WorldWideScience

Sample records for ar gas filled

  1. Effect of adding Ar gas on the pulse height distribution of BF3-filled neutron detectors

    Indian Academy of Sciences (India)

    M Padalakshmi; A M Shaikh

    2008-11-01

    Boron trifluoride (BF3) proportional counters are used as detectors for thermal neutrons. They are characterized by high neutron sensitivity and good gamma discriminating properties. Most practical BF3 counters are filled with pure boron trifluoride gas enriched up to 96% 10B. But BF3 is not an ideal proportional counter gas. Worsening of plateau characteristics is observed with increasing radius due to impurities in gas. To overcome this problem, counters are filled with BF3 with an admixture of a more suitable gas such as argon. The dilution of BF3 with argon causes a decrease in detection efficiency, but the pulse height spectrum shows sharper peaks and more stable plateau characteristics than counters filled with pure BF3. The present investigations are under-taken to study the pulse height distribution and other important factors in BF3+Ar filled signal counters for neutron beam applications. Tests are performed with detectors with cylindrical geometry filled with BF3 gas enriched in 10B to 90%, and high purity Ar in different proportions. By analysing pulse height spectra, a value of 6.1 ± 0.2 has been obtained for the branching ratio of the 10B(,) reaction.

  2. Simulation model for analyzing voltage-current characteristics of the barrier type lamp filled with Hg-Ar gas

    Science.gov (United States)

    Watanabe, Yoshio; Yamaguchi, Tomohiro; Imada, Ryosuke

    2013-09-01

    The simulation model for DBD lamp filled with Hg-Ar gas is studied. The straight tube filled with Hg and Ar gases is employed as a lamp. Three kinds of applied voltage waveforms at high frequency are applied between the pair of stripe electrodes attached on the outside of the tube. One dimensional model is employed. Ionization frequency based on Townsend ionization coefficient is employed in this model. A try-and-error method is employed to estimate the value of each coefficient, and the calculated waveform is compared with the measured current waveform. The values by which the most similar current waveform to the measurement is obtained are selected as appropriate values. Using these coefficient values, the discharge current waveforms by the applying voltage with triangular waveform and trapezoidal waveforms are calculated and compared with the measured current waveforms. Good agreements between the calculation and the measurement in discharge current waveform are obtained for three types of applied voltage waveform. Then, the distributions of electric field, electron density and ion density in the discharge space are calculated. It is shown that the space charge layer is formed on the glass tube wall and ionization takes place mainly in the space charge layer. Professor

  3. Gas filled detectors

    International Nuclear Information System (INIS)

    The main types of gas filled nuclear detectors: ionization chambers, proportional counters, parallel-plate avalanche counters (PPAC) and microstrip detectors are described. New devices are shown. A description of the processes involved in such detectors is also given. (K.A.) 123 refs.; 25 figs.; 3 tabs

  4. Gas-Filled Capillary Model

    Science.gov (United States)

    Steinhauer, L. C.; Kimura, W. D.

    2006-11-01

    We have developed a 1-D, quasi-steady-state numerical model for a gas-filled capillary discharge that is designed to aid in selecting the optimum capillary radius in order to guide a laser beam with the required intensity through the capillary. The model also includes the option for an external solenoid B-field around the capillary, which increases the depth of the parabolic density channel in the capillary, thereby allowing for propagation of smaller laser beam waists. The model has been used to select the parameters for gas-filled capillaries to be utilized during the Staged Electron Laser Acceleration — Laser Wakefield (STELLA-LW) experiment.

  5. Investigation of prototype gas-filled photomultipliers

    International Nuclear Information System (INIS)

    Parallel-plate gas gain of more than 7000 has been observed in a methane-filled low pressure hexode with a semi-transparent photocathode. The photocathode lifetime has been studied in a similarly constructed phototetrode. Conclusions are drawn for the development of future higher gain devices for use in particle physics experiments in high magnetic fields. (author)

  6. Development Prospect of China's Urban Gas Filling Station

    Institute of Scientific and Technical Information of China (English)

    Luo Zuoxian

    2006-01-01

    @@ Status of China's urban gas filling station Development scale China's urban gas filling stations have kept on increasing in recent years along with the development of gas autos. The number of urban gas filling stations in China increased to 712 in 2004 from 130 in 1999, with the growth rate 448 percent. The annual growth rate of LPG filling stations and CNG filling stations was 34.3 percent and 32.2 percent respectively (see Fig. 1).

  7. The Berkeley gas-filled separator

    CERN Document Server

    Ninov, V; McGrath, C A

    1998-01-01

    The BGS is being constructed at the 88-Inch Cyclotron at LBNL in Berkeley. The magnetic configuration of the BGS will allow a large angular acceptance and good suppression of primary beam particles. BGS operates as a mass spectrometer with a A/ Delta A approximately =200 and as a gas filled separator at pressures between 0.1-50 hPa. The reaction products recoiling off a thin target will be collected with efficiencies from 10-80at the focal plane. A Monte Carlo simulation program of the ion transport through the gas-filled magnets in combination of 3-dimensional TOSCA field maps has been developed and reproduces closely the experimental behavior of BGS. (9 refs).

  8. Electron cloud sizes in gas-filled detectors

    International Nuclear Information System (INIS)

    Electron cloud sizes have been calculated for gas mixtures containing Ar, Xe, CO2, CH4, and N2 for drifts through a constant electric field. The transport coefficients w and D/μ are in good agreement with experimental data of various sources for pure gases. Results of measurements, also performed in this work, for Ar+CO2, Ar+CH4, and Ar+Xe+CO2 mixtures are in fair agreement with the calculated cloud sizes. For a large number of useful gas mixtures calculated electron cloud sizes are presented and discussed, most of which are given for the first time. A suggestion is made for an optimal gas mixture for an X-ray position sensitive proportional counter for medium and low energies. (orig.)

  9. Evolution of gas-filled nanocracks in crystalline solids

    OpenAIRE

    M. Hartmann; Trinkaus, H.

    2002-01-01

    In this work, the evolution of gas-filled cracks under gas implantation and subsequent annealing is studied on the basis of an elastic continuum approach. The observed growth limitation of He-filled nanocracks in SiC is attributed to their stabilization by the formation of circular dislocation dipoles. The formation and Ostwald ripening of bubble-loop complexes at elevated temperatures is modeled in terms of gas atom exchange between such complexes coupled. with local matrix atom exchange bet...

  10. Behavior of argon gas release from manganese oxide minerals as revealed by 40Ar/39Ar laser incremental heating analysis

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    Manganese oxides in association with paleo- weathering may provide significant insights into the multiple factors affecting the formation and evolution of weathering profiles, such as temperature, precipitation, and biodiversity. Laser probe step-heating analysis of supergene hollandite and cryptomelane samples collected from central Queensland, Australia, yield well-defined plateaus andconsistent isochron ages, confirming the feasibility dating very-fined supergene manganese oxides by 40Ar/39Ar technique. Two distinct structural sites hostingAr isotopes can be identified in light of their degassing behaviors obtained byincremental heating analyses. The first site, releasing its gas fraction at thelaser power 0.2-0.4 W, yields primarily 40Aratm, 38Aratm, and 36Aratm (atmospheric Ar isotopes). The second sites yield predominantly 40Ar* (radiogenic 40Ar),39ArK, and 38ArK (nucleogenic components), at ~0.5-1.0 W. There is no significant Ar gas released at the laser power higher than 1.0 W, indicating the breakdown of the tunnel sites hosting the radiogenic and nucleogenic components. The excellent match between the degassing behaviors of 40Ar*, 39ArK, and 38ArK suggests that these isotopes occupy the same crystallographic sites and that 39ArK lossfrom the tunnel site by recoil during neutron irradiation and/or bake-out procedure preceding isotopic analysis does not occur. Present investigation supports that neither the overwhelming atmospheric 40Ar nor the very-fined nature of the supergene manganese oxides poses problems in extracting meaningful weathering geochronological information by analyzing supergene manganese oxides minerals.

  11. Flat-top phase-matched high-order harmonics in gas-filled cell

    Institute of Scientific and Technical Information of China (English)

    Xinhua Xie(谢新华); Zhinan Zeng(曾志男); Ruxin Li(李儒新); Yunpei Deng(邓蕴沛); Haihe Lu(陆海鹤); Dingjun Yin(印定军); Zhizhan Xu(徐至展)

    2004-01-01

    Phase-matched high-order harmonic generation in Ar gas-filled cell is investigated experimentally. We obtain phase-matched 27th order harmonic driven by a commercially available solid-state femtosecond laser system at 0.55 m J/pulse energy level and 1-kHz repetition rate. Moreover, we find that the spatial distribution of intensity of high-order harmonics is flat-top profile other than a Gaussian one under the condition of optimized conversion efficiency in the static gas cell.

  12. Method of Gas Filled Time of Flight in AMS Measurement

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    Isobaric interference is the main problem to be overcome in determination the long-livedradioisotopes. Energy loss method was used to measurement of these nuclides, but in the low energyaccelerator, the △E-E method is limited. In order to improve the power of isobaric identification in theaccelerator mass spectrometric measurements, a gas-filled time-of-flight (GF-TOF) spectrometric detectorhas been designed and set up.

  13. A new cryogenic gas-filled stopping chamber for SHIPTRAP

    Energy Technology Data Exchange (ETDEWEB)

    Eliseev, Sergey; Block, Michael; Herfurth, Frank; Kluge, H. Juergen; Vorobjev, Gleb [GSI, Darmstadt (Germany)

    2008-07-01

    The SHIPTRAP facility at GSI Darmstadt is a unique Penning trap mass spectrometer designed to perform high precision mass measurements on transuranium nuclides produced in fusion-evaporation reactions at the velocity filter SHIP. A crucial element of SHIPTRAP is a gas-filled stopping chamber, which transforms a fast ion beam of a few MeV/u from SHIP into a thermally cooled ion beam. Detailed experimental investigations of the gas-filled stopping chamber have revealed bottle necks, which limit the efficiency of SHIPTRAP. In order to improve the SHIPTRAP a novel cryogenic gas-filled stopping chamber has been designed and is presently under construction. The operation at liquid nitrogen temperature results in enhanced stopping and extraction performance. For example, ion losses due to ion diffusion - a significant loss process in the present room temperature chamber - will be substantially reduced. In addition, an influence of impurities on the performance of the chamber will be drastically reduced. All these modifications will allow us to increase the total efficiency of SHIPTRAP by factor of 4-5.

  14. Systems and methods for regulating pressure of a filled-in gas

    Energy Technology Data Exchange (ETDEWEB)

    Stautner, Ernst Wolfgang; Michael, Joseph Darryl

    2016-05-03

    A system for regulating a pressure of a filled-in gas is presented. The system includes a reservoir that stores a reservoir gas adsorbed in a sorbent material at a storage temperature, a gas-filled tube containing the filled-in gas, a controller configured to determine a pressure change required in the filled-in gas based upon signals representative of a pressure of the filled-in gas inside the gas-filled tube and a required pressure threshold, determine an updated temperature of the sorbent material based upon the pressure change required in the filled-in gas, and regulate the pressure of the filled-in gas by controlling the reservoir to change the storage temperature of the sorbent material to reach the updated temperature of the sorbent material.

  15. Polystyrene foam products equation of state as a function of porosity and fill gas

    Energy Technology Data Exchange (ETDEWEB)

    Mulford, Roberta N [Los Alamos National Laboratory; Swift, Damian C [LLNL

    2009-01-01

    An accurate EOS for polystyrene foam is necessary for analysis of numerous experiments in shock compression, inertial confinement fusion, and astrophysics. Plastic to gas ratios vary between various samples of foam, according to the density and cell-size of the foam. A matrix of compositions has been investigated, allowing prediction of foam response as a function of the plastic-to-air ratio. The EOS code CHEETAH allows participation of the air in the decomposition reaction of the foam. Differences between air-filled, Ar-blown, and CO{sub 2}-blown foams are investigated, to estimate the importance of allowing air to react with products of polystyrene decomposition. O{sub 2}-blown foams are included in some comparisons, to amplify any consequences of reaction with oxygen in air. He-blown foams are included in some comparisons, to provide an extremum of density. Product pressures are slightly higher for oxygen-containing fill gases than for non-oxygen-containing fill gases. Examination of product species indicates that CO{sub 2} decomposes at high temperatures.

  16. Alteration of natural (37)Ar activity concentration in the subsurface by gas transport and water infiltration.

    Science.gov (United States)

    Guillon, Sophie; Sun, Yunwei; Purtschert, Roland; Raghoo, Lauren; Pili, Eric; Carrigan, Charles R

    2016-05-01

    High (37)Ar activity concentration in soil gas is proposed as a key evidence for the detection of underground nuclear explosion by the Comprehensive Nuclear Test-Ban Treaty. However, such a detection is challenged by the natural background of (37)Ar in the subsurface, mainly due to Ca activation by cosmic rays. A better understanding and improved capability to predict (37)Ar activity concentration in the subsurface and its spatial and temporal variability is thus required. A numerical model integrating (37)Ar production and transport in the subsurface is developed, including variable soil water content and water infiltration at the surface. A parameterized equation for (37)Ar production in the first 15 m below the surface is studied, taking into account the major production reactions and the moderation effect of soil water content. Using sensitivity analysis and uncertainty quantification, a realistic and comprehensive probability distribution of natural (37)Ar activity concentrations in soil gas is proposed, including the effects of water infiltration. Site location and soil composition are identified as the parameters allowing for a most effective reduction of the possible range of (37)Ar activity concentrations. The influence of soil water content on (37)Ar production is shown to be negligible to first order, while (37)Ar activity concentration in soil gas and its temporal variability appear to be strongly influenced by transient water infiltration events. These results will be used as a basis for practical CTBTO concepts of operation during an OSI.

  17. Alteration of natural (37)Ar activity concentration in the subsurface by gas transport and water infiltration.

    Science.gov (United States)

    Guillon, Sophie; Sun, Yunwei; Purtschert, Roland; Raghoo, Lauren; Pili, Eric; Carrigan, Charles R

    2016-05-01

    High (37)Ar activity concentration in soil gas is proposed as a key evidence for the detection of underground nuclear explosion by the Comprehensive Nuclear Test-Ban Treaty. However, such a detection is challenged by the natural background of (37)Ar in the subsurface, mainly due to Ca activation by cosmic rays. A better understanding and improved capability to predict (37)Ar activity concentration in the subsurface and its spatial and temporal variability is thus required. A numerical model integrating (37)Ar production and transport in the subsurface is developed, including variable soil water content and water infiltration at the surface. A parameterized equation for (37)Ar production in the first 15 m below the surface is studied, taking into account the major production reactions and the moderation effect of soil water content. Using sensitivity analysis and uncertainty quantification, a realistic and comprehensive probability distribution of natural (37)Ar activity concentrations in soil gas is proposed, including the effects of water infiltration. Site location and soil composition are identified as the parameters allowing for a most effective reduction of the possible range of (37)Ar activity concentrations. The influence of soil water content on (37)Ar production is shown to be negligible to first order, while (37)Ar activity concentration in soil gas and its temporal variability appear to be strongly influenced by transient water infiltration events. These results will be used as a basis for practical CTBTO concepts of operation during an OSI. PMID:26939033

  18. Composition of Ar-Kr, Kr-Xe, and N2-Ar clusters produced by supersonic expansion of gas mixtures

    CERN Document Server

    Konotop, O P; Danylchenko, O G; Samovarov, V N

    2014-01-01

    An electron-diffraction study is made of the composition of binary Ar-Kr, Kr-Xe, and N2-Ar clusters of various size produced by expansion through a supersonic nozzle of gas mixtures with various component concentrations. The resulting clusters are shown to have compositions substantially different from those of the primary gas mixtures and dependent on cluster size. We have found that the key parameters needed for an analysis of cluster composition are the critical cluster radius and the heavier component concentration in the gas mixture which can be used to establish the regions of existence of homogeneous and heterogeneous clusters. These critical values determine the coefficient of the enrichment of clusters with the heavier component with respect to its concentration in the primary gas mixture. Theoretical relations are obtained which provide a good quantitative description of the experimental results and can be expected to be also valid for finding the composition of binary clusters of other van der Waal...

  19. Theoretical rovibrational analysis of the covalent noble gas compound ArNH+

    Science.gov (United States)

    Novak, Carlie M.; Fortenberry, Ryan C.

    2016-04-01

    Noble gasses can make covalent bonds. This has been clearly shown for ArH+ as is evidenced by the observation of this molecule ubiquitously in the interstellar medium. In order to augment the list of potential noble gas molecules, highly-accurate quartic field methods are employed here to analyze the ArNH+ radical cation for the first time. This study is in line with previous examinations of ArOH+, ArH2+, and ArH3+. It is shown here that the Arsbnd N bond strength falls below the Arsbnd O bond energy in ArOH+ but in line with that from ArH2+ indicating that ArNH+ could certainly be synthesized in the lab or, potentially, in nature. In order to aid in the search for this noble gas molecular cation, spectroscopic constants, fundamental vibrational frequencies, absorption intensities, and the center-of-mass dipole moment are provided at high-level in order to augment our understanding of noble gas chemistry.

  20. Handbook for Gas Filled RF Cavity Aficionados'

    Energy Technology Data Exchange (ETDEWEB)

    Tollestrup, A.V.; Chung, Moses; Yonehara, Katsuya; /Fermilab

    2009-05-01

    The use of hydrogen gas filled RF cavities in muon cooling channels has been proposed by Rolland Johnson. Impressive results have been obtained toward attaining high voltage gradients and rapid training in preliminary tests done at the FNAL MTA facility. However, so far it has not been possible to test them under conditions where they were subject to the transversal of a high intensity particle beam. This note is an attempt to bring together a description of some of the pertinent physical processes that take place in the dilute plasma that is generated in the hydrogen gas by the beam. Two effects dominate. The first is that the free electrons generated can load down the cavity and transfer its energy to heating the gas. The second is a question of what happens to the plasma in the longer term. There is an enormous literature on the subject of the subject of dilute hydrogen plasmas and we can tap into this information in order to understand and predict the behavior of the cavity.

  1. A compact gas-filled avalanche counter for DANCE

    Science.gov (United States)

    Wu, C. Y.; Chyzh, A.; Kwan, E.; Henderson, R. A.; Gostic, J. M.; Carter, D.; Bredeweg, T. A.; Couture, A.; Jandel, M.; Ullmann, J. L.

    2012-12-01

    A compact gas-filled avalanche counter for the detection of fission fragments was developed for a highly segmented 4π γ-ray calorimeter, namely the Detector for Advanced Neutron Capture Experiments located at the Lujan Center of the Los Alamos Neutron Science Center. It has been used successfully for experiments with 235U, 238Pu, 239Pu, and 241Pu isotopes to provide a unique signature to differentiate the fission from the competing neutron-capture reaction channel. It was also used to study the spontaneous fission in 252Cf. The design and performance of this avalanche counter for targets with extreme α-decay rate up to ˜2.4×108/s are described.

  2. A compact gas-filled avalanche counter for DANCE

    Energy Technology Data Exchange (ETDEWEB)

    Wu, C.Y., E-mail: wu24@llnl.gov [Lawrence Livermore National Laboratory, Livermore, CA 94551 (United States); Chyzh, A.; Kwan, E.; Henderson, R.A.; Gostic, J.M.; Carter, D. [Lawrence Livermore National Laboratory, Livermore, CA 94551 (United States); Bredeweg, T.A.; Couture, A.; Jandel, M.; Ullmann, J.L. [Los Alamos National Laboratory, Los Alamos, NM 87545 (United States)

    2012-12-01

    A compact gas-filled avalanche counter for the detection of fission fragments was developed for a highly segmented 4{pi} {gamma}-ray calorimeter, namely the Detector for Advanced Neutron Capture Experiments located at the Lujan Center of the Los Alamos Neutron Science Center. It has been used successfully for experiments with {sup 235}U, {sup 238}Pu, {sup 239}Pu, and {sup 241}Pu isotopes to provide a unique signature to differentiate the fission from the competing neutron-capture reaction channel. It was also used to study the spontaneous fission in {sup 252}Cf. The design and performance of this avalanche counter for targets with extreme {alpha}-decay rate up to {approx}2.4 Multiplication-Sign 10{sup 8}/s are described.

  3. A compact gas-filled avalanche counter for DANCE

    International Nuclear Information System (INIS)

    A compact gas-filled avalanche counter for the detection of fission fragments was developed for a highly segmented 4π γ-ray calorimeter, namely the Detector for Advanced Neutron Capture Experiments located at the Lujan Center of the Los Alamos Neutron Science Center. It has been used successfully for experiments with 235U, 238Pu, 239Pu, and 241Pu isotopes to provide a unique signature to differentiate the fission from the competing neutron-capture reaction channel. It was also used to study the spontaneous fission in 252Cf. The design and performance of this avalanche counter for targets with extreme α-decay rate up to ∼2.4×108/s are described.

  4. A method of firing a gas filled switching tube

    Energy Technology Data Exchange (ETDEWEB)

    Bryukhanevich G.I.; Kolesov, G.V.; Lebedev, V.B.; Prokhorenko, V.I.

    1984-01-01

    A method is proposed for firing a gas filled switching tube which involves injecting a laser pulse of picosecond duration with an energy level higher than the firing threshold of the switching tube to the spark gap of the tube to be fired. In order to improve the operational stability of the tube, after a time period equal to delta T (with respect to the point where the first laser pulse is fed to the spark gap), a primary supplementary pulse is fed to the gap; the power level of this pulse is selected to be at least half the power level of the first, and the time interval delta T is selected depending on the value of the experimentally determined minimum delay time (t3 min) of the tube during firing by a separately selected primary pulse in a ratio of .5t3 min is less than delta T is less than or equal to t3 min.

  5. Laser-plasma interactions in large gas-filled hohlraums

    Energy Technology Data Exchange (ETDEWEB)

    Turner, R.E.; Powers, L.V.; Berger, R.L. [and others

    1996-06-01

    Indirect-drive targets planned for the National Ignition Facility (NIF) laser consist of spherical fuel capsules enclosed in cylindrical Au hohlraums. Laser beams, arranged in cylindrical rings, heat the inside of the Au wall to produce x rays that in turn heat and implode the capsule to produce fusion conditions in the fuel. Detailed calculations show that adequate implosion symmetry can be maintained by filling the hohlraum interior with low-density, low-Z gases. The plasma produced from the heated gas provides sufficient pressure to keep the radiating Au surface from expanding excessively. As the laser heats this gas, the gas becomes a relatively uniform plasma with small gradients in velocity and density. Such long-scale-length plasmas can be ideal mediums for stimulated Brillouin Scattering (SBS). SBS can reflect a large fraction of the incident laser light before it is absorbed by the hohlraum; therefore, it is undesirable in an inertial confinement fusion target. To examine the importance of SBS in NIF targets, the authors used Nova to measure SBS from hohlraums with plasma conditions similar to those predicted for high-gain NIF targets. The plasmas differ from the more familiar exploding foil or solid targets as follows: they are hot (3 keV); they have high electron densities (n{sub e}=10{sup 21}cm{sup {minus}3}); and they are nearly stationary, confined within an Au cylinder, and uniform over large distances (>2 mm). These hohlraums have <3% peak SBS backscatter for an interaction beam with intensities of 1-4 x 10{sup 15} W/cm{sup 2}, a laser wavelength of 0.351{micro}m, f/4 or f/8 focusing optics, and a variety of beam smoothing implementations. Based on these conditions the authors conclude that SBS does not appear to be a problem for NIF targets.

  6. Efficient Spectral Broadening in the 100-W Average Power Regime Using Gas Filled Kagome HC-PCF and Pulse Compression

    OpenAIRE

    Emaury, Florian; Saraceno, Clara J.; Debord, Benoit; Ghosh, Debashri; Diebold, Andreas; Gerome, Frederic; Suedmeyer, Thomas; Benabid, Fetah; Keller, Ursula

    2014-01-01

    We present nonlinear pulse compression of a high-power SESAM-modelocked thin-disk laser (TDL) using an Ar-filled hypocycloid-core Kagome Hollow-Core Photonic Crystal Fiber (HC-PCF). The output of the modelocked Yb:YAG TDL with 127 W average power, a pulse repetition rate of 7 MHz, and a pulse duration of 740 fs was spectrally broadened 16-fold while propagating in a Kagome HC-PCF containing 13 bar of static Argon gas. Subsequent compression tests performed using 8.4% of the full available pow...

  7. Automation of experiments at Dubna Gas-Filled Recoil Separator

    Science.gov (United States)

    Tsyganov, Yu. S.

    2016-01-01

    Approaches to solving the problems of automation of basic processes in long-term experiments in heavy ion beams of the Dubna Gas-Filled Recoil Separator (DGFRS) facility are considered. Approaches in the field of spectrometry, both of rare α decays of superheavy nuclei and those for constructing monitoring systems to provide accident-free experiment running with highly radioactive targets and recording basic parameters of experiment, are described. The specific features of Double Side Silicon Strip Detectors (DSSSDs) are considered, special attention is paid to the role of boundary effects of neighboring p-n transitions in the "active correlations" method. An example of an off-beam experiment attempting to observe Zeno effect is briefly considered. Basic examples for nuclear reactions of complete fusion at 48Ca ion beams of U-400 cyclotron (LNR, JINR) are given. A scenario of development of the "active correlations" method for the case of very high intensity beams of heavy ions at promising accelerators of LNR, JINR, is presented.

  8. Development of a portable gas-filled ionization chamber

    Energy Technology Data Exchange (ETDEWEB)

    Chae, K. Y.; Cha, S. M.; Gwak, M. S. [Sungkyunkwan University, Suwon (Korea, Republic of)

    2014-02-15

    A new portable gas-filled ionization chamber has been designed and constructed at the Physics Department of Sung Kyun Kwan University. To overcome the maximum count rate of ∼ 10{sup 5} particles per second of a conventional ionization chamber, which utilizes a Frisch grid, and to enhance the portability of a detector, we adopted the design of multiple electrodes and modified it from the original designs by Kimura et al. and Chae et al. The new design utilizes a stack of multiple electrodes installed perpendicular to the optical beam axis. This configuration provides a fast response time for the detector, which is essential for high-rate counting. The device has been tested with a {sup 241}Am (t{sub 1/2} = 432.2 years) radioactive α source, which mainly emits 5.486-MeV (branching ratio of 85%) and 5.443-MeV (branching ratio of 13%) α particles. An energy resolution of 6.3% was achieved.

  9. Experimental Study of High-Z Gas Buffers in Gas-Filled ICF Engines

    Energy Technology Data Exchange (ETDEWEB)

    Rhodes, M A; Kane, J; Loosmore, G; DeMuth, J; Latkowski, J

    2010-12-03

    ICF power plants, such as the LIFE scheme at LLNL, may employ a high-Z, target-chamber gas-fill to moderate the first-wall heat-pulse due to x-rays and energetic ions released during target detonation. To reduce the uncertainties of cooling and beam/target propagation through such gas-filled chambers, we present a pulsed plasma source producing 2-5 eV plasma comprised of high-Z gases. We use a 5-kJ, 100-ns theta discharge for high peak plasma-heating-power, an electrode-less discharge for minimizing impurities, and unobstructed axial access for diagnostics and beam (and/or target) propagation studies. We will report on the plasma source requirements, design process, and the system design.

  10. A combined noble gas and {sup 40}Ar-{sup 39}Ar study of Salt Lake Crater xenolith SL322 from Oahu, Hawaii

    Energy Technology Data Exchange (ETDEWEB)

    Trieloff, M. [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany); Rocholl, A. [Heidelberg Univ. (Germany). Mineralogisch-Petrographisches Inst.; Jessberger, E.K. [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany)]|[Muenster Univ. (Germany). Inst. fuer Planetologie

    1998-12-31

    The microdistribution of noble gases in a garnet pyroxenite nodule from Salt Lake Crater (SLC), Oahu, Hawaii, was investigated by a detailed step-heating and -crushing analysis and a {sup 40}Ar-{sup 39}Ar-study. A noble gas component with MORB type argon, helium and neon resides in CO{sub 2}-rich fluid inclusions trapped in <30 km depth. This component was most probably derived from the nephelinitic SLC host magma and confirms the dominance of MORB type noble gases in the late post-erosional magmatic stages of Hawaiian volcanism, as suggested previsouly (Kurz et al., 1983; Valbracht et al., 1996). A second previously detected (Rocholl et al., 1996) low {sup 40}Ar/{sup 36}Ar ({proportional_to}5000) component turned out to be associated with two different reservoirs. The larger reservoir is most probably related to garnet, the other one is associated with low retentive sites containing few K and Cl and could not yet be adequately identified. The low {sup 40}Ar/{sup 36}Ar ({proportional_to}5000) component hosted by garnet can be interpreted as a mixture of MORB and plume type noble gas components with specific {sup 4}He/{sup 40}Ar ratios. The results demonstrate the complexity of the microdistribution of noble gases in ultramafic nodules and allow insight into plume induced metasomatism of the Hawaiian lithosphere. (orig.)

  11. A Concept for a Low Pressure Noble Gas Fill Intervention in the IFE Fusion Test Facility (FTF) Target Chamber

    Energy Technology Data Exchange (ETDEWEB)

    Gentile, C. A.; Blanchard, W. R.; Kozub, T. A.; Aristova, M.; McGahan, C.; Natta, S.; Pagdon, K.; Zelenty, J.

    2010-01-14

    wall acts as the primary heat exchanger. During removal, gas is pumped through the laser ports by turbo molecular-drag pumps (TM-DP). For the purpose of reducing organic based lubricants and seals, a magnetically levitated TM-DP is being investigated with pump manufacturers. Currently, magnetically levitated turbo molecular pumps are commercially available. The pumps will be exposed to thermal loads and ionizing radiation (tritium, Ar-41, post detonation neutrons). Although the TM-DP's will be subjected to these various radiations, current designs for similar pumping devices have been hardened and have the ability of locating control electronics in remote radiation shielded enclosures4. The radiation hardened TM-DP's will be 5 required to operate with minimal maintenance for periods of up to 18 continuous months. As part of this initial investigation for developing a conceptual engineering strategy for a gas fill solution, commercial suppliers of low pressure gas pumping systems have been contacted and engaged in this evaluation. Current technology in the area of mechanical pumping systems indicates that the development of a robust pumping system to meet the requirements of the FTF gas fill concept is within the limits of COTS equipment3,4.

  12. A Concept for a Low Pressure Noble Gas Fill Intervention in the IFE Fusion Test Facility (FTF) Target Chamber

    International Nuclear Information System (INIS)

    wall acts as the primary heat exchanger. During removal, gas is pumped through the laser ports by turbo molecular-drag pumps (TM-DP). For the purpose of reducing organic based lubricants and seals, a magnetically levitated TM-DP is being investigated with pump manufacturers. Currently, magnetically levitated turbo molecular pumps are commercially available. The pumps will be exposed to thermal loads and ionizing radiation (tritium, Ar-41, post detonation neutrons). Although the TM-DP's will be subjected to these various radiations, current designs for similar pumping devices have been hardened and have the ability of locating control electronics in remote radiation shielded enclosures4. The radiation hardened TM-DP's will be 5 required to operate with minimal maintenance for periods of up to 18 continuous months. As part of this initial investigation for developing a conceptual engineering strategy for a gas fill solution, commercial suppliers of low pressure gas pumping systems have been contacted and engaged in this evaluation. Current technology in the area of mechanical pumping systems indicates that the development of a robust pumping system to meet the requirements of the FTF gas fill concept is within the limits of COTS equipment3,4.

  13. Detection of a Noble Gas Molecular Ion, {36}ArH^+, in the Crab Nebula

    CERN Document Server

    Barlow, M J; Owen, P J; Cernicharo, J; Gomez, H L; Ivison, R J; Krause, O; Lim, T L; Matsuura, M; Miller, S; Olofsson, G; Polehampton, E T

    2013-01-01

    Noble gas molecules have not hitherto been detected in space. From spectra obtained with the Herschel Space Observatory, we report the detection of emission in the 617.5 GHz and 1234.6 GHz J = 1-0 and 2-1 rotational lines of {36}ArH^+ at several positions in the Crab Nebula, a supernova remnant known to contain both H2 molecules and regions of enhanced ionized argon emission. {36}Ar is believed to have originated from explosive nucleosynthesis in massive stars during core-collapse supernova events. Its detection in the Crab Nebula, the product of such a supernova event, confirms this expectation. The likely excitation mechanism for the observed {36}ArH^+ emission lines is electron collisions in partially ionized regions with electron densities of a few hundred per centimeter cubed.

  14. Anisotropic amplitude variation of the bottom-simulating reflector beneath fracture-filled gas hydrate deposit

    Digital Repository Service at National Institute of Oceanography (India)

    Sriram, G.; Dewangan, P.; Ramprasad, T.; RamaRao, P.

    For the first time, we report the amplitude variation with angle (AVA) pattern of bottom-simulating reflectors (BSRs) beneath fracture-filled gas hydrate deposits when the effective medium is anisotropic. The common depth point (CDP) gathers of two...

  15. Thermoregulated Nitric Cryosystem for Cooling Gas-Filled Detectors of Ionizing Radiation

    Directory of Open Access Journals (Sweden)

    Zharkov I.P.

    2015-09-01

    Full Text Available Cryosystem for cooling and filling of gas-filled detectors of ionizing radiation with compressed inert gas on the basis of wide-nitrogen cryostat, which provides detetector temperature control in a range of 173 — 293 K and its stabilization with accuracy of ± 1°. The work was carried out within the Ukraine — NATO Program of Collaboration, Grant SfP #984655.

  16. Effects of Natural Gas Compositions on CNG Fast Filling Process for Buffer Storage System

    Directory of Open Access Journals (Sweden)

    Farzaneh-Gord M.

    2013-02-01

    Full Text Available The accurate modeling of the fast-fill process occurring in Compressed Natural Gas (CNG fuelled vehicle storage cylinders is a complex process and should be thoroughly studied. Final in-cylinder conditions should meet appropriate cylinder safety standards. The composition of natural gas plays an important role on its thermodynamic properties and consequently, on the fast-fill process and the final conditions. Here, a theoretical analysis has been developed to study the effects of the natural gas composition on the filling process of an onboard Natural Gas Vehicle (NGV cylinder. The cylinder is assumed as a lumped system. The analysis is based on laws of thermodynamics and mass balance. Based on AGA8 Equation of State (EOS and thermodynamics relationships, the required properties of natural gas mixtures have been calculated. The results are presented for an adiabatic system. The results show that the compositions of natural gas have great effects on the filling process and final in-cylinder conditions. Furthermore, the gas with less methane percentage in its composition is more suitable for the filling process.

  17. Synchrotron radiation-excited etching of ZnTe using Ar gas

    Energy Technology Data Exchange (ETDEWEB)

    Tanaka, Tooru [Synchrotron Light Application Center, Saga University, 1 Honjyo, Saga 840-8502 (Japan)]. E-mail: ttanaka@cc.saga-u.ac.jp; Kume, Yusuke [Synchrotron Light Application Center, Saga University, 1 Honjyo, Saga 840-8502 (Japan); Hayashida, Kazuki [Venture Business Laboratory, Saga University, 1 Honjyo, Saga 840-8502 (Japan); Saito, Katsuhiko [Venture Business Laboratory, Saga University, 1 Honjyo, Saga 840-8502 (Japan); Nishio, Mitsuhiro [Department of Electrical and Electronic Engineering, Saga University, 1 Honjyo, Saga 840-8502 (Japan); Guo, Qixin [Department of Electrical and Electronic Engineering, Saga University, 1 Honjyo, Saga 840-8502 (Japan); Ogawa, Hiroshi [Synchrotron Light Application Center, Saga University, 1 Honjyo, Saga 840-8502 (Japan)

    2005-08-15

    Dependence of the synchrotron light-excited etching of ZnTe on the pressure has been investigated. Ar gas was used as an etching gas, and the ZnTe sample was negatively biased against the reaction chamber. The etching rate increases with increasing the pressure, and the maximum etching rate of 16.7 nm/A min has been achieved. In order to discuss the etching mechanism, the wavelength dependence of the etching properties was examined using a LiF window.

  18. X-ray detector for automatic exposure control using ionization chamber filled with xenon gas

    CERN Document Server

    Nakagawa, A; Yoshida, T

    2003-01-01

    This report refers to our newly developed X-ray detector for reliable automatic X-ray exposure control, which is to be widely used for X-ray diagnoses in various clinical fields. This new detector utilizes an ionization chamber filled with xenon gas, in contrast to conventional X-ray detectors which use ionization chambers filled with air. Use of xenon gas ensures higher sensitivity and thinner design of the detector. The xenon gas is completely sealed in the chamber, so that the influence of the changes in ambient environments is minimized. (author)

  19. Stabilization of gas-filled surge arrester’s characteristics by use of ionizing radiation

    Directory of Open Access Journals (Sweden)

    Brajović Dragan V.

    2012-01-01

    Full Text Available This paper investigates the stabilization of electrical discharges in gases by means of external ionizing radiation. Discharges in a gas-filled surge arrester model were studied in both passive and active regimes of the device. An originally developed model of the gas-filled surge arrester was used. Gas pressure and the interelectrode gap were the variable parameters in our measurements. Applied radiation types included α-particles, γ-rays, X-rays, and neutrons. Measurements were performed under highly controlled laboratory conditions. The combined measurement uncertainty of the applied procedure was estimated as being under the 5% level. The results obtained are followed by a theoretical explanation. The crucial result is the conclusion that ionizing radiation does not necessarily degrade the gas-filled surge arrester’s functionality but that it, rather, improves it under certain conditions.

  20. Soliton dynamics in gas-filled hollow-core photonic crystal fibers

    International Nuclear Information System (INIS)

    Gas-filled hollow-core photonic crystal fibers offer unprecedented opportunities to observe novel nonlinear phenomena. The various properties of gases that can be used to fill these fibers give additional degrees of freedom for investigating nonlinear pulse propagation in a wide range of different media. In this review, we will consider some of the the new nonlinear interactions that have been discovered in recent years, in particular those which are based on soliton dynamics. (topical review)

  1. Beam cooling using a gas-filled RFQ ion guide

    CERN Document Server

    Henry, S; De Saint-Simon, M; Jacotin, M; Képinski, J F; Lunney, M D

    1999-01-01

    A radiofrequency quadrupole mass filter is being developed for use as a high-transmission beam cooler by operating it in buffer gas at high pressure. Such a device will increase the sensitivity of on-line experiments that make use of weakly produced radioactive ion beams. We present simulations and some preliminary measurements for a device designed to cool the beam for the MISTRAL RF mass spectrometer on- line at ISOLDE. The work is carried out partly within the frame of the European Community research network: EXOTRAPS. (9 refs).

  2. AMS Measurement of 36Cl With a Gas-filled Time of Flight Detector

    Institute of Scientific and Technical Information of China (English)

    GUANYong-jing; HEMing; RUANXiang-dong; WANGHui-juan; LIGuo-qiang; WUShao-yong; WUWei-ming; JIANGShan

    2003-01-01

    In order to determine 36Cl and 36S with high sensitivity by AMS, the present study has been done.Difference of time flight in the gas dependences to total energy, gas pressure in the chamber, and the flight length for isobars. The time resolution (FWHM) of the detector system is 800 ps without gas-filled when the ion energy is 72 MeV. Time straggling is growth with the increase of gas pressure in the chamber.Time straggling caused by the gas pressure is shown in Fig.1.

