp result: AK288095 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK288095 J075191E21 At5g62310.1 68418.m07822 incomplete root hair ... elongation (IRE) / protein kin ... putative nearly identical to IRE (incomplete root hair ... elongation) [Arabidopsis thaliana] gi|6729346|dbj| ...

  9. Arabidopsis CDS blastp result: AK242638 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242638 J090023J02 At5g62310.1 68418.m07822 incomplete root hair ... elongation (IRE) / protein kin ... putative nearly identical to IRE (incomplete root hair ... elongation) [Arabidopsis thaliana] gi|6729346|dbj| ...

  10. Arabidopsis CDS blastp result: AK242651 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242651 J090026B08 At5g62310.1 68418.m07822 incomplete root hair ... elongation (IRE) / protein kin ... putative nearly identical to IRE (incomplete root hair ... elongation) [Arabidopsis thaliana] gi|6729346|dbj| ...

  11. Arabidopsis CDS blastp result: AK287631 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK287631 J065073J24 At5g62310.1 68418.m07822 incomplete root hair ... elongation (IRE) / protein kin ... putative nearly identical to IRE (incomplete root hair ... elongation) [Arabidopsis thaliana] gi|6729346|dbj| ...

  12. Arabidopsis CDS blastp result: AK288923 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK288923 J090081P06 At5g62310.1 68418.m07822 incomplete root hair ... elongation (IRE) / protein kin ... putative nearly identical to IRE (incomplete root hair ... elongation) [Arabidopsis thaliana] gi|6729346|dbj| ...

  13. Arabidopsis CDS blastp result: AK242271 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242271 J075187A19 At5g62310.1 68418.m07822 incomplete root hair ... elongation (IRE) / protein kin ... putative nearly identical to IRE (incomplete root hair ... elongation) [Arabidopsis thaliana] gi|6729346|dbj| ...

  14. Arabidopsis CDS blastp result: AK242681 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242681 J090032N04 At5g62310.1 68418.m07822 incomplete root hair ... elongation (IRE) / protein kin ... putative nearly identical to IRE (incomplete root hair ... elongation) [Arabidopsis thaliana] gi|6729346|dbj| ...

  15. Arabidopsis CDS blastp result: AK243656 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243656 J100088L22 At5g62310.1 68418.m07822 incomplete root hair ... elongation (IRE) / protein kin ... putative nearly identical to IRE (incomplete root hair ... elongation) [Arabidopsis thaliana] gi|6729346|dbj| ...

  16. Arabidopsis CDS blastp result: AK241519 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241519 J065170E12 At5g62310.1 68418.m07822 incomplete root hair ... elongation (IRE) / protein kin ... putative nearly identical to IRE (incomplete root hair ... elongation) [Arabidopsis thaliana] gi|6729346|dbj| ...

  17. Arabidopsis CDS blastp result: AK240655 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK240655 J023135E11 At5g62310.1 68418.m07822 incomplete root hair ... elongation (IRE) / protein kin ... putative nearly identical to IRE (incomplete root hair ... elongation) [Arabidopsis thaliana] gi|6729346|dbj| ...

  18. Arabidopsis CDS blastp result: AK242733 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242733 J090047O22 At5g62310.1 68418.m07822 incomplete root hair ... elongation (IRE) / protein kin ... putative nearly identical to IRE (incomplete root hair ... elongation) [Arabidopsis thaliana] gi|6729346|dbj| ...

  19. Arabidopsis CDS blastp result: AK242859 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242859 J090073L24 At5g62310.1 68418.m07822 incomplete root hair ... elongation (IRE) / protein kin ... putative nearly identical to IRE (incomplete root hair ... elongation) [Arabidopsis thaliana] gi|6729346|dbj| ...

  20. Arabidopsis CDS blastp result: AK243187 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243187 J100039E11 At5g62310.1 68418.m07822 incomplete root hair ... elongation (IRE) / protein kin ... putative nearly identical to IRE (incomplete root hair ... elongation) [Arabidopsis thaliana] gi|6729346|dbj| ...

  1. Arabidopsis CDS blastp result: AK242550 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242550 J080319D10 At2g35630.1 68415.m04369 microtubule organization 1 protein (MO...R1) identical to microtubule organization 1 protein GI:14317953 from [Arabidopsis thaliana] 5e-44 ...

  2. Arabidopsis CDS blastp result: AK101368 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK101368 J033035L13 At5g24270.1 calcineurin B-like protein, putative / calcium sensor ... homolog (S ... OS3) identical to calcium sensor ... homolog [Arabidopsis thaliana] GI:3309575; similar ...

  3. Arabidopsis CDS blastp result: AK111570 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK111570 J013071C24 At5g24270.1 calcineurin B-like protein, putative / calcium sensor ... homolog (S ... OS3) identical to calcium sensor ... homolog [Arabidopsis thaliana] GI:3309575; similar ...

  4. Arabidopsis CDS blastp result: AK243065 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243065 J100015N03 At5g24270.1 68418.m02855 calcineurin B-like protein, putative / calcium sensor ... or homolog (SOS3) identical to calcium sensor ... homolog [Arabidopsis thaliana] GI:3309575; similar ...

  5. The fifth international conference on Arabidopsis research

    Energy Technology Data Exchange (ETDEWEB)

    Hangarter, R.; Scholl, R.; Davis, K.; Feldmann, K.

    1993-12-31

    This volume contains abstracts of oral and poster presentations made in conjunction with the Fifth International Conference on Arabidopsis Research held August 19--22, 1993 at the Ohio State University, Columbus, Ohio.

  6. Arabidopsis CDS blastp result: AK070528 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK070528 J023060D13 At3g10920.1 superoxide dismutase [Mn], mitochondrial (SODA) / manganese ... supe ... roxide dismutase (MSD1) identical to manganese ... superoxide dismutase [Arabidopsis thaliana] gi|327 ...

  7. Arabidopsis CDS blastp result: AK119904 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK119904 002-182-A05 At3g10920.1 superoxide dismutase [Mn], mitochondrial (SODA) / manganese ... sup ... eroxide dismutase (MSD1) identical to manganese ... superoxide dismutase [Arabidopsis thaliana] gi|327 ...

  8. Arabidopsis CDS blastp result: AK104030 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK104030 001-020-C01 At3g10920.1 superoxide dismutase [Mn], mitochondrial (SODA) / manganese ... sup ... eroxide dismutase (MSD1) identical to manganese ... superoxide dismutase [Arabidopsis thaliana] gi|327 ...

  9. Arabidopsis CDS blastp result: AK104160 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK104160 006-211-E09 At3g10920.1 superoxide dismutase [Mn], mitochondrial (SODA) / manganese ... sup ... eroxide dismutase (MSD1) identical to manganese ... superoxide dismutase [Arabidopsis thaliana] gi|327 ...

  10. Arabidopsis CDS blastp result: AK287459 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK287459 J043019O07 At4g37000.1 68417.m05242 accelerated cell death ... 2 (ACD2) identical to accele ... rated cell death ... 2 (ACD2) GI:12484129 from [Arabidopsis thaliana] 4 ...

  11. Arabidopsis CDS blastp result: AK288034 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK288034 J075140H07 At4g37000.1 68417.m05242 accelerated cell death ... 2 (ACD2) identical to accele ... rated cell death ... 2 (ACD2) GI:12484129 from [Arabidopsis thaliana] 5 ...

  12. Arabidopsis CDS blastp result: AK111576 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK111576 J013075J23 At1g01510.1 C-terminal binding protein (ANGUSTIFOLIA) nearly id...entical to C-terminal binding protein ANGUSTIFOLIA [Arabidopsis thaliana] GI:15408535; contains Pfam profile

  13. Arabidopsis CDS blastp result: AK120838 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK120838 J023022B11 At1g01510.1 C-terminal binding protein (ANGUSTIFOLIA) nearly id...entical to C-terminal binding protein ANGUSTIFOLIA [Arabidopsis thaliana] GI:15408535; contains Pfam profile

  14. Arabidopsis CDS blastp result: AK111921 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK111921 001-013-A10 At1g01510.1 C-terminal binding protein (ANGUSTIFOLIA) nearly i...dentical to C-terminal binding protein ANGUSTIFOLIA [Arabidopsis thaliana] GI:15408535; contains Pfam profil

  15. Arabidopsis CDS blastp result: AK073140 [KOME

    Lifescience Database Archive (English)

    Full Text Available me 4 (EC 3.1.3.16) {Arabidopsis thaliana}, phosphoprotein phosphatase 1 GI:166801 (Arabidopsis thaliana); contains a Ser/Thr protein...AK073140 J033022I01 At2g39840.1 serine/threonine protein phosphatase PP1 isozyme 4 (TOPP4) / phosphoprotein... phosphatase 1 identical to SP|P48484 Serine/threonine protein phosphatase PP1 isozy... phosphatase signature (PDOC00115); contains a metallo-phosphoesterase motif (QDOC50185) 1e-168 ...

  16. Arabidopsis CDS blastp result: AK120439 [KOME

    Lifescience Database Archive (English)

    Full Text Available me 4 (EC 3.1.3.16) {Arabidopsis thaliana}, phosphoprotein phosphatase 1 GI:166801 (Arabidopsis thaliana); contains a Ser/Thr protein...AK120439 J013098H20 At2g39840.1 serine/threonine protein phosphatase PP1 isozyme 4 (TOPP4) / phosphoprotein... phosphatase 1 identical to SP|P48484 Serine/threonine protein phosphatase PP1 isozy... phosphatase signature (PDOC00115); contains a metallo-phosphoesterase motif (QDOC50185) 1e-154 ...

  17. Arabidopsis CDS blastp result: AK121378 [KOME

    Lifescience Database Archive (English)

    Full Text Available me 4 (EC 3.1.3.16) {Arabidopsis thaliana}, phosphoprotein phosphatase 1 GI:166801 (Arabidopsis thaliana); contains a Ser/Thr protein...AK121378 J023127F14 At2g39840.1 serine/threonine protein phosphatase PP1 isozyme 4 (TOPP4) / phosphoprotein... phosphatase 1 identical to SP|P48484 Serine/threonine protein phosphatase PP1 isozy... phosphatase signature (PDOC00115); contains a metallo-phosphoesterase motif (QDOC50185) 1e-142 ...

  18. Arabidopsis CDS blastp result: AK063856 [KOME

    Lifescience Database Archive (English)

    Full Text Available yme 4 (EC 3.1.3.16) {Arabidopsis thaliana}, phosphoprotein phosphatase 1 GI:166801 (Arabidopsis thaliana); contains a Ser/Thr protein...AK063856 001-122-D05 At2g39840.1 serine/threonine protein phosphatase PP1 isozyme 4 (TOPP4) / phosphoprotein... phosphatase 1 identical to SP|P48484 Serine/threonine protein phosphatase PP1 isoz... phosphatase signature (PDOC00115); contains a metallo-phosphoesterase motif (QDOC50185) 6e-46 ...

  19. Terpene Specialized Metabolism in Arabidopsis thaliana

    OpenAIRE

    Tholl, Dorothea; Lee, Sungbeom

    2011-01-01

    Terpenes constitute the largest class of plant secondary (or specialized) metabolites, which are compounds of ecological function in plant defense or the attraction of beneficial organisms. Using biochemical and genetic approaches, nearly all Arabidopsis thaliana (Arabidopsis) enzymes of the core biosynthetic pathways producing the 5-carbon building blocks of terpenes have been characterized and closer insight has been gained into the transcriptional and posttranscriptional/translational mech...

  20. AtPGL3 is an Arabidopsis BURP domain protein that is localized to the cell wall and promotes cell enlargement

    OpenAIRE

    Park, Jiyoung; Cui, Yong; Kang, Byung-Ho

    2015-01-01

    The BURP domain is a plant-specific domain that has been identified in secretory proteins, and some of these are involved in cell wall modification. The tomato polygalacturonase I complex involved in pectin degradation in ripening fruits has a non-catalytic subunit that has a BURP domain. This protein is called polygalacturonase 1 beta (PG1β) and the Arabidopsis genome encodes three proteins that exhibit strong amino acid similarities with PG1β? We generated Arabidopsis lines in which express...

  1. Cis-regulatory Evolution of Chalcone-Synthase Expression in the Genus Arabidopsis

    OpenAIRE

    de Meaux, J. (Juliette); Pop, A.(National Institute for Physics and Nuclear Engineering, Bucharest, Romania); Mitchell-Olds, T.

    2006-01-01

    The contribution of cis-regulation to adaptive evolutionary change is believed to be essential, yet little is known about the evolutionary rules that govern regulatory sequences. Here, we characterize the short-term evolutionary dynamics of a cis-regulatory region within and among two closely related species, A. lyrata and A. halleri, and compare our findings to A. thaliana. We focused on the cis-regulatory region of chalcone synthase (CHS), a key enzyme involved in the synthesis of plant sec...

  2. The Arabidopsis NIMIN proteins affect NPR1 differentially

    Directory of Open Access Journals (Sweden)

    Meike eHermann

    2013-04-01

    Full Text Available NON-EXPRESSOR OF PATHOGENESIS-RELATED GENES1 (NPR1 is the central regulator of the pathogen defense reaction systemic acquired resistance (SAR. NPR1 acts by sensing the SAR signal molecule salicylic acid (SA to induce expression of PATHOGENESIS-RELATED (PR genes. Mechanistically, NPR1 is the core of a transcription complex interacting with TGA transcription factors and NIM1 INTERACTING (NIMIN proteins. Arabidopsis NIMIN1 has been shown to suppress NPR1 activity in transgenic plants. The Arabidopsis NIMIN family comprises four structurally related, yet distinct members. Here, we show that NIMIN1, NIMIN2 and NIMIN3 are expressed differentially, and that the encoded proteins affect expression of the SAR marker PR-1 differentially. NIMIN3 is expressed constitutively at a low level, but NIMIN2 and NIMIN1 are both responsive to SA. While NIMIN2 is an immediate early SA-induced and NPR1-independent gene, NIMIN1 is activated after NIMIN2, but clearly before PR-1. Notably, NIMIN1, like PR-1, depends on NPR1. In a transient assay system, NIMIN3 suppresses SA-induced PR-1 expression, albeit to a lesser extent than NIMIN1, whereas NIMIN2 does not negatively affect PR-1 gene activation. Furthermore, although binding to the same domain in the C-terminus, NIMIN1 and NIMIN2 interact differentially with NPR1, thus providing a molecular basis for their opposing effects on NPR1. Together, our data suggest that the Arabidopsis NIMIN proteins are regulators of the SAR response. We propose that NIMINs act in a strictly consecutive and SA-regulated manner on the SA sensor protein NPR1, enabling NPR1 to monitor progressing threat by pathogens and to promote appropriate defense gene activation at distinct stages of SAR. In this scenario, the defense gene PR-1 is repressed at the onset of SAR by SA-induced, yet instable NIMIN1.

  3. Advances in Arabidopsis research in China from 2006 to 2007

    Institute of Scientific and Technical Information of China (English)

    LIANG Yan; ZUO JianRu; YANG WeiCai

    2007-01-01

    @@ Arabidopsis thaliana, a model plant species, has a number of advantages over other plant species as an experimental organism due to many of its genetic and genomic features. The Chinese Arabidopsis community has made significant contributions to plant biology research in recent years[1,2]. In 2006, studies of plant biology in China received more attention than ever before, especially those pertaining to Arabidopsis research. Here we briefly summarize recent advances in Arabidopsis research in China.

  4. Populus: arabidopsis for forestry. Do we need a model tree?

    Science.gov (United States)

    Taylor, Gail

    2002-12-01

    Trees are used to produce a variety of wood-based products including timber, pulp and paper. More recently, their use as a source of renewable energy has also been highlighted, as has their value for carbon mitigation within the Kyoto Protocol. Relative to food crops, the domestication of trees has only just begun; the long generation time and complex nature of juvenile and mature growth forms are contributory factors. To accelerate domestication, and to understand further some of the unique processes that occur in woody plants such as dormancy and secondary wood formation, a 'model' tree is needed. Here it is argued that Populus is rapidly becoming accepted as the 'model' woody plant and that such a 'model' tree is necessary to complement the genetic resource being developed in arabidopsis. The genus Populus (poplars, cottonwoods and aspens) contains approx. 30 species of woody plant, all found in the Northern hemisphere and exhibiting some of the fastest growth rates observed in temperate trees. Populus is fulfilling the 'model' role for a number of reasons. First, and most important, is the very recent commitment to sequence the Populus genome, a project initiated in February 2002. This will be the first woody plant to be sequenced. Other reasons include the relatively small genome size (450-550 Mbp) of Populus, the large number of molecular genetic maps and the ease of genetic transformation. Populus may also be propagated vegetatively, making mapping populations immortal and facilitating the production of large amounts of clonal material for experimentation. Hybridization occurs routinely and, in these respects, Populus has many similarities to arabidopsis. However, Populus also differs from arabidopsis in many respects, including being dioecious, which makes selfing and back-cross manipulations impossible. The long time-to-flower is also a limitation, whilst physiological and biochemical experiments are more readily conducted in Populus compared with the

  5. Amyloplast movement and gravityperception in Arabidopsis endoderm

    Science.gov (United States)

    Tasaka, M.; Saito, T.; Morita, M. T.

    Gravitropism of higher plant is a growth response regulating the orientation of organs elongation, which includes four sequential steps, the perception of gravistimulus, transduction of the physical stimulus to chemical signal, transmission of the signal, and differential cell elongation depending on the signal. To elucidate the molecular mechanism of these steps, we have isolated a number of Arabidopsis mutants with abnormal shoot gravitropic response. zig (zigzag)/sgr4(shoot gravitropism 4) shows little gravitropism in their shoots. Besides, their inflorescence stems elongate in a zigzag-fashion to bend at each node. ZIG encodes a SNARE, AtVTI11. sgr3 with reduced gravitropic response in inflorescence stems had a missense mutation in other SNARE, AtVAM3. These two SNAREs make a complex in the shoot endoderm cells that are gravity-sensing cells, suggesting that the vesicle transport from trans-Golgi network (TGN) to prevacuolar compartment (PVC) and/or vacuole is involved in gravitropism. Abnormal vesicular/vacuolar structures were observed in several tissues of both mutants. Moreover, SGR2 encodes phospholipase A1-like protein that resides in the vacuolar membrane. Endodermis-specific expression of these genes could complement gravitropism in each mutant. In addition, amyloplasts thought to be statoliths localized abnormally in their endoderm cells. These results strongly suggest that formation and function of vacuole in the endoderm cells are important for amyloplasts sedimentation, which is involved in the early process of shoot gravitropism. To reveal this, we constructed vertical stage microscope system to visualize the behavior of amyloplasts and vacuolar membrane in living endodermal cells. We hope to discuss the mechanism of gravity perception after showing their movements.