  3. Acoustic emission from gas-filled coal under triaxial compression

    Institute of Scientific and Technical Information of China (English)

    Yin; Guangzhi; Qin; Hu; Huang; Gun; Lv; Youchang; Dai; Zhixu

    2012-01-01

    Acoustic emission(AE) experiments have been performed on gas-saturated coal specimens under conventional triaxial compression.The AE characteristics were investigated for a methane gas flow through the coal specimen.One AE parameter,AE count,when normalized by the total count number was used to represent the damage evolution in the gassy coal.It is shown that this AE parameter is a reasonable indicator for damage occurring within the coal specimen since its envelope has almost the same shape as the complete stress-strain curve,except for a short time delay.In addition,the change in AE count is highly consistent with the change in coal permeability.Test results also show that methane containing coal emits a small number of AE events before entering the yield stage.AE activity gradually increases during the yield process up to the peak stress.The lowest permeability corresponds to the highest AE activity,implying failure will soon occur.An AE based constitutive model was constructed and the theoretical results agree well with those of experiments.

  4. Isobaric Identification Using Gas-Filled Time-of-Flight Measurements in an Accelerator Mass Spectrometry

    Institute of Scientific and Technical Information of China (English)

    GUAN Yong-Jing; RUAN Xiang-Dong; HE Ming; WANG Hui-Juan; LI Guo-Qiang; WU Shao-Yong; DONG Ke-Jun; LIN Min; JIANG Shan

    2005-01-01

    @@ A gas-filled time-of-flight (GF-TOF) detector has been built and developed to improve the ability of isobaric identification in accelerator mass spectrometry (AMS) measurements, and a time resolution (without gas filled)of better than 350ps is achieved. The GF-TOF detector is tested by means of measuring a standard AgCl(36Cl/Cl = 7.6 × 10-9g/g) sample with the 36Cl ion energy of 64, 49 and 33MeV, respectively. 36Cl and 36S particles were successfully separated in the TOF spectra output from the GF-TOF detector. The comparison between the gas-filled time-of-flight method and the △E - E method is described. Some results relative to the GF-TOF method are given as well.

  5. Gas-filled targets for large scale-length plasma interaction experiments on Nova

    International Nuclear Information System (INIS)

    Stimulated Brillouin backscatter from large scale-length gas-filled targets has been measured on the Nova laser. These targets were designed to approximate conditions in indirect drive ignition target designs in underdense plasma electron density (ne∼1021/cm3), temperature (Te>3 keV), and gradient scale lengths (Ln∼2 mm, Lv>6 mm) as well as calculated gain for stimulated Brillouin scattering (SBS). The targets used in these experiments were gas-filled balloons with polyimide walls (gasbags) and gas-filled hohlraums. Detailed characterization using x-ray imaging and x-ray and optical spectroscopy verifies that the calculated plasma conditions are achieved. Time-resolved SBS backscatter from these targets is <3% for conditions similar to ignition target designs

  6. New gas-filled mode of the large-acceptance spectrometer VAMOS

    Energy Technology Data Exchange (ETDEWEB)

    Schmitt, C., E-mail: schmitt@ganil.f [GANIL, CEA/DSM-CNRS/IN2P3, Bd Henri Becquerel, BP 55027, F-14076 Caen Cedex 5 (France); Rejmund, M.; Navin, A.; Lecornu, B.; Jacquot, B.; France, G. de; Lemasson, A.; Shrivastava, A. [GANIL, CEA/DSM-CNRS/IN2P3, Bd Henri Becquerel, BP 55027, F-14076 Caen Cedex 5 (France); Greenlees, P.; Uusitalo, J. [Department of Physics, University of Jyvaskyla, P.O. Box 35, FI-40014, Jyvaskyla (Finland); Subotic, K. [VINCA Institute of Nuclear Sciences, P.O. Box 522, 11001 Belgrade (Serbia); Gaudefroy, L. [CEA, DAM, DIF, F-91297 Arpajon (France); Theisen, Ch.; Sulignano, B. [CEA-Saclay DSM/IRFU/SPhN, F-91191 Gif/Yvette Cedex (France); Dorvaux, O.; Stuttge, L. [IPHC, UMR7178, IN2P3-CNRS et Universite Louis Pasteur, BP28, F-67037 Strasbourg (France)

    2010-09-21

    A new gas-filled operation mode of the large-acceptance spectrometer VAMOS at GANIL is reported. A beam rejection factor greater than 10{sup 10} is obtained for the {sup 40}Ca+{sup 150}Sm system at 196 MeV. The unprecedented transmission efficiency for the evaporation residues produced in this reaction is estimated to be around 80% for {alpha}x n channels and above 95% for x ny p channels. A detailed study of the performance of the gas-filled VAMOS and future developments are discussed. This new operation mode opens avenues to explore the potential of fusion reactions in various kinematics.

  7. Gas gain limitation in low pressure proportional counters filled with TEG mixtures

    Science.gov (United States)

    Kowalski, T. Z.

    2014-12-01

    Proportional counters filled with tissue equivalent gas mixtures (TEPC) can be used to simulate interactions and energy transferred to small tissue volumes. One criteria which allows to use TEPC as the dose meter is that the particle ranges are larger compared to the gas volume. TEPC achieve this by operating at low gas pressures. Single ionization events dominate the distribution of low-LET radiation at low gas pressure and therefore their detection is of primary importance, a high gas gain is necessary. Therefore gas gain factor has been measured for Methane- and Propane-based tissue equivalent gas mixtures. The highest stable gas gains, second ionization Townsend coefficient and electron avalanche dimensions have been determined.

  8. Deposition dynamics of droplet-free Si nanoparticles in Ar gas using laser ablation

    Science.gov (United States)

    Takeuchi, D.; Mizuta, T.; Makimura, T.; Yoshida, S.; Fujita, M.; Hata, K.; Shigekawa, H.; Murakami, K.

    2002-09-01

    Droplet-free deposition of Si nanoparticle films has been studied applying time-resolved imaging of Si nanoparticles formed by laser ablation of Si targets in Ar gas. We found that Si nanoparticles can be deposited not only on substrates facing to the targets but also on substrates placed beside the target. We further confirmed using a scanning tunneling microscope (STM), Si nanoparticles with sizes of 5-8 nm are deposited on substrates placed beside the target and using a scanning electron microscope (SEM) on the substrates, no droplets are observed.

  9. Measurement of void volume of a fuel rod and the exchange of occluded gases from mixed carbide fuel with filling gas helium

    Energy Technology Data Exchange (ETDEWEB)

    Rama Rao, G.A. [Bhabha Atomic Res. Centre, Bombay (India). Fuel Chem. Div.; Kulkarni, S.G. [Bhabha Atomic Res. Centre, Bombay (India). Fuel Chem. Div.; Venugopal, V. [Bhabha Atomic Res. Centre, Bombay (India). Fuel Chem. Div.; Manchanda, V.K. [Radiochemistry Division, Bhabha Atomic Research Centre, Bombay 400 085 (India); Goswami, G.L. [Atomic Fuels Division, Bhabha Atomic Research Centre, Bombay 400 085 (India)

    1995-02-01

    The presence of gaseous impurities in the filling gas of a fuel pin is detrimental to the thermal performance of a nuclear reactor fuel. The composition of the filling gas does not remain constant throughout the life of the fuel pin. The gas exchange phenomena that occur between the cover gas and impurity gases affect the fuel performance more severely in (U, Pu)O{sub 2} fuel pin due to its inherently poor thermal conductivity than in advanced fuels such as mixed carbides and nitrides. In the present study the exchange phenomenon of the occluded gases present in our Fast Breeder Test Reactor (FBTR) fuel pellets [(U{sub 0.30}, Pu{sub 0.70})C with 6500 ppm O] with the cover gas helium was observed as a function of time and temperature. Quantitative analysis of the released gases namely H{sub 2}, O{sub 2}+Ar, N{sub 2}, CH{sub 4} and CO was carried out at subambient pressure by gas chromatography. The void volume of the fuel element is determined experimentally by gas equilibration with known volume. ((orig.))

  10. Measurement of void volume of a fuel rod and the exchange of occluded gases from mixed carbide fuel with filling gas helium

    Science.gov (United States)

    Rao, G. A. Rama; Kukarni, S. G.; Venugoopal, V.; Manchanda, V. K.; Goswami, G. L.

    1995-02-01

    The presence of gaseous impurities in the filling gas of a fuel pin is detriental to the thermal performance of a nuclear reactor fuel. The composition of the filling gas does not remain constant throughout the life of the fuel pin. The gas exchange phenomena that occur between the cover gas and impurity gases affect the fuel performance more severely in (U, Pu)O 2 fuel pin due to its inherently poor thermal conductivity than in advanced fuels such as mixed carbides and nitrides. In the present study the exchange phenomenon of the occluded gases present in our Fast Breeder Test Reactor (FBTR) fuel pellets [(U 0.30, Pu 0.70)C with 6500 ppm o] with the cover gas helium was observed as a function of time and temperature. Quantitative analysis of the released gases namely H 2, O 2 + Ar, N 2, CH 4 and CO was carried out at subambient pressure by gas chromatography. The void volume of the fuel element is determined experimentally by gas equilibration with known volume.

  11. Physiological and behavioral responses of poultry exposed to gas-filled high expansion foam

    NARCIS (Netherlands)

    Mckeegan, D.E.F.; Reimert, H.G.M.; Hindle, V.A.; Boulcott, P.; Sparrey, J.M.; Wathes, C.M.; Demmers, T.G.M.; Gerritzen, M.A.

    2013-01-01

    Disease control measures require poultry to be killed on farms to minimize the risk of disease being transmitted to other poultry and, in some cases, to protect public health. We assessed the welfare implications for poultry of the use of high-expansion gas-filled foam as a potentially humane, emerg

  12. Production of high intensity heavy ion beams for the experiments on a gas-filled separator

    International Nuclear Information System (INIS)

    A gas-filled separator of heavy ions induced reactions products permits a substantial suppression of the background from primary beam ions. This feature allows one to obtain an extremely intensive ion beam from the cyclotron U-400. Experimental studies were performed to investigate the operation of various stripping carbon foils. 7 refs.; 2 figs

  13. Etching characteristic and mechanism of BST thin films using inductively coupled Cl2/Ar plasma with additive CF4 gas

    International Nuclear Information System (INIS)

    BST thin films were etched with inductively coupled CF4/(Cl2+Ar) plasmas. The maximum etch rate of the BST thin films was 53.6 nm/min for a 10% CF4 to the Cl2/Ar gas mixture at RF power of 700 W, DC bias of -150 V, and chamber pressure of 2 Pa. Small addition of CF4 to the Cl2/Ar mixture increased chemical effect. Consequently, the increased chemical effect caused the increase in the etch rate of the BST thin films. To clarify the etching mechanism, the surface reaction of the BST thin films was investigated by X-ray photoelectron spectroscopy

  14. Effects of sputtering Ar gas pressure in the exchange stiffness constant of Co40Fe40B20 thin films

    International Nuclear Information System (INIS)

    The exchange stiffness constants of 25-nm-thick Co40Fe40B20 films are investigated by Brillouin light scattering. Series of Co40Fe40B20 films is prepared with various Ar gas pressures, and we found that the exchange stiffness constant decreases from 1.41 to 0.98×10−11 1rom 1.41 to 0.98ous Ar gas pressures, and we found that thin stiffness constants are much smaller than CoFe values due to the B atoms, and the dependence of Ar gas pressure is noticeable. Based on our previous theoretical work, the switching current density of spin transfer torque magnetic random access memory is very sensitive on the exchange stiffness constant; it implies that engineering the exchange stiffness constant by the fabrication process is important to reduce switching current density and the dispersion of switching current density. - Highlights: ► We study the exchange stiffness constant in CoFeB thin films. ► Series of CoFeB films is prepared with various Ar gas pressures. ► We found the exchange stiffness constant decreases with increasing Ar gas pressure

  15. The gas-filled magnet: An isobar separator for accelerator mass spectrometry

    International Nuclear Information System (INIS)

    The most difficult problem for accelerator mass spectrometry is the rejection of stable atomic isobars. The intensity of isobaric interference is expected to become a problem for 36Cl measurements with the use of new high-intensity ion sources. Although better chemical separation may be possible through improved sample preparation, the device expected to help most with this problem is the gas-filled magnet. We tested a gas-filled Enge split-pole spectrograph combined with a multi-plate gas ionization detector for the separation of 36S from 36Cl and obtained an isobar separation of about two orders of magnitude better than that possible with the detector alone. 10 refs., 3 figs., 1 tab

  16. Utilizing gas-filled cavities for the generation of an intense muon source

    International Nuclear Information System (INIS)

    A key requirement for designing intense muon sources is operating rf cavities in multi-tesla magnetic fields. Recently, a proof-of-principle experiment demonstrated that an rf cavity filed with high pressure hydrogen gas could meet this goal. In this study, rigorous simulation is used to design and evaluate the performance of an intense muon source with gas filled cavities. We present a new lattice design and compare our results with conventional schemes. We detail the influence of gas pressure on the muon production rate.

  17. Utilizing Gas Filled Cavities for the Generation of an Intense Muon Source

    Energy Technology Data Exchange (ETDEWEB)

    Stratakis, Diktys; Neuffer, David V.

    2015-05-01

    A key requirement for designing intense muon sources is operating rf cavities in multi-tesla magnetic fields. Recently, a proof-of-principle experiment demonstrated that an rf cavity filed with high pressure hydrogen gas could meet this goal. In this study, rigorous simulation is used to design and evaluate the performance of an intense muon source with gas filled cavities. We present a new lattice design and compare our results with conventional schemes. We detail the influence of gas pressure on the muon production rate.

  18. Utilizing gas-filled cavities for the generation of an intense muon source

    Energy Technology Data Exchange (ETDEWEB)

    Stratakis, Diktys [Brookhaven National Lab. (BNL), Upton, NY (United States); Neuffer, David V. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States)

    2015-05-03

    A key requirement for designing intense muon sources is operating rf cavities in multi-tesla magnetic fields. Recently, a proof-of-principle experiment demonstrated that an rf cavity filed with high pressure hydrogen gas could meet this goal. In this study, rigorous simulation is used to design and evaluate the performance of an intense muon source with gas filled cavities. We present a new lattice design and compare our results with conventional schemes. We detail the influence of gas pressure on the muon production rate.

  19. A comparative study of naturally ventilated and gas filled windows for hot climates

    International Nuclear Information System (INIS)

    The use of absorbing gases filling the gap between glass sheets appears to be an alternative solution for thermally insulated glass windows. Fluid flow in the gap between the glass sheets either forced or natural offers other options for thermally efficient windows. In this work, the thermal efficiencies of glass windows filled with an absorbing gas exposed to solar radiation in hot climate is compared with both a simple glass window and a double glass window naturally ventilated. The two-dimensional transient energy equations with radiation absorption in the internal domain are used to model the simple glass window. The cumulative wavenumber model (CW) for real gas modeling together the discrete ordinates method is used to model double glass window filled with infrared absorbing gases. The numerical simulations were realized with three mixtures of gases, a strongly absorbing gas mixture, an intermediate absorbing gas mixture and a transparent to infrared radiation mixture. To model a double glass window naturally ventilated, a two-dimensional transient laminar incompressible flow formulation is used and the buoyancy effects are accounting for by the Bussinesq approximation. Heat transfer through the windows is calculated and the total heat gain coefficient is compared for the three types of windows.

  20. X-ray Sources Generated from Gas-Filled Laser-Heated Targets

    Energy Technology Data Exchange (ETDEWEB)

    Back, C A; Grun, J; Decker, C D; Davis, J; Laming, J M; Feldman, U; Suter, L J; Landen, O L; Miller, M; Serduke, F; Wuest, C

    2000-06-06

    The X-ray sources in the 4-7 keV energy regime can be produced by laser-irradiating high-Z gas-filled targets with high-powered lasers. A series of experiments have been performed using underdense targets that are supersonically heated with {approx} 35 W of 0.35 {micro}m laser light. These targets were cylindrical Be enclosures that were filled with 1-2 atms of Xe gas. L-shell x-ray emission is emitted from the plasma and detected by Bragg crystal spectrometers and x-ray diodes. Absolute flux measurements show conversion efficiencies of {approx} 10% in the multi-kilovolt x-ray emission. These sources can be used as bright x-ray backlighters or for material testing.

  1. High-density carbon ablator ignition path with low-density gas-filled rugby hohlraum

    Energy Technology Data Exchange (ETDEWEB)

    Amendt, Peter; Ho, Darwin D.; Jones, Ogden S. [Lawrence Livermore National Laboratory, Livermore, California 94551 (United States)

    2015-04-15

    A recent low gas-fill density (0.6 mg/cc {sup 4}He) cylindrical hohlraum experiment on the National Ignition Facility has shown high laser-coupling efficiency (>96%), reduced phenomenological laser drive corrections, and improved high-density carbon capsule implosion symmetry [Jones et al., Bull. Am. Phys. Soc. 59(15), 66 (2014)]. In this Letter, an ignition design using a large rugby-shaped hohlraum [Amendt et al., Phys. Plasmas 21, 112703 (2014)] for high energetics efficiency and symmetry control with the same low gas-fill density (0.6 mg/cc {sup 4}He) is developed as a potentially robust platform for demonstrating thermonuclear burn. The companion high-density carbon capsule for this hohlraum design is driven by an adiabat-shaped [Betti et al., Phys. Plasmas 9, 2277 (2002)] 4-shock drive profile for robust high gain (>10) 1-D ignition performance and large margin to 2-D perturbation growth.

  2. Separation of actinide-made transurania by a gas-filled magnetic separator

    International Nuclear Information System (INIS)

    The performance of the gas-filled magnetic separator HECK at the UNI-LAC at GSI Darmstadt is described. The system consists of a 30 -dipole magnet and a quadrupole doublet of wide aperture. The separator is operated with helium at pressures between (0.1-1) hPa. It is used to investigate heavy ion induced fusion products in-flight. The recoils emerging from a thin target are separated with high efficiency of (10-50)%. The suppression factor of primary beam particles and transfer products is (1015) and (103), respectively. In this application of a gas-filled separator to synthesize transuranium elements using 238U-targets, isotopes of the elements fermium and nobelium were identified in irradiations with 16O- and 20Ne-beams. (orig.)

  3. Demonstrated high performance of gas-filled rugby-shaped hohlraums on Omega

    Energy Technology Data Exchange (ETDEWEB)

    Philippe, F. [Commissariat a l' Energie Atomique et aux Energies Alternatives (CEA), Arpajon (France); Tassin, V. [Commissariat a l' Energie Atomique et aux Energies Alternatives (CEA), Arpajon (France); Depierreux, S. [Commissariat a l' Energie Atomique et aux Energies Alternatives (CEA), Arpajon (France); Gauthier, P. [Commissariat a l' Energie Atomique et aux Energies Alternatives (CEA), Arpajon (France); Masson-Laborde, P. E. [Commissariat a l' Energie Atomique et aux Energies Alternatives (CEA), Arpajon (France); Monteil, M. C. [Commissariat a l' Energie Atomique et aux Energies Alternatives (CEA), Arpajon (France); Seytor, P. [Commissariat a l' Energie Atomique et aux Energies Alternatives (CEA), Arpajon (France); Villette, B. [Commissariat a l' Energie Atomique et aux Energies Alternatives (CEA), Arpajon (France); Lasinski, B. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Park, H. S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Ross, J. S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Amendt, P. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Doeppner, T. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Hinkel, D. E. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Wallace, R. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Williams, E. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Michel, P. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Frenje, J. [Massachusetts Inst. of Technology (MIT), Cambridge, MA (United States). Plasma Science and Fusion Center; Gatu-Johnson, M. [Massachusetts Inst. of Technology (MIT), Cambridge, MA (United States). Plasma Science and Fusion Center; Li, C. K. [Massachusetts Inst. of Technology (MIT), Cambridge, MA (United States). Plasma Science and Fusion Center; Petrasso, R. [Massachusetts Inst. of Technology (MIT), Cambridge, MA (United States). Plasma Science and Fusion Center; Glebov, V. [Univ. of Rochester, NY (United States). Lab. for Laser Energetics; Sorce, C. [Univ. of Rochester, NY (United States). Lab. for Laser Energetics; Stoeckl, C. [Univ. of Rochester, NY (United States). Lab. for Laser Energetics; Nikroo, A. [General Atomics, San Diego, CA (United States); Giraldez, E. [General Atomics, San Diego, CA (United States)

    2014-07-25

    A direct experimental comparison of rugby-shaped and cylindrical shaped gas-filled hohlraums on the Omega laser facility demonstrates that higher coupling and minimal backscatter can be achieved in the rugby geometry, leading to significantly enhanced implosion performance. A nearly 50% increase of x-ray drive is associated with earlier bangtime and increase of neutron production. The observed drive enhancement from rugby geometry in this study is almost twice stronger than in previously published results.

  4. Demonstrated high performance of gas-filled rugby-shaped hohlraums on Omega

    Energy Technology Data Exchange (ETDEWEB)

    Philippe, F.; Villette, B. [CEA, DAM, DIF, F-91297 Arpajon (France); Michel, P. [Lawrence Livermore National Laboratory, Livermore, California 94550 (United States); Petrasso, R. [Plasma Science and Fusion Center, Massachusetts Institute of Technology, Cambridge, Massachusetts 02139 (United States); Stoeckl, C. [Laboratory for Laser Energetics, University of Rochester, Rochester, New York 14623 (United States); Giraldez, E. [General Atomics, P.O. Box 85608, San Diego, California 92186-5608 (United States); Tassin, V.; Depierreux, S.; Gauthier, P.; Masson-Laborde, P. E.; Monteil, M. C.; Seytor, P.; Lasinski, B.; Park, H. S.; Ross, J. S.; Amendt, P.; Döppner, T.; Hinkel, D. E.; Wallace, R.; Williams, E.; and others

    2014-07-15

    A direct experimental comparison of rugby-shaped and cylindrical shaped gas-filled hohlraums on the Omega laser facility demonstrates that higher coupling and minimal backscatter can be achieved in the rugby geometry, leading to significantly enhanced implosion performance. A nearly 50% increase of x-ray drive is associated with earlier bangtime and increase of neutron production. The observed drive enhancement from rugby geometry in this study is almost twice stronger than in previously published results.

  5. Welfare assessment of gas-filled foam as an agent for killing poultry

    OpenAIRE

    Gerritzen, M.A.; Reimert, H.G.M.; Hindle, V.A.; McKeegan, D.E.F.; Sparrey, J.

    2010-01-01

    During outbreaks of notifiable diseases in poultry measures are taken to restrict the spread of the disease. Mass on-farm killing of birds using gasfilled foam is such a measure. This study examines the method and technologies involved using gas-filled foam and looks at the problems involved by scaling up the procedure. Methods and results are discussed in relation to poultry physiology and behaviour monitored during controlled studies. Recommendations are made for system design and an operat...

  6. Tunable frequency-up/down conversion in gas-filled hollow-core photonic crystal fibers

    OpenAIRE

    Saleh, Mohammed F.; Biancalana, Fabio

    2015-01-01

    Based on the interplay between photoionization and Raman effect in gas-filled photonic crystal fibers, we propose a new optical device to control frequency-conversion of ultrashort pulses. By tuning the input-pulse energy, the output spectrum can be either down-converted, up-converted, or even frequency-shift compensated. For low input energies, Raman effect is dominant and leads to a redshift that increases linearly during propagation. For larger pulse energies, photoionization starts to tak...

  7. First in situ determination of gas transport coefficients (DO2, DAr and DN2) from bulk gas concentration measurements (O2, N2, Ar) in natural sea ice

    DEFF Research Database (Denmark)

    Crabeck, O.; Delille, B.; Rysgaard, Søren;

    2014-01-01

    We report bulk gas concentrations of O2, N2, and Ar, as well as their transport coefficients, in natural landfast subarctic sea ice in southwest Greenland. The observed bulk ice gas composition was 27.5% O2, 71.4% N2, and 1.09% Ar. Most previous studies suggest that convective transport is the main...... driver of gas displacement in sea ice and have neglected diffusion processes. According to our data, brines were stratified within the ice, so that no convective transport could occur within the brine system. There- fore, diffusive transport was the main driver of gas migration. By analyzing the temporal...... evolution of an internal gas peak within the ice, we deduced the bulk gas transport coefficients for oxygen (DO2), argon (DAr), and nitrogen (DN2). The values fit to the few existing estimates from experimental work, and are close to the diffusivity values in water (1025 cm2 s21). We suggest that gas...

  8. Hydro-Coupling Effects on Compression Symmetry in Gas-Filled Hohlraum Experiments at the Omega Laser

    Energy Technology Data Exchange (ETDEWEB)

    Dewalds, E L; Pollaine, S W; Landen, O L; Amendt, P A; Turner, R E; Wallace, R; Campbell, K M; Glenzer, S H

    2003-08-26

    Ignition hohlraum designs use low Z gas fill to slow down the inward progress of high Z ablated plasma from the hohlraum walls preventing large laser spot motion and capsule drive asymmetries. In order to optimize the ignition design, the gas hydro-coupling effect to a fusion capsule asymmetry is presently being assessed in experiments at the Omega laser facility with gas filled hohlraums and foam balls. Our experiments measure the effects of the pressure spike that is generated by direct gas heating by the drive laser beams on the capsule surrogate for various hohlraum gas fill densities (0-2.5 mg/cc). To isolate the effect of the gas-hydro coupling pressure, we have begun by using plastic ''hohlraums'' to reduce the x-ray ablation pressure. The foam ball images measured by x-ray backlighting show increasing pole-hot pressure asymmetry for increasing gas pressure. In addition, the gas hydrodynamics is studied by imaging of a low concentration Xe gas fill dopant. The gas fill self-emission. shows the early pressure spike and its propagation towards the foam ball, as well as the gas stagnation on the holraum axis at later times, both contributing to the capsule asymmetry. These first gas hydro-coupling results are compared to LASNEX simulations.

  9. Ultraviolet Light Generation in Gas-Filled Kagome Photonic Crystal Fiber

    Science.gov (United States)

    Rodrigues, Sílvia M. G.; Facão, Margarida; Ferreira, Mário F. S.

    2015-03-01

    Kagome hollow-core photonic crystal fibers were found to be ideal for the occurrence of ultrafast non-linear optics. This article reports the optimal conditions for the generation of ultraviolet light using a gas filled kagome hollow-core-photonic crystal fiber. It is shown that by changing the pressure of the gas and the input pulse characteristics, the efficiency of conversion and quality of ultraviolet light can be improved, as well as tuning its central frequency. Results suggest that a highly coherent and tunable ultraviolet light source can be constructed, which can find numerous applications.

  10. Differentiated muscles are mandatory for gas-filling of the Drosophila airway system

    Directory of Open Access Journals (Sweden)

    Yiwen Wang

    2015-12-01

    Full Text Available At the end of development, organs acquire functionality, thereby ensuring autonomy of an organism when it separates from its mother or a protective egg. In insects, respiratory competence starts when the tracheal system fills with gas just before hatching of the juvenile animal. Cellular and molecular mechanisms of this process are not fully understood. Analyses of the phenotype of Drosophila embryos with malformed muscles revealed that they fail to gas-fill their tracheal system. Indeed, we show that major regulators of muscle formation like Lame duck and Blown fuse are important, while factors involved in the development of subsets of muscles including cardiac and visceral muscles are dispensable for this process, suggesting that somatic muscles (or parts of them are essential to enable tracheal terminal differentiation. Based on our phenotypic data, we assume that somatic muscle defect severity correlates with the penetrance of the gas-filling phenotype. This argues that a limiting molecular or mechanical muscle-borne signal tunes tracheal differentiation. We think that in analogy to the function of smooth muscles in vertebrate lungs, a balance of physical forces between muscles and the elasticity of tracheal walls may be decisive for tracheal terminal differentiation in Drosophila.

  11. Efficient Spectral Broadening in the 100-W Average Power Regime Using Gas Filled Kagome HC-PCF and Pulse Compression

    CERN Document Server

    Emaury, Florian; Debord, Benoit; Ghosh, Debashri; Diebold, Andreas; Gerome, Frederic; Suedmeyer, Thomas; Benabid, Fetah; Keller, Ursula

    2014-01-01

    We present nonlinear pulse compression of a high-power SESAM-modelocked thin-disk laser (TDL) using an Ar-filled hypocycloid-core Kagome Hollow-Core Photonic Crystal Fiber (HC-PCF). The output of the modelocked Yb:YAG TDL with 127 W average power, a pulse repetition rate of 7 MHz, and a pulse duration of 740 fs was spectrally broadened 16-fold while propagating in a Kagome HC-PCF containing 13 bar of static Argon gas. Subsequent compression tests performed using 8.4% of the full available power resulted in a pulse duration as short as 88 fs using the spectrally broadened output from the fiber. Compressing the full transmitted power through the fiber (118 W) could lead to a compressed output of >100 W of average power and >100 MW of peak power with an average power compression efficiency of 88%. This simple laser system with only one ultrafast laser oscillator and a simple single-pass fiber pulse compressor, generating both high peak power >100 MW and sub-100-fs pulses at megahertz repetition rate, is very int...

  12. Absolute gas refractometer without gas-filling and pumping process benefiting from quasi-synthetic wavelength theory

    CERN Document Server

    Zhang, Jitao; Li, Yan; Wei, Haoyun

    2012-01-01

    We present a method to measure the refractive index of gas at 633 nm absolutely, which does not need filling or pumping gas during the measurement. We develop a quasi-synthetic wavelength (QSW) theory by means of the configuration of two-frequency Jamin interferometry and vacuum tubes with specific lengths. With the aid of the QSW theory, we construct a gas refractometer and demonstrate its performance by the measurement of dry air and nitrogen gas at different pressures ranging from 80 kPa to 100 kPa. The results indicate that the refractometer has an uncertainty of better than 1E-7 and a dynamic range of 3.95E-4.

  13. Detecting leaks in gas-filled pressure vessels using acoustic resonances

    Science.gov (United States)

    Gillis, K. A.; Moldover, M. R.; Mehl, J. B.

    2016-05-01

    We demonstrate that a leak from a large, unthermostatted pressure vessel into ambient air can be detected an order of magnitude more effectively by measuring the time dependence of the ratio p/f2 than by measuring the ratio p/T. Here f is the resonance frequency of an acoustic mode of the gas inside the pressure vessel, p is the pressure of the gas, and T is the kelvin temperature measured at one point in the gas. In general, the resonance frequencies are determined by a mode-dependent, weighted average of the square of the speed-of-sound throughout the volume of the gas. However, the weighting usually has a weak dependence on likely temperature gradients in the gas inside a large pressure vessel. Using the ratio p/f2, we measured a gas leak (dM/dt)/M ≈ - 1.3 × 10-5 h-1 = - 0.11 yr-1 from a 300-liter pressure vessel filled with argon at 450 kPa that was exposed to sunshine-driven temperature and pressure fluctuations as large as (dT/dt)/T ≈ (dp/dt)/p ≈ 5 × 10-2 h-1 using a 24-hour data record. This leak could not be detected in a 72-hour record of p/T. (Here M is the mass of the gas in the vessel and t is the time.)

  14. Gas-filled cell as a narrow bandwidth bandpass filter in the VUV wavelength range

    International Nuclear Information System (INIS)

    We propose a method for spectrally filtering radiation in the VUV wavelength range by means of a monochromator constituted by a cell filled with a resonantly absorbing rare gas. Around particular wavelengths, the gas exhibits narrow-bandwidth absorbing resonances following the Fano profile. In particular, within the photon energy range 60 eV-65 eV, the correlation index of the Fano profiles for the photoionization spectra in Helium is equal to unity, meaning that the minimum of the cross-section is exactly zero. For sufficiently large column density in the gas cell, the spectrum of the incoming radiation will be attenuated by the background cross-section of many orders of magnitude, except for those wavelengths close to the point where the cross-section is zero. Remarkable advantages of a gas monochromator based on this principle are simplicity, efficiency and narrow-bandwidth. A gas monochromator installed in the experimental hall of a VUV SASE FEL facility would enable the delivery of a single-mode VUV laser beam. The design is identical to that of already existing gas attenuator systems for VUV or X-ray FELs. We present feasibility study and exemplifications for the FLASH facility in the VUV regime. (orig.)

  15. Study of high pressure gas filled RF cavities for muon collider

    CERN Document Server

    Yonehara, Katsuya

    2015-01-01

    Muon collider is a considerable candidate of the next-generation high-energy lepton collider machine. Operating an RF cavity in a multi-Tesla magnet is a critical requirement in a muon accelerator and a cooling channel. However, the maximum RF gradient in a vacuum RF cavity is strongly limited by an external magnetic field. Dense hydrogen gas filled RF cavity has been proposed since it is functional of generating a high RF accelerating gradient in a strong magnetic field and making an ionization cooling process at the same time. A critical issue of the cavity is a beam- induced plasma that consumes a considerable amount of RF power. The gas filled RF test cell was made and measured the RF loading due to a beam-induced plasma by using an intense proton beam at Fermilab. By doping an electronegative gas in dense hydrogen, the plasma loading effect is significantly mitigated. The result shows that the cavity is functional with a muon collider beam. Recent progress is shown in this presentation.

  16. Continuous Measurements of Dissolved Ne, Ar, Kr, and Xe Ratios with a Field-Deployable Gas Equilibration Mass Spectrometer.

    Science.gov (United States)

    Manning, Cara C; Stanley, Rachel H R; Lott, Dempsey E

    2016-03-15

    Noble gases dissolved in natural waters are useful tracers for quantifying physical processes. Here, we describe a field-deployable gas equilibration mass spectrometer (GEMS) that provides continuous, real-time measurements of Ne, Ar, Kr, and Xe mole ratios in natural waters. Gas is equilibrated with a membrane contactor cartridge and measured with a quadrupole mass spectrometer, after in-line purification with reactive metal alloy getters. We use an electron energy of 35 V for Ne to eliminate isobaric interferences, and a higher electron energy for the other gases to improve sensitivity. The precision is 0.7% or better and 1.0% or better for all mole ratios when the instrument is installed in a temperature-controlled environment and a variable-temperature environment, respectively. In the lab, the accuracy is 0.9% or better for all gas ratios using air as the only calibration standard. In the field (and/or at greater levels of disequilbrium), the accuracy is 0.7% or better for Ne/Kr, Ne/Ar, and Ar/Kr, and 2.5% or better for Ne/Xe, Ar/Xe, and Kr/Xe using air as the only calibration standard. The field accuracy improves to 0.6% or better for Ne/Xe, Ar/Xe, and Kr/Xe when the data is calibrated using discrete water samples run on a laboratory-based mass spectrometer. The e-folding response time is 90-410 s. This instrument enables the collection of a large number of continuous, high-precision and accuracy noble gas measurements at substantially reduced cost and labor compared to traditional methods. PMID:26854788

  17. Continuous Measurements of Dissolved Ne, Ar, Kr, and Xe Ratios with a Field-Deployable Gas Equilibration Mass Spectrometer.

    Science.gov (United States)

    Manning, Cara C; Stanley, Rachel H R; Lott, Dempsey E

    2016-03-15

    Noble gases dissolved in natural waters are useful tracers for quantifying physical processes. Here, we describe a field-deployable gas equilibration mass spectrometer (GEMS) that provides continuous, real-time measurements of Ne, Ar, Kr, and Xe mole ratios in natural waters. Gas is equilibrated with a membrane contactor cartridge and measured with a quadrupole mass spectrometer, after in-line purification with reactive metal alloy getters. We use an electron energy of 35 V for Ne to eliminate isobaric interferences, and a higher electron energy for the other gases to improve sensitivity. The precision is 0.7% or better and 1.0% or better for all mole ratios when the instrument is installed in a temperature-controlled environment and a variable-temperature environment, respectively. In the lab, the accuracy is 0.9% or better for all gas ratios using air as the only calibration standard. In the field (and/or at greater levels of disequilbrium), the accuracy is 0.7% or better for Ne/Kr, Ne/Ar, and Ar/Kr, and 2.5% or better for Ne/Xe, Ar/Xe, and Kr/Xe using air as the only calibration standard. The field accuracy improves to 0.6% or better for Ne/Xe, Ar/Xe, and Kr/Xe when the data is calibrated using discrete water samples run on a laboratory-based mass spectrometer. The e-folding response time is 90-410 s. This instrument enables the collection of a large number of continuous, high-precision and accuracy noble gas measurements at substantially reduced cost and labor compared to traditional methods.

  18. A giant gas-filled abdominal mass in an elderly female: A case report

    Institute of Scientific and Technical Information of China (English)

    Hoi Man Deon Chong; Fung Yee Janet Lee; Anthony Lo; Chak Man Jimmy Li

    2011-01-01

    We report an extremely rare case of gas-filled abdomi?nal mass caused by an ovarian teratoma fistulating to the sigmoid colon. The patient was an 85-year-old female, who presented with severe abdominal disten?sion. Urgent computed tomography scan showed a huge abdominal mass with air fluid level and fecal matter inside. Communication between the mass and the sigmoid colon was suspected. She underwent emergency laparotomy. The mass was resected with the involved segment of colon. Pathology confirmed squamous cell carcinoma arising from mature cystic teratoma of the ovary.

  19. Simulation of laser-plasma interaction experiments with gas-filled hohlraums on the LIL facility

    Science.gov (United States)

    Loiseau, P.; Masson-Laborde, P.-E.; Teychenné, D.; Monteil, M.-C.; Casanova, M.; Marion, D.; Tran, G.; Huser, G.; Rousseaux, C.; Hüller, S.; Héron, A.; Pesme, D.

    2016-03-01

    Laser-plasma interaction is a major issue for achieving ignition in inertial confinement fusion schemes, and still a major concern for the upcoming french laser mégajoule (LMJ) program. In order to mitigate the deleterious effects due to laser-plasma instabilities (LPI), clearly evidenced during the recent US National Ignition Campaign conducted on the National Ignition Facility, we use the LIL facility as a demonstrator for LPI studies. In this article, we focus on preliminary results regarding the propagation of a typical LMJ quadruplet through gas-filled hohlraums. Results on hohlraum energetics will then be discussed.

  20. Development of a Gas Filled Magnet spectrometer within the FIPPS project

    Science.gov (United States)

    Chebboubi, A.; Kessedjian, G.; Faust, H.; Blanc, A.; Jentschel, M.; Köster, U.; Materna, T.; Méplan, O.; Sage, C.; Serot, O.

    2016-06-01

    The Fission Product Prompt γ -ray Spectrometer, FIPPS, is under development to enable prompt γ -ray spectroscopy correlated with fission fragment identification. This will open new possibilities in the study of fission and of nuclear structure of neutron rich nuclei. FIPPS will consist of an array of γ and neutron detectors coupled with a fission fragment filter. The chosen solution for the filter is a Gas Filled Magnet (GFM). Both experimental and modeling work was performed in order to extract the key parameters of such a device and design the future GFM of the FIPPS project. Experiments performed with a GFM behind the LOHENGRIN spectrometer demonstrated the capability of additional beam purification.