  6. Expression of aberrant forms of AUXIN RESPONSE FACTOR8 stimulates parthenocarpy in Arabidopsis and tomato.

    Science.gov (United States)

    Goetz, Marc; Hooper, Lauren C; Johnson, Susan D; Rodrigues, Julio Carlyle Macedo; Vivian-Smith, Adam; Koltunow, Anna M

    2007-10-01

    Fruit initiation in Arabidopsis (Arabidopsis thaliana) is generally repressed until fertilization occurs. However, mutations in AUXIN RESPONSE FACTOR8 (ARF8) uncouple fruit initiation from fertilization, resulting in the formation of seedless, parthenocarpic fruit. Here we induced parthenocarpy in wild-type Arabidopsis by introducing either the mutant genomic (g) Atarf8-4 sequence or gAtARF8:beta-glucuronidase translational fusion constructs by plant transformation. Silencing of endogenous AtARF8 transcription was not observed, indicating that the introduced, aberrant ARF8 transcripts were compromising the function of endogenous ARF8 and/or associated factors involved in suppressing fruit initiation. To analyze the role of ARF8 in tomato (Solanum lycopersicum) we initially emasculated 23 tomato cultivars to test for background parthenocarpy. Surprisingly, all had a predisposition to initiate fertilization-independent fruit growth. Expression of gAtarf8-4 in transgenic tomato ('Monalbo') resulted in a significant increase in the number and size of parthenocarpic fruit. Isolation of tomato ARF8 cDNA indicated significant sequence conservation with AtARF8. SlARF8 may therefore control tomato fruit initiation in a similar manner as AtARF8 does in Arabidopsis. Two SlARF8 cDNAs differing in size by 5 bp were found, both arising from the same gene. The smaller cDNA is a splice variant and is also present in Arabidopsis. We propose that low endogenous levels of the splice variant products might interfere with efficient formation/function of a complex repressing fruit initiation, thereby providing an explanation for the observed ovary expansion in tomato and also Arabidopsis after emasculation. Increasing the levels of aberrant Atarf8-4 transcripts may further destabilize formation/function of the complex in a dosage-dependent manner enhancing tomato parthenocarpic fruit initiation frequency and size and mimicking the parthenocarpic dehiscent silique phenotype found in

  7. Mining the active proteome of Arabidopsis thaliana

    Directory of Open Access Journals (Sweden)

    Renier A. L. Van Der Hoorn

    2011-11-01

    Full Text Available Assigning functions to the >30.000 proteins encoded by the Arabidopsis genome is a challenging task of the Arabidopsis Functional Genomics Network. Although genome-wide technologies like proteomics and transcriptomics have generated a wealth of information that significantly accelerated gene annotation, protein activities are poorly predicted by transcript or protein levels as protein activities are post-translationally regulated. To directly display protein activities in Arabidopsis proteomes, we developed and applied Activity-based Protein Profiling (ABPP. ABPP is based on the use of small molecule probes that react with the catalytic residues of distinct protein classes in an activity-dependent manner. Labeled proteins are separated and detected from proteins gels and purified and identified by mass spectrometry. Using probes of six different chemotypes we have displayed of activities of 76 Arabidopsis proteins. These proteins represent over ten different protein classes that contain over 250 Arabidopsis proteins, including cysteine- serine- and metallo-proteases, lipases, acyltransferases, and the proteasome. We have developed methods for identification of in vivo labeled proteins using click-chemistry and for in vivo imaging with fluorescent probes. In vivo labeling has revealed novel protein activities and unexpected subcellular activities of the proteasome. Labeling of extracts displayed several differential activities e.g. of the proteasome during immune response and methylesterases during infection. These studies illustrate the power of ABPP to display the functional proteome and testify to a successful interdisciplinary collaboration involving chemical biology, organic chemistry and proteomics.

  8. Bioavailability of nanoparticulate hematite to Arabidopsis thaliana

    International Nuclear Information System (INIS)

    The environmental effects and bioavailability of nanoparticulate iron (Fe) to plants are currently unknown. Here, plant bioavailability of synthesized hematite Fe nanoparticles was evaluated using Arabidopsis thaliana (A. thaliana) as a model. Over 56-days of growing wild-type A. thaliana, the nanoparticle-Fe and no-Fe treatments had lower plant biomass, lower chlorophyll concentrations, and lower internal Fe concentrations than the Fe-treatment. Results for the no-Fe and nanoparticle-Fe treatments were consistently similar throughout the experiment. These results suggest that nanoparticles (mean diameter 40.9 nm, range 22.3–67.0 nm) were not taken up and therefore not bioavailable to A. thaliana. Over 14-days growing wild-type and transgenic (Type I/II proton pump overexpression) A. thaliana, the Type I plant grew more than the wild-type in the nanoparticle-Fe treatment, suggesting Type I plants cope better with Fe limitation; however, the nanoparticle-Fe and no-Fe treatments had similar growth for all plant types. -- Highlights: ► Iron nanoparticles were synthesized and assessed for bioavailability to Arabidopsis. ► Arabidopsis grew better in the presence of EDTA-bound iron than nanoparticulate iron. ► Arabidopsis grew the same in the presence of nanoparticulate iron compared to no iron. -- Synthesized iron nanoparticles were not bioavailable to Arabidopsis thaliana in agar nutrient media

  9. The COP9 signalosome interacts with SCF UFO and participates in Arabidopsis flower development.

    Science.gov (United States)

    Wang, Xiping; Feng, Suhua; Nakayama, Naomi; Crosby, W L; Irish, Vivian; Deng, Xing Wang; Wei, Ning

    2003-05-01

    The COP9 signalosome (CSN) is involved in multiple developmental processes. It interacts with SCF ubiquitin ligases and deconjugates Nedd8/Rub1 from cullins (deneddylation). CSN is highly expressed in Arabidopsis floral tissues. To investigate the role of CSN in flower development, we examined the expression pattern of CSN in developing flowers. We report here that two csn1 partially deficient Arabidopsis strains exhibit aberrant development of floral organs, decline of APETALA3 (AP3) expression, and low fertility in addition to defects in shoot and inflorescence meristems. We show that UNUSUAL FLORAL ORGANS (UFO) forms a SCF(UFO) complex, which is associated with CSN in vivo. Genetic interaction analysis indicates that CSN is necessary for the gain-of-function activity of the F-box protein UFO in AP3 activation and in floral organ transformation. Compared with the previously reported csn5 antisense and csn1 null mutants, partial deficiency of CSN1 causes a reduction in the level of CUL1 in the mutant flowers without an obvious defect in CUL1 deneddylation. We conclude that CSN is an essential regulator of Arabidopsis flower development and suggest that CSN regulates Arabidopsis flower development in part by modulating SCF(UFO)-mediated AP3 activation. PMID:12724534

  10. Posttranslational modifications of FERREDOXIN-NADP+ OXIDOREDUCTASE in Arabidopsis chloroplasts.

    Science.gov (United States)

    Lehtimäki, Nina; Koskela, Minna M; Dahlström, Käthe M; Pakula, Eveliina; Lintala, Minna; Scholz, Martin; Hippler, Michael; Hanke, Guy T; Rokka, Anne; Battchikova, Natalia; Salminen, Tiina A; Mulo, Paula

    2014-12-01

    Rapid responses of chloroplast metabolism and adjustments to photosynthetic machinery are of utmost importance for plants' survival in a fluctuating environment. These changes may be achieved through posttranslational modifications of proteins, which are known to affect the activity, interactions, and localization of proteins. Recent studies have accumulated evidence about the crucial role of a multitude of modifications, including acetylation, methylation, and glycosylation, in the regulation of chloroplast proteins. Both of the Arabidopsis (Arabidopsis thaliana) leaf-type FERREDOXIN-NADP(+) OXIDOREDUCTASE (FNR) isoforms, the key enzymes linking the light reactions of photosynthesis to carbon assimilation, exist as two distinct forms with different isoelectric points. We show that both AtFNR isoforms contain multiple alternative amino termini and undergo light-responsive addition of an acetyl group to the α-amino group of the amino-terminal amino acid of proteins, which causes the change in isoelectric point. Both isoforms were also found to contain acetylation of a conserved lysine residue near the active site, while no evidence for in vivo phosphorylation or glycosylation was detected. The dynamic, multilayer regulation of AtFNR exemplifies the complex regulatory network systems controlling chloroplast proteins by a range of posttranslational modifications, which continues to emerge as a novel area within photosynthesis research. PMID:25301888

  11. A Journey Through a Leaf: Phenomics Analysis of Leaf Growth in Arabidopsis thaliana

    Science.gov (United States)

    Vanhaeren, Hannes; Gonzalez, Nathalie; Inzé, Dirk

    2015-01-01

    In Arabidopsis, leaves contribute to the largest part of the aboveground biomass. In these organs, light is captured and converted into chemical energy, which plants use to grow and complete their life cycle. Leaves emerge as a small pool of cells at the vegetative shoot apical meristem and develop into planar, complex organs through different interconnected cellular events. Over the last decade, numerous phenotyping techniques have been developed to visualize and quantify leaf size and growth, leading to the identification of numerous genes that contribute to the final size of leaves. In this review, we will start at the Arabidopsis rosette level and gradually zoom in from a macroscopic view on leaf growth to a microscopic and molecular view. Along this journey, we describe different techniques that have been key to identify important events during leaf development and discuss approaches that will further help unraveling the complex cellular and molecular mechanisms that underlie leaf growth. PMID:26217168

  12. Recent Progress in Arabidopsis Research in China: A Preface

    Institute of Scientific and Technical Information of China (English)

    Zhi-Hong Xu

    2006-01-01

    @@ In 2002, a workshop on Arabidopsis research in China was held in Shanghai, when a small group of Chinese plant scientists was working on this model species. Since then, we have witnessed the rapid growth of Arabidopsis research in China. This special issue of Journal of Integrative Plant Biology is dedicated exclusively to the Fourth Workshop on Arabidopsis Research in China, scheduled on November 30, 2005, in Beijing. In addition to reports collected in this special issue, the Chinese Arabidopsis community has been able to make significant contributions to many research fields. Here, I briefly summarize recent advances in Arabidopsis research in China.

  13. The arabidopsis cyclic nucleotide interactome

    KAUST Repository

    Donaldson, Lara

    2016-05-11

    Background Cyclic nucleotides have been shown to play important signaling roles in many physiological processes in plants including photosynthesis and defence. Despite this, little is known about cyclic nucleotide-dependent signaling mechanisms in plants since the downstream target proteins remain unknown. This is largely due to the fact that bioinformatics searches fail to identify plant homologs of protein kinases and phosphodiesterases that are the main targets of cyclic nucleotides in animals. Methods An affinity purification technique was used to identify cyclic nucleotide binding proteins in Arabidopsis thaliana. The identified proteins were subjected to a computational analysis that included a sequence, transcriptional co-expression and functional annotation analysis in order to assess their potential role in plant cyclic nucleotide signaling. Results A total of twelve cyclic nucleotide binding proteins were identified experimentally including key enzymes in the Calvin cycle and photorespiration pathway. Importantly, eight of the twelve proteins were shown to contain putative cyclic nucleotide binding domains. Moreover, the identified proteins are post-translationally modified by nitric oxide, transcriptionally co-expressed and annotated to function in hydrogen peroxide signaling and the defence response. The activity of one of these proteins, GLYGOLATE OXIDASE 1, a photorespiratory enzyme that produces hydrogen peroxide in response to Pseudomonas, was shown to be repressed by a combination of cGMP and nitric oxide treatment. Conclusions We propose that the identified proteins function together as points of cross-talk between cyclic nucleotide, nitric oxide and reactive oxygen species signaling during the defence response.

  14. ASK1 physically interacts with COI1 and is required for male fertility in Arabidopsis

    Institute of Scientific and Technical Information of China (English)

    戴良英; 徐领会; 黄大昉; 李栒; 罗宽; 官春云

    2002-01-01

    Jasmonates are a new class of plant hormones that play important roles in plant development and plant defense. The COI1 gene was previously shown to be required for jasmonate- regulated plant fertility and defense. We demonstrated for the first time that COI1 interacts with the Arabidopsis SKP1-LIKE1 (ASK1) to form a complex that is required for jasmonate action in planta. Functional analysis by antisense strategy showed that ASK1 is involved in male fertility.

  15. Identification of novel regulators of COP1-controlled morphogenesis in Arabidopsis thaliana

    OpenAIRE

    Schrader, Andrea

    2011-01-01

    In Arabidopsis thaliana, COP1 is an essential element of light signal transduction acting downstream of photoreceptors and upstream of light-regulated gene expression. The COP1 protein acts as part of an E3 ligase complex to suppress photomorphogenic gene expression by ubiquitin-dependent degradation of light-regulated transcription factors. In dark-grown seedlings, the repression of photomorphogenesis involves the inhibition of hypocotyl growth, anthocyanin accumulation, expre...

  16. Seed coat mucilage cells of Arabidopsis thaliana as a model for plant cell wall research

    OpenAIRE

    Arsovski, Andrej A; Haughn, George W; Western, Tamara L.

    2010-01-01

    Plant cells are encased within a complex polysaccharide wall that strengthens the cell and has key roles in all aspects of plant cell growth, differentiation and interaction with the environment. This dynamic structure is under continual modification during plant development, and its synthesis and modification require the activity of a myriad of enzymes. The mucilage secretory cells (MSCs) of the Arabidopsis thaliana seed coat provide a model for the discovery of novel genes involved in the s...

  17. Molecular Biology, Biochemistry and Cellular Physiology of Cysteine Metabolism in Arabidopsis thaliana

    OpenAIRE

    Hell, Rüdiger; Wirtz, Markus

    2011-01-01

    Cysteine is one of the most versatile molecules in biology, taking over such different functions as catalysis, structure, regulation and electron transport during evolution. Research on Arabidopsis has contributed decisively to the understanding of cysteine synthesis and its role in the assimilatory pathways of S, N and C in plants. The multimeric cysteine synthase complex is present in the cytosol, plastids and mitochondria and forms the centre of a unique metabolic sensing and signaling sys...

  18. ATR cooperates with CTC1 and STN1 to maintain telomeres and genome integrity in Arabidopsis

    OpenAIRE

    Boltz, Kara A.; Leehy, Katherine; Song, Xiangyu; Nelson, Andrew D.; Shippen, Dorothy E.

    2012-01-01

    The CTC1/STN1/TEN1 (CST) complex is an essential constituent of plant and vertebrate telomeres. Here we show that CST and ATR (ataxia telangiectasia mutated [ATM] and Rad3-related) act synergistically to maintain telomere length and genome stability in Arabidopsis. Inactivation of ATR, but not ATM, temporarily rescued severe morphological phenotypes associated with ctc1 or stn1. Unexpectedly, telomere shortening accelerated in plants lacking CST and ATR. In first-generation (G1) ctc1 atr muta...

  19. Proteomics of loosely bound cell wall proteins of Arabidopsis thaliana cell suspension cultures: a critical analysis.

    OpenAIRE

    Borderies, Gisèle; Jamet, Elisabeth; Lafitte, Claude; Rossignol, Michel; Jauneau, Alain; Boudart, Georges; Monsarrat, Bernard; Esquerré-Tugayé, Marie-Thérèse; Boudet, Alain; Pont-Lezica, Rafael

    2003-01-01

    The complete sequencing of the Arabidopsis thaliana genome allows the use of the recently developed mass spectrometry techniques to identify the cell wall proteins (CWPs). Most proteomic approaches depend on the quality of sample preparation. Extraction of CWPs is particularly complex since the proteins may be free in the apoplast or are embedded in a polysaccharide matrix where they are retained by Van der Waals interactions, hydrogen bonds, hydrophobic or ionic interactions, or cross-linked...

  20. “Rhizoponics”: a novel hydroponic rhizotron for root system analyses on mature Arabidopsis thaliana plants

    OpenAIRE

    Mathieu, Laura; Lobet, Guillaume; Tocquin, Pierre; Périlleux, Claire

    2015-01-01

    Background Well-developed and functional roots are critical to support plant life and reach high crop yields. Their study however, is hampered by their underground growth and characterizing complex root system architecture (RSA) therefore remains a challenge. In the last few years, several phenotyping methods, including rhizotrons and x-ray computed tomography, have been developed for relatively thick roots. But in the model plant Arabidopsis thaliana, in vitro culture remains the easiest and...

  1. Making sense of hormone-mediated defense networking: from rice to Arabidopsis

    OpenAIRE

    De Vleesschauwer, David; Xu, Jing; Höfte, Monica

    2014-01-01

    Phytohormones are not only essential for plant growth and development but also play central roles in triggering the plant immune signaling network. Historically, research aimed at elucidating the defense-associated role of hormones has tended to focus on the use of experimentally tractable dicot plants such as Arabidopsis thaliana. Emerging from these studies is a picture whereby complex crosstalk and induced hormonal changes mold plant health and disease, with outcomes largely dependent on t...

  2. Post-transcriptional regulation of ethylene perception and signaling in Arabidopsis

    Energy Technology Data Exchange (ETDEWEB)

    Schaller, George Eric

    2014-03-19

    The simple gas ethylene functions as an endogenous regulator of plant growth and development, and modulates such energy relevant processes as photosynthesis and biomass accumulation. Ethylene is perceived in the plant Arabidopsis by a five-member family of receptors related to bacterial histidine kinases. Our data support a general model in which the receptors exist as parts of larger protein complexes. Our goals have been to (1) characterize physical interactions among members of the signaling complex; (2) the role of histidine-kinase transphosphorylation in signaling by the complex; and (3) the role of a novel family of proteins that regulate signal output by the receptors.

  3. Final Report [Function of the Arabidopsis TIR1 gene in auxin response

    Energy Technology Data Exchange (ETDEWEB)

    Estelle, Mark

    2000-12-18

    During this grant period substantial progress was made in the characterization of the TIR1 gene in Arabidopsis. Studies showed that the TIR1 protein is part of a protein complex that includes AtCUL1, ASK1 and RBX1. This complex, called SCF-TIR1, functions in the ubiquitin-mediated protein degradation pathway. Our work is the first report of an SCF complex in a plant system. The results of our studies are described in more detail in the report together with a publication resulting from this study.

  4. Isolation of Promoters and Fragments of Genes Controlling Endosperm Development Without Fertilization in Arabidopsis and Engineering of the Antisense Constructions

    Directory of Open Access Journals (Sweden)

    Grigory A. Gerashchenkov

    2015-06-01

    Full Text Available Apomixis is asexual seed reproduction without both meiosis and fertilization based on the complex developmental processes such as apomeiosis, parthenogenesis and specific endosperm development. This investigation is aimed at engineering of apomixis in Arabidopsis thaliana with sexual seed reproduction. The fragments of known genes of endosperm formation MEA, FIE, FIS2 and gene of apomeiosis DYAD (as control were isolated using Q5 high fidelity DNA polymerase. These gene fragments of interest at the antisense orientation were fused with isolated constitutive and meiosis specific promoters of Arabidopsis at NcoI sites. The fused promoter-gene fragment modules were cloned in pCambia1301 at SalI cites. The engineered constructions will be used for the floral dip transformation of Arabidopsis and down regulation of these genes at engineering of apomixis.