  1. Parameter monitoring system of the Dubna Gas-Filled Recoil Separator

    CERN Document Server

    Tsyganov, Y S; Sukhov, A M

    2015-01-01

    PC-based one-crate monitoring and control system of the Dubna Gas Filled Recoil Separator (DGFRS) is considered. It is developed for the long-term experiments at the U400 FLNR cyclotron and is aimed at the synthesis of super heavy nuclei in heavy ion induced complete fusion reactions. Parameters related to: a) beam and cyclotron; b) separator by itself, c) detection system, d) target and entrance window are measured and stored in the protocol file of the experiment. Special attention is paid to generating the alarm signals and implementing further the appropriate procedures

  2. BiCMOS amplifier-discriminator integrated circuit for gas-filled detector readout

    Energy Technology Data Exchange (ETDEWEB)

    Herve, C. [European Synchrotron Radiation Facility, BP 220, 38043 Grenoble Cedex (France)]. E-mail: herve@esrf.fr; Dzahini, D. [Laboratoire de Physique Subatomique et de Cosmologie, Grenoble (France); Le Caer, T. [European Synchrotron Radiation Facility, BP 220, 38043 Grenoble Cedex (France); Richer, J.-P. [Laboratoire de Physique Subatomique et de Cosmologie, Grenoble (France); Torki, K. [Laboratoire TIMA, Grenoble (France)

    2005-03-21

    The paper presents a 16-channel amplifier-discriminator designed in BiCMOS technology. It will be used for the binary parallel readout of gas-filled detectors being designed at the European Synchrotron Radiation Facility. The circuit (named AMS211) has been manufactured. The measured transimpedance gain (400 K{omega}), bandwidth (25 MHz) and noise (1570 e{sup -}+95 e{sup -}/pF ENC) well match the simulated results. The discriminator thresholds are individually controlled by built-in Digital to Analogue Converter. The experience gained with a first prototype of readout electronics indicates that the AMS211 should meet our requirements.

  3. Focal spot size predictions for beam transport through a gas-filled reactor

    International Nuclear Information System (INIS)

    Results from calculations of focal spot size for beam transport through a gas-filled reactor are summarized. In the converging beam mode, we find an enlargement of the focal spot due to multiple scattering and zeroth order self-field effects. This enlargement can be minimized by maintaining small reactors together with a careful choice of the gaseous medium. The self-focused mode, on the other hand, is relatively insensitive to the reactor environment, but is critically dependent upon initial beam quality. This requirement on beam quality can be significantly eased by the injection of an electron beam of modest current from the opposite wall

  4. Tunable frequency-up/down conversion in gas-filled hollow-core photonic crystal fibers.

    Science.gov (United States)

    Saleh, Mohammed F; Biancalana, Fabio

    2015-09-15

    Based on the interplay between photoionization and Raman effects in gas-filled photonic crystal fibers, we propose a new optical device to control frequency conversion of ultrashort pulses. By tuning the input-pulse energy, the output spectrum can be either down-converted, up-converted, or even frequency-shift compensated. For low input energies, the Raman effect is dominant and leads to a redshift that increases linearly during propagation. For larger pulse energies, photoionization starts to take over the frequency-conversion process and induces a strong blueshift. The fiber-output pressure can be used as an additional degree of freedom to control the spectrum shift. PMID:26371900

  5. Mapping the Ionization State of Laser-Irradiated Ar Gas Jets With Multi-Wavelength Monochromatic X-Ray Imaging

    Energy Technology Data Exchange (ETDEWEB)

    Kugland, N L; Doppner, T; Kemp, A; Schaeffer, D; Glenzer, S H; Niemann, C

    2010-04-08

    Two-dimensional monochromatic images of fast-electron stimulated Ar K{alpha} and He-{alpha} x-ray self-emission have recorded a time-integrated map of the extent of Ar{sup {approx}6+} and Ar{sup 16+} ions, respectively, within a high density (10{sup 20} cm{sup -3} atomic density) Ar plasma. This plasma was produced by irradiating a 2 mm wide clustering Ar gas jet with an ultra-high intensity (10{sup 19} W/cm{sup 2}, 200 fs) Ti:Sapphire laser operating at 800 nm. Spherically bent quartz crystals in the 200 (for K{alpha}) and 201 (for He-{alpha}) planes were used as near-normal incidence reflective x-ray optics. We see that a large (830 {micro}m long) region of plasma emits K{alpha} primarily along the laser axis, while the He-{alpha} emission is confined to smaller hot spot (230 {micro}m long) region that likely corresponds to the focal volume of the f/8 laser beam. X-ray spectra from a Bragg spectrometer operating in the von Hamos geometry, which images in one dimension, indicate that the centroids of the K{alpha} and He-{alpha} emission regions are separated by approximately 330 {micro}m along the laser axis.

  6. New Hadron Monitor By Using A Gas-Filled RF Resonator

    Energy Technology Data Exchange (ETDEWEB)

    Yonehara, Katsuya [Fermilab; Fasce, Giorgio [ECONA, Rome; Flanagan, Gene [MUONS Inc., Batavia; Johnson, Rolland [MUONS Inc., Batavia; Tollestrup, Alvin [Fermilab; Zwaska, Robert [Fermilab

    2015-05-01

    It is trend to build an intense neutrino beam facility for the fundamental physics research, e.g. LBNF at Fermilab, T2K at KEK, and CNGS at CERN. They have investigated a hadron monitor to diagnose the primary/secondary beam quality. The existing hadron monitor based on an ionization chamber is not robust in the high-radiation environment vicinity of MW-class secondary particle production targets. We propose a gas-filled RF resonator to use as the hadron monitor since it is simple and hence radiation robust in this environment. When charged particles pass through the resonator they produce ionized plasma via the Coulomb interaction with the inert gas. The beam-induced plasma changes the permittivity of inert gas. As a result, a resonant frequency in the resonator shifts with the amount of ionized electrons. The radiation sensitivity is adjustable by the inert gas pressure and the RF amplitude. The hadron profile will be reconstructed with a tomography technique in the hodoscope which consists of X, Y, and theta layers by using a strip-shaped gas resonator. The sensitivity and possible system design will be shown in this presentation.

  7. Gas Filled RF Resonator Hadron Beam Monitor for Intense Neutrino Beam Experiments

    Energy Technology Data Exchange (ETDEWEB)

    Yonehara, Katsuya [Fermilab; Abrams, Robert [MUONS Inc., Batavia; Dinkel, Holly [U. Missouri, Columbia; Freemire, Ben [IIT, Chicago; Johnson, Rolland [MUONS Inc., Batavia; Kazakevich, Grigory [MUONS Inc., Batavia; Tollestrup, Alvin [Fermilab; Zwaska, Robert [Fermilab

    2016-06-01

    MW-class beam facilities are being considered all over the world to produce an intense neutrino beam for fundamental particle physics experiments. A radiation-robust beam monitor system is required to diagnose the primary and secondary beam qualities in high-radiation environments. We have proposed a novel gas-filled RF-resonator hadron beam monitor in which charged particles passing through the resonator produce ionized plasma that changes the permittivity of the gas. The sensitivity of the monitor has been evaluated in numerical simulation. A signal manipulation algorithm has been designed. A prototype system will be constructed and tested by using a proton beam at the MuCool Test Area at Fermilab.

  8. Characterizing passive coherent population trapping resonance in a cesium vapor cell filled with neon buffer gas

    Institute of Scientific and Technical Information of China (English)

    Liu Zhi; Wang Jie-Ying; Diao Wen-Ting; He Jun; Wang Jun-Min

    2013-01-01

    We present a pair of phase-locked lasers with a 9.2-GHz frequency difference through the injection locking of a master laser to the RF-modulation sideband of a slave diode laser.Using this laser system,a coherent population trapping (CPT)signal with a typical linewidth of ~ 182 Hz is obtained in a cesium vapor cell filled with 30 Torr (4 kPa) of neon as the buffer gas.We investigate the influence of the partial pressure of the neon buffer gas on the CPT linewidth,amplitude,and frequency shift.The results may offer some references for CPT atomic clocks and CPT atomic magnetometers.

  9. Process and device for subdividing a glass tube filled with a radioactive gas

    International Nuclear Information System (INIS)

    A process is described for subdividing into individual sealed segments an elongated glass tube coated internally with a luminescent material and filled with a radioactive gas, this tube having a longitudinal axis. It consists in directing a focused laser beam on to the surface of the tube in an ambient atmosphere with a pressure greater than that of the gas in the tube and to create a relative, repetitive and alternating movement between the laser beam and the surface of the tube. This movement is transversal to the longitudinal axis of the tube, so as to heat and soften the tube along a cutting line until the tube divides and presents new ends where it contracts, causing these ends to seal up

  10. Ion beam characteristics of the controlatron/zetatron family of the gas filled neutron tubes

    Energy Technology Data Exchange (ETDEWEB)

    Berg, R.S.; Shope, L.A.; O' Neal, M.L.; Boers, J.E.; Bickes, R.W. Jr.

    1981-03-01

    A gas filled tube used to produce a neutron flux with the D(T,He/sup 4/)n reaction is described. Deuterium and tritium ions generated in a reflex discharge are extracted and accelerated to 100 keV by means of an accelerator electrode onto a deutero-tritide target electrode. The electrodes are designed to focus the ion beam onto the target. Total tube currents consisting of extracted ions, unsuppressed secondary electrons, and ions generated by interactions with the background gas are typically 100 mA. The characteristics of the extracted ion beam are discussed. Accelerating voltages greater than 50 kV are required to focus the beam through the accelerator aperture for configurations that give beams with the proper energy density onto the target. The perveance of the beam is discussed. Maximum perveance values are 2 to 20 nanopervs. Tube focusing and neutron production characteristics are described.

  11. REVIEW ARTICLE: Optical frequency comb generation in gas-filled hollow core photonic crystal fibres

    Science.gov (United States)

    Couny, F.; Benabid, F.

    2009-10-01

    The efficiency of gas-based nonlinear processes is often limited by the diffraction of the pump laser as it propagates through the nonlinear medium. As a consequence, phenomena with strong nonlinear response requirements, such as high harmonic generation or Raman sideband generation, lack the required laser-matter interaction to fulfil their potential. Indeed, the conversion efficiency of these techniques is usually low and the experimental set-up cumbersome. The advent of hollow core photonic crystal fibre technology drafts new territories for nonlinear optics, and in particular offers new alternatives for sub-femtosecond pulse generation. The air-guiding fibre combines unprecedented laser confinement over long interaction lengths and, when filled with an adequate nonlinear gas, offers improved conversion efficiency and up to a million-fold reduction of the pump power threshold. This paper presents a review of the types of hollow core PCF available for nonlinear applications and the results obtained for efficient Raman conversion in H2-filled hollow core PCF that led to the observation of a multi-octave frequency comb spanning from ~325 to ~2300 nm using a single pump laser with relatively low power. The generated ultra-broad spectrum creates a simple route towards a compact source of attosecond pulses.

  12. Formation of single-wall carbon nanotubes in Ar and nitrogen gas atmosphere by using laser furnace technique

    Science.gov (United States)

    Suzuki, S.; Asai, N.; Kataura, H.; Achiba, Y.

    2007-07-01

    The formation of single-wall carbon nanotubes (SWNTs) by using laser vaporization technique in different ambient gas atmosphere was investigated. SWNTs were prepared with Rh/Pd (1.2/1.2 atom%)-carbon composite rod in Ar and nitrogen gas atmosphere, respectively. Raman spectra of raw carbon materials including SWNTs and photoluminescence mapping of dispersed SWNTs in a surfactant solution demonstrate that the diameter distribution of SWNTs prepared in Ar atmosphere is narrower than those obtained by using CVD technique (e.g. HiPco nanotube), even when the ambient temperature is as high as 1150 ?C. It was also found that nitrogen atmosphere gives wider diameter distribution of SWNTs than that obtained with Ar atmosphere. Furthermore, the relative yield of fullerenes (obtained as byproducts) is investigated by using HPLC (high-performance liquid chromatography) technique. It was found that the relative yield of higher fullerenes becomes lower, when nitrogen is used as an ambient gas atmosphere. Based on these experimental findings, a plausible formation mechanism of SWNTs is discussed.

  13. Use of the gas-filled-magnet technique for particle identification at low energies

    Energy Technology Data Exchange (ETDEWEB)

    Rehm, K.K.; Jiang, C.L.; Paul, M. [Hebrew Univ., Jerusalem (Israel)

    1995-08-01

    Reaction studies of interest to astrophysics with radioactive ion beams will be done mainly in inverse reaction kinematics, i.e., heavy particles bombarding a hydrogen target. The low energy of the outgoing heavy reaction products makes particle identification with respect to mass and nuclear charge a major challenge. For the planned {sup 18}F(p,{alpha}) experiment one expects five different types of particles in the outgoing channels: {sup 18}F and {sup 18}O (from elastic scattering of {sup 18}F and {sup 18}O on {sup 12}C), {sup 15}O and {sup 15}N (from the {sup 18}F and {sup 18}O induced (p,{alpha}) reactions) and {sup 12}C recoils from the polypropylene target. While mass determination can be achieved easily by time-of-flight (TOF) measurements, a determination of the nuclear charge presents a challenge, especially if the energy of the particles is below 500 keV/u. We studied the gas-filled magnet technique for Z-identification of light ions between Z = 6-9. In a gas-filled magnet the particles move with an average charge state {bar q} which in one parameterization is given by {bar q} = Z ln(avZ{sup {alpha}})/ln(bZ{sup {beta}}) where Z is the nuclear charge of the ions and v their velocity. Introducing into the expression for the magnetic rigidity B{rho} = mv/{bar q} results in a Z dependence of B{rho} which is valid to very low velocities. As a magnet we used the Enge split-pole spectrograph which was filled with nitrogen gas at a pressure of 0.5 Torr. The particles were detected in the focal plane with a 50 x 10 cm{sup 2} parallel-grid-avalanche counter which measured TOF and magnetic rigidity. The mass and Z separation was tested with {sup 13}C and {sup 18}O beams at energies of about 600 keV/u and recoil particles ranging from {sup 12}C to {sup 19}F. The Z-separation obtained at these energies was {triangle}Z/Z = 0.28 which is sufficient to separate individual elements for Z < 10.

  14. Developments for transactinide chemistry experiments behind the gas-filled separator TASCA

    International Nuclear Information System (INIS)

    Topic of this thesis is the development of experiments behind the gas-filled separator TASCA (TransActinide Separator and Chemistry Apparatus) to study the chemical properties of the transactinide elements. In the first part of the thesis, the electrodepositions of short-lived isotopes of ruthenium and osmium on gold electrodes were studied as model experiments for hassium. From literature it is known that the deposition potential of single atoms differs significantly from the potential predicted by the Nernst equation. This shift of the potential depends on the adsorption enthalpy of therndeposited element on the electrode material. If the adsorption on the electrode-material is favoured over the adsorption on a surface made of the same element as the deposited atom, the electrode potential is shifted to higher potentials. This phenomenon is called underpotential deposition. Possibilities to automatize an electro chemistry experiment behind the gas-filled separator were explored for later studies with transactinide elements. The second part of this thesis is about the in-situ synthesis of transition-metal-carbonyl complexes with nuclear reaction products. Fission products of uranium-235 and californium-249 were produced at the TRIGA Mainz reactor and thermalized in a carbon-monoxide containing atmosphere. The formed volatile metal-carbonyl complexes could be transported in a gas-stream. Furthermore, short-lived isotopes of tungsten, rhenium, osmium, and iridium were synthesised at the linear accelerator UNILAC at GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt. The recoiling fusion products were separated from the primary beam and the transfer products in the gas-filled separator TASCA. The fusion products were stopped in the focal plane of TASCA in a recoil transfer chamber. This chamber contained a carbon-monoxide - helium gas mixture. The formed metal-carbonyl complexes could be transported in a gas stream to various experimental setups. All

  15. High pressure gas filled RF cavity beam test at the Fermilab Mucool test area

    Science.gov (United States)

    Freemire, Ben

    With a new generation of lepton colliders being conceived, muons have been proposed as an alternative particle to electrons. Muons lose less energy to synchrotron radiation and a Muon Collider can provide luminosity within a smaller energy range than a comparable electron collider. This allows a circular collider to be built. As part of the accelerator, it would also be possible to allow the muons to decay to study neutrinos. Because the muon is an unstable particle, a muon beam must be cooled and accelerated within a short amount of time. Muons are generated with a huge phase space, so radio frequency cavities placed in strong magnetic fields are required to bunch, focus, and accelerate the muons. Unfortunately, traditional vacuum RF cavities have been shown to break down in the magnetic fields necessary. To successfully operate RF cavities in strong magnetic fields, the cavity can be filled with a high pressure gas in order to mitigate breakdown. The gas has the added benefit of providing cooling for the beam. The electron-ion plasma created in the cavity by the beam absorbs energy and degrades the accelerating electric field of the cavity. As electrons account for the majority of the energy loss in the cavity, their removal in a short time is highly desirable. The addition of an electronegative dopant gas can greatly decrease the lifetime of an electron in the cavity. Measurements in pure hydrogen of the energy consumption of electrons in the cavity range in 10-18 and 10-16 joules per RF cycle per electron. When hydrogen doped with dry air is used, measurements of the power consumption indicate an energy loss range of 10-20 to 10-18 joules per RF cycle per ion, two orders of magnitude improvement over non-doped measurements. The lifetime of electrons in a mixture of hydrogen gas and dry air has been measured from < 1 ns, up to 200 ns. The results extrapolated to the parameters of a Neutrino Factory and Muon Collider indicate that a high pressure gas filled RF

  16. Mapping the ionization state of laser-irradiated Ar gas jets with multiwavelength monochromatic x-ray imaging

    International Nuclear Information System (INIS)

    Two-dimensional monochromatic images of fast-electron stimulated Ar Kα and He-α x-ray self-emission have recorded a time-integrated map of the extent of Ar≅6+ and Ar16+ ions, respectively, within a high density (1020 cm-3 atomic density) Ar plasma. This plasma was produced by irradiating a 2 mm wide clustering Ar gas jet with an ultrahigh intensity (1019 W/cm2, 50 TW) Ti:sapphire laser operating at 800 nm. Spherically bent quartz crystals in the 200 (for Kα) and 201 (for He-α) planes were used as near-normal incidence reflective x-ray optics. We see that a large (830 μm long) region of plasma emits Kα primarily along the laser axis, while the He-α emission is confined to smaller hot spot (230 μm long) region that likely corresponds to the focal volume of the f/8 laser beam. X-ray spectra from a Bragg spectrometer operating in the von Hamos geometry indicate that the centroids of the Kα and He-α emission regions are separated by approximately 330 μm along the laser axis.

  17. Expansion characteristics of twin combustion gas jets with high pressure in cylindrical filling liquid chamber

    Institute of Scientific and Technical Information of China (English)

    薛晓春; 余永刚; 张琦

    2013-01-01

    To deal with the problem of how to control the interior ballistic stability in the bulk-loaded liquid propellant gun, the expansion and mixing process of the twin combustion-gas jets with high temperature and pressure in a liquid medium is studied in the cylindrical filling liquid chamber. A series of the jet expansion shapes is obtained by using a high-speed photographic system. The influences of the jet pressure on the jet expansion shape are discussed. Based on the experiments, the three-dimensional mathematical model is established. The expansion processes of the twin gas jets in the liquid medium are simulated by means of fluent to get the pressure, density, temperature, velocity contours and evolutionary process of vortices. Results show that the jet external outline and tops are all irregular. The Kelvin-Helmholtz instability is shown in the whole expansion process. The numerical simulation results of the axial displacement of the twin gas jets in liquid agree well with the experiment.

  18. Comparison between large discharges of a gas counter in pure CH4 and in a CH4-Ar mixture

    International Nuclear Information System (INIS)

    Gas discharge characteristics in pure CH4 have been studied in the high gas-multiplication region by using a gas counter with a thick anode wire (50 μm in diameter) and compared with those of the self-quenching streamer (SQS) mode in a CH4-Ar mixture. The results of the first optical observation indicate that the large pulses observed in CH4, whose pulse amplitudes are comparable to those of the SQS mode, are not due to streamer discharges. Instead, a luminous region is observed near the anode wire (r≤0.7 mm) where the electric field is higher than the threshold value for gas multiplication, 104 V/cm. (orig.)

  19. A new focal plane detector for the gas-filled separator TASCA

    International Nuclear Information System (INIS)

    Superheavy elements (SHE) exist solely because of enhanced nuclear stability due to shell effects. The production cross sections for the synthesis of SHE decrease continuously, thus, exploration of SHE nuclei is close to the border of present technical limitation. To increase the efficiency and sensitivity in SHE experiments, highly efficient recoil separators with state-of-the-art detection systems are required. In the framework of this thesis, the new focal plane detection system with the dedicated electronics have been developed for the gas-filled recoil separator TASCA at the GSI Helmholtzzentrum for Schwerionenforschung GmbH. The new detection system has been successfully used in recent experiments on synthesis of the E114.

  20. Temporal condensed matter physics in gas-filled photonic crystal fibers

    CERN Document Server

    Saleh, Mohammed F; Tran, Truong X; Marini, Andrea; Belli, Federico; Abdolvand, Amir; Biancalana, Fabio

    2014-01-01

    Raman effect in gases can generate an extremely long-living wave of coherence that can lead to the establishment of an almost perfect periodic variation of the medium refractive index. We show theoretically and numerically that the equations, regulate the pulse propagation in hollow-core photonic crystal fibers filled by Raman-active gas, are exactly identical to a classical problem in quantum condensed matter physics -- but with the role of space and time reversed -- namely an electron in a periodic potential subject to a constant electric field. We are therefore able to infer the existence of Wannier-Stark ladders, Bloch oscillations, and Zener tunneling, phenomena that are normally associated with condensed matter physics only, now realized with purely optical means in the temporal domain.

  1. Development of a Gas Filled Magnet spectrometer coupled with the Lohengrin spectrometer for fission study

    Directory of Open Access Journals (Sweden)

    Materna T.

    2013-03-01

    Full Text Available The accurate knowledge of the fission of actinides is necessary for studies of innovative nuclear reactor concepts. The fission yields have a direct influence on the evaluation of the fuel inventory or the reactor residual power after shutdown. A collaboration between the ILL, LPSC and CEA has developed a measurement program on fission fragment distributions at ILL in order to measure the isotopic and isomeric yields. The method is illustrated using the 233U(n,f98Y reaction. However, the extracted beam from the Lohengrin spectrometer is not isobaric ions which limits the low yield measurements. Presently, the coupling of the Lohengrin spectrometer with a Gas Filled Magnet (GFM is studied at the ILL in order to define and validate the enhanced purification of the extracted beam. This work will present the results of the spectrometer characterisation, along with a comparison with a dedicated Monte Carlo simulation especially developed for this purpose.

  2. Tunable frequency-up/down conversion in gas-filled hollow-core photonic crystal fibers

    CERN Document Server

    Saleh, Mohammed F

    2015-01-01

    Based on the interplay between photoionization and Raman effect in gas-filled photonic crystal fibers, we propose a new optical device to control frequency-conversion of ultrashort pulses. By tuning the input-pulse energy, the output spectrum can be either down-converted, up-converted, or even frequency-shift compensated. For low input energies, Raman effect is dominant and leads to a redshift that increases linearly during propagation. For larger pulse energies, photoionization starts to take over the frequency conversion process, and induces a strong blueshift. We have found also that by changing the fiber-output pressure the pulse spectrum blueshifts, providing an additional degree of freedom in the design.

  3. Applying the Different Statistical Tests in Analysis of Electrical Breakdown Mechanisms in Nitrogen Filled Gas Diode

    Science.gov (United States)

    Čedomir, A. Maluckov; Saša, A. Rančev; Miodrag, K. Radović

    2016-10-01

    This paper presents the results of our investigations of breakdown mechanisms, as well as a description of their influence on the distributions of time delay distributions, for a gas tube filled with nitrogen at 4 mbar. The values of the time delay are measured for different voltages, and the values of the relaxation times and their distributions and probability plots are analyzed. The obtained density distributions have Gaussian distributions and exponential distributions for different values of relaxation times (Gaussian for small values and exponential for large values of relaxation time). It is shown that for middle values of relaxation time the delay distributions have a shape between Gaussian and exponential distributions, which is a result of the different influences of electrical breakdown.

  4. 40Ar/39Ar dating of Quaternary volcanic ashes by multi-collection noble gas mass spectrometry: protocols, precision and intercalibration

    DEFF Research Database (Denmark)

    Storey, Michael; Rivera, Tiffany; Flude, Stephanie;

    for single crystal 40Ar/39Ar dating of Quaternary samples because of: (i) improved source sensitivity; (ii) ion-counting electron multipliers, which have low signal to noise ratios enabling precise measurement of very small 36Ar signals - resulting in accurate correction for atmospheric-derived 40Ar; (iii......) higher mass resolution allows hydrocarbon interferences to be pseudo resolved for the different argon isotopes; and (iv) multi-collection, allowing more data to be gathered in a fixed time in comparison with single-collector peak-switching measurements. We evaluate (i) protocols for detector inter...

  5. Nitriding molybdenum: Effects of duration and fill gas pressure when using 100-Hz pulse DC discharge technique

    International Nuclear Information System (INIS)

    Molybdenum is nitrided by a 100-Hz pulsed DC glow discharge technique for various time durations and fill gas pressures to study the effects on the surface properties of molybdenum. X-ray diffractometry (XRD), scanning electron microscopy (SEM), and atomic force microscopy (AFM) are used for the structural and morphological analysis of the nitrided layers. Vickers' microhardness tester is utilized to investigate surface microhardness. Phase analysis shows the formation of more molybdenum nitride molecules for longer nitriding durations at fill gas pressures of 2 mbar and 3 mbar (1 bar = 105 Pa). A considerable increase in surface microhardness (approximately by a factor of 2) is observed for longer duration (10 h) and 2-mbar pressure. Longer duration (10 h) and 2-mbar fill gas pressure favors the formation of homogeneous, smooth, hard layers by the incorporation of more nitrogen. (physics of gases, plasmas, and electric discharges)

  6. Simulation for Large-Area, Inductively-Coupled Plasma Systems Using an Ar/Cl2 Gas Mixture.

    Science.gov (United States)

    Oh, Seon-Geun; Lee, Young-Jun; Jeon, Jae-Hong; Kim, Young-Jin; Seo, Jong-Hyun; Choe, Hee-Hwan

    2015-11-01

    As research and development of high-performance devices are becoming increasingly important in the flat panel display industry, new structures and processes are essential to improve the performance of the TFT backplane. Also, high-density plasma systems are needed for new device fabrications. Chlorine-based, inductively-coupled plasma systems are widely used for highly-selective, anisotropic etching of polysilicon layers. In this paper, a plasma simulation for a large-area ICP system (8th glass size and 9 planar antenna set) was conducted using Ar/Cl2 gas. Transport models and Maxwell Equations were applied to calculate the plasma parameters such as electron density, electron temperature and electric potential. In addition, the spatial distribution of ions such as Ar+, Cl2+, Cl-, Cl+ were investigated respectively. PMID:26726552

  7. Signal-Pressure Curves of Cascaded Four-Wave Mixing in Gas-Filled Capillary by fs Pulses

    Institute of Scientific and Technical Information of China (English)

    CHEN Bao-Zhen; HUANG Zu-Qia

    2005-01-01

    The theoretical framework for the cascaded four waves mixing (CFWM) in gas-filled capillary by fs pulses is constructed. Based on the theoretical framework, the signal-pressure curves (SPC) of the CFWM in gas-filled capillary by fs pulses are calculated. With a comparison between the theoretical and experimental SPC we have discussed the influence of the walk-off and Phase modulation on the SPC. At the same time, we have discussed the possible origin of the first three peaks of the SPC.

  8. Collapse and rebound of a gas-filled spherical bubble immersed in a diagnostic ultrasonic field.

    Science.gov (United States)

    Aymé-Bellegarda, E J

    1990-08-01

    This work is concerned with the influence of the finite-amplitude distortion of a driving diagnostic ultrasonic field on the collapse and rebound of a gas-filled spherical microbubble, present in the exposed compressible liquid. Such an analysis is especially important since one of the mechanisms for cavitation damage comes from the very large gas pressures generated at bubble collapse and in the subsequent pressure wave formed by bubble rebound. Gilmore's model [F.R. Gilmore, "The growth or collapse of a spherical bubble in a viscous compressible liquid," Hydrodynamics Lab. Rep. No. 26-4, California Institute of Technology, Pasadena, CA (1952)] for bubble dynamics is used to obtain the motion of the bubble interface when subjected to a pulsed diagnostic ultrasonic field of large amplitude. Knowledge of the bubble motion allows one to derive the pressure distribution around the bubble. Numerical results over a range of initial bubble sizes, acoustic pressures, and frequencies relevant to medical use show that the strength of the pressure spikes radiated by the rebounding bubble depends upon (i) the acoustic frequency (f), (ii) the initial bubble size (R0), and (iii) the magnitude of the pressure amplitude of the fundamental (PF) in a Fourier series description of the distorted pulse. As the pressure spikes propagate outward from the bubble wall, their strength is attenuated as the reciprocal of the distance from the center of collapse.

  9. Propagation dynamics of femtosecond laser pulses in a hollow fiber filled with argon: constant gas pressure versus differential gas pressure

    Science.gov (United States)

    Nurhuda, Muhammad; Suda, Akira; Midorikawa, Katsumi; Hatayama, Masatoshi; Nagasaka, Keigo

    2003-09-01

    We investigate the dynamics of femtosecond laser pulses propagating in a hollow fiber filled with argon, through a full numerical solution of the nonlinear Schrödinger equation. The simulation results show that, if the intensity is low and no ionization takes place, the spatial profile of the beam does not change very much so that its propagation model may be simplified to a one-dimensional model. If the intensity is high and ionization takes place, the spatial dynamics as well as temporal dynamics become very complicated because of self-focusing and defocusing. It is found that, for the same value of the B integral, self-focusing inside a hollow fiber can be substantially suspended by a differential gas pressure technique, where the gas pressure is set to be a minimum at the entrance and then increased with the propagation distance. Numerical simulations show that using such a technique, the energy transmitted during propagation inside hollow fiber is significantly enhanced, and the spatial phase is also improved.

  10. Development of high pressure-high vacuum-high conductance piston valve for gas-filled radiation detectors

    International Nuclear Information System (INIS)

    Gas-filled radiation detectors need gas filling at pressures that range from few cms of mercury to as high as 25kg/cm2 at room temperature. Before gas-filling these detectors require evacuation to a vacuum of the order of ∼1 x 10-5 mbar. For these operations of evacuation and gas filling a system consisting of a vacuum pump with a high vacuum gauge, gas cylinder with a pressure gauge and a valve is used. The valve has to meet the three requirements of compatibility with high-pressure and high vacuum and high conductance. A piston valve suitable for the evacuation and gas filling of radiation detectors has been designed and fabricated to meet the above requirements. The stainless steel body (80mmx160mm overall dimensions) valve with a piston arrangement has a 1/2 inch inlet/outlet opening, neoprene/viton O-ring at piston face and diameter for sealing and a knob for opening and closing the valve. The piston movement mechanism is designed to have minimum wear of sealing O-rings. The valve has been hydrostatic pressure tested up to 75bars and has Helium leak rate of less than 9.6x10-9 m bar ltr/sec in vacuum mode and 2x10-7 mbar ltr/sec in pressure mode. As compared to a commercial diaphragm valve, which needed 3 hours to evacuate a 7 litre chamber to 2.5x10-5 mbar, the new valve achieved vacuum 7.4x10-6mbar in the same time under the same conditions

  11. Development of high pressure-high vacuum-high conductance piston valve for gas-filled radiation detectors

    Science.gov (United States)

    Prasad, D. N.; Ayyappan, R.; Kamble, L. P.; Singh, J. P.; Muralikrishna, L. V.; Alex, M.; Balagi, V.; Mukhopadhyay, P. K.

    2008-05-01

    Gas-filled radiation detectors need gas filling at pressures that range from few cms of mercury to as high as 25kg/cm2 at room temperature. Before gas-filling these detectors require evacuation to a vacuum of the order of ~1 × 10-5 mbar. For these operations of evacuation and gas filling a system consisting of a vacuum pump with a high vacuum gauge, gas cylinder with a pressure gauge and a valve is used. The valve has to meet the three requirements of compatibility with high-pressure and high vacuum and high conductance. A piston valve suitable for the evacuation and gas filling of radiation detectors has been designed and fabricated to meet the above requirements. The stainless steel body (80mm×160mm overall dimensions) valve with a piston arrangement has a 1/2 inch inlet/outlet opening, neoprene/viton O-ring at piston face & diameter for sealing and a knob for opening and closing the valve. The piston movement mechanism is designed to have minimum wear of sealing O-rings. The valve has been hydrostatic pressure tested up to 75bars and has Helium leak rate of less than 9.6×10-9 m bar ltr/sec in vacuum mode and 2×10-7 mbar ltr/sec in pressure mode. As compared to a commercial diaphragm valve, which needed 3 hours to evacuate a 7 litre chamber to 2.5×10-5 mbar, the new valve achieved vacuum 7.4×10-6mbar in the same time under the same conditions.

  12. Design and fabrication of a data logger for atmospheric pressure, temperature and relative humidity for gas-filled detector development

    CERN Document Server

    Sahu, S; Rudra, Sharmili; Biswas, S; Mohanty, B; Sahu, P K

    2015-01-01

    A novel instrument has been developed to monitor and record the ambient pa- rameters such as temperature, atmospheric pressure and relative humidity. These parameters are very essential for understanding the characteristics such as gain of gas filled detectors like Gas Electron Multiplier (GEM) and Multi Wire Propor- tional Counter (MWPC). In this article the details of the design, fabrication and operation processes of the device has been presented.

  13. Preparation and characterization of gas-filled liposomes: can they improve oil recovery?

    Science.gov (United States)

    Vangala, Anil; Morris, Robert; Bencsik, Martin; Perrie, Yvonne

    2007-01-01

    Although well known for delivering various pharmaceutical agents, liposomes can be prepared to entrap gas rather than aqueous media and have the potential to be used as pressure probes in magnetic resonance imaging (MRI). Using these gas-filled liposomes (GFL) as tracers, MRI imaging of pressure regions of a fluid flowing through a porous medium could be established. This knowledge can be exploited to enhance recovery of oil from the porous rock regions within oil fields. In the preliminary studies, we have optimized the lipid composition of GFL prepared using a simple homogenization technique and investigated key physico-chemical characteristics (size and the physical stability) and their efficacy as pressure probes. In contrast to the liposomes possessing an aqueous core which are prepared at temperatures above their phase transition temperature (T(c)), homogenization of the phospholipids such as 1,2-dipalmitoyl-sn-glycero-3-phosphocholine (DPPC) or 1,2-distearoyl-sn-glycero-3-phosphocoline (DSPC) in aqueous medium below their T(c) was found to be crucial in formation of stable GFL. DSPC based preparations yielded a GFL volume of more than five times compared to their DPPC counter part. Although the initial vesicle sizes of both DSPC and DPPC based GFL were about 10 microm, after 7 days storage at 25 degrees C, the vesicle sizes of both formulations significantly (p surfactant, stearylamine, at a molar ratio of 0.25 or 0.125. Interestingly, the zeta potential values remained around neutrality at both stearylamine ratios suggesting the cationic surfactant was not incorporated within the bilayers of the GFL. Microscopic analysis of GFL confirmed the presence of spherical structures with a size distribution between 1-8 microm. This study has identified that DSPC based GFL in aqueous medium dispersed in 2% w/v methyl cellulose although yielded higher vesicle sizes over time were most stable under high pressures exerted in MRI. PMID:18027246

  14. Standard practice for examination of seamless, gas-filled, steel pressure vessels using angle beam ultrasonics

    CERN Document Server

    American Society for Testing and Materials. Philadelphia

    2007-01-01

    1.1 This practice describes a contact angle-beam shear wave ultrasonic technique to detect and locate the circumferential position of longitudinally oriented discontinuities and to compare the amplitude of the indication from such discontinuities to that of a specified reference notch. This practice does not address examination of the vessel ends. The basic principles of contact angle-beam examination can be found in Practice E 587. Application to pipe and tubing, including the use of notches for standardization, is described in Practice E 213. 1.2 This practice is appropriate for the ultrasonic examination of cylindrical sections of gas-filled, seamless, steel pressure vessels such as those used for the storage and transportation of pressurized gasses. It is applicable to both isolated vessels and those in assemblies. 1.3 The practice is intended to be used following an Acoustic Emission (AE) examination of stacked seamless gaseous pressure vessels (with limited surface scanning area) described in Test Met...

  15. Convergent ablation measurements with gas-filled rugby hohlraum on OMEGA

    Science.gov (United States)

    Casner, A.; Jalinaud, T.; Galmiche, D.

    2016-03-01

    Convergent ablation experiments with gas-filled rugby hohlraum were performed for the first time on the OMEGA laser facility. A time resolved 1D streaked radiography of capsule implosion is acquired in the direction perpendicular to hohlraum axis, whereas a 2D gated radiography is acquired at the same time along the hohlraum axis on a x-ray framing camera. The implosion trajectory has been measured for various kinds of uniformly doped ablators, including germanium-doped and silicon-doped polymers (CH), at two different doping fraction (2% and 4% at.). Our experiments aimed also at measuring the implosion performance of laminated capsules. A laminated ablator is constituted by thin alternate layers of un-doped and doped CH. It has been previously shown in planar geometry that laminated ablators could mitigate Rayleigh Taylor growth at ablation front. Our results confirm that the implosion of a capsule constituted with a uniform or laminated ablator behaves similarly, in accordance with post-shot simulations performed with the CEA hydrocode FCI2.

  16. Heavy ion beam propagation through a gas-filled chamber for inertial confinement fusion

    Energy Technology Data Exchange (ETDEWEB)

    Barboza, N.O.

    1996-10-01

    The work presented here evaluates the dynamics of a beam of heavy ions propagating through a chamber filled with gas. The motivation for this research stems from the possibility of using heavy ion beams as a driver in inertial confinement fusion reactors for the purpose of generating electricity. Such a study is important in determining the constraints on the beam which limit its focus to the small radius necessary for the ignition of thermonuclear microexplosions which are the source of fusion energy. Nuclear fusion is the process of combining light nuclei to form heavier ones. One possible fusion reaction combines two isotopes of hydrogen, deuterium and tritium, to form an alpha particle and a neutron, with an accompanying release of {approximately}17.6 MeV of energy. Generating electricity from fusion requires that we create such reactions in an efficient and controlled fashion, and harness the resulting energy. In the inertial confinement fusion (ICF) approach to energy production, a small spherical target, a few millimeters in radius, of deuterium and tritium fuel is compressed so that the density and temperature of the fuel are high enough, {approximately}200 g/cm{sup 3} and {approximately}20 keV, that a substantial number of fusion reactions occur; the pellet microexplosion typically releases {approximately}350 MJ of energy in optimized power plant scenarios.

  17. Generation Control of ZnO Nanoparticles Using a Coaxial Gas-Flow Pulse Plasma Ar/O2 Plasma

    Directory of Open Access Journals (Sweden)

    Hiroki Shirahata

    2015-01-01

    Full Text Available Generation of ZnO nanoparticles was investigated using a coaxial gas-flow pulse plasma. We studied how zinc atoms, sputtered from a zinc target, reacted with oxygen in a plasma and/or on a substrate to form ZnO nanoparticles when the discharge parameters, such as applied pulse voltage and gas flow rate, were controlled in an O2/Ar plasma. The formation processes were estimated by SEM, TEM, and EDX. We observed many ZnO nanoparticles deposited on Si substrate. The particle yield and size were found to be controlled by changing the experimental parameters. The diameter of the particles was typically 50–200 nm.

  18. Laser absorption, power transfer, and radiation symmetry during the first shock of inertial confinement fusion gas-filled hohlraum experiments

    Energy Technology Data Exchange (ETDEWEB)

    Pak, A.; Dewald, E. L.; Landen, O. L.; Milovich, J.; Strozzi, D. J.; Berzak Hopkins, L. F.; Bradley, D. K.; Divol, L.; Ho, D. D.; MacKinnon, A. J.; Meezan, N. B.; Michel, P.; Moody, J. D.; Moore, A. S.; Schneider, M. B.; Town, R. P. J.; Hsing, W. W.; Edwards, M. J. [Lawrence Livermore National Laboratory, Livermore, California, 94550 (United States)

    2015-12-15

    Temporally resolved measurements of the hohlraum radiation flux asymmetry incident onto a bismuth coated surrogate capsule have been made over the first two nanoseconds of ignition relevant laser pulses. Specifically, we study the P2 asymmetry of the incoming flux as a function of cone fraction, defined as the inner-to-total laser beam power ratio, for a variety of hohlraums with different scales and gas fills. This work was performed to understand the relevance of recent experiments, conducted in new reduced-scale neopentane gas filled hohlraums, to full scale helium filled ignition targets. Experimental measurements, matched by 3D view factor calculations, are used to infer differences in symmetry, relative beam absorption, and cross beam energy transfer (CBET), employing an analytic model. Despite differences in hohlraum dimensions and gas fill, as well as in laser beam pointing and power, we find that laser absorption, CBET, and the cone fraction, at which a symmetric flux is achieved, are similar to within 25% between experiments conducted in the reduced and full scale hohlraums. This work demonstrates a close surrogacy in the dynamics during the first shock between reduced-scale and full scale implosion experiments and is an important step in enabling the increased rate of study for physics associated with inertial confinement fusion.

  19. The Gas-Filled-Magnet at PRIME Lab: Increased Sensitivity of Cosmogenic Nuclide Measurements

    Science.gov (United States)

    Caffee, M. W.; Granger, D. E.; Woodruff, T. E.

    2015-12-01

    Abstract: Using accelerator mass spectrometry (AMS), radionuclides produced either by cosmic-ray interactions or by nucleogenic means can be measured. Typical isotopic abundance ratios range from 1 x 10-10 to 1 x 10-15. The routinely measured radionuclides are 10Be, 14C, 26Al, 36Cl, and 129I. Be-10, 26Al, and 36Cl have isobaric interferences that cannot be eliminated mass through mass analysis, but dE/dx techniques suppresses these isobars enough to allow successful measurements. There are compromises, the isobar for 26Al, 26Mg, precludes successful measurement of 26Al if AlO- is injected into the accelerator. Mg- doesn't form a stable negative ion so a 26Al measurement requires injection of 26Al-. But the Al- ion is formed inefficiently; secondary ion currents using Al- are ~ 10 times less than an AlO- secondary ion beam. Precision scales with count rate so precise measurement of the 26Al/Al for all but higher ratio samples is difficult. It has long been recognized that a gas-filled-magnet (GFM) could potentially improve the measurement of those radionuclides with intractable isobar interferences. A GFM works on the principle that each element of an isobar pair, e.g. 26Mg and 26Al, has a different average charge state as it traverses a gas (3-4 Torr of N2) contained within the vacuum jacket of a magnet. The magnet steers each species with its own momentum-to-charge ratio on its own distinct radius of curvature. The magnet can be tuned to allow the isotope of interest into a dE/dx detector; most of the isobar doesn't make it into the detector. Using the PRIME Lab GFM we are now able to routinely run 26Al with a precision that is comparable to that obtained with 10Be. We are also using the GFM for routine measurements of 10Be and 36Cl. Although the improvement for these nuclides is not as pronounced as it is for 26Al, the GFM has improved the detection sensitivity for both. Our 10Be background is now ~ 5 x 10-16 and for 36Cl we can now run the source more

  20. High-power gas-discharge excimer ArF, KrCl, KrF and XeCl lasers utilising two-component gas mixtures without a buffer gas

    Science.gov (United States)

    Razhev, A. M.; Kargapol'tsev, E. S.; Churkin, D. S.

    2016-03-01

    Results of an experimental study of the influence of a gas mixture (laser active medium) composition on an output energy and total efficiency of gas-discharge excimer lasers on ArF* (193 nm), KrCl* (222 nm), KrF* (248 nm) and XeCl* (308 nm) molecules operating without a buffer gas are presented. The optimal ratios of gas components (from the viewpoint of a maximum output energy) of an active medium are found, which provide an efficient operation of laser sources. It is experimentally confirmed that for gas-discharge excimer lasers on halogenides of inert gases the presence of a buffer gas in an active medium is not a necessary condition for efficient operation. For the first time, in two-component gas mixtures of repetitively pulsed gas-discharge excimer lasers on electron transitions of excimer molecules ArF*, KrCl*, KrF* and XeCl*, the pulsed energy of laser radiation obtained under pumping by a transverse volume electric discharge in a low-pressure gas mixture without a buffer gas reached up to 170 mJ and a high pulsed output power (of up to 24 MW) was obtained at a FWHM duration of the KrF-laser pulse of 7 ns. The maximal total efficiency obtained in the experiment with two-component gas mixtures of KrF and XeCl lasers was 0.8%.

  1. Chronology and shock history of the Bencubbin meteorite: A nitrogen, noble gas, and Ar-Ar investigation of silicates, metal and fluid inclusions

    Science.gov (United States)

    Marty, Bernard; Kelley, Simon; Turner, Grenville

    2010-11-01

    We have investigated the distribution and isotopic composition of nitrogen and noble gases, and the Ar-Ar chronology of the Bencubbin meteorite. Gases were extracted from different lithologies by both stepwise heating and vacuum crushing. Significant amounts of gases were found to be trapped within vesicles present in silicate clasts. Results indicate a global redistribution of volatile elements during a shock event caused by an impactor that collided with a planetary regolith. A transient atmosphere was created that interacted with partially or totally melted silicates and metal clasts. This atmosphere contained 15N-rich nitrogen with a pressure ⩾3 × 10 5 hPa, noble gases, and probably, although not analyzed here, other volatile species. Nitrogen and noble gases were re-distributed among bubbles, metal, and partly or totally melted silicates, according to their partition coefficients among these different phases. The occurrence of N 2 trapped in vesicles and dissolved in silicates indicates that the oxygen fugacity ( fO2) was greater than the iron-wüstite buffer during the shock event. Ar-Ar dating of Bencubbin glass gives an age of 4.20 ± 0.05 Ga, which probably dates this impact event. The cosmic-ray exposure age is estimated at ˜40 Ma with two different methods. Noble gases present isotopic signatures similar to those of "phase Q" (the major host of noble gases trapped in chondrites) but elemental patterns enriched in light noble gases (He, Ne and Ar) relative to Kr and Xe, normalized to the phase Q composition. Nitrogen isotopic data together with 40Ar/ 36Ar ratios indicate mixing between a 15N-rich component (δ 15N = +1000‰), terrestrial N, and an isotopically normal, chondritic N. Bencubbin and related 15N-rich meteorites of the CR clan do not show stable isotope (H and C) anomalies, precluding contribution of a nucleosynthetic component as the source of 15N enrichments. This leaves two possibilities, trapping of an ancient, highly fractionated

  2. Reliability of semiconductor and gas-filled diodes for over-voltage protection exposed to ionizing radiation

    Directory of Open Access Journals (Sweden)

    Stanković Koviljka

    2009-01-01

    Full Text Available The wide-spread use of semiconductor and gas-filled diodes for non-linear over-voltage protection results in a variety of possible working conditions. It is therefore essential to have a thorough insight into their reliability in exploitation environments which imply exposure to ionizing radiation. The aim of this paper is to investigate the influence of irradiation on over-voltage diode characteristics by exposing the diodes to californium-252 combined neutron/gamma radiation field. The irradiation of semiconductor over-voltage diodes causes severe degradation of their protection characteristics. On the other hand, gas-filled over-voltage diodes exhibit a temporal improvement of performance. The results are presented with the accompanying theoretical interpretations of the observed changes in over-voltage diode behaviour, based on the interaction of radiation with materials constituting the diodes.

  3. An experimental challenge: Unraveling the dependencies of ultrasonic and electrical properties of sandy sediments with pore-filling gas hydrates

    Science.gov (United States)

    Heeschen, Katja; Spangenberg, Erik; Seyberth, Karl; Priegnitz, Mike; Schicks, Judith M.

    2016-04-01

    The accuracy of gas hydrate quantification using seismic or electric measurements fundamentally depends on the knowledge of any factor describing the dependencies of physical properties on gas hydrate saturation. Commonly, these correlations are the result of laboratory measurements on artificially produced gas hydrates of exact saturation. Thus, the production of gas hydrates and accurate determination of gas hydrate concentrations or those of a substitute are a major concern. Here we present data of both, seismic and electric measurements on accurately quantified pore-filling ice as a substitute for natural gas hydrates. The method was validated using selected gas hydrate saturations in the same experimental set-up as well as literature data from glass bead samples [Spangenberg and Kulenkampff, 2006]. The environmental parameters were chosen to fit those of a possible gas hydrate reservoir in the Danube Delta, which is in the focus of models for joint inversions of seismic and electromagnetic data in the SUGAR III project. The small effective pressures present at this site proved to be yet another challenge for the experiments. Using a more powerful pulse generator and a 4 electrode electric measurement, respectively, models for a wide range of gas hydrate saturations between 20 - 90 % vol. could be established. Spangenberg, E. and Kulenkampff, J., Influence of methane hydrate content on electrical sediment properties. Geophysical Research Letters 2006, 33, (24).

  4. Annual and transient signatures of gas exchange and transport in the Castañar de Ibor cave (Spain

    Directory of Open Access Journals (Sweden)

    Fernandez-Cortes A.

    2009-07-01

    Full Text Available The large microclimatic stability is a basic characteristic of the subterranean karst systems and causes a high sensitivity to changesin environmental conditions. High-accuracy monitoring of Castañar de Ibor cave (Spain determined the temporal evolution of theaerodynamic processes and ventilation rate by tracking CO2 and 222Rn levels over a twelve-month period. This cave is characterizedby a very stable microclimate, with high and relatively constant radon content (the mean value is 32200 Bq/m3, roughly, and thestandard deviation is 7600 Bq/m3 and a moderate and quite stable CO2 concentration (the mean value is 3730 ppm and the standarddeviation is 250 ppm. Beside the general patterns of cave microclimate throughout an annual cycle, some particular microclimaticprocesses are described with regard to the gas exchange between the cave and the outside atmosphere. There is a complexmicroclimatic functional relationship between the meteorological and cave microclimate conditions and the diffusion and flow of tracergases from the fractures and the pore system of soil and host rock to cave atmosphere. Transient variations of tracer gas on cave airare controlled by natural barometric fluxes and anthropogenic forced ventilation due to uncontrolled opening of cave entrance. Theshort-term fluctuations of gas levels on cave air reveal distinct patterns during the exhalation process of theses gases from the netof fissures and pores to the cave atmosphere, depending on the isolation effect of soil and host rock.

  5. Observation of reduced beam deflection using smoothed beams in gas-filled hohlraum symmetry experiments at Nova

    International Nuclear Information System (INIS)

    Execution and modeling of drive symmetry experiments in gas-filled hohlraums have been pursued to provide both a better understanding of radiation symmetry in such hohlraums and to verify the accuracy of the design tools which are used to predict target performance for the National Ignition Facility (NIF) [J. Lindl, Phys. Plasmas 2, 3933 (1995)]. In this paper, the results of a series of drive symmetry experiments using gas-filled hohlraums at the Nova laser facility [C. Bibeau et al., Appl. Opt. 31, 5799 (1992)] at Lawrence Livermore National Laboratory are presented. A very important element of these experiments was the use of kineform phase plates (KPP) to smooth the Nova beams. The effect of smoothing the ten Nova beams with KPP phase plates is to remove most of the beam bending which had been observed previously, leaving a residual bending of only 1.5 degree sign , equivalent to a 35 μm pointing offset at the hohlraum wall. The results show that the symmetry variation with pointing of implosions in gas-filled hohlraums is consistent with time integrated modeling. (c) 2000 American Institute of Physics

  6. Hybrid recoil mass analyzer at IUAC – First results using gas-filled mode and future plans

    Indian Academy of Sciences (India)

    N Madhavan; S Nath; T Varughese; J Gehlot; A Jhingan; P Sugathan; A K Sinha; R Singh; K M Varier; M C Radhakrishna; E Prasad; S Kalkal; G Mohanto; J J Das; Rakesh Kumar; R P Singh; S Muralithar; R K Bhowmik; A Roy; Rajesh Kumar; S K Suman; A Mandal; T S Datta; J Chacko; A Choudhury; U G Naik; A J Malyadri; M Archunan; J Zacharias; S Rao; Mukesh Kumar; P Barua; E T Subramanian; K Rani; B P Ajith Kumar; K S Golda

    2010-08-01

    Hybrid recoil mass analyzer (HYRA) is a unique, dual-mode spectrometer designed to carry out nuclear reaction and structure studies in heavy and medium-mass nuclei using gas-filled and vacuum modes, respectively and has the potential to address newer domains in nuclear physics accessible using high energy, heavy-ion beams from superconducting LINAC accelerator (being commissioned) and ECR-based high current injector system (planned) at IUAC. The first stage of HYRA is operational and initial experiments have been carried out using gas-filled mode for the detection of heavy evaporation residues and heavy quasielastic recoils in the direction of primary beam. Excellent primary beam rejection and transmission efficiency (comparable with other gas-filled separators) have been achieved using a smaller focal plane detection system. There are plans to couple HYRA to other detector arrays such as Indian national gamma array (INGA) and 4 spin spectrometer for ER tagged spectroscopic/spin distribution studies and for focal plane decay measurements.

  7. Adding Some Gas Can Completely Change How an Object in a Liquid-Filled Housing Responds to Vibration

    Science.gov (United States)

    Torczynski, J. R.; O'Hern, T. J.; Clausen, J. R.

    2015-11-01

    Adding a little gas can completely change the motion of an object in a liquid-filled housing during vibration. A common system exhibiting this behavior is a spring-supported piston in a liquid-filled cylinder, where the gaps between them are narrow and depend on the piston position. When gas is absent, the piston's vibrational response is highly overdamped due to forcing viscous liquid through narrow gaps. When a small amount of gas is added, Bjerknes forces cause some of the gas to migrate below the piston. The resulting two gas regions form a pneumatic spring that enables the liquid to move with the piston, with the result that very little liquid is forced through the narrow gaps. This ``Couette mode'' has low damping and thus has a strong resonance near the frequency given by the pneumatic spring constant and the piston mass. At this frequency, the piston response is large, and the nonlinearity from the gap geometry produces a net force on the piston. This ``rectified'' force can be many times the piston's weight and can cause the piston to compress its supporting spring. Sandia National Laboratories is a multi-program laboratory managed and operated by Sandia Corporation, a wholly owned subsidiary of Lockheed Martin Corporation, for the U.S. Department of Energy's National Nuclear Security Administration under contract DE-AC04-94AL85000.

  8. Characteristics and interpretation of fracture-filled gas hydrate: an example from the Ulleung Basin, East Sea of Korea

    Science.gov (United States)

    Lee, Myung Woong; Collett, Timothy S.

    2013-01-01

    Through the use of 2-D and 3-D seismic data, a total of thirteen sites were selected and drilled in the East Sea of Korea in 2010. A suite of logging-while-drilling (LWD) logs was acquired at each site. LWD logs from the UBGH2-3A well indicate significant gas hydrate in clay-bearing sediments including several zones with massive gas hydrate with a bulk density less than 1.0 g/m3 for depths between 5 and 103 m below the sea floor. The UBGH2-3A well was drilled on a seismically identified chimney structure with a mound feature at the sea floor. Average gas hydrate saturations estimated from the isotropic analysis of ring resistivity and P-wave velocity logs are 80 ± 13% and 47 ± 16%, respectively, whereas they are 46 ± 17% and 45 ± 16%, respectively from the anisotropic analysis. Modeling indicates that the upper part of chimney (between 5 and 45 m below sea floor [mbsf]) is characterized by gas hydrate filling near horizontal fractures (7° dip) and the lower part of chimney (between 45 and 103 mbsf) is characterized by gas hydrate filling high angle fractures on the basis of ring resistivity and P-wave velocity. The anisotropic analysis using P40H resistivity (phase shift resistivity at 32 mHz with 40 inch spacing) and the P-wave velocity yields a gas hydrate saturation of 46 ± 15% and 46 ± 15% respectively, similar to those estimated using ring resistivity and P-wave velocity, but with quite different fracture dip angles. Differences in vertical resolution, depth of investigation, and a finite fracture dimension relative to the tool separation appear to contribute to this discrepancy. Forward modeling of anisotropic resistivity and velocity are essential to identify gas hydrate in fractures and to estimate accurate gas hydrate amounts.

  9. Efficient spectral broadening in the 100-W average power regime using gas-filled kagome HC-PCF and pulse compression.

    Science.gov (United States)

    Emaury, Florian; Saraceno, Clara J; Debord, Benoit; Ghosh, Debashri; Diebold, Andreas; Gèrôme, Frederic; Südmeyer, Thomas; Benabid, Fetah; Keller, Ursula

    2014-12-15

    We present nonlinear pulse compression of a high-power SESAM-modelocked thin-disk laser (TDL) using an Ar-filled hypocycloid-core kagome hollow-core photonic crystal fiber (HC-PCF). The output of the modelocked Yb:YAG TDL with 127 W average power, a pulse repetition rate of 7 MHz, and a pulse duration of 740 fs was spectrally broadened 16-fold while propagating in a kagome HC-PCF containing 13 bar of static argon gas. Subsequent compression tests performed using 8.4% of the full available power resulted in a pulse duration as short as 88 fs using the spectrally broadened output from the fiber. Compressing the full transmitted power through the fiber (118 W) could lead to a compressed output of >100  W of average power and >100  MW of peak power with an average power compression efficiency of 88%. This simple laser system with only one ultrafast laser oscillator and a simple single-pass fiber pulse compressor, generating both high peak power >100  MW and sub-100-fs pulses at megahertz repetition rate, is very interesting for many applications such as high harmonic generation and attosecond science with improved signal-to-noise performance.

  10. Ars disyecta Ars disyecta

    Directory of Open Access Journals (Sweden)

    Alejandra Castillo

    2012-07-01

    Full Text Available Bajo la nominación Ars Disyecta se busca exponer el vínculo entre artes visuales, feminismo y metamorfosis. Las prácticas artísticas feministas aquí presentadas se proponen perturbar el espacio metafórico heredado de la diferencia sexual (pensemos, por ejemplo, en las palabras engendramiento, matriz, vida, compenetración o invaginamiento. En este sentido, la nominación Ars disyecta pone en escena un conjunto de prácticas e intervenciones que intentan interrumpir la matriz de la diferencia, desestabilizando lo femenino desde aquellas figuras que se resisten a la lógica de la totalidad y de un tiempo propio. Buscando seguir la huella de un arte disyecto es que interrogaré en este ensayo aquellas autorías feministas que en el arte contemporáneo trafican con las huellas del contagio, la mutación y la alteridad.This article aims to present the relation between visual arts, feminism I and metamorphosis. The feminist artistic practices portrayed in this article attempt to question categories inherited from the metaphor of sexual difference such as engendering, matrix and life. From this perspective, Ars disyecta will establish a set of artistic practices and interventions that intend to interrupt the proper idea of «feminine difference». Following this line of argument, I will discuss in this article a few contemporary feminist works of art that could be defined by words such as contagious, mutation and otherness.

  11. Resonant third harmonic generation of KrF laser in Ar gas.

    Science.gov (United States)

    Rakowski, R; Barna, A; Suta, T; Bohus, J; Földes, I B; Szatmári, S; Mikołajczyk, J; Bartnik, A; Fiedorowicz, H; Verona, C; Verona Rinati, G; Margarone, D; Nowak, T; Rosiński, M; Ryć, L

    2014-12-01

    Investigations of emission of harmonics from argon gas jet irradiated by 700 fs, 5 mJ pulses from a KrF laser are presented. Harmonics conversion was optimized by varying the experimental geometry and the nozzle size. For the collection of the harmonic radiation silicon and solar-blind diamond semiconductor detectors equipped with charge preamplifiers were applied. The possibility of using a single-crystal CVD diamond detector for separate measurement of the 3rd harmonic in the presence of a strong pumping radiation was explored. Our experiments show that the earlier suggested 0.7% conversion efficiency can really be obtained, but only in the case when phase matching is optimized with an elongated gas target length corresponding to the length of coherence. PMID:25554270

  12. The Lampedusa supersite of ChArMex: observing aerosol-radiation interactions and gas phase chemistry in the Mediterranean

    Science.gov (United States)

    Formenti, Paola; di Sarra, Alcide Giorgio

    2014-05-01

    Within the frame of the ADRIMED (Aerosol Direct Radiative Impact in the regional climate in the MEDiterranean region) project of the Chemistry-Aerosol Mediterranean experiment (ChArMex), the ENEA Laboratory for Climate Study "Roberto Sarao" (WMO/GAW/NDACC) on the Island of Lampedusa (35°31'N, 12°37°E) has been augmented to one of the supersites of the first phase of the Special Observing Period 1 by the measurements of the in situ properties of aerosols and trace gases by the of the PortablE Gas and Aerosol Sampling Units (PEGASUS) mobile station. The ground-based measurements have been completed by several coordinated overpasses of the ATR-42 and the F20 of SAFIRE. In this paper we present the first highlights of operations, which took place between June 6 and July 8 2013. Insights on the data provide with an unprecedented characterisation of the physico-chemical and properties aerosols and gas phase chemistry on air masses of various origins (pollution, marine, mineral dust, …..). The effect of aerosols on radiation fields is ascertained by coupling ground-based and aircraft measurements during dedicated overpasses providing with measurements of upwelling and downwelling shortwave and longwave radiation fluxes together with the properties of the aerosol load resolved on the column. Coordination with CALIPSO overpasses will also be explored.

  13. Niobium films produced by magnetron sputtering using an Ar-He mixture as discharge gas

    CERN Document Server

    Schucan, G M; Calatroni, Sergio

    1995-01-01

    Superconducting RF accelerating cavities have been produced at CERN by sputter-coating, with a thin niobium layer, cavities made of copper. In the present work, the discharge behaviour and niobium film properties have been investigated when part of the argon sputtering gas is replaced with helium. Helium is chosen because of its low mass, which reduces the energy lost by the niobium atoms colliding with the sputter gas atoms. The higher niobium atom energy should lead to higher adatom mobility on the substrate and, hence, to a larger grain size, a feature which is highly desirable to reduce the cavity surface resistance. It has been found that helium addition effectively helps to maintain the discharge at considerably lower argon pressures, via metastable-neutral ionisation and high secondary electron yield. However, a large amount of helium is trapped in the film, amount which is proportional to the helium partial pressure during the discharge, resulting in a reduction of both Residual Resistivity Ratio and ...

  14. Surface modification of graphite-encapsulated iron nanoparticles by RF excited Ar/NH3 gas mixture plasma and their application to Escherichia coli capture

    Science.gov (United States)

    Viswan, Anchu; Chou, Han; Sugiura, Kuniaki; Nagatsu, Masaaki

    2016-09-01

    Graphite-encapsulated iron nanoparticles with an average diameter of 20 nm were synthesized using the DC arc discharge method. For biomedical application, the nanoparticles were functionalized with amino groups using an inductively coupled radio-frequency (RF) plasma. The Ar, NH3, and Ar/NH3 plasmas that were used for functionalization were diagnosed using optical emission spectroscopy, confirming the presence of the required elements. The best conditions for functionalization were optimized by changing various parameters. The pretreatment time with Ar plasma was varied from 0 to 12.5 min, the post-treatment time from 30 s to 3 min. The dependence of the RF power and the gas mixture ratio of Ar/NH3 on the amino group population was also analyzed. From Raman spectroscopy, x-ray photoelectron spectroscopy, and determination of absolute number of amino groups through chemical derivatization, it was found that 5 min of Ar pretreatment and 6%NH3/94%Ar plasma post-treatment for 3 min with an RF power of 80 W gives the best result of about 5  ×  104 amino groups per particle. The nanoparticles that were amino functionalized under optimized conditions and immobilized with an Escherichia coli (E.coli) antibody on their surface were incubated with E.coli bacteria to determine the efficiency of collection by direct culture assay.

  15. Theoretical prediction of new noble-gas molecules FNgBNR (Ng = Ar, Kr, and Xe; R = H, CH3, CCH, CHCH2, F, and OH).

    Science.gov (United States)

    Chen, Jien-Lian; Yang, Chang-Yu; Lin, Hsiao-Jing; Hu, Wei-Ping

    2013-06-28

    We have computationally predicted a new class of stable noble-gas molecules FNgBNR (Ng = Ar, Kr, Xe; R = H, CH3, CCH, CHCH2, F, and OH). The FNgBNR were found to have compact structures with F-Ng bond lengths of 1.9-2.2 Å and Ng-B bond lengths of ~1.8 Å. The endoergic three-body dissociation energies of FNgBNH to F + Ng + BNH were calculated to be 12.8, 31.7, and 63.9 kcal mol(-1), for Ng = Ar, Kr, and Xe, respectively at the CCSD(T)/CBS level. The energy barriers of the exoergic two-body dissociation to Ng + FBNH were calculated to be 16.1, 24.0, and 33.2 kcal mol(-1) for Ng = Ar, Kr, and Xe, respectively. Our results showed that the dissociation energetics is relatively insensitive to the identities of the terminal R groups. The current study suggested that a wide variety of noble-gas containing molecules with different types of R groups can be thermally stable at low temperature, and the number of potentially stable noble-gas containing molecules would thus increase very significantly. It is expected some of the FNgBNR molecules could be identified in future experiments under cryogenic conditions in noble-gas matrices or in the gas phase.

  16. Nuclear charge and isobar separation in a gas-filled enge split-pole magnetic spectrograph

    International Nuclear Information System (INIS)

    The sepration technique is based on the fact that charge-changing processes of an ion in a gas, if they occur frequently enough in a magnetic field region, lead to trajectories determined by the average charge state of the ion in the gas. The technique has been used to separate isobaric 58Ni and 58Fe ions. 7 refs., 4 figs., 1 tab

  17. Study of x-rays produced from debris-free sources with Ar, Kr and Kr/Ar mixture linear gas jets irradiated by UNR Leopard laser beam with fs and ns pulse duration

    Science.gov (United States)

    Kantsyrev, V. L.; Schultz, K. A.; Shlyaptseva, V. V.; Safronova, A. S.; Shrestha, I. K.; Petrov, G. M.; Moschella, J. J.; Petkov, E. E.; Stafford, A.; Cooper, M. C.; Weller, M. E.; Cline, W.; Wiewior, P.; Chalyy, O.

    2016-06-01

    Experiments of x-ray emission from Ar, Kr, and Ar/Kr gas jet mixture were performed at the UNR Leopard Laser Facility operated with 350 fs pulses at laser intensity of 2 × 1019 W/cm2 and 0.8 ns pulses at an intensity of 1016 W/cm2. Debris free x-ray source with supersonic linear nozzle generated clusters/monomer jet with an average density of ≥1019 cm-3 was compared to cylindrical tube subsonic nozzle, which produced only monomer jet with average density 1.5-2 times higher. The linear (elongated) cluster/gas jet provides the capability to study x-ray yield anisotropy and laser beam self-focusing with plasma channel formation that are interconnecting with efficient x-ray generation. Diagnostics include x-ray diodes, pinhole cameras and spectrometers. It was observed that the emission in the 1-9 keV spectral region was strongly anisotropic depending on the directions of laser beam polarization for sub-ps laser pulse and supersonic linear jet. The energy yield in the 1-3 keV region produced by a linear nozzle was an order of magnitude higher than from a tube nozzle. Non-LTE models and 3D molecular dynamic simulations of Ar and Kr clusters irradiated by sub-ps laser pulses have been implemented to analyze obtained data. A potential evidence of electron beam generation in jets' plasma was discussed. Note that the described debris-free gas-puff x-ray source can generate x-ray pulses in a high repetition regime. This is a great advantage compared to solid laser targets.

  18. Tunable vacuum-UV to visible ultrafast pulse source based on gas-filled Kagome-PCF.

    Science.gov (United States)

    Mak, Ka Fai; Travers, John C; Hölzer, Philipp; Joly, Nicolas Y; Russell, Philip St J

    2013-05-01

    An efficient and tunable 176-550 nm source based on the emission of resonant dispersive radiation from ultrafast solitons at 800 nm is demonstrated in a gas-filled hollow-core photonic crystal fiber (PCF). By careful optimization and appropriate choice of gas, informed by detailed numerical simulations, we show that bright, high quality, localized bands of UV light (relative widths of a few percent) can be generated at all wavelengths across this range. Pulse energies of more than 75 nJ in the deep-UV, with relative bandwidths of ~3%, are generated from pump pulses of a few μJ. Excellent agreement is obtained between numerical and experimental results. The effects of positive and negative axial pressure gradients are also experimentally studied, and the coherence of the deep-UV dispersive wave radiation numerically investigated.

  19. Optical design and characterization of a gas filled MEMS Fabry-Perot filter

    Science.gov (United States)

    Ayerden, N. Pelin; Ghaderi, Mohammadamir; de Graaf, Ger; Wolffenbuttel, Reinoud F.

    2015-05-01

    A concept for a highly integrated and miniaturized gas sensor based on infrared absorption, a Fabry-Perot type linear variable optical filter with integrated gas cell, is presented. The sample chamber takes up most of the space in a conventional spectrometer and is the only component that has so far not been miniaturized. In this concept the gas cell is combined with the resonator cavity of the filter. The optical design, fabrication, and characterization results on a MEMSbased realization are reported for a 24-25.5 μm long tapered resonator cavity. Multiple reflections from highly reflective mirrors enable this optical cavity to also act as a gas cell with an equivalent optical absorption path length of 8 mm. Wideband operation of the filter is ensured by fabrication of a tapered mirror. In addition to the functional integration and significant size reduction, the filter contains no moving parts, thus enables the fabrication of a robust microspectrometer

  20. Strong Raman-induced non-instantaneous soliton interactions in gas-filled photonic crystal fibers

    CERN Document Server

    Saleh, Mohammed F; Marini, Andrea; Biancalana, Fabio

    2015-01-01

    We have developed an analytical model based on the perturbation theory in order to study the optical propagation of two successive intense solitons in hollow-core photonic crystal fibers filled with Raman-active gases. Based on the time delay between the two solitons, we have found that the trailing soliton dynamics can experience unusual nonlinear phenomena such as spectral and temporal soliton oscillations and transport towards the leading soliton. The overall dynamics can lead to a spatiotemporal modulation of the refractive index with a uniform temporal period and a uniform or chirped spatial period.

  1. Reactor simulations of the GEC reference cell reactor with an ICP source for Ar/Cl2 and BCl3/Cl2 gas mixtures.

    Science.gov (United States)

    Veerasingam, Ramana; Choi, Seung J.; Riley, Merle; Hoekstra, Robert; Kushner, Mark

    1996-10-01

    The ICP (inductively coupled plasma) device is a widely researched plasma etching technology to meet the stringent requirements of dielectric and metal etch for the next generation semiconductor wafers. At Sandia, the GEC reference cell has been modified to include a planar coil geometry to couple the RF power to the plasma inductively. Measurements of densities of electrons, CL-, Ar+, and recently of ion current flux have been made. In this paper, we will present results of simulations modeling the GEC cell for Ar/CL2 and BCL3/Cl2 gas mixtures using the HPEM and GEMINI code packages. Results will be parametrized with power, pressure, and gas mixture. In addition, simulations of the ion current flux using a sheath model developed at Sandia and the HPEM will be performed and compared to data.

  2. Effect of O2/Ar Gas Flow Ratios on Properties of Cathodic Vacuum Arc Deposited ZnO Thin Films on Polyethylene Terephthalate Substrate

    Directory of Open Access Journals (Sweden)

    Chien-Wei Huang

    2016-01-01

    Full Text Available Cathodic vacuum arc deposition (CVAD can obtain a good quality thin film with a low growth temperature and a high deposition rate, thus matching the requirement of film deposition on flexible electronics. This paper reported the room-temperature deposition of zinc oxide (ZnO thin films deposited by CVAD on polyethylene terephthalate (PET substrate. Microstructure, optical, and electrical measurements of the deposited ZnO thin films were investigated with various O2/Ar gas flow ratios from 6 : 1 to 10 : 1. The films showed hexagonal wurtzite crystal structure. With increasing the O2/Ar gas flow ratios, the c-axis (002 oriented intensity decreased. The crystal sizes were around 16.03 nm to 23.42 nm. The average transmittance values in the visible range of all deposited ZnO films were higher than 83% and the calculated band gaps from the absorption data were found to be around 3.1 to 3.2 eV. The resistivity had a minimum value in the 3.65 × 10−3 Ω·cm under the O2/Ar gas flow ratio of 8 : 1. The luminescence mechanisms of the deposited film were also investigated to understand the defect types of room-temperature grown ZnO films.

  3. Effects of Ar or O2 Gas Bubbling for Shape, Size, and Composition Changes in Silver-Gold Alloy Nanoparticles Prepared from Galvanic Replacement Reaction

    Directory of Open Access Journals (Sweden)

    Md. Jahangir Alam

    2013-01-01

    Full Text Available The galvanic replacement reaction between silver nanostructures and AuCl4- solution has recently been demonstrated as a versatile method for generating metal nanostructures with hollow interiors. Here we describe the results of a systematic study detailing the morphological, structural, compositional, and spectral changes involved in such a heterogeneous reaction on the nanoscale. Effects of Ar or O2 gas bubbling for the formation of Ag-Au alloy nanoparticles by the galvanic replacement between spherical Ag nanoparticles and AuCl4- especially were studied in ethylene glycol (EG at 150°C. The shape, size, and composition changes occur rapidly under O2 bubbling in comparison with those under Ar bubbling. The major product after 60 min heating under Ar gas bubbling was perforated Ag-Au alloy particles formed by the replacement reaction and the minor product was ribbon-type particles produced from splitting off some perforated particles. On the other hand, the major product after 60 min heating under O2 gas bubbling was ribbon-type particles. In addition, small spherical Ag particles are produced. They are formed through rereduction of Ag+ ions released from the replacement reaction and oxidative etching of Ag nanoparticles by O2/Cl− in EG.

  4. Fabrication and testing of gas filled targets for large scale plasma experiments on Nova

    International Nuclear Information System (INIS)

    An experimental campaign on the Nova laser was started in July 1993 to study one st of target conditions for the point design of the National Ignition Facility (NIF). The targets were specified to investigate the current NIF target conditions--a plasma of ∼3 keV electron temperature and an electron density of ∼1.0 E + 21 cm-3. A gas cell target design was chosen to confine as gas of ∼0.01 cm3 in volume at ∼ 1 atmosphere. This paper will describe the major steps and processes necessary in the fabrication, testing and delivery of these targets for shots on the Nova Laser at LLNL

  5. Fabrication and testing of gas filled targets for large scale plasma experiments on Nova

    Energy Technology Data Exchange (ETDEWEB)

    Stone, G.F.; Spragge, M.; Wallace, R.J. [Lawrence Livermore National Lab., CA (United States); Rivers, C.J. [Lawrence Livermore National Lab., CA (United States)]|[Schafer (W.J.) Associates, Inc., Livermore, CA (United States)

    1995-03-06

    An experimental campaign on the Nova laser was started in July 1993 to study one st of target conditions for the point design of the National Ignition Facility (NIF). The targets were specified to investigate the current NIF target conditions--a plasma of {approximately}3 keV electron temperature and an electron density of {approximately}1.0 E + 21 cm{sup {minus}3}. A gas cell target design was chosen to confine as gas of {approximately}0.01 cm{sup 3} in volume at {approximately} 1 atmosphere. This paper will describe the major steps and processes necessary in the fabrication, testing and delivery of these targets for shots on the Nova Laser at LLNL.

  6. Fabrication and testing of gas-filled targets for large-scale plasma experiments on nova

    Energy Technology Data Exchange (ETDEWEB)

    Stone, G.F.; Rivers, C.J.; Spragge, M.R.; Wallace, R.J.

    1996-06-01

    The proposed next-generation ICF facility, the National Ignition Facility (NIF) is designed to produce energy gain from x-ray heated {open_quotes}indirect-drive{close_quotes} fuel capsules. For indirect-drive targets, laser light heats the inside of the Au hohlraum wall and produces x rays which in turn heat and implode the capsule to produce fusion conditions in the fuel. Unlike Nova targets, in NIF-scale targets laser light will propagate through several millimeters of gas, producing a plasma, before impinging upon the Au hohlraum wall. The purpose of the gas-produced plasma is to provide sufficient pressure to keep the radiating Au surface from expanding excessively into the hohlraum cavity. Excessive expansion of the Au wall interacts with the laser pulse and degrades the drive symmetry of the capsule implosion. The authors have begun an experimental campaign on the Nova laser to study the effect of hohlraum gas on both laser-plasma interaction and implosion symmetry. In their current NIF target design, the calculated plasma electron temperature is T{sub e} {approx} 3 keV and the electron density is N{sub e} {approx} 10{sup 21}cm{sup {minus}3}.

  7. Synchrotron X-Ray Study of Melting in Submonolayer Ar and other Rare-Gas Films on Graphite

    DEFF Research Database (Denmark)

    McTague, J. P.; Als-Nielsen, Jens Aage; Bohr, Jakob;

    1982-01-01

    Synchrotron x-ray diffraction studies of the (10) peak of Ar on the (001) surface of ZYX graphite show a sharp but continuous broadening of the Bragg peak with increasing temperature. Below a coverage of ∼ 1 Ar atom per six surface carbon atoms (ρ=1) the onset of this transition occurs at a cover...... at a coverage-independent temperature T=47.9 K. We interpret this point as a critical end point for melting. For coverages 0.94...

  8. FIssion Product Prompt γ-ray spectrometer: Development of an instrumented gas-filled magnetic spectrometer at the ILL

    Science.gov (United States)

    Blanc, A.; Chebboubi, A.; Faust, H.; Jentschel, M.; Kessedjian, G.; Köster, U.; Materna, T.; Panebianco, S.; Sage, C.; Urban, W.

    2013-12-01

    Accurate thermal neutron-induced fission data are important for applications in reactor physics as well as for fundamental nuclear physics. FIPPS is the new FIssion Product Prompt γ-ray Spectrometer being developed at the Institut Laue Langevin for neutron-induced fission studies. FIPPS is based on the combination of a large Germanium detector array surrounding a fission target, a Time-Of-Flight detector and a Gas-Filled Magnet (GFM) to identify mass, nuclear charge and kinetic energy of one of the fission fragments. The GFM will be instrumented with a Time-Projection Chamber (TPC) for individual 3D tracking of the fragments. A conceptual design study of the new spectrometer is presented.

  9. Effect of a transverse magnetic field on the generation of electron beams in the gas-filled diode

    Science.gov (United States)

    Baksht, E. H.; Burachenko, A. G.; Erofeev, M. V.; Kostyrya, I. D.; Lomaev, M. I.; Rybka, D. V.; Tarasenko, V. F.