  5. Arabidopsis CDS blastp result: AK243152 [KOME

    Lifescience Database Archive (English)

    Full Text Available ase PP1 isozyme 4 (EC 3.1.3.16) {Arabidopsis thaliana}, phosphoprotein phosphatase 1 GI:166801 (Arabidopsis thaliana); contains...P1 isozyme 4 (TOPP4) / phosphoprotein phosphatase 1 identical to SP|P48484 Serine/threonine protein phosphat... a Ser/Thr protein phosphatase signature (PDOC00115); contains a metallo-phosphoesterase motif (QDOC50185) 1e-154 ... ...AK243152 J100032N02 At2g39840.1 68415.m04893 serine/threonine protein phosphatase P

  6. Arabidopsis CDS blastp result: AK288069 [KOME

    Lifescience Database Archive (English)

    Full Text Available ase PP1 isozyme 4 (EC 3.1.3.16) {Arabidopsis thaliana}, phosphoprotein phosphatase 1 GI:166801 (Arabidopsis thaliana); contains...P1 isozyme 4 (TOPP4) / phosphoprotein phosphatase 1 identical to SP|P48484 Serine/threonine protein phosphat... a Ser/Thr protein phosphatase signature (PDOC00115); contains a metallo-phosphoesterase motif (QDOC50185) 6e-70 ... ...AK288069 J075158N05 At2g39840.1 68415.m04893 serine/threonine protein phosphatase P

  7. Gibberellins control fruit patterning in Arabidopsis thaliana.

    Science.gov (United States)

    Arnaud, Nicolas; Girin, Thomas; Sorefan, Karim; Fuentes, Sara; Wood, Thomas A; Lawrenson, Tom; Sablowski, Robert; Østergaard, Lars

    2010-10-01

    The Arabidopsis basic helix-loop-helix (bHLH) proteins INDEHISCENT (IND) and ALCATRAZ (ALC) specify tissues required for fruit opening that have major roles in seed dispersal and plant domestication. Here, we show that synthesis of the phytohormone gibberellin is a direct and necessary target of IND, and that ALC interacts directly with DELLA repressors, which antagonize ALC function but are destabilized by gibberellin. Thus, the gibberellin/DELLA pathway has a key role in patterning the Arabidopsis fruit, and the interaction between DELLA and bHLH proteins, previously shown to connect gibberellin and light responses, is a versatile regulatory module also used in tissue patterning. PMID:20889713

  8. Regulation of Arabidopsis root development by small signaling peptides

    Directory of Open Access Journals (Sweden)

    Christina eDelay

    2013-09-01

    Full Text Available Plant root systems arise de novo from a single embryonic root. Complex and highly coordinated developmental networks are required to ensure the formation of lateral organs maximises plant fitness. The Arabidopsis root is well suited to dissection of regulatory and developmental networks due to its highly ordered, predictable structure. A myriad of regulatory signalling networks control the development of plant roots, from the classical hormones such as auxin and cytokinin to short-range positional signalling molecules that relay information between neighbouring cells. Small signaling peptides are a growing class of regulatory molecules involved in many aspects of root development including meristem maintenance, the gravitropic response, lateral root development and vascular formation. Here, recent findings on the roles of regulatory peptides in these aspects of root development are discussed.

  9. Arabidopsis CDS blastp result: AK066771 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK066771 J013083K07 At1g01170.1 ozone-responsive stress-related protein, putative s...imilar to stress-related ozone-induced protein AtOZI1 (GI:790583) [Arabidopsis thaliana]; contains 1 predicted transmembrane domain; 2e-29 ...

  10. Arabidopsis CDS blastp result: AK059353 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK059353 001-026-D01 At1g01170.1 ozone-responsive stress-related protein, putative ...similar to stress-related ozone-induced protein AtOZI1 (GI:790583) [Arabidopsis thaliana]; contains 1 predicted transmembrane domain; 2e-29 ...

  11. Arabidopsis CDS blastp result: AK059160 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK059160 001-023-D05 At1g01170.1 ozone-responsive stress-related protein, putative ...similar to stress-related ozone-induced protein AtOZI1 (GI:790583) [Arabidopsis thaliana]; contains 1 predicted transmembrane domain; 3e-28 ...

  12. Arabidopsis CDS blastp result: AK242849 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242849 J090072M15 At1g68370.1 68414.m07809 gravity -responsive protein / altered response to gravity ... ty protein (ARG1) identical to Altered Response to Gravity ... [Arabidopsis thaliana] GI:4249662; contains Pfam p ...

  13. Arabidopsis CDS blastp result: AK288959 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK288959 J090084E19 At1g68370.1 68414.m07809 gravity -responsive protein / altered response to gravity ... ty protein (ARG1) identical to Altered Response to Gravity ... [Arabidopsis thaliana] GI:4249662; contains Pfam p ...

  14. Arabidopsis CDS blastp result: AK243008 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243008 J090097H12 At1g68370.1 68414.m07809 gravity -responsive protein / altered response to gravity ... ty protein (ARG1) identical to Altered Response to Gravity ... [Arabidopsis thaliana] GI:4249662; contains Pfam p ...

  15. Arabidopsis CDS blastp result: AK288072 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK288072 J075161I05 At1g68370.1 68414.m07809 gravity -responsive protein / altered response to gravity ... ty protein (ARG1) identical to Altered Response to Gravity ... [Arabidopsis thaliana] GI:4249662; contains Pfam p ...

  16. Arabidopsis CDS blastp result: AK243178 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243178 J100036P15 At1g68370.1 68414.m07809 gravity -responsive protein / altered response to gravity ... ty protein (ARG1) identical to Altered Response to Gravity ... [Arabidopsis thaliana] GI:4249662; contains Pfam p ...

  17. Arabidopsis CDS blastp result: AK243505 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243505 J100074N19 At1g68370.1 68414.m07809 gravity -responsive protein / altered response to gravity ... ty protein (ARG1) identical to Altered Response to Gravity ... [Arabidopsis thaliana] GI:4249662; contains Pfam p ...

  18. Arabidopsis CDS blastp result: AK287577 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK287577 J065037N08 At1g68370.1 68414.m07809 gravity -responsive protein / altered response to gravity ... ty protein (ARG1) identical to Altered Response to Gravity ... [Arabidopsis thaliana] GI:4249662; contains Pfam p ...

  19. Arabidopsis CDS blastp result: AK241402 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241402 J065159A02 At4g19070.1 68417.m02810 cadmium-responsive protein / cadmium i...nduced protein (AS8) identical to cadmium induced protein AS8 SP:P42735 from [Arabidopsis thaliana] 3e-11 ...

  20. Arabidopsis CDS blastp result: AK242143 [KOME

    Lifescience Database Archive (English)

    Full Text Available ar to GI:6573119 from [Lycopersicon esculentum] (Plant Physiol. 122 (1), 292 (2000)) 3e-12 ... ... identical to SP|Q9C888 Phospholipase D epsilon (EC 3.1.4.4) (AtPLDepsilon) (PLD epsilon) (PLDalpha3) {Arabidopsis thaliana}; simil

  1. Arabidopsis CDS blastp result: AK242143 [KOME

    Lifescience Database Archive (English)

    Full Text Available ar to GI:6573119 from [Lycopersicon esculentum] (Plant Physiol. 122 (1), 292 (2000)) 6e-22 ... ... identical to SP|Q9C888 Phospholipase D epsilon (EC 3.1.4.4) (AtPLDepsilon) (PLD epsilon) (PLDalpha3) {Arabidopsis thaliana}; simil

  2. Arabidopsis CDS blastp result: AK240654 [KOME

    Lifescience Database Archive (English)

    Full Text Available ar to GI:6573119 from [Lycopersicon esculentum] (Plant Physiol. 122 (1), 292 (2000)) 1e-160 ... ... identical to SP|Q9C888 Phospholipase D epsilon (EC 3.1.4.4) (AtPLDepsilon) (PLD epsilon) (PLDalpha3) {Arabidopsis thaliana}; simil

  3. Arabidopsis CDS blastp result: AK242290 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242290 J075191E07 At4g13870.1 68417.m02148 Werner Syndrome-like exonuclease (WEX)... contains Pfam profile PF01612: 3'-5' exonuclease; identical to Werner Syndrome-like exonuclease [Arabidopsis thaliana] GP:28195109 gb:AAO33765 1e-20 ...

  4. Arabidopsis CDS blastp result: AK063585 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK063585 001-118-A04 At4g13870.2 Werner Syndrome-like exonuclease (WEX) contains Pf...am profile PF01612: 3'-5' exonuclease; identical to Werner Syndrome-like exonuclease [Arabidopsis thaliana] GP:28195109 gb:AAO33765 6e-16 ...

  5. Arabidopsis CDS blastp result: AK242290 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242290 J075191E07 At4g13870.2 68417.m02149 Werner Syndrome-like exonuclease (WEX)... contains Pfam profile PF01612: 3'-5' exonuclease; identical to Werner Syndrome-like exonuclease [Arabidopsis thaliana] GP:28195109 gb:AAO33765 1e-20 ...

  6. Arabidopsis CDS blastp result: AK243230 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243230 J100044L04 At1g19850.1 68414.m02490 transcription factor MONOPTEROS (MP) /... auxin-responsive protein (IAA24) / auxin response factor 5 (ARF5) identical to transcription factor MONOPTEROS (MP/IAA24/ARF5) SP:P93024 from [Arabidopsis thaliana] 2e-65 ...

  7. Arabidopsis CDS blastp result: AK103452 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK103452 J033129I11 At1g19850.1 transcription factor MONOPTEROS (MP) / auxin-respon...sive protein (IAA24) / auxin response factor 5 (ARF5) identical to transcription factor MONOPTEROS (MP/IAA24/ARF5) SP:P93024 from [Arabidopsis thaliana] 1e-166 ...

  8. Arabidopsis CDS blastp result: AK318617 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK318617 J100090H20 At1g19850.1 68414.m02490 transcription factor MONOPTEROS (MP) /... auxin-responsive protein (IAA24) / auxin response factor 5 (ARF5) identical to transcription factor MONOPTEROS (MP/IAA24/ARF5) SP:P93024 from [Arabidopsis thaliana] 2e-63 ...

  9. Arabidopsis CDS blastp result: AK287832 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK287832 J065187F20 At1g30950.1 68414.m03790 unusual floral organ (UFO ) / F-box family protein ( ... ubunit; almost identical to unusual floral organs (UFO )GI:4376159 from [Arabidopsis thaliana] Landsberg-e ...

  10. Arabidopsis CDS blastp result: AK241547 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241547 J065176G22 At1g30950.1 68414.m03790 unusual floral organ (UFO ) / F-box family protein ( ... ubunit; almost identical to unusual floral organs (UFO )GI:4376159 from [Arabidopsis thaliana] Landsberg-e ...

  11. Arabidopsis CDS blastp result: AK242616 [KOME

    Lifescience Database Archive (English)

    Full Text Available ve contains PF00481: Protein phosphatase 2C domain; identical to protein phosphatase 2C (GI:4587992) [Arabidopsis thaliana] 2e-34 ... ...AK242616 J090017C19 At2g40180.1 68415.m04941 protein phosphatase 2C, putative / PP2C, putati

  12. Arabidopsis CDS blastp result: AK242846 [KOME

    Lifescience Database Archive (English)

    Full Text Available ve contains PF00481: Protein phosphatase 2C domain; identical to protein phosphatase 2C (GI:4587992) [Arabidopsis thaliana] 9e-12 ... ...AK242846 J090071I10 At2g40180.1 68415.m04941 protein phosphatase 2C, putative / PP2C, putati

  13. Arabidopsis CDS blastp result: AK241162 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241162 J065116A05 At5g54800.1 68418.m06826 glucose-6-phosphate/phosphate translocator, putative identic...al to glucose 6 phosphate/phosphate translocator [Arabidopsis thaliana] gi|7229675|gb|AAF42936 2e-11 ...

  14. Arabidopsis CDS blastp result: AK242098 [KOME

    Lifescience Database Archive (English)

    Full Text Available ve contains PF00481: Protein phosphatase 2C domain; identical to protein phosphatase 2C (GI:4587992) [Arabidopsis thaliana] 3e-22 ... ...AK242098 J075143H11 At2g40180.1 68415.m04941 protein phosphatase 2C, putative / PP2C, putati

  15. Arabidopsis CDS blastp result: AK243041 [KOME

    Lifescience Database Archive (English)

    Full Text Available ve contains PF00481: Protein phosphatase 2C domain; identical to protein phosphatase 2C (GI:4587992) [Arabidopsis thaliana] 4e-31 ... ...AK243041 J100008G07 At2g40180.1 68415.m04941 protein phosphatase 2C, putative / PP2C, putati

  16. Arabidopsis CDS blastp result: AK243539 [KOME

    Lifescience Database Archive (English)

    Full Text Available ve contains PF00481: Protein phosphatase 2C domain; identical to protein phosphatase 2C (GI:4587992) [Arabidopsis thaliana] 6e-34 ... ...AK243539 J100078G04 At2g40180.1 68415.m04941 protein phosphatase 2C, putative / PP2C, putati

  17. Arabidopsis CDS blastp result: AK242576 [KOME

    Lifescience Database Archive (English)

    Full Text Available ve contains PF00481: Protein phosphatase 2C domain; identical to protein phosphatase 2C (GI:4587992) [Arabidopsis thaliana] 3e-22 ... ...AK242576 J090009A15 At2g40180.1 68415.m04941 protein phosphatase 2C, putative / PP2C, putati

  18. Arabidopsis CDS blastp result: AK289111 [KOME

    Lifescience Database Archive (English)

    Full Text Available ve contains PF00481: Protein phosphatase 2C domain; identical to protein phosphatase 2C (GI:4587992) [Arabidopsis thaliana] 5e-20 ... ...AK289111 J090096N14 At2g40180.1 68415.m04941 protein phosphatase 2C, putative / PP2C, putati

  19. Arabidopsis CDS blastp result: AK289248 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK289248 J100079D02 At5g54800.1 68418.m06826 glucose-6-phosphate/phosphate translocator, putative identic...al to glucose 6 phosphate/phosphate translocator [Arabidopsis thaliana] gi|7229675|gb|AAF42936 7e-19 ...

  20. Arabidopsis CDS blastp result: AK287695 [KOME

    Lifescience Database Archive (English)

    Full Text Available ve contains PF00481: Protein phosphatase 2C domain; identical to protein phosphatase 2C (GI:4587992) [Arabidopsis thaliana] 3e-81 ... ...AK287695 J065129B08 At2g40180.1 68415.m04941 protein phosphatase 2C, putative / PP2C, putati

  1. Arabidopsis CDS blastp result: AK243048 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243048 J100010D20 At1g07370.1 68414.m00786 proliferating cell nuclear ... antigen 1 (PCNA1) identi ... cal to SP|Q9M7Q7 Proliferating cellular nuclear ... antigen 1 (PCNA 1) {Arabidopsis thaliana}; nearly ... identical to SP|Q43124 Proliferating cell nuclear ... antigen (PCNA) {Brassica napus}; contains Pfam pro ...

  2. Arabidopsis CDS blastp result: AK071591 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK071591 J023105C08 At2g29570.1 proliferating cell nuclear ... antigen 2 (PCNA2) identical to SP|Q9Z ... W35 Proliferating cell nuclear ... antigen 2 (PCNA 2) {Arabidopsis thaliana}; nearly ... identical to SP|Q43124 Proliferating cell nuclear ... antigen (PCNA) {Brassica napus}; contains Pfam pro ...

  3. Arabidopsis CDS blastp result: AK243048 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243048 J100010D20 At2g29570.1 68415.m03591 proliferating cell nuclear ... antigen 2 (PCNA2) identi ... cal to SP|Q9ZW35 Proliferating cell nuclear ... antigen 2 (PCNA 2) {Arabidopsis thaliana}; nearly ... identical to SP|Q43124 Proliferating cell nuclear ... antigen (PCNA) {Brassica napus}; contains Pfam pro ...

  4. Arabidopsis CDS blastp result: AK241265 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241265 J065132C02 At3g19450.1 68416.m02466 cinnamyl-alcohol dehydrogenase (CAD ) identical to S ... 523 Cinnamyl-alcohol dehydrogenase (EC 1.1.1.195) (CAD ) [Arabidopsis thaliana] 1e-81 ...

  5. Arabidopsis CDS blastp result: AK105739 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK105739 001-202-A05 At3g19450.1 cinnamyl-alcohol dehydrogenase (CAD ) identical to SP|P48523 Cin ... namyl-alcohol dehydrogenase (EC 1.1.1.195) (CAD ) [Arabidopsis thaliana] 2e-46 ...

  6. Arabidopsis CDS blastp result: AK243022 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243022 J100001E20 At3g19450.1 68416.m02466 cinnamyl-alcohol dehydrogenase (CAD ) identical to S ... 523 Cinnamyl-alcohol dehydrogenase (EC 1.1.1.195) (CAD ) [Arabidopsis thaliana] 4e-64 ...

  7. Arabidopsis CDS blastp result: AK287708 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK287708 J065132C02 At3g19450.1 68416.m02466 cinnamyl-alcohol dehydrogenase (CAD ) identical to S ... 523 Cinnamyl-alcohol dehydrogenase (EC 1.1.1.195) (CAD ) [Arabidopsis thaliana] 1e-81 ...

  8. Arabidopsis CDS blastp result: AK121261 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK121261 J023104H13 At1g55350.4 calpain-type cysteine protease family identical to calpain...-like protein GI:20268660 from [Arabidopsis thaliana]; contains Pfam profiles: PF00648 Calpain family... cysteine protease, PF01067 Calpain large subunit,domain III; identical to cDNA calpain-like protein GI:20268659 0.0 ...

  9. Arabidopsis CDS blastp result: AK100867 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK100867 J023124E13 At2g29640.1 josephin family protein contains Pfam domain PF02099: Jose...phin; similar to Josephin-like protein (Swiss-Prot:O82391) [Arabidopsis thaliana] 7e-59 ...

  10. Arabidopsis CDS blastp result: AK243512 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243512 J100075C18 At4g16280.3 68417.m02471 flowering time ... control protein / FCA gamma (FCA) id ... entical to SP|O04425 Flowering time ... control protein FCA {Arabidopsis thaliana}; four a ...

  11. Arabidopsis CDS blastp result: AK243512 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243512 J100075C18 At4g16280.2 68417.m02470 flowering time ... control protein / FCA gamma (FCA) id ... entical to SP|O04425 Flowering time ... control protein FCA {Arabidopsis thaliana}; four a ...