    2008-06-01

    The effect of a transverse magnetic field (0.080 and 0.016 T) on generation of an electron beam in the gas-filled diode is experimentally investigated. It is shown that, at voltage U = 25 kV across the diode and a low helium pressure (45 Torr), the transverse magnetic field influences the beam current amplitude behind a foil and its distribution over the foil cross section. At elevated pressures and under the conditions of ultrashort avalanche electron beam formation in helium, nitrogen, and air, the transverse magnetic field (0.080 and 0.016 T) has a minor effect on the amplitude and duration of the beam behind the foil. It is established that, when the voltage of the pulse generator reaches several hundreds of kilovolts, some runaway electrons (including the electrons from the discharge plasma near the cathode) are incident on the side walls of the diode.

  10. Accelerator mass spectrometry of 63Ni using a gas-filled magnet at the Munich Tandem Laboratory

    Science.gov (United States)

    Rugel, G.; Faestermann, T.; Knie, K.; Korschinek, G.; Marchetti, A. A.; McAninch, J. E.; Rühm, W.; Straume, T.; Wallner, C.

    2000-10-01

    The detection of 63Ni ( T1/2=100.1 yr) by means of accelerator mass spectrometry (AMS) using a gas-filled magnet (GFM) is described. The experimental setup includes a dedicated ion source, a 14 MV MP tandem, a GFM and a multi-anode ionization chamber. First results indicate a background level of 63Ni/Ni ratios as low as 2×10 -14. This sensitivity will allow - for the first time ever - to detect 63Ni induced by fast neutrons in copper samples from Hiroshima and Nagasaki, even for distances beyond 1500 m from the hypocenters. Thus, it will be possible to reconstruct experimentally the neutron doses of the A-bomb survivors from Hiroshima and Nagasaki.

  11. Gas filled prototype of a CdZnTe pixel detector

    Energy Technology Data Exchange (ETDEWEB)

    Ramsey, B.; Sharma, D.; Sipila, H.; Gostilo, V. E-mail: bsi@bsi.lv; Loupilov, A

    2001-06-01

    CdZnTe pixel structures are currently the most promising detectors for the focal planes of hard X-ray telescopes, for astronomical observation in the range 5-100 keV. In Sharma et al. (Proc. SPIE 3765 (1999) 822) and Ramsey et al. (Nucl. Instrum. Methods A 458 (2001) 55) we presented preliminary results on the development of prototype 4x4 CdZnTe imaging detectors operated under vacuum. These pixel detectors were installed inside vacuum chambers on three-stage Peltier coolers providing detector temperatures down to -40 deg. C. A miniature sputter ion pump inside each chamber maintained the necessary vacuum of 10{sup -5} Torr. At a temperature of -20 deg. C we achieved an FWHM energy resolution of between 2% and 3% at 60 keV and {approx}15% at 5.9 keV; however, the dependency on temperature was weak and at +20 deg. C the respective resolutions were 3% and 20%. As the detectors could be operated at room temperature without loss of their good characteristics it was possible to exclude the sputter ion pump and fill the chamber with dry nitrogen instead. We have tested a nitrogen-filled CdZnTe (5x5x1 mm{sup 3}) prototype having 0.65x0.65 mm{sup 2} readout pads on a 0.75 mm pitch. The interpixel resistance at an applied voltage of 10 V was higher than 50 G{omega} and the pixel leakage currents at room temperature with a bias of 200 V between each pad and the common electrode did not exceed 0.8 nA. The pixel detector inside the microassembly, which also contained the input stages of the preamplifiers, was installed on a Peltier cooler to maintain the detector temperature at +20 deg. C. To define real leakage currents of the pixels in their switched-on state we have checked the voltage on the preamplifiers feedback resistors. The resulting currents were 10-50 pA at a detector bias of 500 V. Under test, the typical energy resolution per pixel at +20 deg. C was {approx}3% at energy 59.6 keV and {approx}20% at energy 5.9 keV, which are similar to the values obtained in the

  12. Supernova Feedback and the Hot Gas Filling Fraction of the Interstellar Medium

    CERN Document Server

    Li, Miao; Cen, Renyue; Bryan, Greg L; Naab, Thorsten

    2015-01-01

    Supernovae are the most energetic among stellar feedback processes, and are crucial for regulating the interstellar medium (ISM) and launching galactic winds. We explore how supernova remnants (SNRs) create a multiphase medium by performing high resolution, 3D hydrodynamical simulations at various SN rates, $S$, and ISM average densities, $n$. We find that the evolution of a SNR in a self-consistently generated three-phase ISM is qualitatively different from that in a uniform or a two-phase warm/cold medium. By traveling faster and further in the cooling-inefficient hot phase, the spatial-temporal domain of a SNR is enlarged by $>10^{2.5}$ in a hot-dominated multiphase medium (HDMM) compared to the uniform case. We then examine the resultant ISM as we vary $n$ and $S$, finding that a steady state can only be achieved when the hot gas volume fraction \\fvh $\\lesssim 0.6\\pm 0.1$. Above that, overlapping SNRs render connecting topology of the hot gas, and such a HDMM is subjected to thermal runaway with growing p...

  13. Effect of stratified inequality of blood flow on gas exchange in liquid-filled lungs.

    Science.gov (United States)

    West, J. B.; Maloney, J. E.; Castle, B. L.

    1972-01-01

    This investigation set out to answer two questions: (1) are the distal alveoli in the terminal lung units less well perfused than the proximal alveoli, i.e., is there stratification of blood flow; and (2) if so, does this enhance gas exchange in the presence of stratified inequality of ventilation. Excised dog lungs were ventilated with saline and perfused with blood. Following single inspirations of xenon 133 in saline and various periods of breath holding, the expired xenon concentration against volume was measured and it confirmed marked stratified inequality of ventilation under these conditions. By measuring the rate of depletion of xenon from alveoli during a period of blood flow, we showed that the alveoli which emptied at the end of expiration had 16% less blood flow than those exhaling earlier. However, by measuring the xenon concentration in pulmonary venous blood, we found that about 10% less tracer was transferred from the alveoli into the blood when the inspired xenon was stratified within the respiratory zone. Thus while stratification of blood flow was confirmed, it was shown to impair rather than enhance the efficiency of gas transfer.

  14. Electrical compensation method of mechanically induced disturbances in gas-filled radiation detectors

    International Nuclear Information System (INIS)

    In recent years ionization chambers could be improved in many properties such as accuracy and speed. Rise time values of about 1 ms could be realized by the implementation of high sophisticated inner electrode configurations reducing the free length between the electrodes of about 10 mm distance, so that the slow gas-ions generate a displacement current only over a short time interval. These improvements are combined with the disadvantage of increasing sensitivity to mechanical loads as vibrations and shocks. These effects reduce the good applicability of ionization chambers specially in a rough industrial environment. The solution for this problem can be found by using improved mechanical constructions enclosed damped mounting and stabilized construction elements. This paper describes an electrical compensation method of mechanically induced disturbing signals. The implementation is independent of a special detector and can be applied for the suppression of interference signals caused by the 'microphony' effect, comparable with the known operation of a condenser microphone. (orig.)

  15. Effects of total CH4/Ar gas pressure on the structures and field electron emission properties of carbon nanomaterials grown by plasma-enhanced chemical vapor deposition

    International Nuclear Information System (INIS)

    The effects of total CH4/Ar gas pressure on the growth of carbon nanomaterials on Si (1 0 0) substrate covered with CoO nanoparticles, using plasma-enhanced chemical vapor deposition (PECVD), were investigated. The structures of obtained products were correlated with the total gas pressure and changed from pure carbon nanotubes (CNTs) through hybrid CNTs/graphene sheets (GSs), to pure GSs as the total gas pressure changed from 20 to 4 Torr. The total gas pressure influenced the density of hydrogen radicals and Ar ions in chamber, which in turn determined the degree of how CoO nanoparticles were deoxidized and ion bombardment energy that governed the final carbon nanomaterials. Moreover, the obtained hybrid CNTs/GSs exhibited a lower turn-on field (1.4 V/μm) emission, compared to either 2.7 V/μm for pure CNTs or 2.2 V/μm for pure GSs, at current density of 10 μA/cm2.

  16. Analysis of burns caused by pre-filled gas canisters used for lamps or portable camping stoves.

    Science.gov (United States)

    Desouches, C; Salazard, B; Romain, F; Karra, C; Lavie, A; Volpe, C Della; Manelli, J C; Magalon, G

    2006-12-01

    The use of pre-filled valveless gas canisters for lamps or camping stoves has caused a number of serious burn incidents. We performed a retrospective analysis of all of the patients who were victims of such incidents admitted to the Marseille Burn Centre between January 1990 and March 2004. There were a total of 21 patients burned in such conditions. Adult males made up the majority of the victims of this sort. Lesions were often extensive (60% of the patients were burned over more than 10% of their body surface) and systematically deep. In order of frequency, burn locations were: the lower limbs, the upper limbs, the hands and the face. The incidents principally occurred during replacement of the canister near an open flame. The marketing of a canister with a valve in order to avoid gas leaks did not cause the old canisters to be taken off the market. On the contrary, European Safety Standard EN417, updated in October 2003, validated the use of these valveless canisters. The severity of the lesions caused and the existence of safe equivalent products requires the passage of a law that forbids valveless canisters. PMID:16982156

  17. Integrated processing of contrast pulse sequencing ultrasound imaging for enhanced active contrast of hollow gas filled silica nanoshells and microshells.

    Science.gov (United States)

    Ta, Casey N; Liberman, Alexander; Paul Martinez, H; Barback, Christopher V; Mattrey, Robert F; Blair, Sarah L; Trogler, William C; Kummel, Andrew C; Wu, Zhe

    2012-03-01

    In recent years, there have been increasing developments in the field of contrast-enhanced ultrasound both in the creation of new contrast agents and in imaging modalities. These contrast agents have been employed to study tumor vasculature in order to improve cancer detection and diagnosis. An in vivo study is presented of ultrasound imaging of gas filled hollow silica microshells and nanoshells which have been delivered intraperitoneally to an IGROV-1 tumor bearing mouse. In contrast to microbubbles, this formulation of microshells provided strong ultrasound imaging signals by shell disruption and release of gas. Imaging of the microshells in an animal model was facilitated by novel image processing. Although the particle signal could be identified by eye under live imaging, high background obfuscated the particle signal in still images and near the borders of the tumor with live images. Image processing techniques were developed that employed the transient nature of the particle signal to selectively filter out the background signal. By applying image registration, high-pass, median, threshold, and motion filtering, a short video clip of the particle signal was compressed into a single image, thereby resolving the silica shells within the tumor. © 2012 American Vacuum Society.

  18. Standard practice for examination of seamless, Gas-Filled, pressure vessels using acoustic emission

    CERN Document Server

    American Society for Testing and Materials. Philadelphia

    2009-01-01

    1.1 This practice provides guidelines for acoustic emission (AE) examinations of seamless pressure vessels (tubes) of the type used for distribution or storage of industrial gases. 1.2 This practice requires pressurization to a level greater than normal use. Pressurization medium may be gas or liquid. 1.3 This practice does not apply to vessels in cryogenic service. 1.4 The AE measurements are used to detect and locate emission sources. Other nondestructive test (NDT) methods must be used to evaluate the significance of AE sources. Procedures for other NDT techniques are beyond the scope of this practice. See Note 1. Note 1—Shear wave, angle beam ultrasonic examination is commonly used to establish circumferential position and dimensions of flaws that produce AE. Time of Flight Diffraction (TOFD), ultrasonic examination is also commonly used for flaw sizing. 1.5 The values stated in inch-pound units are to be regarded as the standard. The values given in parentheses are for information only. 1.6 This standa...

  19. Effect of N2 and Ar gas on DC arc plasma generation and film composition from Ti-Al compound cathodes

    International Nuclear Information System (INIS)

    DC arc plasma from Ti, Al, and Ti1−xAlx (x = 0.16, 0.25, 0.50, and 0.70) compound cathodes has been characterized with respect to plasma chemistry (charged particles) and charge-state-resolved ion energy for Ar and N2 pressures in the range 10−6 to 3 × 10−2 Torr. Scanning electron microscopy was used for exploring the correlation between the cathode and film composition, which in turn was correlated with the plasma properties. In an Ar atmosphere, the plasma ion composition showed a reduction of Al of approximately 5 at. % compared to the cathode composition, while deposited films were in accordance with the cathode stoichiometry. Introducing N2 above ∼5 × 10−3 Torr, lead to a reduced Al content in the plasma as well as in the film, and hence a 1:1 correlation between the cathode and film composition cannot be expected in a reactive environment. This may be explained by an influence of the reactive gas on the arc mode and type of erosion of Ti and Al rich contaminations, as well as on the plasma transport. Throughout the investigated pressure range, a higher deposition rate was obtained from cathodes with higher Al content. The origin of generated gas ions was investigated through the velocity rule, stating that the most likely ion velocities of all cathode elements from a compound cathode are equal. The results suggest that the major part of the gas ions in Ar is generated from electron impact ionization, while gas ions in a N2 atmosphere primarily originate from a nitrogen contaminated layer on the cathode surface. The presented results provide a contribution to the understanding processes of plasma generation from compound cathodes. It also allows for a more reasonable approach to the selection of composite cathode and experimental conditions for thin film depositions

  20. Fijación de arsénico en fase gas con hematita sólida

    Directory of Open Access Journals (Sweden)

    Balladares, E.

    2004-10-01

    Full Text Available Feasibility to obtain ferric arsenate starting from arsenic containing gas in contact with Fe2 O3 has been studied. Thermodynamic stability of the system Fe-As-O was analysed in order to verify conditions to form FexAsy y Oz type compounds. Experiments were made using a hematite sample suspended in a thermogravimetric device. As4O6 was generated starting from solid As2 O3 which was circulating through the iron oxide. Final samples were analysed chemically and by means of DRX, verifying the formation of FeAsO4, FeAsO4·2H2O and FeAsO4·(H2O2 in small quantities. Tests in porous bed and pellets were carried out, studying the effect of: porosity, temperature and oxygen potential. The largest conversion obtained was 10 % at 800 °C, pO2 =50% and porosity = 0.883.

    Se estudió, a escala laboratorio, la factibilidad de obtener arseniato férrico a partir de una corriente gaseosa rica en arsénico, en contacto con Fe2 O3. Se analizó la estabilidad termodinámica del sistema Fe-As-O a fin de verificar las condiciones de formación de compuestos del tipo FexAsy y Oz. Se usó una muestra de hematita suspendida de una balanza termogravimétrica. El gas As4O6 fue generado a partir de AS2 O3 sólido y se hizo circular a través del óxido de hierro. Las muestras obtenidas fueron analizadas químicamente y mediante DRX, verificándose la formación de cantidades menores de FeAsO4, FeAsO4·2H2O y FeAsO4·(H2O2. Se estudió el efecto de porosidad, temperatura y presión parcial de oxígeno. La mayor conversión obtenida fue de 10 %, a 800 °C, pO2 = 50 % y porosidad = 0,883.

  1. High harmonic generation in a gas-filled hollow-core photonic crystal fiber

    Science.gov (United States)

    Heckl, O. H.; Baer, C. R. E.; Kränkel, C.; Marchese, S. V.; Schapper, F.; Holler, M.; Südmeyer, T.; Robinson, J. S.; Tisch, J. W. G.; Couny, F.; Light, P.; Benabid, F.; Keller, U.

    2009-10-01

    High harmonic generation (HHG) of intense infrared laser radiation (Ferray et al., J. Phys. B: At. Mol. Opt. Phys. 21:L31, 1988; McPherson et al., J. Opt. Soc. Am. B 4:595, 1987) enables coherent vacuum-UV (VUV) to soft-X-ray sources. In the usual setup, energetic femtosecond laser pulses are strongly focused into a gas jet, restricting the interaction length to the Rayleigh range of the focus. The average photon flux is limited by the low conversion efficiency and the low average power of the complex laser amplifier systems (Keller, Nature 424:831, 2003; Südmeyer et al., Nat. Photonics 2:599, 2008; Röser et al., Opt. Lett. 30:2754, 2005; Eidam et al., IEEE J. Sel. Top. Quantum Electron. 15:187, 2009) which typically operate at kilohertz repetition rates. This represents a severe limitation for many experiments using the harmonic radiation in fields such as metrology or high-resolution imaging. Driving HHG with novel high-power diode-pumped multi-megahertz laser systems has the potential to significantly increase the average photon flux. However, the higher average power comes at the expense of lower pulse energies because the repetition rate is increased by more than a thousand times, and efficient HHG is not possible in the usual geometry. So far, two promising techniques for HHG at lower pulse energies were developed: external build-up cavities (Gohle et al., Nature 436:234, 2005; Jones et al., Phys. Rev. Lett. 94:193, 2005) and resonant field enhancement in nanostructured targets (Kim et al., Nature 453:757, 2008). Here we present a third technique, which has advantages in terms of ease of HHG light extraction, transverse beam quality, and the possibility to substantially increase conversion efficiency by phase-matching (Paul et al., Nature 421:51, 2003; Ren et al., Opt. Express 16:17052, 2008; Serebryannikov et al., Phys. Rev. E (Stat. Nonlinear Soft Matter Phys.) 70:66611, 2004; Serebryannikov et al., Opt. Lett. 33:977, 2008; Zhang et al., Nat. Phys. 3

  2. Microcontroller based system for electrical breakdown time delay measurement in gas-filled devices

    International Nuclear Information System (INIS)

    This paper presents realization of a digital embedded system for measuring electrical breakdown time delay. The proposed system consists of three major parts: dc voltage supply, analog subsystem, and a digital subsystem. Any dc power source with the range from 100 to 1000 V can be used in this application. The analog subsystem should provide fast and accurate voltage switching on the testing device as well as transform the signals that represent the voltage pulse on the device and the device breakdown into the form suitable for detection by a digital subsystem. The insulated gate bipolar transistor IRG4PH40KD driven by TC429 MOSFET driver is used for high voltage switching on the device. The aim of a digital subsystem is to detect the signals from the analog subsystem and to measure the elapsed time between their occurrences. Moreover, the digital subsystem controls various parameters that influence time delay and provides fast data storage for a large number of measured data. For this propose, we used the PIC18F4550 microcontroller with a full-speed compatible universal serial bus (USB) engine. Operation of this system is verified on different commercial and custom made gas devices with different structure and breakdown mechanisms. The electrical breakdown time delay measurements have been carried out as a function of several parameters, which dominantly influence electrical breakdown time delay. The obtained results have been verified using statistical methods, and they show good agreement with the theory. The proposed system shows good repeatability, sensitivity, and stability for measuring the electrical breakdown time delay.

  3. Microcontroller based system for electrical breakdown time delay measurement in gas-filled devices.

    Science.gov (United States)

    Pejović, Milić M; Denić, Dragan B; Pejović, Momčilo M; Nešić, Nikola T; Vasović, Nikola

    2010-10-01

    This paper presents realization of a digital embedded system for measuring electrical breakdown time delay. The proposed system consists of three major parts: dc voltage supply, analog subsystem, and a digital subsystem. Any dc power source with the range from 100 to 1000 V can be used in this application. The analog subsystem should provide fast and accurate voltage switching on the testing device as well as transform the signals that represent the voltage pulse on the device and the device breakdown into the form suitable for detection by a digital subsystem. The insulated gate bipolar transistor IRG4PH40KD driven by TC429 MOSFET driver is used for high voltage switching on the device. The aim of a digital subsystem is to detect the signals from the analog subsystem and to measure the elapsed time between their occurrences. Moreover, the digital subsystem controls various parameters that influence time delay and provides fast data storage for a large number of measured data. For this propose, we used the PIC18F4550 microcontroller with a full-speed compatible universal serial bus (USB) engine. Operation of this system is verified on different commercial and custom made gas devices with different structure and breakdown mechanisms. The electrical breakdown time delay measurements have been carried out as a function of several parameters, which dominantly influence electrical breakdown time delay. The obtained results have been verified using statistical methods, and they show good agreement with the theory. The proposed system shows good repeatability, sensitivity, and stability for measuring the electrical breakdown time delay.

  4. Measurement of the viscosities of He, Ne and Ar for the determination of their gas – kinetic diameters.

    Directory of Open Access Journals (Sweden)

    P.N. Ekemezie

    2015-11-01

    Full Text Available The viscosities of He, Ne and Ar gases were measured using pressure transducer to obtain the pressure, time data. Using the viscosity of dry air at the measured 320C ambient temperature, the evacuation data (pressure, time were converted to viscosity values thus: He (1.03 x 10-4 poise, Ne (1.72 x 10-4 poise, and Ar (1.96 x 10-4 poise. Finally, the collision diameter of the gases were calculated using appropriate equations to obtain He (0.19nm, Ne (0.22nm, and Ar (0.33nm. The values obtained were compared with those of literature (He = 0.21nm, Ne = 0.24nm, Ar = 0.36nm. Since the values of collision diameter obtained in this experiment are in conformity with those obtained from literature, we can safely conclude that measurement of collision diameter can be used as a quality assay for gases.

  5. Computational modelling of the interaction of shock waves with multiple gas-filled bubbles in a liquid

    Science.gov (United States)

    Betney, M. R.; Tully, B.; Hawker, N. A.; Ventikos, Y.

    2015-03-01

    This study presents a computational investigation of the interactions of a single shock wave with multiple gas-filled bubbles in a liquid medium. This work illustrates how multiple bubbles may be used in shock-bubble interactions to intensify the process on a local level. A high resolution front-tracking approach is used, which enables explicit tracking of the gas-liquid interface. The collapse of two identical bubbles, one placed behind the other is investigated in detail, demonstrating that peak pressures in a two bubble arrangement can exceed those seen in single bubble collapse. Additionally, a parametric investigation into the effect of bubble separation is presented. It is found that the separation distance has a significant effect on both the shape and velocity of the main transverse jet of the second bubble. Extending this analysis to effects of relative bubble size, we show that if the first bubble is sufficiently small relative to the second, it may become entirely entrained in the second bubble main transverse jet. In contrast, if the first bubble is substantially larger than the second, it may offer it significant protection from the incident shock. This protection is utilised in the study of a triangular array of three bubbles, with the central bubble being significantly smaller than the outer bubbles. It is demonstrated that, through shielding of bubbles until later in the collapse process, pressures over five times higher than the maximum pressure observed in the single bubble case may be achieved. This corresponds to a peak pressure that is approximately 40 times more intense than the incident shock wave. This work has applications in a number of different fields, including cavitation erosion, explosives, targeted drug delivery/intensification, and shock wave lithotripsy.

  6. Portable optical frequency standard based on sealed gas-filled hollow-core fiber using a novel encapsulation technique

    DEFF Research Database (Denmark)

    Triches, Marco; Brusch, Anders; Hald, Jan

    2015-01-01

    of 5.3 kHz. The system is also assembled in a more compact and easy-to-use configuration (Plug&Play), showing comparable performance with previously published work. The real portability of this technology is proved by shipping the system to a collaborating laboratory, showing unchanged performance......A portable stand-alone optical frequency standard based on a gas-filled hollow-core photonic crystal fiber is developed to stabilize a fiber laser to the 13C2H2 P(16) (ν1 + ν3) transition at 1542 nm using saturated absorption. A novel encapsulation technique is developed to permanently seal...... the hollow-core fiber with easy light coupling, showing negligible pressure increase over two months. The locked laser shows a fractional frequency instability below 8 × 10−12 for an averaging time up to 104 s. The lock-point repeatability over one month is 2.6 × 10−11, corresponding to a standard deviation...

  7. Understanding fast neutrons utilizing a water Cherenkov detector and a gas-filled detector at the soudan underground laboratory

    Science.gov (United States)

    Ghimire, Chiranjibi

    Many experiments are currently searching for Weakly Interactive Massive Particles (WIMPs), a well-motivated class of hypothetical dark matter candidates. These direct dark matter detection experiments are located in deep underground to shield from cosmic-ray muons and the fast neutrons they produce. Fast neutrons are particularly dangerous to WIMP detectors because they can penetrate a WIMP-search experiment's neutron shielding. Once inside, these fast neutrons can interact with high-Z material near the WIMP detector, producing slower neutrons capable of mimicking the expected WIMP signal. My research uses two detectors located in Soudan Underground Laboratory to understand fast neutron production by muons in an underground environment: a water-Cherenkov detector sensitive to fast neutrons; and a gas-filled detector sensitive to charged particles like muons. The different kinds of selection criterion and their efficiencies are reported in this thesis. This thesis estimate the number of high energy neutron-like candidates associated with a nearby muon by using data from both detector systems.

  8. Experimental tests of Rayleigh-Taylor stabilization mechanisms with long pulse gas-filled halfraums on OMEGA

    Science.gov (United States)

    Casner, A.; Huser, G.; Vandenboomgaerde, M.; Liberatore, S.; Masse, L.; Galmiche, D.

    2008-11-01

    Mitigation of Rayleigh-Taylor instabilities growth is a key issue on the road toward ignition. The graded doped ablator is a common concept for NIF [1] and LMJ [2] point designs. A complementary stabilization mechanism based on anisotropic thermal diffusion was theoretically underlined [3] for the ablative Rayleigh-Taylor instability. We will present the first ever experimental tests of these mechanisms. Indirect drive experiments were performed on the OMEGA laser facility with a long-pulse platform. We used in fact gas-filled halfraums and stack 15 drive beams along 2 cones to create a 7 ns long radiation drive. Halfraum energetics with E-IDI-300 phase plates was validated by dedicated shots along P5/P8 and is fairly reproduced by the simulations. These drive measurements allowed also to determine the graded doped planar emulator whose layers thicknesses and composition should be carefully optimized . Side-on and face-on data acquired with germanium-doped plastic samples (modulations wavelength 35 and 50 microns) will be presented and compared with FCI2 hydrocodes simulations. [1] S.W. Haan et al., Phys. Plasmas 12, 056316 (2005). [2] C C-Cl'erouin et al 2008 J. Phys.: Conf. Ser. 112 022023 [3] L. Masse., Phys. Rev. Lett. 98, 245001 (2007).

  9. Studies of implosion dynamics of D3He gas-filled plastic targets using nuclear diagnostics at OMEGA

    International Nuclear Information System (INIS)

    Information about target-implosion dynamics is essential for understanding how assembly occurs. Without carefully tailored assembly of the fuel, hot-spot ignition on National Ignition Facility (NIF) will fail. Hot spot ignition relies on shock convergence to 'ignite' the hot spot (shock burn), followed by propagation of the burn into the compressed shell material (compressive burn). The relationship between these events must be understood to ensure the success of Inertial Confinement Fusion (ICF) ignition. To further improve our knowledge about the timing of these events, temporal evolution of areal density (density times radius, normally referred to as ρR) and burn of direct-drive, D3He gas-filled plastic target implosions have been studied using dd neutrons and d3He protons. The proton temporal diagnostic (PTD) code was developed for this purpose. ρR asymmetries were observed at shock-bang time (time of peak burn during shock phase) and grew approximately twice as fast as the average ρR, without any phase changes. Furthermore, it was observed that the shock-bang and compression-bang time occur earlier, and that the time difference between these events decreases for higher laser energy on target, which indicates that the compression-bang time is more sensitive to the variation of laser energy on target. It was also observed that the duration of shock and compression phase might decrease for higher laser energy on target

  10. A velocity map imaging study of gold-rare gas complexes: Au-Ar, Au-Kr, and Au-Xe

    Science.gov (United States)

    Hopkins, W. Scott; Woodham, Alex P.; Plowright, Richard J.; Wright, Timothy G.; Mackenzie, Stuart R.

    2010-06-01

    The ultraviolet photodissociation dynamics of the gold-rare gas atom van der Waals complexes (Au-RG, RG=Ar, Kr, and Xe) have been studied by velocity map imaging. Photofragmentation of Au-Ar and Au-Kr at several wavelengths permits extrapolation to zero of the total kinetic energy release (TKER) spectra as monitored in the Au(P23/2∘[5d106p]) fragment channel, facilitating the determination of ground state dissociation energies of D0″(Au-Ar)=149±13 cm-1 and D0″(Au-Kr)=240±19 cm-1, respectively. In the same spectral region, transitions to vibrational levels of an Ω'=1/2 state of the Au-Xe complex result in predissociation to the lower Au(P21/2∘[5d106p])+Xe(S10[5p6]) fragment channel for which TKER extrapolation yields a value of D0″(Au-Xe)=636±27 cm-1. Asymmetric line shapes for transitions to the v'=14 level of this state indicate coupling to the Au(P23/2∘[5d106p])+Xe(S10[5p6]) continuum, which allows us to refine this value to D0″(Au-Xe)=607±5 cm-1. The dissociation dynamics of this vibrational level have been studied at the level of individual isotopologues by fitting the observed excitation spectra to Fano profiles. These fits reveal a remarkable variation in the predissociation dynamics for different Au-Xe isotopologues. For Au-Ar and Au-Xe, the determined ground state dissociation energies are in good agreement with recent theoretical calculations; the agreement of the Au-Kr value with theory is less satisfactory.

  11. Ars Electronica

    DEFF Research Database (Denmark)

    Kristensen, Thomas Bjørnsten

    2009-01-01

    Anmeldelse af Ars Electronica festivalen 3. - 8. september, 2009 i Linz, Østrig, der fejrede 30 års jubilæum under temaet "Human Nature". Festivalen fokuserer på interaktion mellem menneske, teknologi, kunst og samfund med særlig vægt på udviklingen af computeren og det digitale. Udgivelsesdato: 15.12...

  12. Dependence of charge collection distributions and dose on the gas type filling the ionization chamber for a p(66)Be(49) clinical neutron beam

    International Nuclear Information System (INIS)

    Measurements of central axis depth charge distributions (CADCD) in a p(66)Be(49) clinical neutron beam using A-150 TE plastic ionization chambers (IC) have shown that these distributions are dependent on the gas type filling the ICs. IC volumes from 0.1 to 8 cm3 and nine different gases were investigated. Off axis ratios and build-up measurements do not seem to be as sensitive to gas type. The gas dosimetry constants given in the AAPM Protocol for Neutron Beam Dosimetry for air and methane based TE gases were tested for consistency in water and in TE solution filled phantoms at depths of 10 cm, when used in conjunction with an IC having 5 mm thick walls of A-150. 29 refs., 7 figs., 1 tab

  13. Angle-resolved photoemission spectroscopy with 9-eV photon-energy pulses generated in a gas-filled hollow-core photonic crystal fiber

    International Nuclear Information System (INIS)

    A recently developed source of ultraviolet radiation, based on optical soliton propagation in a gas-filled hollow-core photonic crystal fiber, is applied here to angle-resolved photoemission spectroscopy (ARPES). Near-infrared femtosecond pulses of only few μJ energy generate vacuum ultraviolet radiation between 5.5 and 9 eV inside the gas-filled fiber. These pulses are used to measure the band structure of the topological insulator Bi2Se3 with a signal to noise ratio comparable to that obtained with high order harmonics from a gas jet. The two-order-of-magnitude gain in efficiency promises time-resolved ARPES measurements at repetition rates of hundreds of kHz or even MHz, with photon energies that cover the first Brillouin zone of most materials

  14. Angle-resolved photoemission spectroscopy with 9-eV photon-energy pulses generated in a gas-filled hollow-core photonic crystal fiber

    CERN Document Server

    Bromberger, H; Belli, F; Liu, H; Calegari, F; Chavez-Cervantes, M; Li, M T; Lin, C T; Abdolvand, A; Russell, P St J; Cavalleri, A; Travers, J C; Gierz, I

    2015-01-01

    A recently developed source of ultraviolet radiation, based on optical soliton propagation in a gas-filled hollow-core photonic crystal fiber, is applied here to angle-resolved photoemission spectroscopy (ARPES). Near-infrared femtosecond pulses of only few {\\mu}J energy generate vacuum ultraviolet (VUV) radiation between 5.5 and 9 eV inside the gas-filled fiber. These pulses are used to measure the band structure of the topological insulator Bi2Se3 with a signal to noise ratio comparable to that obtained with high order harmonics from a gas jet. The two-order-of-magnitude gain in efficiency promises time-resolved ARPES measurements at repetition rates of hundreds of kHz or even MHz, with photon energies that cover the first Brillouin zone of most materials.

  15. Angle-resolved photoemission spectroscopy with 9-eV photon-energy pulses generated in a gas-filled hollow-core photonic crystal fiber

    Energy Technology Data Exchange (ETDEWEB)

    Bromberger, H., E-mail: Hubertus.Bromberger@mpsd.mpg.de; Liu, H.; Chávez-Cervantes, M.; Gierz, I. [Max Planck Institute for the Structure and Dynamics of Matter, Luruper Chaussee 149, 22761 Hamburg (Germany); Ermolov, A.; Belli, F.; Abdolvand, A.; Russell, P. St. J.; Travers, J. C. [Max Planck Institute for the Science of Light, Günther-Scharowsky-Str. 1, 91058 Erlangen (Germany); Calegari, F. [Max Planck Institute for the Structure and Dynamics of Matter, Luruper Chaussee 149, 22761 Hamburg (Germany); Institute for Photonics and Nanotechnologies, IFN-CNR, Piazza Leonardo da Vinci 32, I-20133 Milano (Italy); Li, M. T.; Lin, C. T. [Max Planck Institute for Solid State Research, Heisenbergstr. 1, 70569 Stuttgart (Germany); Cavalleri, A. [Max Planck Institute for the Structure and Dynamics of Matter, Luruper Chaussee 149, 22761 Hamburg (Germany); Clarendon Laboratory, Department of Physics, University of Oxford, Parks Rd. Oxford OX1 3PU (United Kingdom)

    2015-08-31

    A recently developed source of ultraviolet radiation, based on optical soliton propagation in a gas-filled hollow-core photonic crystal fiber, is applied here to angle-resolved photoemission spectroscopy (ARPES). Near-infrared femtosecond pulses of only few μJ energy generate vacuum ultraviolet radiation between 5.5 and 9 eV inside the gas-filled fiber. These pulses are used to measure the band structure of the topological insulator Bi{sub 2}Se{sub 3} with a signal to noise ratio comparable to that obtained with high order harmonics from a gas jet. The two-order-of-magnitude gain in efficiency promises time-resolved ARPES measurements at repetition rates of hundreds of kHz or even MHz, with photon energies that cover the first Brillouin zone of most materials.

  16. Density of atoms in Ar*(3p{sup 5}4s) states and gas temperatures in an argon surfatron plasma measured by tunable laser spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Huebner, S.; Carbone, E. A. D.; Mullen, J. J. A. M. van der [Department of Applied Physics, Eindhoven University of Technology, P.O. Box 513, 5600MB Eindhoven (Netherlands); Sadeghi, N. [LIPhy, Universite Joseph Fourier and CNRS, UMR 5588, Grenoble F-38041 (France)

    2013-04-14

    This study presents the absolute argon 1 s (in Paschens's notation) densities and the gas temperature, T{sub g}, obtained in a surfatron plasma in the pressure range 0.65gas pressures of p<10 mbar, changes to a Voigt shape at p>10 mbar, for which the pressure broadening can no more be neglected. T{sub g} is in the range of 480-750 K, increasing with pressure and decreasing with the distance from the microwave launcher. Taking into account the line of sight effects of the absorption measurements, a good agreement is found with our previous measurements by Rayleigh scattering of T{sub g} at the tube center. In the studied pressure range, the Ar(4 s) atom densities are in the order of 10{sup 16}-10{sup 18} m{sup -3}, increasing towards the end of the plasma column, decreasing with the pressure. In the low pressure side, a broad minimum is found around 10Ar(4 s) atom densities increase slightly with rising pressure. For the studied pressure range and all axial positions, the density ratio: 1s{sub 5}/1s{sub 4}/1s{sub 3} is very close to a Boltzmann equilibrium by electron impact mixing at the local T{sub e}, which was previously measured by Thomson scattering. The Ar(4 s) densities are successfully compared to a detailed Collisional Radiative Model.

  17. Investigations on Ni-Co-Mn-Sn thin films: Effect of substrate temperature and Ar gas pressure on the martensitic transformations and exchange bias properties

    International Nuclear Information System (INIS)

    We report the effect of substrate temperature (TS) and Ar gas pressure (PD) on the martensitic transformations, magnetic and exchange bias (EB) properties in Heusler type Ni-Co-Mn-Sn epitaxial thin films. Martensitic transformation temperatures and EB fields at 5 K were found to increase with increasing TS. The observed maximum EB value of 320 Oe after field cooling in the film deposited at 650 ∘C is high among the values reported for Ni-Mn-Sn thin films which is attributed to the coexistence of ferromagnetic (FM) and antiferromagnetic (AF) phases in the martensitic state. In the case of PD variation, with increase in PD, martensitic transformation temperatures were increased and a sharp transformation was observed in the film deposited at 0.06 mbar. Magnetization values at 5 K were higher for increasing PD. These observations are attributed to the compositional shift. EB effect is also present in these films. Microstructural features observed using atomic force microscopy (AFM) shows a fine twinning and reduced precipitation with increase in PD, which is also confirmed from the scanning electron microscopy (SEM) images. EB effects in both series were confirmed from the training effect. Target ageing effect has been observed in the films deposited before and after ninety days of time interval. This has been confirmed both on substrate temperature and Ar gas pressure variations

  18. Multistage plasma initiation process by pulsed CO2 laser irradiation of a Ti sample in an ambient gas (He, Ar, or N2)

    Science.gov (United States)

    Hermann, J.; Boulmer-Leborgne, C.; Mihailescu, I. N.; Dubreuil, B.

    1993-02-01

    New experimental results are reported on plasma initiation in front of a titanium sample irradiated by ir (λ=10.6 μm) laser pulses in an ambient gas (He, Ar, and N2) at pressures ranging from several Torr up to the atmosphere. The plasma is studied by space- and time-resolved emission spectroscopy, while sample vaporization is probed by laser-induced fluorescence spectroscopy. Threshold laser intensities leading to the formation of a plasma in the vapor and in the ambient gases are determined. Experimental results support the model of a vaporization mechanism for the plasma initiation (vaporization-initiated plasma breakdown). The plasma initiation is described by simple numerical criteria based on a two-stage process. Theoretical predictions are found to be in a reasonable agreement with the experiment. This study provides also a clear explanation of the influence of the ambient gas on the laser beam-metal surface energy transfer. Laser irradiation always causes an important vaporization when performed in He, while in the case of Ar or N2, the interaction is reduced in heating and vaporization of some surface defects and impurities.