  12. Arabidopsis CDS blastp result: AK242890 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242890 J090079L19 At5g16910.1 68418.m01982 cellulose synthase family protein similar to gi:2827143 cellulo...se synthase catalytic subunit, Arabidopsis thaliana, gi:9622886 cellulose synthase-7 from Zea mays 1e-130 ...

  13. Arabidopsis CDS blastp result: AK242585 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242585 J090010M20 At5g16910.1 68418.m01982 cellulose synthase family protein similar to gi:2827143 cellulo...se synthase catalytic subunit, Arabidopsis thaliana, gi:9622886 cellulose synthase-7 from Zea mays 2e-65 ...

  14. Arabidopsis CDS blastp result: AK110534 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK110534 002-168-A07 At5g16910.1 cellulose synthase family protein similar to gi:2827143 cellulose... synthase catalytic subunit, Arabidopsis thaliana, gi:9622886 cellulose synthase-7 from Zea mays 1e-114 ...

  15. Arabidopsis CDS blastp result: AK242585 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242585 J090010M20 At1g32180.1 68414.m03958 cellulose synthase family protein similar to cellulose... synthase catalytic subunit gi:2827143 from [Arabidopsis thaliana], cellulose synthase-9 (gi:9622890) from Zea mays 1e-24 ...

  16. Arabidopsis CDS blastp result: AK242601 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242601 J090014G03 At5g16910.1 68418.m01982 cellulose synthase family protein similar to gi:2827143 cellulo...se synthase catalytic subunit, Arabidopsis thaliana, gi:9622886 cellulose synthase-7 from Zea mays 0.0 ...

  17. Arabidopsis CDS blastp result: AK242601 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242601 J090014G03 At2g32540.1 68415.m03975 cellulose synthase family protein similar to cellulose... synthase catalytic subunit from Arabidopsis thaliana [gi:5230423], cellulose synthase-5 from Zea mays [gi:9622882] 2e-45 ...

  18. Arabidopsis CDS blastp result: AK242585 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242585 J090010M20 At1g32180.1 68414.m03958 cellulose synthase family protein similar to cellulose... synthase catalytic subunit gi:2827143 from [Arabidopsis thaliana], cellulose synthase-9 (gi:9622890) from Zea mays 3e-66 ...

  19. Arabidopsis CDS blastp result: AK069071 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK069071 J023010H01 At2g32540.1 cellulose synthase family protein similar to cellulose... synthase catalytic subunit from Arabidopsis thaliana [gi:5230423], cellulose synthase-5 from Zea mays [gi:9622882] 1e-167 ...

  20. Arabidopsis CDS blastp result: AK242585 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242585 J090010M20 At4g23990.1 68417.m03448 cellulose synthase family protein similar to cellulose... synthase catalytic subunit from Arabidopsis thaliana [gi:5230423], cellulose synthase-5 from Zea mays [gi:9622882] 1e-124 ...

  1. Arabidopsis CDS blastp result: AK060286 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK060286 001-006-C08 At2g32540.1 cellulose synthase family protein similar to cellulose... synthase catalytic subunit from Arabidopsis thaliana [gi:5230423], cellulose synthase-5 from Zea mays [gi:9622882] 6e-78 ...

  2. Arabidopsis CDS blastp result: AK242601 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242601 J090014G03 At4g38190.1 68417.m05391 cellulose synthase family protein similar to cellulose... synthase catalytic subunit gi:2827143 from [Arabidopsis thaliana], cellulose synthase-5 (gi:9622882) from Zea mays 0.0 ...

  3. Arabidopsis CDS blastp result: AK242601 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242601 J090014G03 At2g32530.1 68415.m03974 cellulose synthase family protein similar to cellulose... synthase catalytic subunit from Arabidopsis thaliana [gi:5230423], cellulose synthase-5 from Zea mays [gi:9622882] 2e-29 ...

  4. Arabidopsis CDS blastp result: AK242601 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242601 J090014G03 At4g23990.1 68417.m03448 cellulose synthase family protein similar to cellulose... synthase catalytic subunit from Arabidopsis thaliana [gi:5230423], cellulose synthase-5 from Zea mays [gi:9622882] 5e-25 ...

  5. Arabidopsis CDS blastp result: AK242585 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242585 J090010M20 At5g16910.1 68418.m01982 cellulose synthase family protein similar to gi:2827143 cellulo...se synthase catalytic subunit, Arabidopsis thaliana, gi:9622886 cellulose synthase-7 from Zea mays 1e-28 ...

  6. Arabidopsis CDS blastp result: AK105393 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK105393 001-123-B04 At5g16910.1 cellulose synthase family protein similar to gi:2827143 cellulose... synthase catalytic subunit, Arabidopsis thaliana, gi:9622886 cellulose synthase-7 from Zea mays 0.0 ...

  7. Arabidopsis CDS blastp result: AK242601 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242601 J090014G03 At4g23990.1 68417.m03448 cellulose synthase family protein similar to cellulose... synthase catalytic subunit from Arabidopsis thaliana [gi:5230423], cellulose synthase-5 from Zea mays [gi:9622882] 8e-25 ...

  8. Arabidopsis CDS blastp result: AK242890 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242890 J090079L19 At1g32180.1 68414.m03958 cellulose synthase family protein similar to cellulose... synthase catalytic subunit gi:2827143 from [Arabidopsis thaliana], cellulose synthase-9 (gi:9622890) from Zea mays 1e-126 ...

  9. Arabidopsis CDS blastp result: AK242585 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242585 J090010M20 At4g38190.1 68417.m05391 cellulose synthase family protein similar to cellulose... synthase catalytic subunit gi:2827143 from [Arabidopsis thaliana], cellulose synthase-5 (gi:9622882) from Zea mays 8e-63 ...

  10. Arabidopsis CDS blastp result: AK242890 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242890 J090079L19 At4g38190.1 68417.m05391 cellulose synthase family protein similar to cellulose... synthase catalytic subunit gi:2827143 from [Arabidopsis thaliana], cellulose synthase-5 (gi:9622882) from Zea mays 1e-125 ...

  11. Arabidopsis CDS blastp result: AK242601 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242601 J090014G03 At1g32180.1 68414.m03958 cellulose synthase family protein similar to cellulose... synthase catalytic subunit gi:2827143 from [Arabidopsis thaliana], cellulose synthase-9 (gi:9622890) from Zea mays 0.0 ...

  12. Arabidopsis CDS blastp result: AK242601 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242601 J090014G03 At4g23990.1 68417.m03448 cellulose synthase family protein similar to cellulose... synthase catalytic subunit from Arabidopsis thaliana [gi:5230423], cellulose synthase-5 from Zea mays [gi:9622882] 2e-26 ...

  13. Arabidopsis CDS blastp result: AK242890 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242890 J090079L19 At2g32540.1 68415.m03975 cellulose synthase family protein similar to cellulose... synthase catalytic subunit from Arabidopsis thaliana [gi:5230423], cellulose synthase-5 from Zea mays [gi:9622882] 4e-47 ...

  14. Arabidopsis CDS blastp result: AK242585 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242585 J090010M20 At2g32540.1 68415.m03975 cellulose synthase family protein similar to cellulose... synthase catalytic subunit from Arabidopsis thaliana [gi:5230423], cellulose synthase-5 from Zea mays [gi:9622882] 4e-98 ...

  15. Arabidopsis CDS blastp result: AK242585 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242585 J090010M20 At2g32530.1 68415.m03974 cellulose synthase family protein similar to cellulose... synthase catalytic subunit from Arabidopsis thaliana [gi:5230423], cellulose synthase-5 from Zea mays [gi:9622882] 8e-98 ...

  16. Arabidopsis CDS blastp result: AK109812 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK109812 002-147-H02 At5g16910.1 cellulose synthase family protein similar to gi:2827143 cellulose... synthase catalytic subunit, Arabidopsis thaliana, gi:9622886 cellulose synthase-7 from Zea mays 5e-90 ...

  17. Arabidopsis CDS blastp result: AK242601 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242601 J090014G03 At2g32540.1 68415.m03975 cellulose synthase family protein similar to cellulose... synthase catalytic subunit from Arabidopsis thaliana [gi:5230423], cellulose synthase-5 from Zea mays [gi:9622882] 3e-31 ...

  18. Arabidopsis CDS blastp result: AK121003 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK121003 J023045B21 At2g32540.1 cellulose synthase family protein similar to cellulose... synthase catalytic subunit from Arabidopsis thaliana [gi:5230423], cellulose synthase-5 from Zea mays [gi:9622882] 1e-167 ...

  19. Arabidopsis CDS blastp result: AK242601 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242601 J090014G03 At2g32530.1 68415.m03974 cellulose synthase family protein similar to cellulose... synthase catalytic subunit from Arabidopsis thaliana [gi:5230423], cellulose synthase-5 from Zea mays [gi:9622882] 5e-48 ...

  20. Arabidopsis CDS blastp result: AK242890 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242890 J090079L19 At4g23990.1 68417.m03448 cellulose synthase family protein similar to cellulose... synthase catalytic subunit from Arabidopsis thaliana [gi:5230423], cellulose synthase-5 from Zea mays [gi:9622882] 1e-45 ...

  1. Arabidopsis CDS blastp result: AK242585 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242585 J090010M20 At4g38190.1 68417.m05391 cellulose synthase family protein similar to cellulose... synthase catalytic subunit gi:2827143 from [Arabidopsis thaliana], cellulose synthase-5 (gi:9622882) from Zea mays 4e-27 ...

  2. Arabidopsis CDS blastp result: AK061162 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK061162 006-209-A01 At2g32540.1 cellulose synthase family protein similar to cellulose... synthase catalytic subunit from Arabidopsis thaliana [gi:5230423], cellulose synthase-5 from Zea mays [gi:9622882] 3e-35 ...

  3. Arabidopsis CDS blastp result: AK242890 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242890 J090079L19 At2g32530.1 68415.m03974 cellulose synthase family protein similar to cellulose... synthase catalytic subunit from Arabidopsis thaliana [gi:5230423], cellulose synthase-5 from Zea mays [gi:9622882] 4e-50 ...

  4. Arabidopsis CDS blastp result: AK066153 [KOME

    Lifescience Database Archive (English)

    Full Text Available pC almost identical to ClpC GI:2921158 from [Arabidopsis thaliana]; contains Pfam profile PF02861: Clp amino... terminal domain; contains Pfam profile PF00004: ATPase, AAA family; contains Pfam profile PF02151: UvrB/uvrC motif 0.0 ...

  5. Arabidopsis CDS blastp result: AK287906 [KOME

    Lifescience Database Archive (English)

    Full Text Available subunit / ClpC almost identical to ClpC GI:2921158 from [Arabidopsis thaliana]; contains Pfam profile PF028...61: Clp amino terminal domain; contains Pfam profile PF00004: ATPase, AAA family; contains Pfam profile PF02151: UvrB/uvrC motif 0.0 ...

  6. Arabidopsis CDS blastp result: AK069552 [KOME

    Lifescience Database Archive (English)

    Full Text Available pC almost identical to ClpC GI:2921158 from [Arabidopsis thaliana]; contains Pfam profile PF02861: Clp amino... terminal domain; contains Pfam profile PF00004: ATPase, AAA family; contains Pfam profile PF02151: UvrB/uvrC motif 0.0 ...

  7. Arabidopsis CDS blastp result: AK100126 [KOME

    Lifescience Database Archive (English)

    Full Text Available pC almost identical to ClpC GI:2921158 from [Arabidopsis thaliana]; contains Pfam profile PF02861: Clp amino... terminal domain; contains Pfam profile PF00004: ATPase, AAA family; contains Pfam profile PF02151: UvrB/uvrC motif 0.0 ...

  8. Arabidopsis CDS blastp result: AK058510 [KOME

    Lifescience Database Archive (English)

    Full Text Available lpC almost identical to ClpC GI:2921158 from [Arabidopsis thaliana]; contains Pfam profile PF02861: Clp amin...o terminal domain; contains Pfam profile PF00004: ATPase, AAA family; contains Pfam profile PF02151: UvrB/uvrC motif 0.0 ...

  9. Shotgun Proteomic Analysis of Arabidopsis thaliana Leaves

    Science.gov (United States)

    Two shotgun tandem mass spectrometry proteomics approaches, Multidimensional Protein Identification Technology (MudPIT) and 1D-Gel-LC-MS/MS, were used to identify Arabidopsis thaliana leaf proteins. These methods utilize different protein/peptide separation strategies. Detergents not compatible wit...

  10. Arabidopsis CDS blastp result: AK318553 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK318553 J075145A22 At4g11230.1 68417.m01819 respiratory burst ... oxidase, putative / NADPH oxidase ... , putative similar to respiratory burst ... oxidase homolog F [gi:3242456], RbohAp108 [gi:2654 ... 868] from Arabidopsis thaliana, respiratory burst ... oxidase homolog [GI:16549087] from Solanum tuberos ...

  11. Arabidopsis CDS blastp result: AK110694 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK110694 002-170-A08 At5g59560.2 sensitivity to red light reduced protein (SRR1) id...entical to sensitivity to red light reduced protein [Arabidopsis thaliana] GI:25527089; supporting cDNA gi|25527088|gb|AY127047.1| 1e-18 ...

  12. Arabidopsis CDS blastp result: AK099399 [KOME

    Lifescience Database Archive (English)

    Full Text Available 079; contains weak similarity to the SAPB protein (TR:E236624) [Arabidopsis thaliana]; similar to seven transme...AK099399 J013000O17 At3g05010.1 transmembrane protein, putative similar to GB:AAB61...mbrane domain orphan receptor (GI:4321619) [Mus musculus] contains 7 transmembrane domains; 2e-89 ...

  13. Arabidopsis CDS blastp result: AK241202 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241202 J065122B10 At3g20600.1 68416.m02607 non-race specific disease resistance protein (NDR1) ... protein (NDR1) GB:AF021346 [Arabidopsis thaliana] (Science ... 278 (5345), 1963-1965 (1997)) 2e-11 ...

  14. Arabidopsis CDS blastp result: AK240830 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK240830 J065014C16 At3g12280.1 68416.m01533 retinoblastoma-related protein (RBR1) nearly identical to retin...oblastoma-related protein [Arabidopsis thaliana] GI:8777927; contains Pfam profiles: PF01858 retinoblastoma...-associated protein A domain, PF01857 retinoblastoma-associated protein B domain 0.0 ...

  15. Arabidopsis CDS blastp result: AK121431 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK121431 J023138G19 At3g12280.1 retinoblastoma-related protein (RBR1) nearly identical to retinoblastoma...-related protein [Arabidopsis thaliana] GI:8777927; contains Pfam profiles: PF01858 retinoblastoma...-associated protein A domain, PF01857 retinoblastoma-associated protein B domain 0.0 ...

  16. Arabidopsis CDS blastp result: AK064987 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK064987 J013001D03 At3g12280.1 retinoblastoma-related protein (RBR1) nearly identical to retinoblastoma...-related protein [Arabidopsis thaliana] GI:8777927; contains Pfam profiles: PF01858 retinoblastoma...-associated protein A domain, PF01857 retinoblastoma-associated protein B domain 0.0 ...

  17. Arabidopsis CDS blastp result: AK241627 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241627 J065187G05 At3g12280.1 68416.m01533 retinoblastoma-related protein (RBR1) nearly identical to retin...oblastoma-related protein [Arabidopsis thaliana] GI:8777927; contains Pfam profiles: PF01858 retinoblastoma...-associated protein A domain, PF01857 retinoblastoma-associated protein B domain 0.0 ...

  18. Arabidopsis CDS blastp result: AK241568 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241568 J065179E12 At3g56700.1 68416.m06307 male ... sterility protein, putative similar to SP|Q088 ... 91 Male ... sterility protein 2 {Arabidopsis thaliana}; contai ... ns Pfam profile PF03015: Male ... sterility protein 2e-70 ...

  19. Arabidopsis CDS blastp result: AK242888 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242888 J090079L06 At3g56700.1 68416.m06307 male ... sterility protein, putative similar to SP|Q088 ... 91 Male ... sterility protein 2 {Arabidopsis thaliana}; contai ... ns Pfam profile PF03015: Male ... sterility protein 8e-81 ...

  20. Arabidopsis CDS blastp result: AK287630 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK287630 J065073I15 At5g22260.1 68418.m02593 male ... sterility 1 protein, putative (MS1) identical ... to male ... sterility 1 protein [Arabidopsis thaliana] gi|1555 ... fam profile PF00628: PHD-finger; identical to cDNA male ... sterility 1 protein (ms1 gene) GI:15554514 3e-78 ...

  1. Arabidopsis CDS blastp result: AK058440 [KOME

    Lifescience Database Archive (English)

    Full Text Available 20S proteasome beta subunit PBB1 (PBB1) GB:AAC32066 [Arabidopsis thaliana] (Genetics 149 (2), 677-692 (1998)); contains Pfam profile: PF00227 proteasome A-type and B-type; 1e-92 ...

  2. Arabidopsis CDS blastp result: AK119246 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK119246 001-121-C04 At5g26570.1 glycoside hydrolase starch -binding domain-containing protein si ... milar to SEX1 (starch ... excess) [Arabidopsis thaliana] GI:12044358; contai ... ns Pfam profile PF00686: Starch ... binding domain 1e-116 ...

  3. Arabidopsis CDS blastp result: AK072331 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK072331 J023039L19 At5g26570.1 glycoside hydrolase starch -binding domain-containing protein sim ... ilar to SEX1 (starch ... excess) [Arabidopsis thaliana] GI:12044358; contai ... ns Pfam profile PF00686: Starch ... binding domain 0.0 ...

  4. Arabidopsis CDS blastp result: AK107208 [KOME

    Lifescience Database Archive (English)

    Full Text Available Ala hydrolase, putative virtually identical to gr1-protein from [Arabidopsis thaliana] GI:3559811; similar t...AK107208 002-125-B11 At1g44350.1 IAA-amino acid hydrolase 6, putative (ILL6) / IAA-

  5. Arabidopsis CDS blastp result: AK072218 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK072218 J013167O21 At1g55350.4 calpain-type cysteine protease family identical to calpain...-like protein GI:20268660 from [Arabidopsis thaliana]; contains Pfam profiles: PF00648 Calpain family... cysteine protease, PF01067 Calpain large subunit,domain III; identical to cDNA calpain-like protein GI:20268659 1e-150 ...

  6. Arabidopsis CDS blastp result: AK287447 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK287447 J043016O04 At2g46590.1 68415.m05811 Dof zinc finger protein DAG2 / Dof affecting germination... 2 (DAG2) identical to SP|Q9ZPY0 DOF zinc finger protein DAG2 (Dof affecting germination 2) {Arabidopsis thaliana} 2e-30 ...