  19. Late-time radiography of beryllium ignition-target ablators in long-pulse gas-filled hohlraums

    International Nuclear Information System (INIS)

    A multiple-laboratory campaign is underway to qualify beryllium as a fusion capsule ablator for the National Ignition Facility [Moses and Wuest, Fusion Sci. Technol. 43, 420 (2003)]. Although beryllium has many advantages over other ablator materials, individual crystals of beryllium have anisotropic properties, e.g., sound speed, elastic constants, and thermal expansion coefficients, which may seed hydrodynamic instabilities during the implosion phase of ignition experiments. Experiments based on modeling have begun at the OMEGA laser [Boehly, McCrory, Verdon et al., Fusion Eng. Design 44, 35 (1999)] to create a test bed for measuring instability growth rates with face-on radiography of perturbed beryllium samples with the goal of establishing a specification for microstructure in beryllium used as an ablator. The specification would include the size and distribution of sizes of grains and voids and the impurity content. The experimental platform is a 4 kJ laser-heated (for ∼6 ns) hohlraum that is well modeled for radiation temperature and for shock pressure and breakout timing through the driven beryllium sample. A 1 atm methane gas fill has been used to maintain a clear line of sight through the hohlraum for radiography with acceptable plasma backscatter losses. The peak radiation temperature is 145 eV; the pressure early in the laser pulse is 1 Mbar for over 1 ns. Radiographs of sinusoidally perturbed copper-doped (0.9% by atom) beryllium samples have been obtained more than 10 ns after drive initiation. With the current laser drive, a growth factor approaching ten has been measured for initial 2.5 μm perturbations with on-axis radiography

  20. Analysis of the insulation characteristics of CF3I gas mixtures with Ar, Xe, He, N2, and CO2 using Boltzmann equation method

    Science.gov (United States)

    Deng, Yunkun; Xiao, Dengming

    2014-09-01

    The present study is devoted to the calculation of electron swarm parameters, including the reduced effective ionization coefficient, electron mean energy, and electron drift velocity, for the gas mixtures of CF3I with Ar, Xe, He, N2, and CO2. These data are computed by employing the Boltzmann equation method with two-term approximation in the condition of steady-state Townsend (SST) discharge. For the purpose of evaluating the insulation strength of CF3I gas mixtures, values of the limiting field strength (E/N)lim for which the ionization exactly balances the electron attachment are determined from the variation curves of (α - η)/N. The results indicate that mixtures of CF3I-N2 present the greatest insulation strength among all the combinations for CF3I content varied from 20 to 90%. Furthermore, the gas mixture with 70% CF3I can achieve a very similar dielectric strength to that of SF6. The concerned liquefaction issues are also taken into account to fully assess the possibility of applying CF3I gas mixtures in power equipment as an insulation medium.

  1. Pore- and fracture-filling gas hydrate reservoirs in the Gulf of Mexico Gas Hydrate Joint Industry Project Leg II Green Canyon 955 H well

    Science.gov (United States)

    Lee, M.W.; Collett, T.S.

    2012-01-01

    High-quality logging-while-drilling (LWD) downhole logs were acquired in seven wells drilled during the Gulf of MexicoGasHydrateJointIndustryProjectLegII in the spring of 2009. Well logs obtained in one of the wells, the GreenCanyon Block 955Hwell (GC955-H), indicate that a 27.4-m thick zone at the depth of 428 m below sea floor (mbsf; 1404 feet below sea floor (fbsf)) contains gashydrate within sand with average gashydrate saturations estimated at 60% from the compressional-wave (P-wave) velocity and 65% (locally more than 80%) from resistivity logs if the gashydrate is assumed to be uniformly distributed in this mostly sand-rich section. Similar analysis, however, of log data from a shallow clay-rich interval between 183 and 366 mbsf (600 and 1200 fbsf) yielded average gashydrate saturations of about 20% from the resistivity log (locally 50-60%) and negligible amounts of gashydrate from the P-wave velocity logs. Differences in saturations estimated between resistivity and P-wave velocities within the upper clay-rich interval are caused by the nature of the gashydrate occurrences. In the case of the shallow clay-rich interval, gashydrate fills vertical (or high angle) fractures in rather than fillingpore space in sands. In this study, isotropic and anisotropic resistivity and velocity models are used to analyze the occurrence of gashydrate within both the clay-rich and sand dominated gas-hydrate-bearing reservoirs in the GC955-Hwell.

  2. Ionization-induced asymmetric self-phase modulation and universal modulational instability in gas-filled hollow-core photonic crystal fibers

    CERN Document Server

    Saleh, Mohammed F; Travers, John C; Russell, Philip St J; Biancalana, Fabio

    2012-01-01

    We study theoretically the propagation of relatively long pulses with ionizing intensities in a hollow-core photonic crystal fiber filled with a Raman-inactive gas. Due to photoionization, previously unknown types of asymmetric self-phase modulation and `universal' modulational instabilities existing in both normal and anomalous dispersion regions appear. We also show that it is possible to spontaneously generate a plasma-induced continuum of blueshifting solitons, opening up new possibilities for pushing supercontinuum generation towards shorter and shorter wavelengths.

  3. The size and structure of the laser entrance hole in gas-filled hohlraums at the National Ignition Facility

    Energy Technology Data Exchange (ETDEWEB)

    Schneider, M. B., E-mail: schneider5@llnl.gov; MacLaren, S. A.; Widmann, K.; Meezan, N. B.; Hammer, J. H.; Yoxall, B. E.; Bell, P. M.; Benedetti, L. R.; Bradley, D. K.; Callahan, D. A.; Dewald, E. L.; Döppner, T.; Eder, D. C.; Edwards, M. J.; Hinkel, D. E.; Hsing, W. W.; Kervin, M. L.; Landen, O. L.; Lindl, J. D.; May, M. J. [Lawrence Livermore National Laboratory, P.O. Box 808, Livermore, California 94550 (United States); and others

    2015-12-15

    At the National Ignition Facility, a thermal X-ray drive is created by laser energy from 192 beams heating the inside walls of a gold cylinder called a “hohlraum.” The x-ray drive heats and implodes a fuel capsule. The laser beams enter the hohlraum via laser entrance holes (LEHs) at each end. The LEH radius decreases as heated plasma from the LEH material blows radially inward but this is largely balanced by hot plasma from the high-intensity region in the center of the LEH pushing radially outward. The x-ray drive on the capsule is deduced by measuring the time evolution and spectra of the x-radiation coming out of the LEH and correcting for geometry and for the radius of the LEH. Previously, the LEH radius was measured using time-integrated images in an x-ray band of 3–5 keV (outside the thermal x-ray region). For gas-filled hohlraums, the measurements showed that the LEH radius is larger than that predicted by the standard High Flux radiation-hydrodynamic model by about 10%. A new platform using a truncated hohlraum (“ViewFactor hohlraum”) is described, which allows time-resolved measurements of the LEH radius at thermal x-ray energies from two views, from outside the hohlraum and from inside the hohlraum. These measurements show that the LEH radius closes during the low power part of the pulse but opens up again at peak power. The LEH radius at peak power is larger than that predicted by the models by about 15%–20% and does not change very much with time. In addition, time-resolved images in a >4 keV (non-thermal) x-ray band show a ring of hot, optically thin gold plasma just inside the optically thick LEH plasma. The structure of this plasma varies with time and with Cross Beam Energy Transfer.

  4. New Empirical Potential Energy Functions for the Heavier Homonuclear Rare Gas Pairs: {Ne}_2, {Ar}_2, {Kr}_2, and {Xe}_2

    Science.gov (United States)

    Myatt, Philip Thomas; Baker, Matthew T.; Kang, Ju-Hee; Escobar Moya, Andres; McCourt, Frederick R. W.; Le Roy, Robert J.

    2016-06-01

    The many decades of work on determining accurate analytic pair potentials for rare gas dimers from experimental data focussed largely on the use of bulk non-ideal gas and collisional properties, with the use of spectroscopic data being somewhat of an afterthought, for testing the resulting functions. This was a natural result of experimental challenges, as the very weak binding of ground-state rare gas pairs made high resolution spectroscopy a relatively late arrival as a practical tool in this area. However, we believe that it is now time for a comprehensive reassessment. Following up on a preliminary report at this meeting five years ago, this paper describes work to determine a new generation of empirical potential energy functions for the four heavier (i.e., not involving He) homonuclear rare gas pairs from direct fits to all available spectroscopic, pressure virial, and acoustic virial coefficient data, with the resulting functions being `tuned' by comparisons with available thermal transport property data: viscosity, mass diffusion and thermal diffusion, and thermal conductivity data, and tested against the best available ab initio potentials. The resulting functions are everywhere smooth and differentiable to all orders, incorporate the correct (damped) theoretical inverse-power long-range behaviour, and have sensible short-range extrapolation behaviour. R.J. Le Roy, C.J.W. Mackie, P. Chandrasekhar and K.M. Sentjens, ``Accurate New Potential Energy Functions From Spectroscopic and Virial Coefficient Data for the Ten Rare Gas Pairs formed from Ne, Ar, Kr and Xe, paper MF03 at the 66th Ohio State University International Symposium on Molecular Spectroscopy, Columbus, Ohio, June 13-17 (2011).

  5. Effect of glow DBD modulation on gas and thin film chemical composition: case of Ar/SiH4/NH3 mixture

    International Nuclear Information System (INIS)

    In recent years, atmospheric pressure plasma-enhanced chemical vapour deposition has been identified as a convenient way to deposit good quality thin films. With this type of process, where the gas mixture is injected on one side of the electrodes, the chemical composition of the gas evolves with the gas residence time in the plasma. The consequence is a possible gradient in the chemical composition over the thickness of in-line coatings. The present work shows that the modulation of the plasma with a square signal significantly reduces this gradient while the drawback of low growth rate is avoided by increasing the discharge power. This study deals with plane/plane glow dielectric barrier discharges (DBDs) in an Ar/NH3/SiH4 gas mixture to make thin films. The 50 kHz discharge power of the glow DBD was varied by increasing voltage and modulating excitation. The impact on (i) the plasma development was observed through emission spectroscopy and (ii) the thin film coating through Fourier transform infrared measurements. It is shown that the modulation significantly decreases the time and the energy needed to achieve stable chemistry, enhances secondary chemistry and limits disturbance induced by impurities because of a slower decrease of SiH4 concentration and thus a higher ratio of SiH4/impurities, all very important points for in-line AP-PECVD development. When the growth rate is limited by diffusion, coating growth continues when the discharge is off, so long as there is a precursor gradient between the surface and the gas bulk. A higher discharge power steepens this gradient, which enhances diffusion from the bulk and thus growth rate. (paper)

  6. Gas isotopic signatures (He, C, and Ar) in the Lake Kivu region (western branch of the East African rift system): Geodynamic and volcanological implications

    Science.gov (United States)

    Tedesco, D.; Tassi, F.; Vaselli, O.; Poreda, R. J.; Darrah, T.; Cuoco, E.; Yalire, M. M.

    2010-01-01

    On 17 January 2002, the city of Goma was partly destroyed by two of the several lava flows erupted from a roughly N-S oriented fracture system opened along the southern flank of Mount Nyiragongo (Democratic Republic of Congo), in the western branch of the East African rift system. A humanitarian and scientific response was promptly organized by international, governmental, and nongovernmental agencies coordinated by the United Nations and the European Union. Among the different scientific projects undertaken to study the mechanisms triggering this and possible future eruptions, we focused on the isotopic (He, C, and Ar) analysis of the magmatic-hydrothermal and cold gas discharges related to the Nyiragongo volcanic system, the Kivu and Virunga region. The studied area includes the Nyiragongo volcano, its surroundings, and peripheral areas inside and outside the rift. They have been subdivided into seven regions characterized by distinct 3He/4He (expressed as R/Rair) ratios and/or δ13C-CO2 values. The Nyiragongo summit crater fumaroles, whose R/Rair and δ13C-CO2 values are up to 8.73 and from -3.5‰ to -4.0‰ VPDB, respectively, show a clear mantle, mid-ocean ridge basalt (MORB)-like contribution. Similar mantle-like He isotopic values (6.5-8.3 R/Rair) are also found in CO2-rich gas emanations (mazukus) along the northern shoreline of Lake Kivu main basin, whereas the 13δC-CO2 values range from -5.3‰ to -6.8‰ VPDB. The mantle influence progressively decreases in (1) dissolved gases of Lake Kivu (2.6-5.5 R/Rair) and (2) the distal gas discharges within and outside the two sides of the rift (from 0.1 to 1.7 R/Rair). Similarly, δ13C-CO2 ratios of the peripheral gas emissions are lighter (from -5.9‰ to -11.6‰ VPDB) than those of the crater fumaroles. Therefore, the spatial distribution of He and C signatures in the Lake Kivu region is mainly produced by mixing of mantle-related (e.g., Nyiragongo crater fumaroles and/or mazukus gases) and crustal-related (e

  7. Corrosion behavior of Hastelloy-N alloys in molten salt fluoride in Ar gas or in air

    International Nuclear Information System (INIS)

    The effects of air on the corrosion of Hastelloy-N alloys in molten salt coolant containing fission product elements were investigated to determine the safety of structural materials in high-temperature reactors cooled with fluoride salt. Corrosion tests of Hastelloy-N in the molten fluoride salt FLiNaK in an alumina crucible and a graphite crucible under argon gas or air were performed at 773–923 K for 100 h. The depth of corrosive attack, as well as the extent of chromium and molybdenum depletion, increased with increasing temperature. The extent of Hastelloy-N corrosion in molten salt under air was significantly greater than under argon gas. The effect of adding the impurity cesium iodide to molten salt containing nuclear waste fuel on the corrosion behavior was negligible. (author)

  8. Laser propagation in a gas-filled target with 0.53 and 0.35 μm at various electron densities on Nova

    International Nuclear Information System (INIS)

    Thin-walled gas-filled targets have been irradiated with the Nova laser in order to measure laser propagation into a gas to form a plasma with electron density ranging from 0.05--0.25 nc. The targets consist of a thin (0.6--1.0 μm) polyimide skin that is stretched across the two faces of a washer, and then inflated to hold 1 atmosphere of gas. The experiments were done with ≤ 1 atmosphere of neopentane (3 mg/cm3). Additional shots were done to propagate a Nova beam into a preformed plasma by using two opposing beams with a relative delay. Peak laser irradiance on the target was varied from 3 x 1014 to 6 x 1015 W/cm2. The beam propagation into the gas was measured from streaked and gated x-ray images taken normal to the direction of laser propagation. Plasma temperature was measured spectroscopically with dopants in the gas-fill mixture. The effect of phase plates and SSD on beam propagation into the gas were studied using an f/4 and an f/8 laser beam on Nova. Lateral heat flow was also measured from the gated x-ray imaging. The propagation of the laser burn-front is compared to LASNEX calculations. A mm-scale plasma is created at approximately 1--1.5 keV with 2--3 kJ of laser energy delivered to the target in a 1 ns square-profile pulse

  9. Spectrum Blueshifting of Ultrashort UV Laser Pulse Induced by Ionization of Supersonic He and Ar Gas Jets

    Institute of Scientific and Technical Information of China (English)

    YAN Lixin; ZHANG Yongsheng; LIU Jingru; HUANG Wenhui; TANG Chuanxiang; CHENG Jianping

    2008-01-01

    The predominant spectral blueshifting of a sub-picosecond UV laser pulse induced by ultrafast ionization of noble gases was investigated. Spectral measurements were made at various gas densities. Typical quasi-periodic structures in the blueshifted spectrum were obtained. The observations were in connection with the so-called self-phase modulation of laser pulses in the ultrafast ionization process which was simply simulated with an ADK (Ammosov-Delone-Krainov) ionization model. Some quantitative information can be deduced from the measurements and calculations.

  10. Raman-free, noble-gas-filled PCF source for ultrafast, very bright twin-beam squeezed vacuum

    CERN Document Server

    Finger, Martin A; Joly, Nicolas Y; Chekhova, Maria V; Russell, Philip St J

    2015-01-01

    We report a novel source of twin beams based on modulational instability in high-pressure argon-filled hollow-core kagom\\'e-style photonic-crystal fibre. The source is Raman-free and manifests strong photon-number correlations for femtosecond pulses of squeezed vacuum with a record brightness of ~2500 photons per mode. The ultra-broadband (~50 THz) twin beams are frequency tunable and contain one spatial and less than 5 frequency modes.

  11. Pulsed discharge production Ar* metastables

    Science.gov (United States)

    Han, Jiande; Heaven, Michael C.; Emmons, Daniel; Perram, Glen P.; Weeks, David E.; Bailey, William F.

    2016-03-01

    The production of relatively high densities of Ar* metastables (>1012 cm-3) in Ar/He mixtures, at total pressures close to 1 atm, is essential for the efficient operation of an optically pumped Ar* laser. We have used emission spectroscopy and diode laser absorption spectroscopy measurements to observe the production and decay of Ar* in a parallel plate pulsed discharge. With discharge pulses of 1 μs duration we find that metastable production is dominated by processes occurring within the first 100 ns of the gas break-down. Application of multiple, closely spaced discharge pulses yields insights concerning conditions that favor metastable production. This information has been combined with time-resolved measurements of voltage and current. The experimental results and preliminary modeling of the discharge kinetics are presented.

  12. Enfoque “Aprendizaje Basado en Proyectos” para enseñar sistemas de potencia de gas y vapor

    Directory of Open Access Journals (Sweden)

    Asier Aranzábal

    2014-12-01

    Full Text Available El objetivo de este trabajo es presentar la experiencia y los resultados derivados de la aplicación del método Aprendizaje Basado en Proyectos (PBL en la asignatura Termotecnia de la Titulación de Ingeniería Química de la Universidad del País Vasco/Euskal Herriko Unibertsitatea, para aprender sistemas de potencia de gas y vapor. Tras un análisis crítico de los resultados académicos de los alumnos que aprenden estos sistemas, se observa que la estrategia de enseñanza-aprendizaje tradicional, basada en clases “magistrales + clases de aplicación en una lista de ejercicios (totalmente acotados y con una solución única, estaba fallando. Ante esta situación se plantea un enfoque constructivista centrado en el alumno para que él mismo construya su aprendizaje activa y cooperativamente, y no escuchando clases magistrales, ni memorizando.

  13. Dramatic Raman Gain Suppression in the Vicinity of the Zero Dispersion Point in Gas-Filled Hollow-Core Photonic Crystal Fiber

    CERN Document Server

    Bauerschmidt, Sebastian T; Russell, Philip St J

    2015-01-01

    In 1964 Bloembergen and Shen predicted that Raman gain could be suppressed if the rates of phonon creation and annihilation (by inelastic scattering) exactly balance. This is only possible if the momentum required for each process is identical, i.e., phonon coherence waves created by pump-to-Stokes scattering are identical to those annihilated in pump-to-anti-Stokes scattering. In bulk gas cells, this can only be achieved over limited interaction lengths at an oblique angle to the pump axis. Here we report a simple system that provides dramatic Raman gain suppression over long collinear path-lengths in hydrogen. It consists of a gas-filled hollow-core photonic crystal fiber whose zero dispersion point is pressure-adjusted to lie close to the pump laser wavelength. At a certain precise pressure, generation of Stokes light in the fundamental mode is completely suppressed, allowing other much weaker nonlinear processes to be explored.

  14. Mechanism and computational model for Lyman-{alpha}-radiation generation by high-intensity-laser four-wave mixing in Kr-Ar gas

    Energy Technology Data Exchange (ETDEWEB)

    Louchev, Oleg A.; Saito, Norihito; Wada, Satoshi [Advanced Science Institute, RIKEN, 2-1 Hirosawa, Wako, Saitama, 351-0198 (Japan); Bakule, Pavel [STFC, ISIS Facility, Rutherford Appleton Laboratory, Chilton, Oxfordshire OX11 0QX (United Kingdom); Yokoyama, Koji [Advanced Science Institute, RIKEN, 2-1 Hirosawa, Wako, Saitama, 351-0198 (Japan); Advanced Meson Science Laboratory, RIKEN Nishina Center, RIKEN, Wako, Saitama 351-0198 (Japan); Ishida, Katsuhiko; Iwasaki, Masahiko [Advanced Meson Science Laboratory, RIKEN Nishina Center, RIKEN, Wako, Saitama 351-0198 (Japan)

    2011-09-15

    We present a theoretical model combined with a computational study of a laser four-wave mixing process under optical discharge in which the non-steady-state four-wave amplitude equations are integrated with the kinetic equations of initial optical discharge and electron avalanche ionization in Kr-Ar gas. The model is validated by earlier experimental data showing strong inhibition of the generation of pulsed, tunable Lyman-{alpha} (Ly-{alpha}) radiation when using sum-difference frequency mixing of 212.6 nm and tunable infrared radiation (820-850 nm). The rigorous computational approach to the problem reveals the possibility and mechanism of strong auto-oscillations in sum-difference resonant Ly-{alpha} generation due to the combined effect of (i) 212.6-nm (2+1)-photon ionization producing initial electrons, followed by (ii) the electron avalanche dominated by 843-nm radiation, and (iii) the final breakdown of the phase matching condition. The model shows that the final efficiency of Ly-{alpha} radiation generation can achieve a value of {approx}5x10{sup -4} which is restricted by the total combined absorption of the fundamental and generated radiation.

  15. Mechanism and computational model for Lyman-α-radiation generation by high-intensity-laser four-wave mixing in Kr-Ar gas

    Science.gov (United States)

    Louchev, Oleg A.; Bakule, Pavel; Saito, Norihito; Wada, Satoshi; Yokoyama, Koji; Ishida, Katsuhiko; Iwasaki, Masahiko

    2011-09-01

    We present a theoretical model combined with a computational study of a laser four-wave mixing process under optical discharge in which the non-steady-state four-wave amplitude equations are integrated with the kinetic equations of initial optical discharge and electron avalanche ionization in Kr-Ar gas. The model is validated by earlier experimental data showing strong inhibition of the generation of pulsed, tunable Lyman-α (Ly-α) radiation when using sum-difference frequency mixing of 212.6 nm and tunable infrared radiation (820-850 nm). The rigorous computational approach to the problem reveals the possibility and mechanism of strong auto-oscillations in sum-difference resonant Ly-α generation due to the combined effect of (i) 212.6-nm (2+1)-photon ionization producing initial electrons, followed by (ii) the electron avalanche dominated by 843-nm radiation, and (iii) the final breakdown of the phase matching condition. The model shows that the final efficiency of Ly-α radiation generation can achieve a value of ˜5×10-4 which is restricted by the total combined absorption of the fundamental and generated radiation.

  16. Understanding the amorphous-to-microcrystalline silicon transition in SiF{sub 4}/H{sub 2}/Ar gas mixtures

    Energy Technology Data Exchange (ETDEWEB)

    Dornstetter, Jean-Christophe [TOTAL New Energies, 24 cours Michelet, 92069 Paris La Défense Cedex (France); LPICM-CNRS, Ecole Polytechnique, 91128 Palaiseau (France); Bruneau, Bastien; Bulkin, Pavel; Johnson, Erik V.; Roca i Cabarrocas, Pere [LPICM-CNRS, Ecole Polytechnique, 91128 Palaiseau (France)

    2014-06-21

    We report on the growth of microcrystalline silicon films from the dissociation of SiF{sub 4}/H{sub 2}/Ar gas mixtures. For this growth chemistry, the formation of HF molecules provides a clear signature of the amorphous to microcrystalline growth transition. Depositing films from silicon tetrafluoride requires the removal of F produced by SiF{sub 4} dissociation, and this removal is promoted by the addition of H{sub 2} which strongly reacts with F to form HF molecules. At low H{sub 2} flow rates, the films grow amorphous as all the available hydrogen is consumed to form HF. Above a critical flow rate, corresponding to the full removal of F, microcrystalline films are produced as there is an excess of atomic hydrogen in the plasma. A simple yet accurate phenomenological model is proposed to explain the SiF{sub 4}/H{sub 2} plasma chemistry in accordance with experimental data. This model provides some rules of thumb to achieve high deposition rates for microcrystalline silicon, namely, that increased RF power must be balanced by an increased H{sub 2} flow rate.

  17. Ar-Ar_Redux: rigorous error propagation of 40Ar/39Ar data, including covariances

    Science.gov (United States)

    Vermeesch, P.

    2015-12-01

    Rigorous data reduction and error propagation algorithms are needed to realise Earthtime's objective to improve the interlaboratory accuracy of 40Ar/39Ar dating to better than 1% and thereby facilitate the comparison and combination of the K-Ar and U-Pb chronometers. Ar-Ar_Redux is a new data reduction protocol and software program for 40Ar/39Ar geochronology which takes into account two previously underappreciated aspects of the method: 1. 40Ar/39Ar measurements are compositional dataIn its simplest form, the 40Ar/39Ar age equation can be written as: t = log(1+J [40Ar/39Ar-298.5636Ar/39Ar])/λ = log(1 + JR)/λ Where λ is the 40K decay constant and J is the irradiation parameter. The age t does not depend on the absolute abundances of the three argon isotopes but only on their relative ratios. Thus, the 36Ar, 39Ar and 40Ar abundances can be normalised to unity and plotted on a ternary diagram or 'simplex'. Argon isotopic data are therefore subject to the peculiar mathematics of 'compositional data', sensu Aitchison (1986, The Statistical Analysis of Compositional Data, Chapman & Hall). 2. Correlated errors are pervasive throughout the 40Ar/39Ar methodCurrent data reduction protocols for 40Ar/39Ar geochronology propagate the age uncertainty as follows: σ2(t) = [J2 σ2(R) + R2 σ2(J)] / [λ2 (1 + R J)], which implies zero covariance between R and J. In reality, however, significant error correlations are found in every step of the 40Ar/39Ar data acquisition and processing, in both single and multi collector instruments, during blank, interference and decay corrections, age calculation etc. Ar-Ar_Redux revisits every aspect of the 40Ar/39Ar method by casting the raw mass spectrometer data into a contingency table of logratios, which automatically keeps track of all covariances in a compositional context. Application of the method to real data reveals strong correlations (r2 of up to 0.9) between age measurements within a single irradiation batch. Propertly taking

  18. Development of VUV wavelength shifter for the use with a visible light photodetector in noble gas filled detectors

    Energy Technology Data Exchange (ETDEWEB)

    Akimov, D.Yu., E-mail: akimov_d@itep.ru [State Scientific Centre of Russian Federation Institute for Theoretical and Experimental Physics (ITEP), 25 Bolshaya Cheremushkinskaya street, 117218 Moscow (Russian Federation); Akindinov, A.V.; Alexandrov, I.S.; Belov, V.A. [State Scientific Centre of Russian Federation Institute for Theoretical and Experimental Physics (ITEP), 25 Bolshaya Cheremushkinskaya street, 117218 Moscow (Russian Federation); Borshchev, O.V. [Enikolopov Institute of Synthetic Polymer Materials, Russian Academy of Science, 70 Profsoyuznaya street, 117393 Moscow (Russian Federation); Burenkov, A.A.; Danilov, M.V.; Kovalenko, A.G. [State Scientific Centre of Russian Federation Institute for Theoretical and Experimental Physics (ITEP), 25 Bolshaya Cheremushkinskaya street, 117218 Moscow (Russian Federation); Luponosov, Y.N.; Ponomarenko, S.A. [Enikolopov Institute of Synthetic Polymer Materials, Russian Academy of Science, 70 Profsoyuznaya street, 117393 Moscow (Russian Federation); Stekhanov, V.N. [State Scientific Centre of Russian Federation Institute for Theoretical and Experimental Physics (ITEP), 25 Bolshaya Cheremushkinskaya street, 117218 Moscow (Russian Federation); Surin, N.M. [Enikolopov Institute of Synthetic Polymer Materials, Russian Academy of Science, 70 Profsoyuznaya street, 117393 Moscow (Russian Federation); Zav' yalov, S.A. [State Scientific Centre of Russian Federation Karpov Institute of Physical Chemistry, 10 Vorontsovo Pole street, 105064 Moscow (Russian Federation); Yablokov, M.Yu. [Enikolopov Institute of Synthetic Polymer Materials, Russian Academy of Science, 70 Profsoyuznaya street, 117393 Moscow (Russian Federation)

    2012-12-11

    Development study of a wavelength shifter (WLS) to convert a noble gas emission light from the VUV region to the visible range is presented. The shifter is developed for the use with an array of blue-sensitive multipixel avalanche Geiger photodiodes (MRS APD) to detect Xe 175 nm emission. It was found that a polycrystalline p-terphenyl having an absorption peak at 180 nm with a molar extinction coefficient {epsilon} of 37500{+-}5000 mol{sup -1}{center_dot}l cm{sup -1} is well suited for this. To satisfy a requirement of compatibility with an extra pure noble gas detection medium the p-terphenyl layer was coated with an {approx}1 {mu}m thick poly-para-xylylene protection film. A new WLS with maximum of emission spectrum at 390 nm and at 420 nm is developed on the basis of a nanostructured organosilicon luminophore.

  19. Azaporphine guest-host complexes in solution and gas-phase: evidence for partially filled nanoprisms and exchange reactions

    OpenAIRE

    Weis, Patrick; Schwarz, Ulrike; Hennrich, Frank; Wagner, Danny; Bräse, Stefan; Kappes, Manfred

    2015-01-01

    Supramolecular guest-host complexes comprising various azaporphines stacked in a coordination nanoprism consisting of tris(4-pyridyl)triazines as panels{,} 1{,}4-bis(pyridyl)benzenes as pillars and (en)Pd as hinges were synthesized according to the procedure of Fujita and coworkers and characterized as ions in the gas-phase by high-resolution electrospray ionization mass spectrometry and collision induced dissociation as well as in solution by analytical ultracentrifugation. Apart from fully ...

  20. Performance of a gas flow ionization detector filled with He-iso-C{sub 4}H{sub 10} mixtures for STIM-T

    Energy Technology Data Exchange (ETDEWEB)

    Marques, A.C. [IST/IPFN, Universidade de Lisboa, Campus Tecnológico e Nuclear, E.N.10, 2695-066 Bobadela LRS (Portugal); Centro de Física Nuclear da Universidade de Lisboa, Av. Prof. Gama Pinto 2, 1649-003 Lisboa (Portugal); Fraga, M.M.F.R. [Laboratório de Instrumentação e Física Experimental de Partículas, 3004-516 Coimbra (Portugal); Departamento de Física, Universidade de Coimbra, 3004-516 Coimbra (Portugal); Fonte, P. [Laboratório de Instrumentação e Física Experimental de Partículas, 3004-516 Coimbra (Portugal); Instituto Superior de Engenharia de Coimbra, 3030-199 Coimbra (Portugal); Beasley, D.G. [IST/C2TN, Universidade de Lisboa, Campus Tecnológico e Nuclear, E.N.10, 2695-066 Bobadela LRS (Portugal); Cruz, C. [IST/IPFN, Universidade de Lisboa, Campus Tecnológico e Nuclear, E.N.10, 2695-066 Bobadela LRS (Portugal); Alves, L.C. [IST/C2TN, Universidade de Lisboa, Campus Tecnológico e Nuclear, E.N.10, 2695-066 Bobadela LRS (Portugal); Centro de Física Nuclear da Universidade de Lisboa, Av. Prof. Gama Pinto 2, 1649-003 Lisboa (Portugal); Silva, R.C. da [IST/IPFN, Universidade de Lisboa, Campus Tecnológico e Nuclear, E.N.10, 2695-066 Bobadela LRS (Portugal); Centro de Física Nuclear da Universidade de Lisboa, Av. Prof. Gama Pinto 2, 1649-003 Lisboa (Portugal)

    2015-04-01

    A cylindrical gas flow ionization chamber has been developed for measuring particle energy in Scanning Transmission Ion Microscopy Tomography (STIM-T) experiments due to its ability to withstand the direct beam. The response of a He-iso-C{sub 4}H{sub 10} filled ionization detector to 2 MeV H{sup +} and He{sup +} beams was studied. Different operating parameters, such as concentration of isobutane (in the range of 55–100%), anode voltage, amplifier shaping time, the geometry of the detector entrance canal and the solid angle of the detector, were investigated. The stable operating plateau and the anode voltage at which the best energy resolution is attained were also determined for every gas mixture. The best energy resolution achieved so far for 2 MeV H{sup +} and He{sup +} static beams was ∼1.3%, which is comparable to that of Si PIN diode detectors (in the range of 15–30 keV). Computed tomography (CT) was applied to a set of STIM projections acquired with the gas ionization chamber at the IST/CTN microprobe beam line in order to visualize the 3D-mass distribution in a test structure.

  1. Performance of a gas flow ionization detector filled with He-iso-C4H10 mixtures for STIM-T

    International Nuclear Information System (INIS)

    A cylindrical gas flow ionization chamber has been developed for measuring particle energy in Scanning Transmission Ion Microscopy Tomography (STIM-T) experiments due to its ability to withstand the direct beam. The response of a He-iso-C4H10 filled ionization detector to 2 MeV H+ and He+ beams was studied. Different operating parameters, such as concentration of isobutane (in the range of 55–100%), anode voltage, amplifier shaping time, the geometry of the detector entrance canal and the solid angle of the detector, were investigated. The stable operating plateau and the anode voltage at which the best energy resolution is attained were also determined for every gas mixture. The best energy resolution achieved so far for 2 MeV H+ and He+ static beams was ∼1.3%, which is comparable to that of Si PIN diode detectors (in the range of 15–30 keV). Computed tomography (CT) was applied to a set of STIM projections acquired with the gas ionization chamber at the IST/CTN microprobe beam line in order to visualize the 3D-mass distribution in a test structure

  2. Shaping frequency correlations of ultrafast pulse-pumped modulational instability in gas-filled hollow-core PCF

    CERN Document Server

    Finger, Martin A; Russell, Philip St J; Chekhova, Maria V

    2016-01-01

    We vary the time-frequency mode structure of ultrafast pulse-pumped modulational instability (MI) in an argon-filled hollow-core kagom\\'e-style PCF by adjusting the pressure, pump pulse chirp, fiber length and parametric gain. Compared to solid-core systems, the pressure dependent dispersion landscape brings increased flexibility to the tailoring of frequency correlations. The resulting mode content is characterized by measuring the multimode second-order correlation function g(2) and by directly observing frequency correlations in single-shot MI spectra. We show that, from such measurements, the shapes and weights of time-frequency Schmidt (TFS) modes can be extracted and that the number of modes directly influences the shot-to-shot pulse-energy and spectral-shape fluctuations in MI. Using this approach we are able to change the number of TFS modes from 1.3 (g(2) = 1.75) to 4 (g(2) = 1.25) using only a single fiber.

  3. The use of concomitant elements to evaluate an Ar-N{sub 2} mixed-gas plasma by electrothermal vaporization inductively coupled plasma orthogonal time-of-flight mass spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Balsanek, William J. [Department of Chemistry and Biochemistry, University of Texas at Austin, Austin, TX 78712 (United States); Ertas, Gulay [Department of Chemistry and Biochemistry, University of Texas at Austin, Austin, TX 78712 (United States); Holcombe, James A. [Department of Chemistry and Biochemistry, University of Texas at Austin, Austin, TX 78712 (United States)]. E-mail: holcombe@mail.utexas.edu

    2006-06-15

    The performance of an Ar-N{sub 2} mixed-gas plasma was compared to an Ar plasma using electrothermal vaporization as a sample introduction source to an inductively coupled plasma orthogonal time-of-flight mass spectrometer. The effect of sample matrices NaNO{sub 3} and Pd(NO{sub 3}){sub 2} on a multi-element solution was investigated in mass amounts ranging from 0.1 to 5 {mu}g of the metal matrix (e.g., Na and Pd). Addition of 2% N{sub 2} to the outer plasma gas of an Ar plasma reduced signal suppressions observed in the presence of high concentrations of Na and Pd at the expense of a large reduction in analyte sensitivity (ca. 83%). Signal profiles indicate that suppression may be caused, in part, by space charge effects that are dependent on the ion density of analyte and matrix ions. By reducing the magnitude of the signal from the N{sub 2}-free plasma by repositioning the torch away from the sampling cone, comparable immunity to excess matrix was observed when compared to a plasma with N{sub 2} included in the outer plasma gas.

  4. Direct comparative study on the energy level alignments in unoccupied/occupied states of organic semiconductor/electrode interface by constructing in-situ photoemission spectroscopy and Ar gas cluster ion beam sputtering integrated analysis system

    International Nuclear Information System (INIS)

    Through the installation of electron gun and photon detector, an in-situ photoemission and damage-free sputtering integrated analysis system is completely constructed. Therefore, this system enables to accurately characterize the energy level alignments including unoccupied/occupied molecular orbital (LUMO/HOMO) levels at interface region of organic semiconductor/electrode according to depth position. Based on Ultraviolet Photoemission Spectroscopy (UPS), Inverse Photoemission Spectroscopy (IPES), and reflective electron energy loss spectroscopy, the occupied/unoccupied state of in-situ deposited Tris[4-(carbazol-9-yl)phenyl]amine (TCTA) organic semiconductors on Au (ELUMO: 2.51 eV and EHOMO: 1.35 eV) and Ti (ELUMO: 2.19 eV and EHOMO: 1.69 eV) electrodes are investigated, and the variation of energy level alignments according to work function of electrode (Au: 4.81 eV and Ti: 4.19 eV) is clearly verified. Subsequently, under the same analysis condition, the unoccupied/occupied states at bulk region of TCTA/Au structures are characterized using different Ar gas cluster ion beam (Ar GCIB) and Ar ion sputtering processes, respectively. While the Ar ion sputtering process critically distorts both occupied and unoccupied states in UPS/IPES spectra, the Ar GCIB sputtering process does not give rise to damage on them. Therefore, we clearly confirm that the in-situ photoemission spectroscopy in combination with Ar GCIB sputtering allows of investigating accurate energy level alignments at bulk/interface region as well as surface region of organic semiconductor/electrode structure.

  5. Three sources and three components of success in detection of ultra-rare alpha decays at the Dubna Gas-Filled Recoil separator

    CERN Document Server

    Tsyganov, Y S

    2015-01-01

    General philosophy of procedure of detecting rare events in the recent experiments with 48Ca projectile at the Dubna Gas-Filled Recoil Separator(DGFRS) aimed to the synthesis of superheavy elements (SHE) has been reviewed. Specific instruments and methods are under consideration. Some historical sources of the successful experiments for Z=112-118 are considered too. Special attention is paid to application of method of active correlations in heavy-ion induced complete fusion nuclear reactions. Example of application in Z=115 experiment is presented. Brief description of the 243Am + 48Ca -> 291-x115+xn experiment is presented too. Some attention is paid to the role of chemical experiments in discoveries of SHEs. The DGFRS detection/monitoring system is presented in full firstly.

  6. Simulation of electron beam formation and transport in a gas-filled electron-optical system with a plasma emitter

    Science.gov (United States)

    Grishkov, A. A.; Kornilov, S. Yu.; Rempe, N. G.; Shidlovskiy, S. V.; Shklyaev, V. A.

    2016-07-01

    The results of computer simulations of the electron-optical system of an electron gun with a plasma emitter are presented. The simulations are performed using the KOBRA3-INP, XOOPIC, and ANSYS codes. The results describe the electron beam formation and transport. The electron trajectories are analyzed. The mechanisms of gas influence on the energy inhomogeneity of the beam and its current in the regions of beam primary formation, acceleration, and transport are described. Recommendations for optimizing the electron-optical system with a plasma emitter are presented.

  7. Standard practice for examination of Gas-Filled filament-wound composite pressure vessels using acoustic emission

    CERN Document Server

    American Society for Testing and Materials. Philadelphia

    2010-01-01

    1.1 This practice provides guidelines for acoustic emission (AE) examination of filament-wound composite pressure vessels, for example, the type used for fuel tanks in vehicles which use natural gas fuel. 1.2 This practice requires pressurization to a level equal to or greater than what is encountered in normal use. The tanks' pressurization history must be known in order to use this practice. Pressurization medium may be gas or liquid. 1.3 This practice is limited to vessels designed for less than 690 bar [10,000 psi] maximum allowable working pressure and water volume less than 1 m3 or 1000 L [35.4 ft3]. 1.4 AE measurements are used to detect emission sources. Other nondestructive examination (NDE) methods may be used to gain additional insight into the emission source. Procedures for other NDE methods are beyond the scope of this practice. 1.5 This practice applies to examination of new and in-service filament-wound composite pressure vessels. 1.6 This practice applies to examinations conducted at amb...