  7. Arabidopsis CDS blastp result: AK103126 [KOME

    Lifescience Database Archive (English)

    Full Text Available 0S proteasome beta subunit PBB1 (PBB1) GB:AAC32066 [Arabidopsis thaliana] (Genetics 149 (2), 677-692 (1998)); contains Pfam profile: PF00227 proteasome A-type and B-type; 1e-129 ...

  8. Arabidopsis CDS blastp result: AK243298 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243298 J100053J04 At3g30290.1 68416.m03825 cytochrome P450 family protein similar to Cytochrom ... similar to GB:C71417 from [Arabidopsis thaliana] (Nature ... 391 (6666), 485-488 (1998)) 2e-44 ...

  9. Arabidopsis CDS blastp result: AK241385 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241385 J065156D02 At3g30290.1 68416.m03825 cytochrome P450 family protein similar to Cytochrom ... similar to GB:C71417 from [Arabidopsis thaliana] (Nature ... 391 (6666), 485-488 (1998)) 1e-11 ...

  10. Arabidopsis CDS blastp result: AK241333 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241333 J065144I22 At3g30290.1 68416.m03825 cytochrome P450 family protein similar to Cytochrom ... similar to GB:C71417 from [Arabidopsis thaliana] (Nature ... 391 (6666), 485-488 (1998)) 2e-35 ...

  11. Arabidopsis CDS blastp result: AK240730 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK240730 J043030K09 At3g30290.1 68416.m03825 cytochrome P450 family protein similar to Cytochrom ... similar to GB:C71417 from [Arabidopsis thaliana] (Nature ... 391 (6666), 485-488 (1998)) 6e-11 ...

  12. Arabidopsis CDS blastp result: AK241521 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241521 J065170L14 At3g30290.1 68416.m03825 cytochrome P450 family protein similar to Cytochrom ... similar to GB:C71417 from [Arabidopsis thaliana] (Nature ... 391 (6666), 485-488 (1998)) 9e-32 ...

  13. Arabidopsis CDS blastp result: AK288402 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK288402 J090030B22 At3g30290.1 68416.m03825 cytochrome P450 family protein similar to Cytochrom ... similar to GB:C71417 from [Arabidopsis thaliana] (Nature ... 391 (6666), 485-488 (1998)) 7e-25 ...

  14. Arabidopsis CDS blastp result: AK241581 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241581 J065181K09 At3g30290.1 68416.m03825 cytochrome P450 family protein similar to Cytochrom ... similar to GB:C71417 from [Arabidopsis thaliana] (Nature ... 391 (6666), 485-488 (1998)) 7e-12 ...

  15. Engineering calcium oxalate crystal formation in Arabidopsis

    Science.gov (United States)

    Many plants accumulate crystals of calcium oxalate. Just how these crystals form remains unknown. To gain insight into the mechanisms regulating calcium oxalate crystal formation, a crystal engineering approach was initiated utilizing the non-crystal accumulating plant, Arabidopsis. The success of t...

  16. Arabidopsis CDS blastp result: AK288349 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK288349 J090023P19 At2g46590.1 68415.m05811 Dof zinc finger protein DAG2 / Dof affecting germination... 2 (DAG2) identical to SP|Q9ZPY0 DOF zinc finger protein DAG2 (Dof affecting germination 2) {Arabidopsis thaliana} 1e-23 ...

  17. Arabidopsis CDS blastp result: AK241364 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241364 J065152E11 At2g46590.1 68415.m05811 Dof zinc finger protein DAG2 / Dof affecting germination... 2 (DAG2) identical to SP|Q9ZPY0 DOF zinc finger protein DAG2 (Dof affecting germination 2) {Arabidopsis thaliana} 2e-20 ...

  18. Arabidopsis thaliana glucuronosyltransferase in family GT14.

    Science.gov (United States)

    Dilokpimol, Adiphol; Geshi, Naomi

    2014-01-01

    Arabinogalactan proteins are abundant cell-surface proteoglycans in plants and are involved in many cellular processes including somatic embryogenesis, cell-cell interactions, and cell elongation. We reported a glucuronosyltransferase encoded by Arabidopsis AtGlcAT14A, which catalyzes an addition of glucuronic acid residues to β-1,3- and β-1,6-linked galactans of arabinogalactan (Knoch et al. 2013). The knockout mutant of this gene resulted in the enhanced growth rate of hypocotyls and roots of seedlings, suggesting an involvement of AtGlcAT14A in cell elongation. AtGlcAt14A belongs to the family GT14 in the Carbohydrate Active Enzyme database (CAZy; www.cazy.org), in which a total of 11 proteins, including AtGLCAT14A, are classified from Arabidopsis thaliana. In this paper, we report the enzyme activities for the rest of the Arabidopsis GT14 isoforms, analyzed in the same way as for AtGlcAT14A. Evidently, two other Arabidopsis GT14 isoforms, At5g15050 and At2g37585, also possess the glucuronosyltransferase activity adding glucuronic acid residues to β-1,3- and β-1,6-linked galactans. Therefore, we named At5g15050 and At2g37585 as AtGlcAT14B and AtGlcAT14C, respectively. PMID:24739253

  19. Arabidopsis CDS blastp result: AK242817 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242817 J090063G17 At3g48560.1 68416.m05302 acetolactate synthase, chloroplast / acetohydroxy-a ... cid synthase (ALS ) nearly identical to SP|P17597 Acetolactate syntha ... ormerly EC 4.1.3.18) (Acetohydroxy-acid synthase) (ALS ) {Arabidopsis thaliana} 0.0 ...

  20. Arabidopsis CDS blastp result: AK058963 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK058963 001-020-C04 At3g48560.1 acetolactate synthase, chloroplast / acetohydroxy-acid synthase ... (ALS ) nearly identical to SP|P17597 Acetolactate syntha ... ormerly EC 4.1.3.18) (Acetohydroxy-acid synthase) (ALS ) {Arabidopsis thaliana} 2e-15 ...

  1. Arabidopsis CDS blastp result: AK109628 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK109628 002-138-C02 At3g48560.1 acetolactate synthase, chloroplast / acetohydroxy-acid synthase ... (ALS ) nearly identical to SP|P17597 Acetolactate syntha ... ormerly EC 4.1.3.18) (Acetohydroxy-acid synthase) (ALS ) {Arabidopsis thaliana} 0.0 ...

  2. Arabidopsis CDS blastp result: AK242722 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242722 J090045F10 At3g16857.2 68416.m02153 two-component responsive regulator fam...ily protein / response regulator family protein contains Pfam profile: PF00072 response regulator receiver domain; similar to... ARR1 protein GB:BAA74528 from [Arabidopsis thaliana] (Plant Cell Physiol. (1998) 39 (11), 1232-1239) 2e-22 ...

  3. Arabidopsis CDS blastp result: AK111864 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK111864 J033025G23 At3g16857.2 two-component responsive regulator family protein / response regulato...r family protein contains Pfam profile: PF00072 response regulator receiver domain; similar to... ARR1 protein GB:BAA74528 from [Arabidopsis thaliana] (Plant Cell Physiol. (1998) 39 (11), 1232-1239) 1e-92 ...

  4. Arabidopsis CDS blastp result: AK241362 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241362 J065151H17 At3g16857.1 68416.m02152 two-component responsive regulator fam...ily protein / response regulator family protein contains Pfam profile: PF00072 response regulator receiver domain; similar to... ARR1 protein GB:BAA74528 from [Arabidopsis thaliana] (Plant Cell Physiol. (1998) 39 (11), 1232-1239) 5e-13 ...

  5. Arabidopsis CDS blastp result: AK112039 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK112039 001-044-C11 At3g16857.2 two-component responsive regulator family protein / response regulato...r family protein contains Pfam profile: PF00072 response regulator receiver domain; similar to... ARR1 protein GB:BAA74528 from [Arabidopsis thaliana] (Plant Cell Physiol. (1998) 39 (11), 1232-1239) 4e-18 ...

  6. Arabidopsis CDS blastp result: AK111899 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK111899 J023034P21 At3g16857.2 two-component responsive regulator family protein / response regulato...r family protein contains Pfam profile: PF00072 response regulator receiver domain; similar to... ARR1 protein GB:BAA74528 from [Arabidopsis thaliana] (Plant Cell Physiol. (1998) 39 (11), 1232-1239) 1e-92 ...

  7. Arabidopsis CDS blastp result: AK242722 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242722 J090045F10 At3g16857.1 68416.m02152 two-component responsive regulator fam...ily protein / response regulator family protein contains Pfam profile: PF00072 response regulator receiver domain; similar to... ARR1 protein GB:BAA74528 from [Arabidopsis thaliana] (Plant Cell Physiol. (1998) 39 (11), 1232-1239) 2e-22 ...

  8. Arabidopsis CDS blastp result: AK241362 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241362 J065151H17 At3g16857.2 68416.m02153 two-component responsive regulator fam...ily protein / response regulator family protein contains Pfam profile: PF00072 response regulator receiver domain; similar to... ARR1 protein GB:BAA74528 from [Arabidopsis thaliana] (Plant Cell Physiol. (1998) 39 (11), 1232-1239) 5e-13 ...

  9. HYDROPONIC METHOD FOR CULTURING POPULATIONS OF ARABIDOPSIS

    Science.gov (United States)

    A plant life-cycle bioassay using Arabidopsis thaliana (L.) Heynh. was developed to detect potential chemical phytotoxicity. The bioassay requires large numbers of plants to maximize the probability of detecting deleterious effect and to avoid any bias that could occur if only a ...

  10. Arabidopsis CDS blastp result: AK119521 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK119521 001-202-D09 At3g57050.2 cystathionine beta-lyase, chloroplast / beta-cystathionase...thionase) (Cysteine lyase) {Arabidopsis thaliana} 1e-173 ... ... / cysteine lyase (CBL) identical to SP|P53780 Cystathionine beta-lyase, chloroplast precursor (EC 4.4.1.8) (CBL) (Beta-cysta

  11. Arabidopsis CDS blastp result: AK108403 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK108403 002-142-G06 At3g57050.2 cystathionine beta-lyase, chloroplast / beta-cystathionase...thionase) (Cysteine lyase) {Arabidopsis thaliana} 5e-36 ... ... / cysteine lyase (CBL) identical to SP|P53780 Cystathionine beta-lyase, chloroplast precursor (EC 4.4.1.8) (CBL) (Beta-cysta

  12. Arabidopsis CDS blastp result: AK065345 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK065345 J013008D19 At1g19720.1 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 1e-87 ...

  13. Arabidopsis CDS blastp result: AK243514 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243514 J100075D15 At1g33280.1 68414.m04116 no apical meristem (NAM) family protein similar to ... CUC1 (GP:12060422) {Arabidopsis thaliana} amd ... to NAM (GP:1279640) {Petunia x hybrida} 7e-40 ...

  14. Arabidopsis CDS blastp result: AK243585 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243585 J100082O14 At1g33280.1 68414.m04116 no apical meristem (NAM) family protein similar to ... CUC1 (GP:12060422) {Arabidopsis thaliana} amd ... to NAM (GP:1279640) {Petunia x hybrida} 5e-20 ...

  15. Arabidopsis CDS blastp result: AK287666 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK287666 J065117E22 At1g33280.1 68414.m04116 no apical meristem (NAM) family protein similar to ... CUC1 (GP:12060422) {Arabidopsis thaliana} amd ... to NAM (GP:1279640) {Petunia x hybrida} 1e-41 ...

  16. Arabidopsis CDS blastp result: AK242010 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242010 J075106F03 At1g33280.1 68414.m04116 no apical meristem (NAM) family protein similar to ... CUC1 (GP:12060422) {Arabidopsis thaliana} amd ... to NAM (GP:1279640) {Petunia x hybrida} 7e-14 ...

  17. Arabidopsis CDS blastp result: AK243244 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243244 J100046N20 At1g33280.1 68414.m04116 no apical meristem (NAM) family protein similar to ... CUC1 (GP:12060422) {Arabidopsis thaliana} amd ... to NAM (GP:1279640) {Petunia x hybrida} 4e-29 ...

  18. Arabidopsis CDS blastp result: AK288271 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK288271 J090017A22 At1g33280.1 68414.m04116 no apical meristem (NAM) family protein similar to ... CUC1 (GP:12060422) {Arabidopsis thaliana} amd ... to NAM (GP:1279640) {Petunia x hybrida} 3e-24 ...

  19. Arabidopsis CDS blastp result: AK242268 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242268 J075186C19 At1g33280.1 68414.m04116 no apical meristem (NAM) family protein similar to ... CUC1 (GP:12060422) {Arabidopsis thaliana} amd ... to NAM (GP:1279640) {Petunia x hybrida} 1e-45 ...

  20. Arabidopsis CDS blastp result: AK069545 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK069545 J023025I06 At5g13630.1 magnesium -chelatase subunit chlH, chloroplast, putative / Mg-pro ... IX chelatase, putative (CHLH) nearly identical to magnesium ... chelatase subunit GI:1154627 from [Arabidopsis tha ... liana]; contains Pfam profile: PF02514 CobN/magnesium ... chelatase family protein 0.0 ...

  1. Arabidopsis CDS blastp result: AK065420 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK065420 J013022D10 At5g13630.1 magnesium -chelatase subunit chlH, chloroplast, putative / Mg-pro ... IX chelatase, putative (CHLH) nearly identical to magnesium ... chelatase subunit GI:1154627 from [Arabidopsis tha ... liana]; contains Pfam profile: PF02514 CobN/magnesium ... chelatase family protein 1e-166 ...

  2. Arabidopsis CDS blastp result: AK062262 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK062262 001-047-H04 At5g13630.1 magnesium -chelatase subunit chlH, chloroplast, putative / Mg-pr ... IX chelatase, putative (CHLH) nearly identical to magnesium ... chelatase subunit GI:1154627 from [Arabidopsis tha ... liana]; contains Pfam profile: PF02514 CobN/magnesium ... chelatase family protein 0.0 ...

  3. Arabidopsis CDS blastp result: AK060612 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK060612 001-025-F03 At5g13630.1 magnesium -chelatase subunit chlH, chloroplast, putative / Mg-pr ... IX chelatase, putative (CHLH) nearly identical to magnesium ... chelatase subunit GI:1154627 from [Arabidopsis tha ... liana]; contains Pfam profile: PF02514 CobN/magnesium ... chelatase family protein 0.0 ...

  4. Arabidopsis CDS blastp result: AK067323 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK067323 J013106B16 At5g13630.1 magnesium -chelatase subunit chlH, chloroplast, putative / Mg-pro ... IX chelatase, putative (CHLH) nearly identical to magnesium ... chelatase subunit GI:1154627 from [Arabidopsis tha ... liana]; contains Pfam profile: PF02514 CobN/magnesium ... chelatase family protein 0.0 ...

  5. Targeted parallel sequencing of large genetically-defined genomic regions for identifying mutations in Arabidopsis

    Directory of Open Access Journals (Sweden)

    Liu Kun-hsiang

    2012-03-01

    Full Text Available Abstract Large-scale genetic screens in Arabidopsis are a powerful approach for molecular dissection of complex signaling networks. However, map-based cloning can be time-consuming or even hampered due to low chromosomal recombination. Current strategies using next generation sequencing for molecular identification of mutations require whole genome sequencing and advanced computational devises and skills, which are not readily accessible or affordable to every laboratory. We have developed a streamlined method using parallel massive sequencing for mutant identification in which only targeted regions are sequenced. This targeted parallel sequencing (TPSeq method is more cost-effective, straightforward enough to be easily done without specialized bioinformatics expertise, and reliable for identifying multiple mutations simultaneously. Here, we demonstrate its use by identifying three novel nitrate-signaling mutants in Arabidopsis.

  6. Cyclic mononucleotides modulate potassium and calcium flux responses to H2O2 in Arabidopsis roots

    KAUST Repository

    Ordoñez, Natalia Maria

    2014-02-13

    Cyclic mononucleotides are messengers in plant stress responses. Here we show that hydrogen peroxide (H2O2) induces rapid net K+-efflux and Ca2+-influx in Arabidopsis roots. Pre-treatment with either 10 μM cAMP or cGMP for 1 or 24 h does significantly reduce net K+-leakage and Ca2+-influx, and in the case of the K+-fluxes, the cell permeant cyclic mononucleotides are more effective. We also examined the effect of 10 μM of the cell permeant 8-Br-cGMP on the Arabidopsis microsomal proteome and noted a specific increase in proteins with a role in stress responses and ion transport, suggesting that cGMP is sufficient to directly and/or indirectly induce complex adaptive changes to cellular stresses induced by H2O2. © 2014 Federation of European Biochemical Societies. Published by Elsevier B.V. All rights reserved.

  7. Different myrosinase and idioblast distribution in Arabidopsis and Brassica napus

    DEFF Research Database (Denmark)

    Andreasson, Erik; Jørgensen, Lise Bolt; Höglund, Anna-Stina;

    2001-01-01

    Arabidopsis, Brassica napus, Myrosinase, Myrosinase Binding Protein, Glucosinolates, Myrosin Cell, Immunocytochemistry......Arabidopsis, Brassica napus, Myrosinase, Myrosinase Binding Protein, Glucosinolates, Myrosin Cell, Immunocytochemistry...