  8. Adsorbent filled membranes for gas separation. Part 1. Improvement of the gas separation properties of polymeric membranes by incorporation of microporous adsorbents

    NARCIS (Netherlands)

    Duval, J.-M.; Folkers, B.; Mulder, M.H.V.; Desgrandchamps, G.; Smolders, C.A.

    1993-01-01

    The effect of the introduction of specific adsorbents on the gas separation properties of polymeric membranes has been studied. For this purpose both carbon molecular sieves and zeolites are considered. The results show that zeolites such as silicate-1, 13X and KY improve to a large extent the separ

  9. Atmospheric pressure plasma produced inside a closed package by a dielectric barrier discharge in Ar/CO2 for bacterial inactivation of biological samples

    DEFF Research Database (Denmark)

    Chiper, Alina Silvia; Chen, Weifeng; Mejlholm, Ole;

    2011-01-01

    The generation and evaluation of a dielectric barrier discharge produced inside a closed package made of a commercially available packaging film and filled with gas mixtures of Ar/CO2 at atmospheric pressure is reported. The discharge parameters were analysed by electrical measurements and optical...... emission spectroscopy in two modes of operation: trapped gas atmosphere and flowing gas atmosphere. Gas temperature was estimated using the OH(A–X) emission spectrum and the rotational temperature reached a saturation level after a few minutes of plasma running. The rotational temperature was almost three...

  10. Revised error propagation of 40Ar/39Ar data, including covariances

    Science.gov (United States)

    Vermeesch, Pieter

    2015-12-01

    The main advantage of the 40Ar/39Ar method over conventional K-Ar dating is that it does not depend on any absolute abundance or concentration measurements, but only uses the relative ratios between five isotopes of the same element -argon- which can be measured with great precision on a noble gas mass spectrometer. The relative abundances of the argon isotopes are subject to a constant sum constraint, which imposes a covariant structure on the data: the relative amount of any of the five isotopes can always be obtained from that of the other four. Thus, the 40Ar/39Ar method is a classic example of a 'compositional data problem'. In addition to the constant sum constraint, covariances are introduced by a host of other processes, including data acquisition, blank correction, detector calibration, mass fractionation, decay correction, interference correction, atmospheric argon correction, interpolation of the irradiation parameter, and age calculation. The myriad of correlated errors arising during the data reduction are best handled by casting the 40Ar/39Ar data reduction protocol in a matrix form. The completely revised workflow presented in this paper is implemented in a new software platform, Ar-Ar_Redux, which takes raw mass spectrometer data as input and generates accurate 40Ar/39Ar ages and their (co-)variances as output. Ar-Ar_Redux accounts for all sources of analytical uncertainty, including those associated with decay constants and the air ratio. Knowing the covariance matrix of the ages removes the need to consider 'internal' and 'external' uncertainties separately when calculating (weighted) mean ages. Ar-Ar_Redux is built on the same principles as its sibling program in the U-Pb community (U-Pb_Redux), thus improving the intercomparability of the two methods with tangible benefits to the accuracy of the geologic time scale. The program can be downloaded free of charge from

  11. Determinação de volumes e pressões de balonetes de tubos traqueais insuflados com ar ambiente ou óxido nitroso Determinación de volúmenes y presiones de balones de tubos traqueales insuflados con aire ambiente u óxido nitroso Volume and pressure of tracheal tube cuffs filled with air or nitrous oxide

    Directory of Open Access Journals (Sweden)

    Ernesto Leonardo Cárpio Peña

    2004-06-01

    Full Text Available JUSTIFICATIVA E OBJETIVOS: A pressão exercida pelo balonete do tubo traqueal contra a parede da traquéia deve permitir fluxo capilar adequado e prevenir escapes de ar ou aspiração pulmonar. Esta pesquisa procurou determinar as variações de pressão do balonete insuflado com ar ambiente ou com óxido nitroso a 100%. MÉTODO: Trinta pacientes foram selecionados para receber anestesia geral balanceada com intubação orotraqueal. O balonete foi insuflado conforme critérios clínicos. As medidas de base foram realizadas após 15 minutos do início da anestesia com um manômetro aneróide calibrado em cm de H2O e forneceram os valores iniciais de pressão e volume. Os pacientes foram divididos em dois grupos: balonete reinsuflado com ar ambiente, grupo A, ou com óxido nitroso, grupo B. As medidas de pressão foram obtidas em intervalos até a primeira hora e os resultados comparados. RESULTADOS: Os grupos mostraram-se comparáveis para idade e sexo. Em ambos os grupos os valores basais médios para pressão foram próximos de 40 cmH2O com 8 ml de volume. No grupo com ar ambiente, as pressões aumentaram até 36 cmH2O em uma hora. No grupo de balonete insuflado com N2O, as pressões diminuíram abaixo de 20 cmH2O entre 20 e 30 minutos de anestesia. CONCLUSÕES: O uso de N2O a 100% para insuflação do balonete de sonda traqueal não constitui método seguro, acarretando progressiva perda da capacidade de vedação. O uso de ar ambiente promove aumento de volume e de pressão no balonete, aumentando possibilidade de lesão da mucosa traqueal.JUSTIFICATIVA Y OBJETIVOS: La presión ejercida por el balón del tubo traqueal contra la pared de la traquea debe permitir flujo capilar adecuado y prevenir escapes de aire o aspiración pulmonar. Esta pesquisa buscó determinar las variaciones de presión del balón insuflado con aire ambiente o con óxido nitroso a 100%. MÉTODO: Treinta pacientes fueron seleccionados para recibir anestesia general

  12. Ar + CO2 and He + CO2 Plasmas in ASTRAL

    Science.gov (United States)

    Boivin, R. F.; Gardner, A.; Munoz, J.; Kamar, O.; Loch, S.

    2007-11-01

    Spectroscopy study of the ASTRAL helicon plasma source running Ar + CO2 and He + CO2 gas mixes is presented. ASTRAL produces plasmas with the following parameters: ne = 10^10 - 10^13 cm-3, Te = 2 - 10 eV and Ti = 0.03 - 0.5 eV, B-field <= 1.3 kGauss, rf power <= 2 kWatt. A 0.33 m scanning monochromator is used for this study. Using Ar + CO2 gas mixes, very different plasmas are observed as the concentration of CO2 is changed. At low CO2 concentration, the bluish plasma is essentially atomic and argon transitions dominate the spectra. Weak C I and O I lines are present in the 750 - 1000 nm range. At higher CO2 concentration, the plasma becomes essentially molecular and is characterized by intense, white plasma columns. Here, spectra are filled with molecular bands (CO2, CO2^+, CO and CO^+). Limited molecular dissociative excitation processes associated with the production of C I and O I emission are also observed. On the other hand, He + CO2 plasmas are different. Here, rf matches are only possible at low CO2 concentration. Under these conditions, the spectra are characterized by strong C I and O I transitions with little or no molecular bands. Strong dissociative processes observed in these plasmas can be link to the high Te associated with He plasmas. An analysis of the spectra with possible scientific and industrial applications will be presented.

  13. Coupled cluster calculations of mean excitation energies of the noble gas atoms He, Ne and Ar and of the H2 molecule

    DEFF Research Database (Denmark)

    Sauer, Stephan P. A.; Haq, Inam U.; Sabin, John R.;

    2013-01-01

    Using an asymmetric-Lanczos-chain algorithm for the calculation of the coupled cluster linear response functions at the CCSD and CC2 levels of approximation, we have calculated the mean excitation energies of the noble gases He, Ne and Ar, and of the hydrogen molecule H2. Convergence with respect...

  14. Effects of shock pressure on 40Ar-39Ar radiometric age determinations

    International Nuclear Information System (INIS)

    The relation of shock to the drop in the 40*Ar/39*Ar ratio seen at high release temperatures in some neutron-irradiated lunar samples is investigated through measurements of the 40*Ar/39*Ar ratio in gas samples released by stepwise heating of rock samples previously subjected to shock, either in the laboratory or in nature. Explosives were used to shock solid pieces and powder of a basalt from a diabase dike in Liberia to calculated pressures of 65, 150 and 270 kbar. These, an unshocked sample of the powder, two naturally shocked samples from the Brent impact crater in Canada, one unshocked sample from near the crater, and appropriate monitors were irradiated. Ar from stepwise heating was analyzed. The unshocked basalt shows a good 40*Ar/39*Ar plateau at age 198 +-9 m.y. in agreement with a previous result of 186 +- 2 m.y. The shocked samples contain varying amounts of implanted atmospheric Ar, the isotopes of which have experienced mass fractionation. This effect is small enough in four samples so that the linearity of their graphs of 39*Ar/40Ar vs 36Ar/40Ar is evidence of a plateau. The ages of these samples are then 201 +- 10, 205 +- 12 and 201 +-9 m.y. It appears that the shock has had little effect on the 40Ar-39Ar age spectrum, although the release patterns of the 39*Ar are shifted downward by the order of 2000C. Shock implantation of Ar was at lower shock pressure, in the presence of less Ar, and into a less porous material than previously demonstrated. The Brent Crater samples do not all show good plateaus, but do indicate an age of 420 m.y. for the crater event and 795 +- 24 m.y. for the rock formation, in agreement with previous results. None of the 40*Ar/39*Ar profiles shows a drop at high temperature, but a possible role of shock implantation of Ar is indicated in the production of this effect. Further experiments are suggested. (author)

  15. Study of atmospheric pressure chemical vapor deposition by using a double discharge system for SiOx thin-film deposition with a HMDS/Ar/He/O2 gas mixture

    International Nuclear Information System (INIS)

    SiOx thin films were deposited at atmospheric pressure by using a double discharge system composed of a remote-type dielectric barrier discharge (DBD) formed above the substrate and a direct-type DBD formed by applying an AC power to the substrate with a gas mixture of hexamethyldisilazane (HMDS)/O2/He/Ar. Instead of using a single DBD, the use of the double discharge system not only showed higher SiOx thin film deposition rates but also produced fewer impurities in the deposited SiOx thin film. The improvement was partially related to the increased gas dissociation near the substrate through the direct-type DBD and to the remote-type DBD. A 7-kV, 30-kHz AC voltage was applied to the remote-type DBD and a 5-kV, 20-kHz AC voltage was applied to the direct-type DBD, with a gas mixture of HMDS (400 sccm)/O2 (20 slm)/He (5 slm)/Ar (3 slm). As a result, a SiOx deposition rate of 58.29 nm/scan could be obtained while moving the substrate at a speed of 0.25 meter/min.

  16. Effect of Different Filling Materials in Anammox Bacteria Enrichment

    Directory of Open Access Journals (Sweden)

    Dilek ÖZGÜN

    2012-12-01

    Full Text Available Purpose: Anaerobic ammonium oxidation (Anammox is a process that ammonium as electron donor is oxidized to nitrogen gas using nitrite as electron acceptor. Compared to conventional nitrification-denitrification processes, this process is used less oxygen and no organic material (methanol, glucose. However, the slow growth rate of Anammox bacteria (11-30 days is disadvantages. Therefore, batch reactors have been carried out in these bacteria enrichment. In this study continuously operated upflow anaerobic sludge reactor (UASB using different filling materials disposing of sensitive and slow-growing Anammox bacteria out of the system is purposed. Design and Methods: System is operated up-flow column reactor at 2 days hydraulic retention time (HRT in 45 days. In this study, ceramic stones and Linpor filling material are used. Using synthetic wastewater containing ammonium and nitrite, Ar/CO2 anaerobic conditions (95/5% supplied with gas. System is operated at a temperature 253 C in UASB. Temperature, pH, ammonia-nitrogen and nitrite nitrogen are measured. Results: Both filling material reactors are operated in 45 days. Ceramic stones filling reactor is observed quickly reaches 90% were used reactor ammonium removal. The ammonium nitrogen removal was slower in Linpor filling materials reactor. Nitrite removal is reached up to 90% in both the reactor. When compared to the stoichiometric equation in Linpor was composed of large amounts of nitrate. At the end of 25 days the results were similar to ceramic stone filling reactor with Linpor filling material reactors. Conclusions and Original Value: Anammox process as from nitrogen removal processes was discovered in 1995. Anammox bacteria that make up this process due to very low growth rates of microbial bacteria in the system must be kept in the system. Most of the studies in the literature, these bacteria enrichment stage is started instead of a continuous batch reactor system. In this study

  17. Theoretical Study of Decomposition Pathways for Rare-gas-containing Compounds HRgX (Rg = He, Ne, Ar, Kr; X = Cl, Br)

    Institute of Scientific and Technical Information of China (English)

    AI Chun-Zhi; SUN Ren-An; YAN Jie

    2005-01-01

    Eight species, HRgX (Rg = He, Ne, Ar, Kr; X = Cl, Br), are predicted to have bending transition states at B3PW91/AUG-cc-PVTZ level, leading to 2-body decomposition pathway like . The reaction path has been obtained with Intricate Reaction Coordinates (IRC) method on identical theoretical level. Additionally, the linear transition states of HArCl, HArBr, HKrCl and HKrBr were obtained at MP2/6-311++G (2d, 2p) level, resulting in 3-body dissociation channel as.

  18. Study on the Principle Mechanisms of Heat Transfer for Cryogenic Insulations: Especially Accounting for the Temperature-Dependent Deposition-Evacuation of the Filling Gas (Self-Evacuating Systems)

    Science.gov (United States)

    Geisler, Matthias; Vidi, Stephan; Ebert, Hans-Peter

    2016-11-01

    This study concentrates on the principles of heat transfer within cryogenic insulation systems, especially accounting for self-evacuating systems (deposition-evacuation of the filling gas). These principles allow the extrapolation to other temperatures, gases and other materials with the input of only a few experimentally derived or carefully estimated material properties. The type of gas (e.g. air or CO2) within the porous insulation material dominates the behaviour of the effective thermal conductivity during the cooldown of the cryogenic application. This is due to the specific temperature-dependent saturation gas pressure which determines the contribution of the gas conductivity. The selected material classes include powders, fibrous insulations, foams, aerogels and multilayer insulations in the temperature range of 20 K to 300 K. Novel within this study is an analytical function for the total and the mean thermal conductivity with respect to the temperature, type of gas, external pressure and material class of the insulation. Furthermore, the integral mean value of the thermal conductivity, the so-called mean thermal conductivity, is calculated for a mechanically evacuated insulation material and an insulation material evacuated by deposition-evacuation of the filling gas, respectively. This enables a comparison of the total thermal conductivity of cryogenic insulation materials and their applicability for a self-evacuating cryogenic insulation system.

  19. Dynamics of the spectral behaviour of an ultrashort laser pulse in an argon-gas-filled capillary discharge-preformed plasma channel

    Directory of Open Access Journals (Sweden)

    Sakai S.

    2013-11-01

    Full Text Available We have reported the argon plasma waveguide produced in an alumina (Al2O3 capillary discharge and used to guide ultrashort laser pulses at intensities of the order of 1016  W/cm2. A one-dimensional magnetohydrodynamic (MHD code was used to evaluate the average degree of ionization of Ar in the preformed plasma channel. The spectrum of the propagated laser pulse in the Ar plasma waveguide was not modified and was well reproduced by a particle-in-cell (PIC simulation under initial ion charge state of Ar3+ in the preformed plasma waveguide. The optimum timing for the laser pulse injection was around 150 ns after initiation of a discharge with a peak current of 200 A.

  20. Dynamics of the spectral behaviour of an ultrashort laser pulse in an argon-gas-filled capillary discharge-preformed plasma channel

    Science.gov (United States)

    Sakai, S.; Higashiguchi, T.; Yugami, N.; Bobrova, N.; Sentoku, Y.; Kodama, R.

    2013-11-01

    We have reported the argon plasma waveguide produced in an alumina (Al2O3) capillary discharge and used to guide ultrashort laser pulses at intensities of the order of 1016 W/cm2. A one-dimensional magnetohydrodynamic (MHD) code was used to evaluate the average degree of ionization of Ar in the preformed plasma channel. The spectrum of the propagated laser pulse in the Ar plasma waveguide was not modified and was well reproduced by a particle-in-cell (PIC) simulation under initial ion charge state of Ar3+ in the preformed plasma waveguide. The optimum timing for the laser pulse injection was around 150 ns after initiation of a discharge with a peak current of 200 A.

  1. Spatial evaluation of Ar-systematics in rocks from the British Channel Islands: a UV laserprobe Ar/Ar study of excess 40Ar

    Science.gov (United States)

    Schwenzer, S. P.; Sherlock, S.; Kelley, S. P.

    2010-12-01

    includes sericitization of the feldspars and chloritization of biotite. Ar-Ar investigations were carried out using high spatial resolution UV laser ablation gas release in combination with a NU instruments Noblesse gas mass spectrometer. This sensitive instrumentation allows for a spatial resolution of 80 to 140 µm spot size. Detailed Ar-Ar analysis shows large variability of ages and also correlation with K and Ca content of the spot (measureable as 37Ar, and 39Ar after irradiation). In quartz in some of the samples there is large amounts of excess 40Ar accompanied by high 38Ar/39Ar and low to non-measurable 37Ar concentrations. This indicates the presence of chlorine and excess 40Ar; and thus fluid inclusions in those quartz crystals may be the host for excess 40Ar. Our preliminary results give insights into the behaviour of the Ar system during and after emplacement of igneous rocks from the Cadomian Belt, and the interaction of different reservoirs within the rocks.

  2. Space-filling polyhedral sorbents

    Energy Technology Data Exchange (ETDEWEB)

    Haaland, Peter

    2016-06-21

    Solid sorbents, systems, and methods for pumping, storage, and purification of gases are disclosed. They derive from the dynamics of porous and free convection for specific gas/sorbent combinations and use space filling polyhedral microliths with facial aplanarities to produce sorbent arrays with interpenetrating interstitial manifolds of voids.

  3. Indium-tin oxide thin films deposited at room temperature on glass and PET substrates: Optical and electrical properties variation with the H{sub 2}–Ar sputtering gas mixture

    Energy Technology Data Exchange (ETDEWEB)

    Álvarez-Fraga, L.; Jiménez-Villacorta, F.; Sánchez-Marcos, J.; Andrés, A. de; Prieto, C., E-mail: cprieto@icmm.csic.es

    2015-07-30

    Highlights: • ITO deposition on glass and PET at room temperature by using H. • High transparency and low resistance is obtained by tuning the H. • The figure of merit for ITO films on PET becomes maximal for thickness near 100 nm. - Abstract: The optical and electrical properties of indium tin oxide (ITO) films deposited at room temperature on glass and polyethylene terephthalate (PET) substrates were investigated. A clear evolution of optical transparency and sheet resistance with the content of H{sub 2} in the gas mixture of H{sub 2} and Ar during magnetron sputtering deposition is observed. An optimized performance of the transparent conductive properties ITO films on PET was achieved for samples prepared using H{sub 2}/(Ar + H{sub 2}) ratio in the range of 0.3–0.6%. Moreover, flexible ITO-PET samples show a better transparent conductive figure of merit, Φ{sub TC} = T{sup 10}/R{sub S}, than their glass counterparts. These results provide valuable insight into the room temperature fabrication and development of transparent conductive ITO-based flexible devices.

  4. 39Ar-40Ar dating of mesosiderites: Evidence for major parent body disruption < 4 Ga ago

    International Nuclear Information System (INIS)

    39Ar-40Ar ages were measured on 17 samples of 14 different mesosiderites and indicate major degassing of Ar by one or more thermal events less than 4.0 Ga ago. Three samples gave release patterns of constant age, whereas the other samples typically showed 200-400 Ma increases in 39Ar-40Ar age with increasing gas extraction temperature. These stepwise releases indicate ages of ∼3.4-3.8 Ga; averaged ages for individual meteorites are 3.45-3.82 Ga. No substantial evidence exists in the temperature releases for 39Ar-40Ar ages older than 4.0 Ga, and the Ar ages appear to be in contradiction to 244Pu fission track ages previously reported for a few mesosiderites. We suggest that metal-silicate mixing occurred ∼4.4 Ga ago, but that a major collisional event disrupted the mesosiderite parent planet 500 degree C, and left them deeply buried to undergo slow cooling

  5. Strong magnetism observed in carbon nanoparticles produced by the laser vaporization of a carbon pellet in hydrogen-containing Ar balance gas.

    Science.gov (United States)

    Asano, Hirohito; Muraki, Susumu; Endo, Hiroki; Bandow, Shunji; Iijima, Sumio

    2010-08-25

    Nanometer-scale carbon particles driven by the pulsed-laser vaporization of pelletized pure carbon powder at 1000 °C in a hydrogen-containing environment show anomalous magnetism like a superparamagnet, while the sample prepared in 100% of Ar does not show such magnetism. The observed magnetism was unchanged over months in the ambient. The structure of this nanomaterial resembles the foam of a laundry detergent and transmission electron microscopy indicates a clear corrugated line contrast. On the other hand, a sample without strong magnetism does not give such an image contrast. The x-ray diffraction pattern coincides with that of graphite and no other peak is detected. Thermogravimetry indicates that all samples completely burn out up to approx. 820 °C and no material remains after combustion, indicating that the sample does not contain impurity metals. Magnetization is easily saturated by ∼10,000 G at 280 K with no hysteresis, but the hysteresis appears at 4.2 K. This phenomenon is explained by introducing a crystalline anisotropy which restricts the motion of the magnetic moment and stabilizes the remnant magnetization at zero magnetic field. Magnitudes of the saturation magnetization are in the range of 1-5 emu G g(-1) at 4.2 K, which correspond to 0.002-0.01 Bohr magneton per carbon atom. This concentration may be increased by ten times or more, because only about 4-10% of particles have a magnetic domain in the present samples.

  6. Tracking fluid action in Little Sark Pluton (Channel Islands, UK): a UV laserprobe Ar/Ar study of excess 40Ar

    Science.gov (United States)

    Schwenzer, S. P.; Schwanethal, J.; Tindle, A. G.; Kelley, S. P.; Sherlock, S. C.

    2011-12-01

    Little Sark pluton (Channel Islands, UK) is a weakly to moderately deformed pluton of quartz diorite composition. Zircon from Little Sark has been dated as 611.4(+2.1/-1.3) Ma [Miller et al. 1991, Tectonophysics, 312], whereas titanite has an age of 606.2±0.6 Ma. Hornblende yields an Ar-Ar age of 606.4±3.4 Ma [Dallmeyer et al., 1991, J. Geol. Soc. London 148]. The rocks show evidence for post-magmatic hydrous alteration including chloritisation of biotite, and sericite formation in feldspar. We investigated the alteration in order to understand its influence on the Ar-Ar system. Detailed petrographic investigations of two samples indicate different deformation levels - S1, (less deformed), and S2 (more deformed). The feldspar is andesine to oligoclase in composition, but contains K-rich areas with patchy and sometimes cleavage guided sericitization. Mafic minerals include hornblende and biotite (the latter partially chloritized). Ar-Ar investigations were carried out using high spatial resolution UV laser ablation gas release in combination with a Nu instruments Noblesse gas mass spectrometer using spots of 80 to 140 μm diameter. Mafic minerals in S1 have highly variable 38Ar/39Ar and 37Ar/39Ar ratios and unusually high atmospheric contents for such old samples, possibly reflecting the presence of fluid inclusions associated with the sericite, particularly in the feldspar. The apparent ages in their entirety range from 429 to 668 Ma. Hornblende yields homogeneous apparent ages, whereas the younger and older ages are measured in both micas and feldspars, whose apparent ages range from 245-670 Ma. The modal age for feldspar is around 400-450 Ma, but this may not have geological meaning. Sample S2 shows many of the same features as S1. Mafic minerals span a slightly smaller age range and feldspars display apparent ages of ~245-645 Ma with a mode around 480 Ma. The alteration of both samples appears to have been accompanied by the introduction of 40Ar-rich fluids

  7. Primary production and carbon export rates across the subpolar N. Atlantic Ocean basin based on triple oxygen isotope and dissolved O2 and Ar gas measurements

    Science.gov (United States)

    Quay, P.; Stutsman, J.; Steinhoff, T.

    2012-06-01

    Gross photosynthetic O2 production (GOP) rates in the subpolar North Atlantic Ocean were estimated using the measured isotopic composition of dissolved oxygen in the surface layer on samples collected on nine transits of a container ship between Great Britain and Canada during March 2007 to June 2008. The mean basin-wide GOP rate of 226 ± 48 mmol O2 m-2 d-1 during summer was double the winter rate of 107 ± 41 mmol O2 m-2 d-1. Converting these GOP rates to equivalent 14C-based PP (14C-PPeqv) yielded rates of 1005 ± 216 and 476 ± 183 mg C m-2 d-1 in summer and winter, respectively, that generally agreed well with previous 14C-based PP estimates in the region. The 14C-PPeqv estimates were 1-1.6× concurrent satellite-based PP estimates along the cruise track. A net community production rate (NCP) of 87 ± 12 mmol O2 m-2 d-1 (62 ± 9 mmol C m-2 d-1) and NCP/GOP of 0.35 ± 0.06 in the mixed layer was estimated from O2/Ar and 17Δ measurements (61°N 26°W) during spring bloom conditions in May 2008. Contrastingly, a much lower long-term annual mean NCP or organic carbon export rate of 2.8 ± 2.7 mol C m-2 yr-1 (8 ± 7 mmol C m-2 d-1) and NCP/GOP of 0.07 ± 0.06 at the winter mixed layer depth was estimated from 15 years of surface O2 data in the subpolar N. Atlantic collected during the CARINA program.

  8. The state dependence of the interaction of metastable rare gas atoms Rg sup * (ms sup 3 P sub 2 , sup 3 P sub 0 ) (Rg=Ne, Ar, Kr, Xe) with ground state sodium atoms

    Energy Technology Data Exchange (ETDEWEB)

    Schohl, S.; Mueller, M.W.; Meijer, H.A.J.; Ruf, M.W.; Hotop, H. (Kaiserslautern Univ. (Germany, F.R.). Fachbereich Physik); Morgner, H. (Witten-Herdecke Univ., Witten (Germany, F.R.). Inst. fuer Experimentalphysik)

    1990-08-01

    Using crossed beams of metastable rare gas atoms Rg{sup *}(ms {sup 3}P{sub 2}, {sup 3}P{sub 0}) (Rg=Ne, Ar, Kr, Xe) and ground state sodium atoms Na(3s {sup 2}S{sub 1/2}), we have measured the energy spectra of electrons released in the respective Penning ionization processes at thermal collision energies. For Rg{sup *}({sup 3}P{sub 2})+Na(3s), the spectra are quite similar for the different rare gases, both in width and shape; they reflect attractive interactions in the entrance channel with well depths D{sub e}{sup *} (meV) decreasing slowly from Rg=Ne to Xe as follows: 676(18); 602(23); 565(26); 555(30). For Rg{sup *}({sup 3}P{sub 0})+Na(3 s), the spectra vary strongly with the rare gas, indicating a change in the character of the interaction from van der Waals type attraction (Ne) to chemical binding for Kr and Xe with well depths D{sub e}{sup *} (meV) of: 51(19); 107(25); 432(30); 530(50). These findings are explained through model calculations of the respective potential curves, in which the exchange and the spin orbit interaction in the excited rare gas and the molecular interaction between the two valence s-electrons in terms of suitably chosen singlet and triplet potentials are taken into account. These calculations also explain qualitatively the experimental finding that the ratios q{sub 2}/q{sub 0} of the ionization cross sections for Rg{sup *}({sup 3}P{sub 2})+Na and Rg{sup *}({sup 3}P{sub 0})+Na vary strongly with the rare gas from Ne to Xe as follows: 15.8(3.2); 2.6(4); 1.4(2); 1.6(4). (orig.).

  9. Anionic chemistry of noble gases: formation of Mg-NG (NG = Xe, Kr, Ar) compounds under pressure.

    Science.gov (United States)

    Miao, Mao-Sheng; Wang, Xiao-Li; Brgoch, Jakoah; Spera, Frank; Jackson, Matthew G; Kresse, Georg; Lin, Hai-Qing

    2015-11-11

    While often considered to be chemically inert, the reactivity of noble gas elements at elevated pressures is an important aspect of fundamental chemistry. The discovery of Xe oxidation transformed the doctrinal boundary of chemistry by showing that a complete electron shell is not inert to reaction. However, the reductive propensity, i.e., gaining electrons and forming anions, has not been proposed or examined for noble gas elements. In this work, we demonstrate, using first-principles electronic structure calculations coupled to an efficient structure prediction method, that Xe, Kr, and Ar can form thermodynamically stable compounds with Mg at high pressure (≥125, ≥250, and ≥250 GPa, respectively). The resulting compounds are metallic and the noble gas atoms are negatively charged, suggesting that chemical species with a completely filled shell can gain electrons, filling their outermost shell(s). Moreover, this work indicates that Mg2NG (NG = Xe, Kr, Ar) are high-pressure electrides with some of the electrons localized at interstitial sites enclosed by the surrounding atoms. Previous predictions showed that such electrides only form in Mg and its compounds at very high pressures (>500 GPa). These calculations also demonstrate strong chemical interactions between the Xe 5d orbitals and the quantized interstitial quasiatom (ISQ) orbitals, including the strong chemical bonding and electron transfer, revealing the chemical nature of the ISQ. PMID:26488848

  10. Anionic chemistry of noble gases: formation of Mg-NG (NG = Xe, Kr, Ar) compounds under pressure.

    Science.gov (United States)

    Miao, Mao-Sheng; Wang, Xiao-Li; Brgoch, Jakoah; Spera, Frank; Jackson, Matthew G; Kresse, Georg; Lin, Hai-Qing

    2015-11-11

    While often considered to be chemically inert, the reactivity of noble gas elements at elevated pressures is an important aspect of fundamental chemistry. The discovery of Xe oxidation transformed the doctrinal boundary of chemistry by showing that a complete electron shell is not inert to reaction. However, the reductive propensity, i.e., gaining electrons and forming anions, has not been proposed or examined for noble gas elements. In this work, we demonstrate, using first-principles electronic structure calculations coupled to an efficient structure prediction method, that Xe, Kr, and Ar can form thermodynamically stable compounds with Mg at high pressure (≥125, ≥250, and ≥250 GPa, respectively). The resulting compounds are metallic and the noble gas atoms are negatively charged, suggesting that chemical species with a completely filled shell can gain electrons, filling their outermost shell(s). Moreover, this work indicates that Mg2NG (NG = Xe, Kr, Ar) are high-pressure electrides with some of the electrons localized at interstitial sites enclosed by the surrounding atoms. Previous predictions showed that such electrides only form in Mg and its compounds at very high pressures (>500 GPa). These calculations also demonstrate strong chemical interactions between the Xe 5d orbitals and the quantized interstitial quasiatom (ISQ) orbitals, including the strong chemical bonding and electron transfer, revealing the chemical nature of the ISQ.

  11. Singularity links with exotic Stein fillings

    OpenAIRE

    Özbağcı, Burak; Akhmedov, Anar

    2012-01-01

    arXiv:1206.2468v3 [math.GT] 14 May 2014 SINGULARITY LINKS WITH EXOTIC STEIN FILLINGS ANAR AKHMEDOV AND BURAK OZBAGCI ABSTRACT. In [4], it was shown that there exist infinitely many contact Seifert fibered 3-manifolds each of which admits infinitely many exotic (homeomorphic but pairwise non-diffeomorphic) simply-connected Stein fillings. Here we extend this result to a larger set of contact Seifert fibered 3-manifolds with many singular fibers and observe that these 3- ma...

  12. METAL INERT GAS WELDING OF 2519-T87 HIGH STRENGTH ALUMINUM ALLOY

    Institute of Scientific and Technical Information of China (English)

    XU Lianghong; TIAN Zhiling; ZHANG Xiaomu; PENG Yun

    2007-01-01

    20 mm thick plates of 2519-T87 high strength aluminum alloy have been welded. The effects of the compositions of filier wires, the heat input and the compositions of shielding gas on the mechanical properties and microstructure of the welded joint have been investigated. The results indicate that finer microstructure, better mechanical properties and higher value of hardness of HAZ can be obtained by using lower heat input. The use of Ar/He mixed shielding gas has several advantages over pure Ar shielding gas. With the increase of the proportion of He in the mixed shielding gas, the grain size of the weld metal as well as porosity susceptibility decreases. When the volume ratio of He to Ar reaches 7:3, the porosity and the grain size of weld metal reach the minimum, and the porosity can be further reduced by filling some CO2.

  13. Practical reactor production of {sup 41}Ar from argon clathrate

    Energy Technology Data Exchange (ETDEWEB)

    Mercer, J.R. E-mail: jmercer@pharmacy.ualberta.ca; Duke, M.J.M.; McQuarrie, S.A

    2000-06-01

    The radionuclide {sup 41}Ar has many ideal properties as a gas flow tracer. However, the modest cross-section of {sup 40}Ar for thermal neutron activation makes preparation of suitable activities of {sup 41}Ar technically difficult particularly for low flux reactors. Argon can however be trapped in a molecular complex called a clathrate that can then be irradiated. We prepared argon clathrate and explored its irradiation and stability characteristics. Argon clathrate can be used to provide gigabecquerel quantities of {sup 41}Ar even with low power reactors.

  14. Tunable coherent soft X-ray source based on the generation of high-order harmonic of femtosecond laser radiation in gas-filled capillaries

    International Nuclear Information System (INIS)

    We have carried out experimental and theoretical investigations of a tunable coherent soft X-ray radiation source in the 30 – 52 nm wavelength range based on the generation of high-order harmonics of femtosecond laser radiation propagating in a dielectric xenon-filled capillary. The long path of laser pulse propagation through the capillary permits tuning the generated harmonic wavelengths to almost completely span the range under consideration. (interaction of radiation with matter)

  15. The emission spectra of Ar, Kr and Xe + TEA

    Science.gov (United States)

    Suzuki, Masayo; Strock, Pierre; Sauli, Fabio; Charpak, Georges

    1987-03-01

    The emission spectra of Ar, Kr and Xe + 6% TEA gas mixtures are measured by using a single wire proportional counter as the emission source. Asymmetric emission bands are observed in the range of 270 to 350 nm, which can be attributed to the radiative deexcitation of excited TEA molecules. For the practical application of optical readout of avalanche chambers, the Ar + 2.0% TEA + 20% isobutane gas mixture is also examined, and nearly the same emission band is observed.

  16. ARS Biodiesel Research Initiatives

    Science.gov (United States)

    Biodiesel activities within ARS are concerned with the production, quality, and properties of this alternative fuel from agriculturally derived fats and oils. Currently, in the absence of tax incentives, biodiesel production when using refined fats and oils and conventional alkali transesterificati...

  17. ``Smoking From The Same Pipe": Developement of an 40Ar/39Ar Datting Intercalibration PIpette System (Invited)

    Science.gov (United States)

    Turrin, B. D.; Swisher, C. C.; Deino, A.; Hemming, S. R.; Hodges, K.; Renne, P. R.

    2010-12-01

    The precision and accuracy of Ar isotope ratio measurements is one of the main limiting factors in the uncertainties of an 40Ar/39Ar age. Currently, it is relatively common to measure Ar isotopic ratios to a precision of 1-2‰ or better on an intralaboratory basis. This level of analytical precision equates to a comparable level of precision (1-3‰) in the calculated age, depending on the extent of atmospheric Ar contamination, importance of nucleogenic interference corrections, and other factors. However, it has become clear that improving the precision of mass spectrometry is not the only bottleneck towards improving the accuracy and precision of 40Ar/39Ar dating in general. Rather, the most urgent issue is interlaboratory reproducibility. This became obvious in a recent EARTHTIME initiative undertaken to intercalibrate two commonly used 40Ar/39Ar standards [the Fish Canyon sanidine (FCs) and the Alder Creek sanidine (ACs)]. This effort revealed variations amongst laboratories (at the 1-2% level), an order of magnitude greater than the internal analytical precisions. To address these issues, we have proposed (to NSF) to construct two identical pipette systems loaded to identical starting pressures and with identical isotopic compositions. One pipette system will travel between participating 40Ar/39Ar labs and the second system will not travel and serve as the “Master” system to test for any fractionation or undocumented depletion of the traveling pipette system. In order to ensure delivery of uniform amounts of homogenous gas, the pipette system will be computer-controlled with preprogrammed routines and lockouts to prevent compromising the reservoirs. The pipette systems will deliver three gas samples with different isotopic ratios at two different pressures/concentrations. One pipette bulb will be of atmospheric isotopic composition, and the other two pipette bulbs will have 40Ar*/39ArK ratios corresponding to co-irradiated ACs and FCs fixed by their

  18. Hydrogen Filling Station

    Energy Technology Data Exchange (ETDEWEB)

    Boehm, Robert F; Sabacky, Bruce; Anderson II, Everett B; Haberman, David; Al-Hassin, Mowafak; He, Xiaoming; Morriseau, Brian

    2010-02-24

    Hydrogen is an environmentally attractive transportation fuel that has the potential to displace fossil fuels. The Freedom CAR and Freedom FUEL initiatives emphasize the importance of hydrogen as a future transportation fuel. Presently, Las Vegas has one hydrogen fueling station powered by natural gas. However, the use of traditional sources of energy to produce hydrogen does not maximize the benefit. The hydrogen fueling station developed under this grant used electrolysis units and solar energy to produce hydrogen fuel. Water and electricity are furnished to the unit and the output is hydrogen and oxygen. Three vehicles were converted to utilize the hydrogen produced at the station. The vehicles were all equipped with different types of technologies. The vehicles were used in the day-to-day operation of the Las Vegas Valley Water District and monitoring was performed on efficiency, reliability and maintenance requirements. The research and demonstration utilized for the reconfiguration of these vehicles could lead to new technologies in vehicle development that could make hydrogen-fueled vehicles more cost effective, economical, efficient and more widely used. In order to advance the development of a hydrogen future in Southern Nevada, project partners recognized a need to bring various entities involved in hydrogen development and deployment together as a means of sharing knowledge and eliminating duplication of efforts. A road-mapping session was held in Las Vegas in June 2006. The Nevada State Energy Office, representatives from DOE, DOE contractors and LANL, NETL, NREL were present. Leadership from the National hydrogen Association Board of Directors also attended. As a result of this session, a roadmap for hydrogen development was created. This roadmap has the ability to become a tool for use by other road-mapping efforts in the hydrogen community. It could also become a standard template for other states or even countries to approach planning for a hydrogen

  19. Hydrogen Filling Station

    Energy Technology Data Exchange (ETDEWEB)

    Boehm, Robert F; Sabacky, Bruce; Anderson II, Everett B; Haberman, David; Al-Hassin, Mowafak; He, Xiaoming; Morriseau, Brian

    2010-02-24

    Hydrogen is an environmentally attractive transportation fuel that has the potential to displace fossil fuels. The Freedom CAR and Freedom FUEL initiatives emphasize the importance of hydrogen as a future transportation fuel. Presently, Las Vegas has one hydrogen fueling station powered by natural gas. However, the use of traditional sources of energy to produce hydrogen does not maximize the benefit. The hydrogen fueling station developed under this grant used electrolysis units and solar energy to produce hydrogen fuel. Water and electricity are furnished to the unit and the output is hydrogen and oxygen. Three vehicles were converted to utilize the hydrogen produced at the station. The vehicles were all equipped with different types of technologies. The vehicles were used in the day-to-day operation of the Las Vegas Valley Water District and monitoring was performed on efficiency, reliability and maintenance requirements. The research and demonstration utilized for the reconfiguration of these vehicles could lead to new technologies in vehicle development that could make hydrogen-fueled vehicles more cost effective, economical, efficient and more widely used. In order to advance the development of a hydrogen future in Southern Nevada, project partners recognized a need to bring various entities involved in hydrogen development and deployment together as a means of sharing knowledge and eliminating duplication of efforts. A road-mapping session was held in Las Vegas in June 2006. The Nevada State Energy Office, representatives from DOE, DOE contractors and LANL, NETL, NREL were present. Leadership from the National hydrogen Association Board of Directors also attended. As a result of this session, a roadmap for hydrogen development was created. This roadmap has the ability to become a tool for use by other road-mapping efforts in the hydrogen community. It could also become a standard template for other states or even countries to approach planning for a hydrogen

  20. Getting a prescription filled

    Science.gov (United States)

    ... are located inside of a grocery or large "chain" store. It is best to fill all prescriptions ... be used for long-term medicines and medical supplies. The website should have clear directions for filling ...