  8. Functionally Similar WRKY Proteins Regulate Vacuolar Acidification in Petunia and Hair Development in Arabidopsis.

    Science.gov (United States)

    Verweij, Walter; Spelt, Cornelis E; Bliek, Mattijs; de Vries, Michel; Wit, Niek; Faraco, Marianna; Koes, Ronald; Quattrocchio, Francesca M

    2016-03-01

    The WD40 proteins ANTHOCYANIN11 (AN11) from petunia (Petunia hybrida) and TRANSPARENT TESTA GLABRA1 (TTG1) fromArabidopsis thalianaand associated basic helix-loop-helix (bHLH) and MYB transcription factors activate a variety of differentiation processes. In petunia petals, AN11 and the bHLH protein AN1 activate, together with the MYB protein AN2, anthocyanin biosynthesis and, together with the MYB protein PH4, distinct genes, such asPH1andPH5, that acidify the vacuole. To understand how AN1 and AN11 activate anthocyanin biosynthetic andPHgenes independently, we isolatedPH3 We found thatPH3is a target gene of the AN11-AN1-PH4 complex and encodes a WRKY protein that can bind to AN11 and is required, in a feed-forward loop, together with AN11-AN1-PH4 for transcription ofPH5 PH3 is highly similar to TTG2, which regulates hair development, tannin accumulation, and mucilage production in Arabidopsis. Like PH3, TTG2 can bind to petunia AN11 and the Arabidopsis homolog TTG1, complementph3in petunia, and reactivate the PH3 target genePH5 Our findings show that the specificity of WD40-bHLH-MYB complexes is in part determined by interacting proteins, such as PH3 and TTG2, and reveal an unanticipated similarity in the regulatory circuitry that controls petunia vacuolar acidification and Arabidopsis hair development. PMID:26977085

  9. Elongator Plays a Positive Role in Exogenous NAD-Induced Defense Responses in Arabidopsis.

    Science.gov (United States)

    An, Chuanfu; Ding, Yezhang; Zhang, Xudong; Wang, Chenggang; Mou, Zhonglin

    2016-05-01

    Extracellular NAD is emerging as an important signal molecule in animal cells, but its role in plants has not been well-established. Although it has been shown that exogenous NAD(+) activates defense responses in Arabidopsis, components in the exogenous NAD(+)-activated defense pathway remain to be fully discovered. In a genetic screen for mutants insensitive to exogenous NAD(+) (ien), we isolated a mutant named ien2. Map-based cloning revealed that IEN2 encodes ELONGATA3 (ELO3)/AtELP3, a subunit of the Arabidopsis Elongator complex, which functions in multiple biological processes, including histone modification, DNA (de)methylation, and transfer RNA modification. Mutations in the ELO3/AtELP3 gene compromise exogenous NAD(+)-induced expression of pathogenesis-related (PR) genes and resistance to the bacterial pathogen Pseudomonas syringae pv. maculicola ES4326, and transgenic expression of the coding region of ELO3/AtELP3 in elo3/Atelp3 restores NAD(+) responsiveness to the mutant plants, demonstrating that ELO3/AtELP3 is required for exogenous NAD(+)-induced defense responses. Furthermore, mutations in genes encoding the other five Arabidopsis Elongator subunits (ELO2/AtELP1, AtELP2, ELO1/AtELP4, AtELP5, and AtELP6) also compromise exogenous NAD(+)-induced PR gene expression and resistance to P. syringae pv. maculicola ES4326. These results indicate that the Elongator complex functions as a whole in exogenous NAD(+)-activated defense signaling in Arabidopsis. PMID:26926998

  10. Arabidopsis: An Adequate Model for Dicot Root Systems?

    OpenAIRE

    Zobel, Richard W.

    2016-01-01

    The Arabidopsis root system is frequently considered to have only three classes of root: primary, lateral, and adventitious. Research with other plant species has suggested up to eight different developmental/functional classes of root for a given plant root system. If Arabidopsis has only three classes of root, it may not be an adequate model for eudicot plant root systems. Recent research, however, can be interpreted to suggest that pre-flowering Arabidopsis does have at least five (5) of t...

  11. Physiological and molecular basis of Azospirillum-Arabidopsis Interaction

    OpenAIRE

    Nazeer, Ahmed

    2012-01-01

    The present study was aimed at revealing the early signalling events during the interaction of the diazotrophic soil bacterium Azospirillum brasilense with its host plant Arabidopsis thaliana. Furthermore, taking advantage of the micro array technique, a comprehensive overview of Arabidopsis genes has been undertaken which are affected upon association with A. brasilense The characterization of the early responses of Arabidopsis plants upon inoculation with Azospirillum brasilense strain Sp7 ...

  12. MOL1 is required for cambium homeostasis in Arabidopsis.

    Science.gov (United States)

    Gursanscky, Nial Rau; Jouannet, Virginie; Grünwald, Karin; Sanchez, Pablo; Laaber-Schwarz, Martina; Greb, Thomas

    2016-05-01

    Plants maintain pools of pluripotent stem cells which allow them to constantly produce new tissues and organs. Stem cell homeostasis in shoot and root tips depends on negative regulation by ligand-receptor pairs of the CLE peptide and leucine-rich repeat receptor-like kinase (LRR-RLK) families. However, regulation of the cambium, the stem cell niche required for lateral growth of shoots and roots, is poorly characterized. Here we show that the LRR-RLK MOL1 is necessary for cambium homeostasis in Arabidopsis thaliana. By employing promoter reporter lines, we reveal that MOL1 is active in a domain that is distinct from the domain of the positively acting CLE41/PXY signaling module. In particular, we show that MOL1 acts in an opposing manner to the CLE41/PXY module and that changing the domain or level of MOL1 expression both result in disturbed cambium organization. Underlining discrete roles of MOL1 and PXY, both LRR-RLKs are not able to replace each other when their expression domains are interchanged. Furthermore, MOL1 but not PXY is able to rescue CLV1 deficiency in the shoot apical meristem. By identifying genes mis-expressed in mol1 mutants, we demonstrate that MOL1 represses genes associated with stress-related ethylene and jasmonic acid hormone signaling pathways which have known roles in coordinating lateral growth of the Arabidopsis stem. Our findings provide evidence that common regulatory mechanisms in different plant stem cell niches are adapted to specific niche anatomies and emphasize the importance of a complex spatial organization of intercellular signaling cascades for a strictly bidirectional tissue production. PMID:26991973

  13. Root gravitropism in maize and Arabidopsis

    Science.gov (United States)

    Evans, Michael L.

    1993-01-01

    Research during the period 1 March 1992 to 30 November 1993 focused on improvements in a video digitizer system designed to automate the recording of surface extension in plants responding to gravistimulation. The improvements included modification of software to allow detailed analysis of localized extension patterns in roots of Arabidopsis. We used the system to analyze the role of the postmitotic isodiametric growth zone (a region between the meristem and the elongation zone) in the response of maize roots to auxin, calcium, touch and gravity. We also used the system to analyze short-term auxin and gravitropic responses in mutants of Arabidopsis with reduced auxin sensitivity. In a related project, we studied the relationship between growth rate and surface electrical currents in roots by examining the effects of gravity and thigmostimulation on surface potentials in maize roots.

  14. Arabidopsis CDS blastp result: AK100975 [KOME

    Lifescience Database Archive (English)

    Full Text Available ase 1 identical to SP:Q38882 Phospholipase D alpha 1 (EC 3.1.4.4) (AtPLDalpha1) (PLD alpha 1) (Choline ph...osphatase 1) (Phosphatidylcholine-hydrolyzing phospholipase D 1) (PLDalpha) [Arabidopsis thaliana] 0.0 ... ...AK100975 J023143J04 At3g15730.1 phospholipase D alpha 1 / PLD alpha 1 (PLDALPHA1) (PLD1) / choline phosphat

  15. Arabidopsis CDS blastp result: AK240654 [KOME

    Lifescience Database Archive (English)

    Full Text Available (PLDALPHA1) (PLD1) / choline phosphatase 1 identical to SP:Q38882 Phospholipase D alpha 1 (EC 3.1.4.4) (AtPLDalpha1) (PLD alpha... 1) (Choline phosphatase 1) (Phosphatidylcholine-hydrolyzing phospholipase D 1) (PLDalpha) [Arabidopsis thaliana] 0.0 ... ...AK240654 J023098I11 At3g15730.1 68416.m01993 phospholipase D alpha 1 / PLD alpha 1

  16. Arabidopsis CDS blastp result: AK065102 [KOME

    Lifescience Database Archive (English)

    Full Text Available ase 1 identical to SP:Q38882 Phospholipase D alpha 1 (EC 3.1.4.4) (AtPLDalpha1) (PLD alpha 1) (Choline ph...osphatase 1) (Phosphatidylcholine-hydrolyzing phospholipase D 1) (PLDalpha) [Arabidopsis thaliana] 0.0 ... ...AK065102 J013001N03 At3g15730.1 phospholipase D alpha 1 / PLD alpha 1 (PLDALPHA1) (PLD1) / choline phosphat

  17. Arabidopsis CDS blastp result: AK119523 [KOME

    Lifescience Database Archive (English)

    Full Text Available osphatase 1) (Phosphatidylcholine-hydrolyzing phospholipase D 1) (PLDalpha) [Arabidopsis thaliana] 0.0 ... ...ase 1 identical to SP:Q38882 Phospholipase D alpha 1 (EC 3.1.4.4) (AtPLDalpha1) (PLD alpha 1) (Choline ph...AK119523 001-202-E03 At3g15730.1 phospholipase D alpha 1 / PLD alpha 1 (PLDALPHA1) (PLD1) / choline phosphat

  18. Arabidopsis CDS blastp result: AK066556 [KOME

    Lifescience Database Archive (English)

    Full Text Available ase 1 identical to SP:Q38882 Phospholipase D alpha 1 (EC 3.1.4.4) (AtPLDalpha1) (PLD alpha 1) (Choline ph...osphatase 1) (Phosphatidylcholine-hydrolyzing phospholipase D 1) (PLDalpha) [Arabidopsis thaliana] 4e-63 ... ...AK066556 J013073D11 At3g15730.1 phospholipase D alpha 1 / PLD alpha 1 (PLDALPHA1) (PLD1) / choline phosphat

  19. Arabidopsis CDS blastp result: AK072121 [KOME

    Lifescience Database Archive (English)

    Full Text Available ase 1 identical to SP:Q38882 Phospholipase D alpha 1 (EC 3.1.4.4) (AtPLDalpha1) (PLD alpha 1) (Choline ph...osphatase 1) (Phosphatidylcholine-hydrolyzing phospholipase D 1) (PLDalpha) [Arabidopsis thaliana] 0.0 ... ...AK072121 J013122J23 At3g15730.1 phospholipase D alpha 1 / PLD alpha 1 (PLDALPHA1) (PLD1) / choline phosphat

  20. Arabidopsis CDS blastp result: AK119861 [KOME

    Lifescience Database Archive (English)

    Full Text Available osphatase 1) (Phosphatidylcholine-hydrolyzing phospholipase D 1) (PLDalpha) [Arabidopsis thaliana] 0.0 ... ...ase 1 identical to SP:Q38882 Phospholipase D alpha 1 (EC 3.1.4.4) (AtPLDalpha1) (PLD alpha 1) (Choline ph...AK119861 002-178-H08 At3g15730.1 phospholipase D alpha 1 / PLD alpha 1 (PLDALPHA1) (PLD1) / choline phosphat

  1. Arabidopsis CDS blastp result: AK121264 [KOME

    Lifescience Database Archive (English)

    Full Text Available ase 1 identical to SP:Q38882 Phospholipase D alpha 1 (EC 3.1.4.4) (AtPLDalpha1) (PLD alpha 1) (Choline ph...osphatase 1) (Phosphatidylcholine-hydrolyzing phospholipase D 1) (PLDalpha) [Arabidopsis thaliana] 0.0 ... ...AK121264 J023105D06 At3g15730.1 phospholipase D alpha 1 / PLD alpha 1 (PLDALPHA1) (PLD1) / choline phosphat

  2. Arabidopsis CDS blastp result: AK243041 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243041 J100008G07 At3g11410.1 68416.m01392 protein phosphatase 2C, putative / PP2C, putative identic...osphatase 2C; identical to cDNA protein phosphatase 2C GI:633027 2e-21 ... ...al to protein phosphatase 2C (PP2C) GB:P49598 [Arabidopsis thaliana]; contains Pfam profile PF00481: Protein ph

  3. Arabidopsis CDS blastp result: AK100278 [KOME

    Lifescience Database Archive (English)

    Full Text Available ase 1 identical to SP:Q38882 Phospholipase D alpha 1 (EC 3.1.4.4) (AtPLDalpha1) (PLD alpha 1) (Choline ph...osphatase 1) (Phosphatidylcholine-hydrolyzing phospholipase D 1) (PLDalpha) [Arabidopsis thaliana] 0.0 ... ...AK100278 J023073L15 At3g15730.1 phospholipase D alpha 1 / PLD alpha 1 (PLDALPHA1) (PLD1) / choline phosphat

  4. Arabidopsis CDS blastp result: AK120459 [KOME

    Lifescience Database Archive (English)

    Full Text Available ase 1 identical to SP:Q38882 Phospholipase D alpha 1 (EC 3.1.4.4) (AtPLDalpha1) (PLD alpha 1) (Choline ph...osphatase 1) (Phosphatidylcholine-hydrolyzing phospholipase D 1) (PLDalpha) [Arabidopsis thaliana] 0.0 ... ...AK120459 J013106C05 At3g15730.1 phospholipase D alpha 1 / PLD alpha 1 (PLDALPHA1) (PLD1) / choline phosphat

  5. Arabidopsis CDS blastp result: AK064381 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK064381 002-108-E01 At1g55350.4 calpain-type cysteine protease family identical to calpain...-like protein GI:20268660 from [Arabidopsis thaliana]; contains Pfam profiles: PF00648 Calpain famil...y cysteine protease, PF01067 Calpain large subunit,domain III; identical to cDNA calpain-like protein GI:20268659 0.0 ...

  6. Flavonoid-specific staining of Arabidopsis thaliana.

    Science.gov (United States)

    Sheahan, J J; Rechnitz, G A

    1992-12-01

    Crop yields may be threatened by increases in UV-B radiation resulting from depletion of the ozone layer. In higher plants, the presence of flavonols provides a protective mechanism, and we report a novel staining procedure for the visualization of such protectants in plant tissue. It is shown that the proposed technique provides sensitive and specific fluorescence of flavonoids in chlorophyll-bleached tissue of Arabidopsis thaliana. PMID:1282347

  7. Unraveling the circadian clock in Arabidopsis

    OpenAIRE

    Wang, Xiaoxue; Ma, Ligeng

    2012-01-01

    The circadian clock is an endogenous timing system responsible for coordinating an organism’s biological processes with its environment. Interlocked transcriptional feedback loops constitute the fundamental architecture of the circadian clock. In Arabidopsis, three feedback loops, the core loop, morning loop and evening loop, comprise a network that is the basis of the circadian clock. The components of these three loops are regulated in distinct ways, including transcriptional, post-transcri...

  8. Ecology and Evolutionary Biology of Arabidopsis

    OpenAIRE

    Pigliucci, Massimo

    2002-01-01

    Arabidopsis thaliana is now widely used as a model system in molecular and developmental biology, as well as in physiology and cell biology. However, ecologists and evolutionary biologists have turned their attention to the mouse ear cress only much more recently and almost reluctantly. The reason for this is the perception that A. thaliana is not particularly interesting ecologically and that it represents an oddity from an evolutionary standpoint. While there is some truth in both these att...

  9. Fluorescence-Activated Nucleolus Sorting in Arabidopsis.

    Science.gov (United States)

    Pontvianne, Frédéric; Boyer-Clavel, Myriam; Sáez-Vásquez, Julio

    2016-01-01

    Nucleolar isolation allows exhaustive characterization of the nucleolar content. Centrifugation-based protocols are not adapted to isolation of nucleoli directly from a plant tissue because of copurification of cellular debris. We describe here a method that allows the purification of nucleoli using fluorescent-activated cell sorting from Arabidopsis thaliana leaves. This approach requires the expression of a specific nucleolar protein such as fibrillarin fused to green fluorescent protein in planta. PMID:27576720

  10. Arabidopsis CDS blastp result: AK071200 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK071200 J023086K07 At1g64200.1 vacuolar ATP synthase ... subunit E , putative ... / V-ATPase ... E ... subunit, ... putative ... / vacuolar proton pump E ... subunit, putative ... similar ... to SP|Q39258 Vacuolar ATP synthase ... subunit E ... (E C 3.6.3.14) (V-ATPase ... E ... subunit) (Vacu ... olar proton pump E ... subunit) {Arabidopsis thaliana}; contains Pfam pro ... file ... PF01991: ATP synthase ... (E /31 kDa) subunit 1e -86 ...

  11. Arabidopsis CDS blastp result: AK100850 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK100850 J023123I11 At4g11150.1 vacuolar ATP synthase ... subunit E ... / V-ATPase ... E ... subunit / vacuolar ... proton pump E ... subunit (VATE ) ide ntical to SP|Q39258 Vacuolar ATP ... synthase ... subunit E ... (E C 3.6.3.14) (V-ATPase ... E ... subunit) (Vacu ... olar proton pump E ... subunit) {Arabidopsis thaliana} 2e -79 ...

  12. Arabidopsis CDS blastp result: AK072778 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK072778 J023139P14 At4g11150.1 vacuolar ATP synthase ... subunit E ... / V-ATPase ... E ... subunit / vacuolar ... proton pump E ... subunit (VATE ) ide ntical to SP|Q39258 Vacuolar ATP ... synthase ... subunit E ... (E C 3.6.3.14) (V-ATPase ... E ... subunit) (Vacu ... olar proton pump E ... subunit) {Arabidopsis thaliana} 1e -72 ...

  13. Arabidopsis CDS blastp result: AK241580 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241580 J065181H03 At4g23640.1 68417.m03404 potassium transporter / tiny root hair ... 1 protein (T ... RH1) identical to tiny root hair ... 1 protein [Arabidopsis thaliana] gi|11181958|emb|C ... MID:11500563; identical to cDNA mRNA for tiny root hair ... 1 protein (trh1) GI:11181957 1e-139 ...

  14. Arabidopsis CDS blastp result: AK110331 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK110331 002-164-D12 At2g31510.1 IBR domain-containing protein / ARIADNE-like prote...in ARI7 (ARI7) identical to ARIADNE-like protein ARI7 [Arabidopsis thaliana] GI:29125028; contains similarit...y to Swiss-Prot:Q94981 ariadne-1 protein (Ari-1) [Drosophila melanogaster]; contains Pfam profile PF01485: IBR domain 3e-59 ...

  15. Arabidopsis CDS blastp result: AK242789 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242789 J090057B20 At2g31510.1 68415.m03850 IBR domain-containing protein / ARIADN...E-like protein ARI7 (ARI7) identical to ARIADNE-like protein ARI7 [Arabidopsis thaliana] GI:29125028; contai...ns similarity to Swiss-Prot:Q94981 ariadne-1 protein (Ari-1) [Drosophila melanogaster]; contains Pfam profile PF01485: IBR domain 8e-12 ...

  16. Arabidopsis CDS blastp result: AK065950 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK065950 J013049M07 At3g11820.1 syntaxin 121 (SYP121) / syntaxin-related protein (SYR1) conta...ins Pfam profiles: PF00804 syntaxin and PF05739: SNARE domain; identical to cDNA syntaxin-related ...protein At-SYR1 (At-Syr1) GI:4206788, SP|Q9ZSD4 Syntaxin 121 (AtSYP121) (Syntaxin-related protein At-Syr1) {Arabidopsis thaliana} 5e-88 ...

  17. A Superfamily of Arabidopsis Thaliana Retrotransposons

    OpenAIRE

    Konieczny, A; Voytas, D. F.; Cummings, M. P.; Ausubel, F M

    1991-01-01

    We describe a superfamily of Arabidopsis thaliana retrotransposable elements that consists of at least ten related families designated Ta1-Ta10. The Ta1 family has been described previously. Two genomic clones representing the Ta2 and Ta3 elements were isolated from an A. thaliana (race Landsberg erecta) λ library using sequences derived from the reverse transcriptase region of Ta1 as hybridization probes. Nucleotide sequence analysis showed that the Ta1, Ta2 and Ta3 families share >75% amino...

  18. Arabidopsis CDS blastp result: AK243366 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK243366 J100062A03 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 3e-33 ...

  19. Arabidopsis CDS blastp result: AK241693 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK241693 J065195J20 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 4e-31 ...

  20. Arabidopsis CDS blastp result: AK240979 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK240979 J065049G14 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 1e-40 ...

  1. Arabidopsis CDS blastp result: AK242723 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK242723 J090045G15 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 7e-31 ...

  2. Arabidopsis CDS blastp result: AK241693 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK241693 J065195J20 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 4e-15 ...

  3. Arabidopsis CDS blastp result: AK289251 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK289251 J100081E23 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 9e-17 ...

  4. Arabidopsis CDS blastp result: AK318555 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK318555 J075159J07 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 8e-83 ...

  5. Arabidopsis CDS blastp result: AK288980 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK288980 J090085N06 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 4e-67 ...

  6. Arabidopsis CDS blastp result: AK288612 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK288612 J090053J15 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 4e-34 ...

  7. Arabidopsis CDS blastp result: AK241656 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK241656 J065191E22 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 3e-44 ...

  8. Arabidopsis CDS blastp result: AK288115 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK288115 J080036I11 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 3e-15 ...

  9. Arabidopsis CDS blastp result: AK242521 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK242521 J080313L24 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 5e-27 ...

  10. Arabidopsis CDS blastp result: AK241784 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK241784 J065206N09 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 5e-16 ...

  11. Arabidopsis CDS blastp result: AK240965 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK240965 J065046D15 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 1e-30 ...

  12. Arabidopsis CDS blastp result: AK243366 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK243366 J100062A03 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 2e-16 ...

  13. Arabidopsis CDS blastp result: AK288938 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK288938 J090082P07 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 5e-38 ...

  14. Arabidopsis CDS blastp result: AK242649 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK242649 J090025M16 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 2e-12 ...

  15. Arabidopsis CDS blastp result: AK287434 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK287434 J043012F24 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 4e-38 ...

  16. Arabidopsis CDS blastp result: AK240855 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK240855 J065021H02 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 1e-16 ...

  17. Arabidopsis CDS blastp result: AK241009 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK241009 J065053H11 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 1e-105 ...

  18. Arabidopsis CDS blastp result: AK243366 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK243366 J100062A03 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 8e-45 ...

  19. Arabidopsis CDS blastp result: AK241102 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK241102 J065078J20 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 1e-13 ...

  20. Arabidopsis CDS blastp result: AK242649 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK242649 J090025M16 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 3e-20 ...

  1. Arabidopsis CDS blastp result: AK288338 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK288338 J090023E14 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 5e-26 ...

  2. Arabidopsis CDS blastp result: AK240965 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK240965 J065046D15 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 1e-49 ...

  3. Arabidopsis CDS blastp result: AK288738 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK288738 J090063N09 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 2e-50 ...

  4. Arabidopsis CDS blastp result: AK288591 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK288591 J090050M07 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 9e-46 ...

  5. Arabidopsis CDS blastp result: AK242863 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK242863 J090074J03 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 3e-15 ...

  6. Arabidopsis CDS blastp result: AK241944 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK241944 J075089B01 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 8e-26 ...

  7. Arabidopsis CDS blastp result: AK287467 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK287467 J043021K18 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 1e-60 ...

  8. Arabidopsis CDS blastp result: AK242863 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK242863 J090074J03 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 5e-31 ...

  9. Arabidopsis CDS blastp result: AK241009 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK241009 J065053H11 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 2e-53 ...

  10. Arabidopsis CDS blastp result: AK287735 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK287735 J065141O09 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 8e-64 ...

  11. Arabidopsis CDS blastp result: AK242649 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK242649 J090025M16 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 3e-55 ...

  12. Arabidopsis CDS blastp result: AK242896 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK242896 J090081F08 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 3e-48 ...

  13. Arabidopsis CDS blastp result: AK241009 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK241009 J065053H11 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 3e-47 ...

  14. Arabidopsis CDS blastp result: AK240965 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK240965 J065046D15 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 4e-33 ...

  15. Arabidopsis CDS blastp result: AK242896 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK242896 J090081F08 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 8e-26 ...

  16. Arabidopsis CDS blastp result: AK241593 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK241593 J065183B01 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 3e-57 ...

  17. Arabidopsis CDS blastp result: AK288831 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK288831 J090073O12 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 4e-69 ...

  18. Arabidopsis CDS blastp result: AK242723 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK242723 J090045G15 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 5e-45 ...

  19. Arabidopsis CDS blastp result: AK242723 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK242723 J090045G15 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 6e-48 ...

  20. Arabidopsis CDS blastp result: AK241944 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK241944 J075089B01 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 9e-27 ...

  1. Arabidopsis CDS blastp result: AK241693 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK241693 J065195J20 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 2e-42 ...

  2. Arabidopsis CDS blastp result: AK240855 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK240855 J065021H02 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 5e-13 ...

  3. Arabidopsis CDS blastp result: AK241593 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK241593 J065183B01 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 7e-31 ...

  4. Arabidopsis CDS blastp result: AK243366 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK243366 J100062A03 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 2e-61 ...

  5. Arabidopsis CDS blastp result: AK240965 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK240965 J065046D15 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 2e-45 ...

  6. Arabidopsis CDS blastp result: AK288753 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK288753 J090065M09 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 2e-26 ...

  7. Arabidopsis CDS blastp result: AK240979 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK240979 J065049G14 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 2e-50 ...

  8. Arabidopsis CDS blastp result: AK288445 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK288445 J090034L04 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 7e-15 ...

  9. Arabidopsis CDS blastp result: AK240979 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK240979 J065049G14 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 6e-17 ...

  10. Arabidopsis CDS blastp result: AK241009 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK241009 J065053H11 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 7e-26 ...

  11. Arabidopsis CDS blastp result: AK287675 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK287675 J065121L06 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 1e-24 ...

  12. Arabidopsis CDS blastp result: AK240855 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK240855 J065021H02 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 6e-16 ...

  13. Arabidopsis CDS blastp result: AK242863 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK242863 J090074J03 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 1e-16 ...

  14. Arabidopsis CDS blastp result: AK288159 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK288159 J090001G18 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 6e-19 ...

  15. Arabidopsis CDS blastp result: AK240965 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK240965 J065046D15 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 7e-12 ...

  16. Arabidopsis CDS blastp result: AK241102 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK241102 J065078J20 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 6e-12 ...

  17. Arabidopsis CDS blastp result: AK241593 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK241593 J065183B01 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 1e-111 ...

  18. Arabidopsis CDS blastp result: AK241656 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK241656 J065191E22 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 1e-32 ...

  19. Arabidopsis CDS blastp result: AK287443 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK287443 J043016D20 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 2e-68 ...

  20. Arabidopsis CDS blastp result: AK241009 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK241009 J065053H11 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 6e-29 ...

  1. Arabidopsis CDS blastp result: AK242649 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK242649 J090025M16 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 6e-20 ...

  2. Arabidopsis CDS blastp result: AK241112 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK241112 J065091K02 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 2e-16 ...

  3. Arabidopsis CDS blastp result: AK288538 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK288538 J090045K13 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 4e-35 ...

  4. Arabidopsis CDS blastp result: AK241656 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK241656 J065191E22 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 4e-25 ...

  5. Arabidopsis CDS blastp result: AK242896 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK242896 J090081F08 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 6e-20 ...

  6. Arabidopsis CDS blastp result: AK242863 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK242863 J090074J03 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 7e-21 ...

  7. Arabidopsis CDS blastp result: AK241944 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK241944 J075089B01 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 7e-14 ...

  8. Arabidopsis CDS blastp result: AK288935 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK288935 J090082J19 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 6e-31 ...

  9. Arabidopsis CDS blastp result: AK241102 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK241102 J065078J20 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 1e-24 ...

  10. Arabidopsis CDS blastp result: AK241944 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK241944 J075089B01 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 2e-21 ...

  11. Arabidopsis CDS blastp result: AK318538 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK318538 J065207N13 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 3e-59 ...

  12. Arabidopsis CDS blastp result: AK241009 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK241009 J065053H11 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 2e-40 ...

  13. Arabidopsis CDS blastp result: AK242863 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK242863 J090074J03 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 6e-65 ...

  14. Arabidopsis CDS blastp result: AK242896 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK242896 J090081F08 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 1e-12 ...

  15. Arabidopsis CDS blastp result: AK240750 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK240750 J043040A15 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 9e-13 ...

  16. Arabidopsis CDS blastp result: AK242605 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242605 J090014M13 At5g35620.2 68418.m04252 eukaryotic translation initiation factor 4E 2 / eIF ... (eIF-4E) (eIF4E) (mRNA cap-binding protein) (eIF-(iso )4F 25 kDa subunit) (eIF-(ISO )4F P28 subunit) (eIF4 ... Eiso ... protein) {Arabidopsis thaliana} 9e-57 ...

  17. Arabidopsis CDS blastp result: AK242605 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242605 J090014M13 At5g35620.1 68418.m04251 eukaryotic translation initiation factor 4E 2 / eIF ... (eIF-4E) (eIF4E) (mRNA cap-binding protein) (eIF-(iso )4F 25 kDa subunit) (eIF-(ISO )4F P28 subunit) (eIF4 ... Eiso ... protein) {Arabidopsis thaliana} 3e-67 ...

  18. Arabidopsis CDS blastp result: AK287958 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK287958 J075053F01 At1g02340.1 68414.m00180 long hypocotyl in far-red 1 (HFR1) / reduced phytoc ... sic helix-loop-helix FBI1 protein (FBI1) / reduced sensitivity ... to far-red light (RSF1) / bHLH protein 26 (BHLH026 ... ng) (Basic helix-loop-helix FBI1 protein) (Reduced sensitivity ... to far-red light) [Arabidopsis thaliana] 8e-12 ...

  19. Analyzing Synthetic Promoters Using Arabidopsis Protoplasts.

    Science.gov (United States)

    Stracke, Ralf; Thiedig, Katharina; Kuhlmann, Melanie; Weisshaar, Bernd

    2016-01-01

    This chapter describes a transient protoplast co-transfection method that can be used to quantitatively study in vivo the activity and function of promoters and promoter elements (reporters), and their induction or repression by transcription factors (effectors), stresses, hormones, or metabolites. A detailed protocol for carrying out transient co-transfection assays with Arabidopsis At7 protoplasts and calculating the promoter activity is provided. PMID:27557761

  20. Phosphorylation of plastoglobular proteins in Arabidopsis thaliana.

    Science.gov (United States)

    Lohscheider, Jens N; Friso, Giulia; van Wijk, Klaas J

    2016-06-01

    Plastoglobules (PGs) are plastid lipid-protein particles with a small specialized proteome and metabolome. Among the 30 core PG proteins are six proteins of the ancient ABC1 atypical kinase (ABC1K) family and their locations in an Arabidopsis mRNA-based co-expression network suggested central regulatory roles. To identify candidate ABC1K targets and a possible ABC1K hierarchical phosphorylation network within the chloroplast PG proteome, we searched Arabidopsis phosphoproteomics data from publicly available sources. Evaluation of underlying spectra and/or associated information was challenging for a variety of reasons, but supported pSer sites and a few pThr sites in nine PG proteins, including five FIBRILLINS. PG phosphorylation motifs are discussed in the context of possible responsible kinases. The challenges of collection and evaluation of published Arabidopsis phosphorylation data are discussed, illustrating the importance of deposition of all mass spectrometry data in well-organized repositories such as PRIDE and ProteomeXchange. This study provides a starting point for experimental testing of phosho-sites in PG proteins and also suggests that phosphoproteomics studies specifically designed toward the PG proteome and its ABC1K are needed to understand phosphorylation networks in these specialized particles. PMID:26962209

  1. Genomewide analysis of intronic microRNAs in rice and Arabidopsis

    Indian Academy of Sciences (India)

    G. D. Yang; K. Yan; B. J. Wu; Y. H. Wang; Y. X. Gao; C. C. Zheng

    2012-12-01

    MicroRNAs (miRNAs) are potent regulators of gene transcription and posttranscriptional processes. The majority of miRNAs are localized within intronic regions of protein-coding genes (host genes) and have diverse functions in regulating important cellular processes in animals. To date, few plant intronic miRNAs have been studied functionally. Here we report a comprehensive computational analysis to characterize intronic miRNAs in rice and Arabidopsis. RT-PCR analysis confirmed that the identified intronic miRNAs were derived from the real introns of host genes. Interestingly, 13 intronic miRNAs in rice and two in Arabidopsis were located within seven clusters, of which four polycistronic clusters contain miRNAs derived from different families, suggesting that these clustered intronic miRNAs might be involved in extremely complex regulation in rice. Length analysis of miRNA-carrying introns, promoter prediction and qRT-PCR analysis results indicated that intronic miRNAs are coexpressed with their host genes. Expression pattern analysis demonstrated that host genes had a very broad expression spectrum in different stages of development, suggesting the intronic miRNAs might play an important role in plant development. This comparative genomics analysis of intronic miRNAs in rice and Arabidopsis provides new insight into the functions and regulatory mechanisms of intronic miRNAs in monocots and dicots.

  2. Proteomic analysis of Arabidopsis thaliana (L.) Heynh responses to a generalist sucking pest (Myzus persicae Sulzer).

    Science.gov (United States)

    Truong, D-H; Bauwens, J; Delaplace, P; Mazzucchelli, G; Lognay, G; Francis, F

    2015-11-01

    Herbivorous insects can cause severe cellular changes to plant foliage following infestations, depending on feeding behaviour. Here, a proteomic study was conducted to investigate the influence of green peach aphid (Myzus persicae Sulzer) as a polyphagous pest on the defence response of Arabidopsis thaliana (L.) Heynh after aphid colony establishment on the host plant (3 days). Analysis of about 574 protein spots on 2-DE gels revealed 31 differentially expressed protein spots. Twenty out of these 31 differential proteins were selected for analysis by mass spectrometry. In 12 of the 20 analysed spots, we identified seven and nine proteins using MALDI-TOF-MS and LC-ESI-MS/MS, respectively. Of the analysed spots, 25% contain two proteins. Different metabolic pathways were modulated in Arabidopsis leaves according to aphid feeding: most corresponded to carbohydrate, amino acid and energy metabolism, photosynthesis, defence response and translation. This paper has established a survey of early alterations induced in the proteome of Arabidopsis by M. persicae aphids. It provides valuable insights into the complex responses of plants to biological stress, particularly for herbivorous insects with sucking feeding behaviour. PMID:26153342

  3. Dysfunctional mitochondria regulate the size of root apical meristem and leaf development in Arabidopsis

    Science.gov (United States)

    Hsieh, Wei-Yu; Liao, Jo-Chien; Hsieh, Ming-Hsiun

    2015-01-01

    Mitochondria play an important role in maintaining metabolic and energy homeostasis in the plant cell. Thus, perturbation of mitochondrial structure and function will affect plant growth and development. Arabidopsis slow growth3 (slo3) is defective in At3g61360 that encodes a pentatricopeptide repeat (PPR) protein. Analysis of slo3 mitochondrial RNA metabolism revealed that the splicing of nad7 intron 2 is impaired, which leads to a dramatic reduction in complex I activity. So the SLO3 PPR protein is a splicing factor that is required for the removal of nad7 intron 2 in Arabidopsis. The slo3 mutant plants have obvious phenotypes with severe growth retardation and delayed development. The size of root apical meristem (RAM) is reduced and the production of meristem cells is decreased in slo3. Furthermore, the rosette leaves of slo3 are curled or crinkled, which may be derived from uneven growth of the leaf surface. The underlying mechanisms by which dysfunctional mitochondria affect these growth and developmental phenotypes have yet to be established. Nonetheless, plant hormone auxin is known to play an important role in orchestrating the development of RAM and leaf shape. It is possible that dysfunctional mitochondria may interact with auxin signaling pathways to regulate the boundary of RAM and the cell division arrest front during leaf growth in Arabidopsis. PMID:26237004

  4. Overexpression of AtBMI1C, a polycomb group protein gene, accelerates flowering in Arabidopsis.

    Directory of Open Access Journals (Sweden)

    Wei Li

    Full Text Available Polycomb group protein (PcG-mediated gene silencing is emerging as an essential developmental regulatory mechanism in eukaryotic organisms. PcGs inactivate or maintain the silenced state of their target chromatin by forming complexes, including Polycomb Repressive Complex 1 (PRC1 and 2 (PRC2. Three PRC2 complexes have been identified and characterized in Arabidopsis; of these, the EMF and VRN complexes suppress flowering by catalyzing the trimethylation of lysine 27 on histone H3 of FLOWER LOCUS T (FT and FLOWER LOCUS C (FLC. However, little is known about the role of PRC1 in regulating the floral transition, although AtRING1A, AtRING1B, AtBMI1A, and AtBMI1B are believed to regulate shoot apical meristem and embryonic development as components of PRC1. Moreover, among the five RING finger PcGs in the Arabidopsis genome, four have been characterized. Here, we report that the fifth, AtBMI1C, is a novel, ubiquitously expressed nuclear PcG protein and part of PRC1, which is evolutionarily conserved with Psc and BMI1. Overexpression of AtBMI1C caused increased H2A monoubiquitination and flowering defects in Arabidopsis. Both the suppression of FLC and activation of FT were observed in AtBMI1C-overexpressing lines, resulting in early flowering. No change in the H3K27me3 level in FLC chromatin was detected in an AtBMI1C-overexpressing line. Our results suggest that AtBMI1C participates in flowering time control by regulating the expression of FLC; moreover, the repression of FLC by AtBMI1C is not due to the activity of PRC2. Instead, it is likely the result of PRC1 activity, into which AtBMI1C is integrated.

  5. The involvement of ethylene in regulation of Arabidopsis gravitropism

    Science.gov (United States)

    Li, Ning; Zhu, Lin

    Plant gravitropism is a directional response to gravity stimulus. This response involves a com-plex signaling network. Ethylene, a major plant hormone, has been found to modulate grav-itropism. The biosynthesis of ethylene is induced by the gravi-stimulus and the requirement for ethylene during gravitropism is tissue-dependent. While ethylene plays a modulating role in inflorescence stems, the light-grown hypocotyls of Arabidopsis requires ethylene to achieve a maximum gravicurvature. Because both inhibitory and stimulatory effects of ethylene on gravitropism have been overwhelmingly documented, there is a need to postulate a new theory to consolidate the apparently contradictory results. A dual-and-opposing effects (DOE) theory is therefore hypothesized to address how ethylene is involved in regulation of Arabidopsis grav-itropism, in which it is suggested that both stimulatory and inhibitory effects act on the same organ of a plant and co-exist at the same time in a mutually opposing manner. The final out-come of gravitropic response is determined by the dynamic display between the two opposing effects. A prolonged pretreatment of ethylene promotes the gravitropism in both inflorescence and light-grown hypocotyls, while a short ethylene pretreatment inhibits gravitropism. Gener-ally speaking, the inhibitory effect of ethylene is dominant over the expression of the stimula-tory effect in light-grown hypocotyls, whereas the stimulatory effect is dominant in inflorescence stem. Each effect is also positively correlated with concentrations of ethylene and in a time-dependent manner. The stimulatory effect occurs slowly but continues to react after the removal of ethylene, whereas the inhibitory effect takes place abruptly and diminishes shortly after its removal. Forward genetic screening based on the DOE phenotype of ethylene-treated Arabidop-sis has revealed a novel component in gravity signaling pathway: EGY1 (ethylene-dependent gravitropism-deficient and yellow

  6. MATH-domain family shows response towards abiotic stress in Arabidopsis and rice

    Directory of Open Access Journals (Sweden)

    Hemant Ritturaj Kushwaha

    2016-06-01

    Full Text Available Response to stress represents a highly complex mechanism in plants involving a plethora of genes and gene families. It has been established that plants use some common set of genes and gene families for both biotic and abiotic stress responses leading to cross-talk phenomena. One such family, Meprin And TRAF Homology (MATH domain containing protein (MDCP, has been known to be involved in biotic stress response. In this study, we present genome-wide identification of various members of MDCP family from both Arabidopsis and rice. A large number of members identified in Arabidopsis and rice show the expansion and diversification of family in both the species. Localization of MDCP genes on the chromosomes of both Arabidopsis and rice show their presence in a few specific clusters on various chromosomes such as chromosome III in Arabidopsis and chromosome X in rice. For the functional analysis of MDCP genes, we used publicly available data for plant growth and development as well as biotic stresses and found differential expression of various members of the family. Further, we narrowed down 11 potential candidate genes in rice which showed high expression in various tissues and development stages as well biotic stress conditions. The expression analysis of these 11 genes in rice using qRT-PCR under drought and salinity stress identified OsM4 and OsMB11 to be highly expressed in both the stress conditions. Taken together, these data indicate that OsM4 and OsMB11 can be used as the potential candidates for generating stress resilient crops.

  7. Putative sugarcane FT/TFL1 genes delay flowering time and alter reproductive architecture in Arabidopsis

    Directory of Open Access Journals (Sweden)

    Carla P. Coelho

    2014-05-01

    Full Text Available Agriculturally important grasses such as rice, maize and sugarcane are evolutionarily distant from Arabidopsis, yet some components of the floral induction process are highly conserved. Flowering in sugarcane is an important factor that negatively affects cane yield and reduces sugar/ethanol production from this important perennial bioenergy crop. Comparative studies have facilitated the identification and characterization of putative orthologs of key flowering time genes in sugarcane, a complex polyploid plant whose genome has yet to be sequenced completely. Using this approach we identified phosphatidylethanolamine-binding protein (PEBP gene family members in sugarcane that are similar to the archetypical FT and TFL1 genes of Arabidopsis that play an essential role in controlling the transition from vegetative to reproductive growth. Expression analysis of ScTFL1, which falls into the TFL1-clade of floral repressors, showed transcripts in developing leaves surrounding the shoot apex but not at the apex itself. ScFT1 was detected in immature leaves and apical regions of vegetatively growing plants and, after the floral transition, expression also occurred in mature leaves. Ectopic over-expression of ScTFL1 in Arabidopsis caused delayed flowering in Arabidopsis, as might be expected for a gene related to TFL1. In addition, lines with the latest flowering phenotype exhibited aerial rosette formation. Unexpectedly, over-expression of ScFT1, which has greatest similarity to the florigen-encoding FT, also caused a delay in flowering. This preliminary analysis of divergent sugarcane FT and TFL1 gene family members from Saccharum spp. suggests that their expression patterns and roles in the floral transition has diverged from the predicted role of similar PEBP family members.

  8. Comparative analysis of drought resistance genes in Arabidopsis and rice

    NARCIS (Netherlands)

    Trijatmiko, K.R.

    2005-01-01

    Keywords: rice, Arabidopsis, drought, genetic mapping,microarray, transcription factor, AP2/ERF, SHINE, wax, stomata, comparative genetics, activation tagging, Ac/Ds, En/IThis thesis describes the use of genomics information and tools from Arabidopsis and

  9. Herbivore-induced resistance against microbial pathogens in Arabidopsis

    NARCIS (Netherlands)

    Vos, de M.; Zaanen, van W.; Koornneef, A.; Korzelius, J.P.; Dicke, M.; Loon, van L.C.; Pieterse, C.M.J.

    2006-01-01

    Caterpillars of the herbivore Pieris rapae stimulate the production of jasmonic acid (JA) and ethylene (ET) in Arabidopsis (Arabidopsis thaliana) and trigger a defense response that affects insect performance on systemic tissues. To investigate the spectrum of effectiveness of P. rapae-induced resis

  10. Methodological approaches for using synchrotron X-ray fluorescence (SXRF) imaging as a tool in ionomics: Examples from Arabidopsis thaliana

    Science.gov (United States)

    Hindt, Maria; Socha, Amanda L.; Zuber, Hélène

    2013-01-01

    Here we present approaches for using multi-elemental imaging (specifically synchrotron X-ray fluorescence microscopy, SXRF) in ionomics, with examples using the model plant Arabidopsis thaliana. The complexity of each approach depends on the amount of a priori information available for the gene and/or phenotype being studied. Three approaches are outlined, which apply to experimental situations where a gene of interest has been identified but has an unknown phenotype (Phenotyping), an unidentified gene is associated with a known phenotype (Gene Cloning) and finally, a Screening approach, where both gene and phenotype are unknown. These approaches make use of open-access, online databases with which plant molecular genetics researchers working in the model plant Arabidopsis will be familiar, in particular the Ionomics Hub and online transcriptomic databases such as the Arabidopsis eFP browser. The approaches and examples we describe are based on the assumption that altering the expression of ion transporters can result in changes in elemental distribution. We provide methodological details on using elemental imaging to aid or accelerate gene functional characterization by narrowing down the search for candidate genes to the tissues in which elemental distributions are altered. We use synchrotron X-ray microprobes as a technique of choice, which can now be used to image all parts of an Arabidopsis plant in a hydrated state. We present elemental images of leaves, stem, root, siliques and germinating hypocotyls. PMID:23912758

  11. Early light-induced proteins protect Arabidopsis from photooxidative stress.

    Science.gov (United States)

    Hutin, Claire; Nussaume, Laurent; Moise, Nicolae; Moya, Ismaël; Kloppstech, Klaus; Havaux, Michel

    2003-04-15

    The early light-induced proteins (ELIPs) belong to the multigenic family of light-harvesting complexes, which bind chlorophyll and absorb solar energy in green plants. ELIPs accumulate transiently in plants exposed to high light intensities. By using an Arabidopsis thaliana mutant (chaos) affected in the posttranslational targeting of light-harvesting complex-type proteins to the thylakoids, we succeeded in suppressing the rapid accumulation of ELIPs during high-light stress, resulting in leaf bleaching and extensive photooxidative damage. Constitutive expression of ELIP genes in chaos before light stress resulted in ELIP accumulation and restored the phototolerance of the plants to the wild-type level. Free chlorophyll, a generator of singlet oxygen in the light, was detected by chlorophyll fluorescence lifetime measurements in chaos leaves before the symptoms of oxidative stress appeared. Our findings indicate that ELIPs fulfill a photoprotective function that could involve either the binding of chlorophylls released during turnover of pigment-binding proteins or the stabilization of the proper assembly of those proteins during high-light stress. PMID:12676998

  12. Comparison of methods for extracting thylakoid membranes of Arabidopsis plants.

    Science.gov (United States)

    Chen, Yang-Er; Yuan, Shu; Schröder, Wolfgang P

    2016-01-01

    Robust and reproducible methods for extracting thylakoid membranes are required for the analysis of photosynthetic processes in higher plants such as Arabidopsis. Here, we compare three methods for thylakoid extraction using two different buffers. Method I involves homogenizing the plant material with a metal/glass blender; method II involves manually grinding the plant material in ice-cold grinding buffer with a mortar and method III entails snap-freezing followed by manual grinding with a mortar, after which the frozen powder is thawed in isolation buffer. Thylakoid membrane samples extracted using each method were analyzed with respect to protein and chlorophyll content, yields relative to starting material, oxygen-evolving activity, protein complex content and phosphorylation. We also examined how the use of fresh and frozen thylakoid material affected the extracts' contents of protein complexes. The use of different extraction buffers did not significantly alter the protein content of the extracts in any case. Method I yielded thylakoid membranes with the highest purity and oxygen-evolving activity. Method III used low amounts of starting material and was capable of capturing rapid phosphorylation changes in the sample at the cost of higher levels of contamination. Method II yielded thylakoid membrane extracts with properties intermediate between those obtained with the other two methods. Finally, frozen and freshly isolated thylakoid membranes performed identically in blue native-polyacrylamide gel electrophoresis experiments conducted in order to separate multimeric protein supracomplexes. PMID:26337850

  13. Targeting Proteins for Degradation by Arabidopsis COP1: Teamwork Is What Matters

    Institute of Scientific and Technical Information of China (English)

    Rongcheng Lin; Haiyang Wang

    2007-01-01

    Arabidopsis COP1 (Constitutive Photomorphogenic 1) defines a key repressor of photomorphogenesis in darkness by acting as an E3 ubiquitin ligase in the nucleus, and is responsible for the targeted degradation of a number of photomorphogenesis-promoting factors, including phyA, HY5, LAF1, and HFR1. Light activation of multiple classes of photoreceptors (including both phytochromes and cryptochromes) inactivates COP1 and reduces its nuclear abundance, allowing the accumulation of these positively acting light signaling intermediates to promote photomorphogenic development. Recent studies suggest that Arabidopsis COP1 teams up with a family of SPA proteins (SPA1-SPA4) to form the physiologically active COP1-SPA E3 ubiquitin ligase complexes. These COP1-SPA complexes play overlapping and distinct functions in regulating seedling photomorphogenesis under different light conditions and adult plant growth. Further, the COP1-SPA complexes act in concert at a biochemical level with the CDD (COP10, DET1, and DDB1) complex and COP9 signalosome (CSN) to orchestrate the repression of photomorphogenesis.

  14. Arabidopsis thaliana WAPL is essential for the prophase removal of cohesin during meiosis.

    Directory of Open Access Journals (Sweden)

    Kuntal De

    2014-07-01

    Full Text Available Sister chromatid cohesion, which is mediated by the cohesin complex, is essential for the proper segregation of chromosomes in mitosis and meiosis. The establishment of stable sister chromatid cohesion occurs during DNA replication and involves acetylation of the complex by the acetyltransferase CTF7. In higher eukaryotes, the majority of cohesin complexes are removed from chromosomes during prophase. Studies in fly and human have shown that this process involves the WAPL mediated opening of the cohesin ring at the junction between the SMC3 ATPase domain and the N-terminal domain of cohesin's α-kleisin subunit. We report here the isolation and detailed characterization of WAPL in Arabidopsis thaliana. We show that Arabidopsis contains two WAPL genes, which share overlapping functions. Plants in which both WAPL genes contain T-DNA insertions show relatively normal growth and development but exhibit a significant reduction in male and female fertility. The removal of cohesin from chromosomes during meiotic prophase is blocked in Atwapl mutants resulting in chromosome bridges, broken chromosomes and uneven chromosome segregation. In contrast, while subtle mitotic alterations are observed in some somatic cells, cohesin complexes appear to be removed normally. Finally, we show that mutations in AtWAPL suppress the lethality associated with inactivation of AtCTF7. Taken together our results demonstrate that WAPL plays a critical role in meiosis and raises the possibility that mechanisms involved in the prophase removal of cohesin may vary between mitosis and meiosis in plants.

  15. Metabolite regulation of the interaction between Arabidopsis thaliana PII and N-acetyl-l-glutamate kinase.

    Science.gov (United States)

    Feria Bourrellier, Ana Belén; Ferrario-Méry, Sylvie; Vidal, Jean; Hodges, Michael

    2009-10-01

    The metabolic control of the interaction between ArabidopsisN-acetyl-l-glutamate kinase (NAGK) and the PII protein has been studied. Both gel exclusion and affinity chromatography analyses of recombinant, affinity-purified PII (trimeric complex) and NAGK (hexameric complex) showed that NAGK strongly interacted with PII only in the presence of Mg-ATP, and that this process was reversed by 2-oxoglutarate (2-OG). Furthermore, metabolites such as arginine, glutamate, citrate, and oxalacetate also exerted a negative effect on the PII-NAGK complex formation in the presence of Mg-ATP. Using chloroplast protein extracts and PII affinity chromatography, NAGK interacted with PII only in the presence of ATP-Mg(2+), and this process was antagonized by 2-OG. These results reveal a complex metabolic control of the PII interaction with NAGK in the chloroplast stroma of higher plants. PMID:19631611

  16. The TORNADO1 and TORNADO2 genes function in several patterning processes during early leaf development in Arabidopsis thaliana

    OpenAIRE

    Cnops, Gerda; Neyt, Pia; Raes, Jeroen; Petrarulo, Marica; Nelissen, Hilde; Malenica, Nenad; Luschnig, Christian; Tietz, Olaf; Ditengou, Franck; Palme, Klaus; Azmi, Abdelkrim; Prinsen, Els; Van Lijsebettens, Maria

    2006-01-01

    In multicellular organisms, patterning is a process that generates axes in the primary body plan, creates domains upon organ formation, and finally leads to differentiation into tissues and cell types. We identified the Arabidopsis thaliana TORNADO1 (TRN1) and TRN2 genes and their role in leaf patterning processes such as lamina venation, symmetry, and lateral growth. In trn mutants, the leaf venation network had a severely reduced complexity: incomplete loops, no tertiary or quaternary veins...

  17. Genetic and environmental control of the Verticillium syndrome in Arabidopsis thaliana

    OpenAIRE

    Diederichsen Elke; Karlovsky Petr; Häffner Eva

    2010-01-01

    Abstract Background Verticillium spp. are major pathogens of dicotyledonous plants such as cotton, tomato, olive or oilseed rape. Verticillium symptoms are often ambiguous and influenced by development and environment. The aim of the present study was to define disease and resistance traits of the complex Verticillium longisporum syndrome in Arabidopsis thaliana (L.) Heynh. A genetic approach was used to determine genetic, developmental and environmental factors controlling specific disease a...

  18. Increased expression of a phloem membrane protein encoded by NHL26 alters phloem export and sugar partitioning in Arabidopsis

    OpenAIRE

    Vilaine, Francoise; Kerchev, Pavel Ivanov; Clément, Gilles; Batailler, Brigitte; Cayla, Thibaud; Bill, Laurence; Gissot, Lionel; Dinant, Sylvie

    2013-01-01

    The complex process of phloem sugar transport involves symplasmic and apoplasmic events. We characterized Arabidopsis thaliana lines ectopically expressing a phloem-specific gene encoding NDR1/HIN1-like26 (NHL26), a putative membrane protein. NHL26 overexpressor plants grew more slowly than wild-type plants, accumulated high levels of carbohydrates in mature leaves, and had a higher shoot biomass, contrasting with slower root growth and a lower seed yield. Similar effects were observed when N...

  19. Gravitropism in Arabidopsis thaliana: violation of the sine- and resultant-law

    Science.gov (United States)

    Galland, Paul

    We investigated the gravitropic bending of hypocotyls and roots of seedlings of Arabidopsis tha-liana in response to long-term centrifugal accelerations in a range of 5 x 10-3 to 4 x g. The so-cal-led resultant law of gravitropism, a corollary of the so called sine law, claims that during centri-fugation a gravitropic organ aligns itself parallel to the resultant stimulus vector. We show here that neither of the two empirical “laws” is apt to describe the complex gravitropic behaviour of seedlings of Arabidopsis. Hypocotyls obey reasonably well the resultant law while roots display a complex behaviour that is clearly at variance with it. Horizontally centrifuged seedlings sense minute accelerations acting parallel to the longitudinal axis. If the centrifugal vector points to-ward the cotyledons, then the bending of hypocotyls and roots is greatly enhanced. If the centri-fugal vector points, however, toward the root tip, then only the bending of roots is enhanced by accelerations as low as 5 x 10-3 x g (positive tonic effect). The absolute gravitropic thresholds were determined for hypocotyls and roots in a clinostat-centrifuge and found to be near 1.5 x 10-2 x g. A behavioural mutant, ehb1-2 (Knauer et al. 2011), displays a lower gravitropic threshold for roots, not however, for hypocotyls. The complex gravitropic behaviour of seedlings of Arabi-dopsis is at odds with the classical sine- as well as the resultant law and can indicates the eminent role that is played by the acceleration vector operating longitudinally to the seedling axis.

  20. Genetic Analysis of Gravity Signal Transduction in Arabidopsis thaliana Seedlings

    Science.gov (United States)

    Boonsirichai, K.; Harrison, B.; Stanga, J.; Young, L.-S.; Neal, C.; Sabat, G.; Murthy, N.; Harms, A.; Sedbrook, J.; Masson, P.

    The primary roots of Arabidopsis thaliana seedlings respond to gravity stimulation by developing a tip curvature that results from differential cellular elongation on opposite flanks of the elongation zone. This curvature appears modulated by a lateral gradient of auxin that originates in the gravity-perceiving cells (statocytes) of the root cap through an apparent lateral repositioning of a component the auxin efflux carrier complex within these cells (Friml et al, 2002, Nature 415: 806-809). Unfortunately, little is known about the molecular mechanisms that govern early phases of gravity perception and signal transduction within the root-cap statocytes. We have used a molecular genetic approach to uncover some of these mechanisms. Mutations in the Arabidopsis ARG1 and ARL2 genes, which encode J-domain proteins, resulted in specific alterations in root and hypocotyl gravitropism, without pleiotropic phenotypes. Interestingly, ARG1 and ARL2 appear to function in the same genetic pathway. A combination of molecular genetic, biochemical and cell-biological approaches were used to demonstrate that ARG1 functions in early phases of gravity signal transduction within the root and hypocotyl statocytes, and is needed for efficient lateral auxin transport within the cap. The ARG1 protein is associated with components of the secretory and/or endosomal pathways, suggesting its role in the recycling of components of the auxin efflux carrier complex between plasma membrane and endosome (Boonsirichai et al, 2003, Plant Cell 15:2612-2625). Genetic modifiers of arg1-2 were isolated and shown to enhance the gravitropic defect of arg1-2, while resulting in little or no gravitropic defects in a wild type ARG1 background. A slight tendency for arg1-2;mar1-1 and arg1-2;mar2-1 double-mutant organs to display an opposite gravitropic response compared to wild type suggests that all three genes contribute to the interpretation of the gravity-vector information by seedling organs. The