  1. Tooth-Colored Fillings

    Science.gov (United States)

    ... past, teeth were filled with a mixture—or amalgam—of different metals. Today that is changing as more natural-looking and metal-free dental fillings are becoming the preferred approach. Dentists are ...

  2. Effect of Na Environment on growth rate of grain and nucleation of precipitate in F/M steel cladding under Sodium and Ar-gas environment at 650 .deg. C

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Tae Yong; Kim, Ji Hyun [Ulsan National Institute of Science and Technology, Ulsan (Korea, Republic of); Shin, Sang Hun [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2015-10-15

    During the design life time (30 to 60 years), the cladding and structural materials are exposed to liquid sodium and aged at the designed operation temperature. When cladding and structural materials exposed to high temperature liquid sodium, the constituents of the components dissolve and exist as various compounds. This can accelerate the dissolution of components into coolant or disrupt flow of coolant with cumulated obstacle in loop. This change can cause a degradation of mechanical strength of structure material and thermal efficiency of UCFR. Therefore, the thermochemical reaction research, on effects of liquid sodium on ferrite/martensite steel for a long time, should additionally be performed. The goal of this study is to investigate growth and nucleation of precipitates of ferrite/martensite steels in liquid sodium and its effect on grain growth. There are many changes such as Cr depletion, decarburization, segregation, precipitate and oxidation, affecting into microstructural evolution of the steels. In a specific procedure, the micro-structure and the surface phenomenon of ferrite/martensite steels that are exposed in liquid sodium at high temperature by using scanning electron microscope (SEM) and transmission electron microscope (TEM) have been investigated. After investigating precipitates formed at surface on liquid sodium and Ar-gas environments, the precipitates' Gibbs free energy is calculated with enthalpy and entropy included in the precipitates. Finally, the calculated values with diffusivity of components will become reason why the phases have different tendency on the growth rate of precipitates. As analyzing the chemical composition by TEM images, the correlation is investigated with supplementary materials. When Gr.92 is exposed to sodium containing oxygen, oxide is formed and there are depletion of Cr and presumably decarburization into sodium. So, the amount of M{sub 23}C{sub 6} is decreased. At Ar-gas environment, there is no

  3. Raman-Free, Noble-Gas-Filled Photonic-Crystal Fiber Source for Ultrafast, Very Bright Twin-Beam Squeezed Vacuum

    Science.gov (United States)

    Finger, Martin A.; Iskhakov, Timur Sh.; Joly, Nicolas Y.; Chekhova, Maria V.; Russell, Philip St. J.

    2015-10-01

    We report a novel source of twin beams based on modulational instability in high-pressure argon-filled hollow-core kagome-style photonic-crystal fiber. The source is Raman-free and manifests strong photon-number correlations for femtosecond pulses of squeezed vacuum with a record brightness of ˜2500 photons per mode. The ultra-broadband (˜50 THz ) twin beams are frequency tunable and contain one spatial and less than 5 frequency modes. The presented source outperforms all previously reported squeezed-vacuum twin-beam sources in terms of brightness and low mode content.

  4. Intermolecular polarizabilities in H{sub 2}-rare-gas mixtures (H{sub 2}–He, Ne, Ar, Kr, Xe): Insight from collisional isotropic spectral properties

    Energy Technology Data Exchange (ETDEWEB)

    Głaz, Waldemar, E-mail: glaz@kielich.amu.edu.pl; Bancewicz, Tadeusz [Nonlinear Optics Division, Faculty of Physics, Adam Mickiewicz University, Umultowska 85, 61-614 Poznań (Poland); Godet, Jean-Luc [Laboratoire de photonique d’Angers, Université d’Angers, 2 boulevard Lavoisier, 49045 Angers (France); Gustafsson, Magnus [Department of Chemistry and Molecular Biology, University of Gothenburg, SE 412 96 Gothenburg (Sweden); Maroulis, George; Haskopoulos, Anastasios [Department of Chemistry, University of Patras, GR-26500 Patras (Greece)

    2014-08-21

    The report presents results of theoretical and numerical analysis of the electrical properties related to the isotropic part of the polarizability induced by interactions within compounds built up of a hydrogen H{sub 2} molecule and a set of noble gas atoms, Rg, ranging from the least massive helium up to the heaviest xenon perturber. The Cartesian components of the collisional polarizabilities of the H{sub 2}–Rg systems are found by means of the quantum chemistry methods and their dependence on the intermolecular distance is determined. On the basis of these data, the spherical, symmetry adapted components of the trace polarizability are derived in order to provide data sets that are convenient for evaluating collisional spectral profiles of the isotropic polarized part of light scattered by the H{sub 2}–Rg mixtures. Three independent methods of numerical computing of the spectral intensities are applied at room temperature (295 K). The properties of the roto-translational profiles obtained are discussed in order to determine the role played by contributions corresponding to each of the symmetry adapted parts of the trace polarizability. By spreading the analysis over the collection of the H{sub 2}–Rg systems, evolution of the spectral properties with the growing masses of the supermolecular compounds can be observed.

  5. Ars Electronica tulekul / Rael Artel

    Index Scriptorium Estoniae

    Artel, Rael, 1980-

    2003-01-01

    6.-11. IX toimub Austrias Linzis "Ars Electronica" festival, mille teema on "Code - The Language of Our Time". Festivali kavast, osalejatest, ava-performance'ist "Europe - A Symphonic Vision", näitusest "Cyberarts 2003. Prix Ars Electronica"

  6. ARABIC LIGHT STEMMER (ARS

    Directory of Open Access Journals (Sweden)

    ASMA AL-OMARI

    2014-12-01

    Full Text Available Stemming is a main step used to process textual data. It is usually used in several types of applications such as: text mining, information retrieval (IR, and natural language processing (NLP. A major task in stemming is to standardize words; which can be achieved by reducing each word to its base (root or stem. Arabic stemming is not an easy task. Unlike other languages, Arabic language is a highly inflected language, since it uses many inflectional forms. Researchers are divided on the benefit of using stemming in fields of IR, NLP...etc., since in Arabic the morphological variants of a certain word are not always semantically related. The aim of this paper is to design and implement a new Arabic light stemmer (ARS which is not based on Arabic root patterns. Instead, it depends on well defined mathematical rules and several relations between letters. A series of tests were conducted on ARS stemmer to compare its effectiveness with the effectiveness of two other Arabic stemmers. Test shows clearly the effectiveness superiority of ARS compared to effectiveness of these two Arabic stemmers.

  7. Efeitos do pneumoperitônio com ar e CO2 na gasometria de suínos Effects of CO2 and air pneumoperitoneum on blood gas changes in pigs

    Directory of Open Access Journals (Sweden)

    Silvio Luis da Silveira Lemos

    2003-10-01

    Full Text Available OBJETIVO: O pneumoperitônio produz várias alterações na fisiologia humana. Algumas destas alterações, como hipercapnia e acidose, dependem ou são agravadas com o uso de CO2, tendo maior repercussão em pacientes com problema cardio-respiratório. A necessidade de uma melhor alternativa para insuflação da cavidade; a observação de que as cirurgias abertas, assim como as laparoscópicas com suspensão mecânica, são realizadas na presença de Ar ambiente; e a escassez de trabalhos testando o Ar em substituição ao CO2 para insuflação da cavidade, foram motivos para a realização deste trabalho. MÉTODOS: Vinte (0 suínos anestesiados foram submetidos a pneumoperitônio com 1 hora de duração. Os animais foram distribuídos em 4 grupos de 5 animais: Grupo A1 - Pneumoperitônio de Ar a 10 mmHg; Grupo A - Pneumoperitônio de Ar a 16 mmHg; Grupo B1 - Pneumoperitônio de CO2 a 10 mmHg; Grupo B - Pneumoperitônio de CO2 a 16 mmHg. O pneumoperitônio foi realizado pela técnica aberta com trocater de Hasson. Através de um cateter venoso central colhe-se amostra de sangue para exame de gasometria em 3 momentos. RESULTADOS: A análise da gasometria venosa não revelou alterações significativas entre os grupos em relação a PaO2 e a saturação do O2. Nos Grupos A1, A e B1 não foram observadas alterações no equilíbrio ácido-básico. No Grupo B após uma hora de pneumoperitônio houve nítida tendência a hipercapnia e acidose. CONCLUSÃO: O ar, com a técnica aberta de pneumoperitônio foi uma opção segura para insuflação de cavidade em procedimentos laparoscópicos diagnósticos de suínos.PURPOSE: The pneumoperitoneum causes several physiological alterations in humans. Some of these alterations, as hypercapnia and acidosis, are dependent on the use of CO2 or aggravated by its use, and affects mainly the patients with cardiopulmonary problems. The need for a better alternative of cavity insufflation; the observation that open

  8. Supercontinuum generation in the vacuum ultraviolet through dispersive-wave and soliton-plasma interaction in a noble-gas-filled hollow-core photonic crystal fiber

    Science.gov (United States)

    Ermolov, A.; Mak, K. F.; Frosz, M. H.; Travers, J. C.; Russell, P. St. J.

    2015-09-01

    We report on the generation of a three-octave-wide supercontinuum extending from the vacuum ultraviolet (VUV) to the near infrared, spanning at least 113-1000 nm (i.e., 11 -1.2 eV ), in He-filled hollow-core kagome-style photonic crystal fiber. Numerical simulations confirm that the main mechanism is an interaction between dispersive-wave emission and plasma-induced blue-shifted soliton recompression around the fiber zero dispersion frequency. The VUV part of the supercontinuum, the modeling of which proves to be coherent and possesses a simple phase structure, has sufficient bandwidth to support single-cycle pulses of 500 asec duration. We also demonstrate, in the same system, the generation of narrower-band VUV pulses through dispersive-wave emission, tunable from 120 to 200 nm with efficiencies exceeding 1 % and VUV pulse energies in excess of 50 nJ.

  9. Supercontinuum generation and tunable ultrafast emission in the vacuum ultraviolet using noble-gas-filled hollow-core photonic crystal fiber

    CERN Document Server

    Ermolov, Alexey; Frosz, Michael H; Travers, John C; Russell, Philip St J

    2015-01-01

    We report on the generation of a three-octave supercontinuum extending from the vacuum ultraviolet (VUV) to the near-infrared, spanning at least 113 to 1000 nm (i.e., 11 to 1.2 eV), in He-filled hollow-core kagome-style photonic crystal fiber. The same system also permits generation of narrower-band VUV radiation tunable from 113 to 200 nm with efficiencies exceeding 1% and VUV pulse energies in excess of 50 nJ. Modeling confirms that the mechanism involves soliton self-compression to sub-femtosecond pulse durations, dispersive-wave emission and the plasma-induced soliton self-frequency blue-shift. The bandwidth of the generated VUV light, which modeling shows to be coherent, is sufficient to support 500 as single-cycle pulses.

  10. 46 CFR 98.25-65 - Filling density.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Filling density. 98.25-65 Section 98.25-65 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) CARGO AND MISCELLANEOUS VESSELS SPECIAL... § 98.25-65 Filling density. (a) The filling density, or the percent ratio of the liquefied gas that...

  11. Study of gas amplification and first Townsend coefficient in parallel plate avalanche counter (PPAC) filled with pure isobutene by using heavy ions

    International Nuclear Information System (INIS)

    In this study by analyzing the PPAC pulse height at low pressures of iso-C4H10 gas (0.5-8.2 Torr) the following results were obtained: First, we described the Townsend coefficient over 171-526 (V/cm.torr) by employing the Brunner method and using O3+ ions. The applicability of these data to the other heavy ions was confirmed by 131 MeV Ne4+ ions. Our data are good agreement with the present data as well. Second, fig.6 shows that at lower pressures, by selecting proper operation condition, one can keep the energy loss approx. = 3 times less and reduced electric field approx. = 3 times higher without loss of pulse height. This is due to irregular behavior of the pulse height and was explained with a simple model of gas amplification. (author)

  12. Acoustic resonance spectroscopy (ARS): ARS300 operations manual, software version 2.01

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-07-25

    Acoustic Resonance Spectroscopy (ARS) is a nondestructive evaluation technology developed at the Los Alamos National Laboratory. The ARS technique is a fast, safe, and nonintrusive technique that is particularly useful when a large number of objects need to be tested. Any physical object, whether solid, hollow, or fluid filled, has many modes of vibration. These modes of vibration, commonly referred to as the natural resonant modes or resonant frequencies, are determined by the object`s shape, size, and physical properties, such as elastic moduli, speed of sound, and density. If the object is mechanically excited at frequencies corresponding to its characteristic natural vibrational modes, a resonance effect can be observed when small excitation energies produce large amplitude vibrations in the object. At other excitation frequencies, i.e., vibrational response of the object is minimal.

  13. H- Beam Stripping Loss at Background Partial Pressure of Ar

    Institute of Scientific and Technical Information of China (English)

    Hu Chundong; Wang Shaohu; Hu Liqun

    2005-01-01

    It has been observed that H- current could be improved by adding Ar to H2 plasma.But due to a slower pumping speed for Ar with the existing pumping scheme, the tank pressure will increase quickly during the length of a beam pulse. Since H- stripping loss depends on the tank pressure and gas species, part of the H- beam can be converted to H0 and then H0 can be converted into H+ with background H2 and Ar gas thickness. Therefore, the H- beam current,measured by a Faraday cup, situated at a distance L from GG (ground grid), will decrease because it will be converted into a H+ current. This gives a ratio of the Faraday cup net current to the H- beam current before stripping at background partial pressure of Ar.

  14. Investigating Diffusion and Entropy with Carbon Dioxide-Filled Balloons

    Science.gov (United States)

    Jadrich, James; Bruxvoort, Crystal

    2010-01-01

    Fill an ordinary latex balloon with helium gas and you know what to expect. Over the next day or two the volume will decrease noticeably as helium escapes from the balloon. So what happens when a latex balloon is filled with carbon dioxide gas? Surprisingly, carbon dioxide balloons deflate at rates as much as an order of magnitude faster than…

  15. Primary retention following nuclear recoil in β-decay: Proposed synthesis of a metastable rare gas oxide (38ArO4) from (38ClO4−) and the evolution of chemical bonding over the nuclear transmutation reaction path

    International Nuclear Information System (INIS)

    (d)]. - Highlights: • Mathematical model for the yield of primary retention after β-decay. • The nature of metastable chemical bonding in thermodynamically unstable compounds. • The changes in the nature of chemical bond upon nuclear transmutation. • Synthetic protocol of metastable rare gas oxides (ArO4) from a hot chemistry route

  16. Laser parametric instability experiments of a 3ω, 15 kJ, 6-ns laser pulse in gas-filled hohlraums at the Ligne d'Intégration Laser facility

    Energy Technology Data Exchange (ETDEWEB)

    Rousseaux, C.; Huser, G.; Loiseau, P.; Casanova, M.; Alozy, E.; Villette, B.; Wrobel, R. [Commissariat à l' Energie Atomique, DAM, DIF, F-91297 Arpajon (France); Henry, O.; Raffestin, D. [Commissariat à l' Energie Atomique, DAM, CESTA, F-33114 Le Barp (France)

    2015-02-15

    Experimental investigation of stimulated Raman (SRS) and Brillouin (SBS) scattering have been obtained at the Ligne-d'Intégration-Laser facility (LIL, CEA-Cesta, France). The parametric instabilities (LPI) are driven by firing four laser beamlets (one quad) into millimeter size, gas-filled hohlraum targets. A quad delivers energy on target of 15 kJ at 3ω in a 6-ns shaped laser pulse. The quad is focused by means of 3ω gratings and is optically smoothed with a kinoform phase plate and with smoothing by spectral dispersion-like 2 GHz and/or 14 GHz laser bandwidth. Open- and closed-geometry hohlraums have been used, all being filled with 1-atm, neo-pentane (C{sub 5}H{sub 12}) gas. For SRS and SBS studies, the light backscattered into the focusing optics is analyzed with spectral and time resolutions. Near-backscattered light at 3ω and transmitted light at 3ω are also monitored in the open geometry case. Depending on the target geometry (plasma length and hydrodynamic evolution of the plasma), it is shown that, at maximum laser intensity about 9 × 10{sup 14} W/cm{sup 2}, Raman reflectivity noticeably increases up to 30% in 4-mm long plasmas while SBS stays below 10%. Consequently, laser transmission through long plasmas drops to about 10% of incident energy. Adding 14 GHz bandwidth to the laser always reduces LPI reflectivities, although this reduction is not dramatic.

  17. Filling Tanks with Hydrazine

    Science.gov (United States)

    Krueger, K.

    2004-10-01

    At the Hydrazine workshop in 2002 in Noordwijk several presentations dealt with the filling of satellite tanks. I was a bit surprised about the amount of manpower that is needed for this work. But I saw the same during the filling of the SCA system tanks some years ago in Trauen/Germany. I want to present the work flow of filling RESUS Hydrazine tanks. This bladder tanks have a capacity of 64 litres and are similar to some of the satellite tanks. We fill this tanks 25 to 50 times a year. Although the specifications are not exactly the same as those for satellite tank filling, it might be interesting to see how this work can be done half-automatically, because handling with Hydrazine is not a nice job, and the faster it goes, the better.

  18. Geological Dating by 40 Ar - 39 Ar method

    International Nuclear Information System (INIS)

    The isotope 40 K is radioactive, it decays to 40 Ar stable. The number of 40 Ar atoms produced from 40 K, permits to calculate the date of rocks and minerals. This dating technique is named 'Conventional K-Ar Dating Method'. The 40 Ar - 39 Ar dating method permits to calculate the age of rocks and minerals eliminating the limitation of the K-Ar method by calculating potassium and argon concentrations in a single measurement of the ratio of argon isotopes. In this work, the irradiation of the sample with fast neutrons in the nuclear reactor was established. 39 Ar is obtained from the induced reaction 39 K (n,p) 39 Ar. Thus the ration of 40 Ar -39 Ar allows to obtain the date of rocks and minerals. This ratio was measured in a mass spectrometer. If the measurement of argon concentration in the sample is carried out at different increasing temperature values, it is possible to get information of paleotemperatures. The number of atoms 39 Ar is a function of the number 39 K atoms, irradiation time, neutrons flux, its energy E and the capture cross section σ of 39 K. These parameters are calculate indirectly by obtaining the so called 'J value ' by using a standard mineral with known age (HD-BI y Biot-133), this mineral is irradiated together with the unknown age sample. The values of 'J' obtained are in the interval of 2.85 a 3.03 (x 10-3)J/h. Rocks from 'Tres Virgenes' were dated by the method described in this work, showing an agreement with previous values of different authors. The age of this rocks are from Cenozoico era, mainly in the miocene period. (Author)

  19. Experimental study of NO2 reduction in N2/Ar and O2/Ar mixtures by pulsed corona discharge.

    Science.gov (United States)

    Zhu, Xinbo; Zheng, Chenghang; Gao, Xiang; Shen, Xu; Wang, Zhihua; Luo, Zhongyang; Cen, Kefa

    2014-11-01

    Non-thermal plasma technology has been regarded as a promising alternative technology for NOx removal. The understanding of NO2 reduction characteristics is extremely important since NO2 reduction could lower the total NO oxidation rate in the plasma atmosphere. In this study, NO2 reduction was experimentally investigated using a non-thermal plasma reactor driven by a pulsed power supply for different simulated gas compositions and operating parameters. The NO2 reduction was promoted by increasing the specific energy density (SED), and the highest conversion rates were 33.7%, 42.1% and 25.7% for Ar, N2/Ar and O2/Ar, respectively. For a given SED, the NO2 conversion rate had the order N2/Ar>Ar>O2/Ar. The highest energy yield of 3.31g/kWh was obtained in N2/Ar plasma and decreased with increasing SED; the same trends were also found in the other two gas compositions. The conversion rate decreased with increasing initial NO2 concentration. Furthermore, the presence of N2 or O2 led to different reaction pathways for NO2 conversion due to the formation of different dominating reactive radicals. PMID:25458679

  20. 40Ar/39Ar Interlaboratory Calibration into the Holocene.

    Science.gov (United States)

    Heizler, M. T.; Jicha, B.; Koppers, A. A. P.; Miggins, D. P.

    2015-12-01

    Advances in 40Ar/39Ar analytical precision for very young rocks requires collaborative efforts amongst argon geochronology labs to demonstrate age reproducibility commensurate with high precision. NM Tech (NMT), the University of Wisconsin (UW) and Oregon State University (OSU) have each dated Quaternary flux monitor standard AC-2 sanidine (~1.185 Ma), a blind sanidine described as being 50-100 ka (BS) and sanidine from the Qixiangshan (QIX) flow (~10 ka), Changbaishan volcano, China. The samples were irradiated in a single package with FC-2 sanidine (28.201 Ma) as the flux monitor and the irradiated material was distributed amongst the labs. Heizler was present during analysis at both OSU and UW and Jicha attended OSU during analysis. Physical presence was key towards gaining understanding of individual protocols and prompted valuable discussions. Analyses were carried out on single crystals using total fusion and/or step heating approaches. Age agreement was achieved within 2s uncertainty that ranged between (0.03-0.3%, 0.13-0.37% and 1.8-2.6%) for AC-2, BS and QIX, respectively. Each lab found AC-2 to vary somewhat beyond a normal distribution and to yield an age relative to FC-2 of ~1.185 Ma that is ~1.3% (~5-10 sigma) lower than some published estimates. A key cause of the variation between this study and previous results may be variable gas pressure equilibration times between extraction line and mass spectrometer coupled with variable choices to estimate time zero by other laboratories. The majority of our efforts concentrated on the QIX sanidine where prior data obtained by our labs revealed a factor of two spread in age (~11 and 23 ka) based on experiments carried out by total fusion and bulk incremental heating. By conducting single crystal age spectrum analysis we were able to mitigate effects of melt inclusion hosted excess argon and xenocrystic contamination towards obtaining analytical agreement with apparent ages near 10 ka. However, philosophical

  1. 40Ar/39Ar age calibration against counted annuallayers

    DEFF Research Database (Denmark)

    Storey, Michael; Stecher, Ole

    2008-01-01

    The 40Ar/39Ar method, based on the decay of the naturally occurring radioactive isotope 40K, is capable of producing ages with precision better than ± 0.1 %. However, accuracy is limited to no better than 1 % mainly due to the relatively large uncertainty in the 40K decay constants. One approach...

  2. A comparative study of CF4/O2/Ar and C4F8/O2/Ar plasmas for dry etching applications

    International Nuclear Information System (INIS)

    The effect of the O2/Ar mixing ratio in CF4/O2/Ar and C4F8/O2/Ar inductively coupled plasmas with a 50% fluorocarbon gas content on plasma parameters and active species densities, which influence dry etching mechanisms, was analyzed. The investigation combined plasma diagnostics using Langmuir probes and zero-dimensional plasma modeling. It was found that, in both gas systems, the substitution of Ar for O2 results in a similar change in the ion energy flux but causes the opposite behavior for the F atom flux. The mechanisms of these phenomena are discussed with regards to plasma chemistry. - Highlights: • The goal was to conduct a comparative study of CF4/O2/Ar and C4F8/O2/Ar plasmas. • The focus was on the parameters directly influencing dry etching mechanisms. • Model-based analysis for neutral species was used in this paper

  3. The radon gas at the context of legislation on the quality of internal air in buildings - the Portuguese experience; O gas radao no contexto da legislacao sobre a qualidade do ar interior em edificios - a experiencia portuguesa

    Energy Technology Data Exchange (ETDEWEB)

    Pinto, Paulo G.A.N.; Pereira, Alcides J.S.C.; Neves, Luis J.P.F., E-mail: ppinto@dct.uc.p, E-mail: apereira@dct.uc.p, E-mail: luisneves@dct.uc.p [Universidade de Coimbra (Portugal). Dept. de Ciencias da Terra. Instituto do Mar

    2011-10-26

    Radon gas has been recognized as an important environmental risk factor, especially when found in high concentrations inside buildings, and is currently classified by the World Health Organization as a carcinogen type 1. In this context, there is legislation in Portugal since 2006 that sets limits to its concentration in indoor air. The aim of this work was to synthesize the existing legislation with focus on the sampling and analysis. Some statistical data about the measurements obtained in the Natural Radioactivity Laboratory, of the Department of Earth Sciences, of the University of Coimbra are presented, and discussed in the context of the National Energy Certification of Buildings System

  4. Primary retention following nuclear recoil in β-decay: Proposed synthesis of a metastable rare gas oxide ((38)ArO4) from ((38)ClO4(-)) and the evolution of chemical bonding over the nuclear transmutation reaction path.

    Science.gov (United States)

    Timm, Matthew J; Matta, Chérif F

    2014-12-01

    Argon tetroxide (ArO4) is the last member of the N=50 e(-) isoelectronic and isosteric series of ions: SiO4(4-), PO4(3-), SO4(2-), and ClO4(-). A high level computational study demonstrated that while ArO4 is kinetically stable it has a considerable positive enthalpy of formation (of ~298kcal/mol) (Lindh et al., 1999. J. Phys. Chem. A 103, pp. 8295-8302) confirming earlier predictions by Pyykkö (1990. Phys. Scr. 33, pp. 52-53). ArO4 can be expected to be difficult to synthesize by traditional chemistry due to its metastability and has not yet been synthesized at the time of writing. A computational investigation of the changes in the chemical bonding of chlorate (ClO4(-)) when the central chlorine atom undergoes a nuclear transmutation from the unstable artificial chlorine isotope (38)Cl to the stable rare argon isotope (38)Ar through β-decay, hence potentially leading to the formation of ArO4, is reported. A mathematical model is presented that allows for the prediction of yields following the recoil of a nucleus upon ejecting a β-electron. It is demonstrated that below a critical angle between the ejected β-electron and that of the accompanying antineutrino their respective linear momentums can cancel to such an extent as imparting a recoil to the daughter atom insufficient for breaking the Ar-O bond. As a result, a primary retention yield of ~1% of ArO4 is predicted following the nuclear disintegration. The study is conducted at the quadratic configuration interaction with single and double excitations [QCISD/6-311+G(3df)] level of theory followed by an analysis of the electron density by the quantum theory of atoms in molecules (QTAIM). Crossed potential energy surfaces (PES) were used to construct a PES from the metastable ArO4 ground singlet state to the Ar-O bond dissociation product ArO3+O((3)P) from which the predicted barrier to dissociation is ca. 22kcal/mol and the exothermic reaction energy is ca. 28kcal/mol [(U)MP2/6-311+G(d)].

  5. About Dental Amalgam Fillings

    Science.gov (United States)

    ... decay and then shapes the tooth cavity for placement of the amalgam filling. Next, under appropriate safety ... About FDA Contact FDA Browse by Product Area Product Areas back Food Drugs Medical Devices Radiation-Emitting ...

  6. High-Energy Ions Emitted from Ar Clusters Irradiated by Intense Femtosecond Laser Pulses

    Institute of Scientific and Technical Information of China (English)

    LI Zhong; LEI An-Le; NI Guo-Quan; XU Zhi-Zhan

    2000-01-01

    We have experimentally studied the energy spectra of Ar ions emitted from Ar clusters irradiated by intense femtosecond laser pulses. The Ar clusters were produced in the adiabatic expansion of Ar gas into vacuum at high backing pressures. The laser peak intensity was about 2×106 W/cm2 with a pulse duration of 45 fs. The maximum and the average energies of Ar ions are 0.2 MeV and 15kev at a backing pressure of 2. S MPa, respectively. They are almost independent of the backing pressures in the range of 0.6 to 4.5 MPa.

  7. Phase-matched high-order harmonics by interaction of Ar atoms with high-repetition-rate low-energy femtosecond laser pulses

    Institute of Scientific and Technical Information of China (English)

    XIE; Xinhua; ZENG; Zhinan; LI; Ruxin; CHEN; Shu; LU; Haihe

    2004-01-01

    Phase-matched high-order harmonic generation in Ar gas-filled cell was investigated experimentally. We obtained phase-matched 27th order harmonic driven by a commercially available solid-state femtosecond laser system at 0.55 m J/pulse energy level and 1 kHz repetition rate. To our knowledge, this is the lowest driving laser energy used to obtain phase-matched 27th order harmonic in a static gas cell. High-order harmonic generation at different gas density was studied systematically. Spectral blueshift and broadening of high harmonics under different pressure were analyzed. We found that the source size and spatial distribution of high-order harmonics are quite different under the phase-matching condition from those of the phase-mismatching case.

  8. Project of multiple controller models for the maintenance of air/fuel ratio in natural gas internal combustion motors; Projeto de controladores multiplos modelos para manutencao da relacao ar/combustivel em motores de combustao interna movidos a gas natural

    Energy Technology Data Exchange (ETDEWEB)

    Freitas Junior, Fernando Sousa e; Fleury, Agenor de Toledo [Sao Paulo Univ. SP (Brazil). Escola Politecnica. Dept. de Engenharia Mecanica]. E-mails: ffreitas@usp.br; agfleury@ipt.br

    2006-07-01

    The objective of this work is the study of advanced control techniques for the reduction of pollutant gases generated by internal combustion engines powered by natural gas. In this paper three techniques are applied to control the fuel injection and the ignition timing: the Generalized Predictive Control (GPC), the Linear Quadratic Regulator (LQR) and H{infinity} Control by Linear Matrix Inequalities (LMI). To each one of those techniques were developed a multiple model structure seeking to include the vast operation region of the engine. The controller's performance is measured by the efficiency in maintaining the fuel/air ratio around 1% of maximum deviation in relation to the stoichiometric value. The results show the possibility of controlling pollutant emission generated by this kind of engine to conform to international emission standards, improving life quality. (author)

  9. Noble Gases in the Monahans Chondrite and Halite: Ar-39 - Ar-40 Age, Space Exposure Age, Trapped Solar Gases, and Neutron Fluence

    Science.gov (United States)

    Garrison, Daniel H.; Bogard, Donald D.

    2000-01-01

    For the Monahans chondrite and halite, we determined Ar-39 - Ar-40 ages of silicate = 4.53 Ga, halite > 4.3 Ga; a space exposure age of approx. 5 Ma; a regolith pre-irradiation; solar gas concentrations in the dark phase; and a regolith thermal neutron fluence.

  10. 40Ar-39Ar geochronology and thermochronology: principles and potential

    International Nuclear Information System (INIS)

    Geochronology based on radiogenic isotopes has become an invaluable tool in earth sciences. Several radioactive parent-daughter systems of varying half-lives such as Rb-Sr, Sm-Nd, K-Ar have been traditionally used by researchers for determining the timing of geological and planetary processes. 40Ar-39Ar dating, a variant of the K-Ar system, is a well-established and versatile method of determining the eruptive ages of volcanic rocks and the ∼150-500 deg C thermal histories of a variety of more slowly cooled igneous and metamorphic rocks. This technique has been the most popular tool for dating felsic and intermediate volcanic rocks. Recently several new areas of research have been explored, including total-fusion dating of mineral grains from volcanic and sedimentary samples, mapping of argon isotopic gradients in crystals, and selective dating of fabric-defining minerals in poly deformed specimens

  11. Etching characteristics and mechanisms of Mo thin films in Cl2/Ar and CF4/Ar inductively coupled plasmas

    Science.gov (United States)

    Lim, Nomin; Efremov, Alexander; Yeom, Geun Young; Choi, Bok-Gil; Kwon, Kwang-Ho

    2014-11-01

    The etching characteristics and mechanism of Mo thin films in Cl2/Ar and CF4/Ar inductively coupled plasmas under the same operating conditions (pressure, 6 mTorr; input power, 700 W; bias power, 200 W) were investigated. For both gas mixtures, an increase in the Ar fraction or gas pressure at a fixed gas mixing ratio was found to cause a non-monotonic change in the Mo etching rates. The X-ray photoelectron spectroscopy (XPS) diagnostics indicated contamination of the etched surfaces by reaction products. The Cl2/Ar and CF4/Ar plasma parameters were also investigated using a combination of a zero-dimensional plasma model and plasma diagnostics using Langmuir probes. An analysis of the etching kinetics with the model-predicted fluxes of the plasma active species suggests that: 1) the Mo etching process occurs in the transitional regime of the ion-assisted chemical reaction, and 2) the non-monotonic Mo etching rate is probably associated with opposing changes in the fluxes of the reactive neutral species and ion energy.

  12. Ars Poetica : [luuletused] / Mats Traat

    Index Scriptorium Estoniae

    Traat, Mats, 1936-

    2008-01-01

    Sisu: Ars poetica ; Veepeegel ; Kontrollõed ; Mandariiniriik ; Nikolai Siamashvili (1888-1911) ; Kolmekümne kolmas aasta ; Kiri linast 1966 ; Italmaz Nuriyev ; Rudolf Rimmelile mõeldes ; Gennadi Aigi

  13. Ar-39-Ar-40 Ages of Two Nakhlites, MIL03346 and Y000593: A Detailed Analysis

    Science.gov (United States)

    Park, Jisun; Garrison, Daniel; Bogard, Donald

    2007-01-01

    Radiometric dating of martian nakhlites by several techniques have given similar ages of approx.1.2-1.4 Ga [e.g. 1, 2]. Unlike the case with shergottites, where the presence of martian atmosphere and inherited radiogenic Ar-40 produce apparent Ar-39-Ar-40 ages older than other radiometric ages, Ar-Ar ages of nakhlites are similar to ages derived by other techniques. However, even in some nakhlites the presence of trapped martian Ar produces some uncertainty in the Ar-Ar age. We present here an analysis of such Ar-Ar ages from the MIL03346 and Y000593 nakhlites.

  14. Computational phase diagrams of noble gas hydrates under pressure

    Energy Technology Data Exchange (ETDEWEB)

    Teeratchanan, Pattanasak, E-mail: s1270872@sms.ed.ac.uk; Hermann, Andreas, E-mail: a.hermann@ed.ac.uk [Centre for Science at Extreme Conditions and SUPA, School of Physics and Astronomy, The University of Edinburgh, Edinburgh EH9 3FD (United Kingdom)

    2015-10-21

    We present results from a first-principles study on the stability of noble gas-water compounds in the pressure range 0-100 kbar. Filled-ice structures based on the host water networks ice-I{sub h}, ice-I{sub c}, ice-II, and C{sub 0} interacting with guest species He, Ne, and Ar are investigated, using density functional theory (DFT) with four different exchange-correlation functionals that include dispersion effects to various degrees: the non-local density-based optPBE-van der Waals (vdW) and rPW86-vdW2 functionals, the semi-empirical D2 atom pair correction, and the semi-local PBE functional. In the He-water system, the sequence of stable phases closely matches that seen in the hydrogen hydrates, a guest species of comparable size. In the Ne-water system, we predict a novel hydrate structure based on the C{sub 0} water network to be stable or at least competitive at relatively low pressure. In the Ar-water system, as expected, no filled-ice phases are stable; however, a partially occupied Ar-C{sub 0} hydrate structure is metastable with respect to the constituents. The ability of the different DFT functionals to describe the weak host-guest interactions is analysed and compared to coupled cluster results on gas phase systems.

  15. Complications of Dermal Filling

    Directory of Open Access Journals (Sweden)

    Sajad Ahmad Salati

    2011-11-01

    Full Text Available Dermal fillers have globally become sought after drugs due to the desire of aging population to regain the youthful looks without any surgical operations. But like other procedures, dermal filling can become complicated. Besides the profitability have introduced the factor of malpractice which can bring in misery rather than beauty and youthful body contours. This article briefly reviews the common adverse effects of dermal fillers.

  16. Analysis list: AR [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available AR Blood,Breast,Prostate + hg19 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/target/AR.1.tsv http://dbar...chive.biosciencedbc.jp/kyushu-u/hg19/target/AR.5.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/tar...get/AR.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/colo/AR.Blood.tsv,http://dbar...chive.biosciencedbc.jp/kyushu-u/hg19/colo/AR.Breast.tsv,http://dbarchive.biosc...iencedbc.jp/kyushu-u/hg19/colo/AR.Prostate.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/colo/Blood.gml,http://dbar

  17. Analysis list: Ar [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Ar Gonad,Kidney,Prostate + mm9 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/targe...t/Ar.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Ar.5.tsv http://dbarchive.biosciencedbc.jp/...kyushu-u/mm9/target/Ar.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Ar.Gonad.tsv,http://dbarchive.bioscien...cedbc.jp/kyushu-u/mm9/colo/Ar.Kidney.tsv,http://dbarchive.bioscienced...bc.jp/kyushu-u/mm9/colo/Ar.Prostate.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Gonad.gml,http://dbarchive.bioscien

  18. Preparation of zeolite 4A filled polyurethaneurea membranes and their gas separation performance%4A沸石填充聚氨酯杂化膜的制备及气体分离性能

    Institute of Scientific and Technical Information of China (English)

    白云翔; 邹超; 张春芳; 顾瑾; 孙余凭

    2011-01-01

    两步法制备了4A沸石填充的端羟基聚丁二烯基聚氨酯膜HTPB-PU/4A,并研究了CO2、H2、O2、N2的气体透过性能.结果表明:沸石与膜的相容性较好,添加4A沸石后,膜的热稳定性明显提高,O2渗透性及O2/N2选择性显著改善;随沸石添加时间的增加,膜对各种气体体系的选择性先增加后减小,而渗透性则先增加后趋于稳定;随硬段含量的增加,气体渗透性均下降,CO2/N2、O2/N2、H2/N2的选择性先升后降;随沸石添加量的增加,O2渗透性一直上升,而O2/N2的选择性先上升后下降,最大选择性达到7.11.%Zeolite 4A-filled hydroxyl terminated polybutadiene (HTPB) -based polyurethaneurea (PU) membranes, HTPB-PU/4A, are prepared by a two-step polymerization process to investigate the permeability of CO2, H2,O2 and N2. The results show that zeolite 4A particles are compatible with the PU segments and the incorporation of the zeolite 4A particles can apparently improve the thermal stability, permeability of O2 and selectivity of O2/N2 of the membranes. With the adding time of zeolite 4A increasing,the selectivity of the various gas systems increases initially and then decreases, while the permeability increases initially and then levels off. Increasing the content of hard segment in HTPB-PU, the permeability of various gas system in this study all decrease. However,the selectivity of CO2/N2 O2/N2 ,H2/N2 increases initially and then decreases. As the amount of zeolite 4A increases, O2 permeability continuously increases while the selectivity of O2/N2 increases at first and descrease afterwards. The highest selectivity can reach 7. 11.

  19. 40Ar/39Ar dating of Daqingshan thrust

    Institute of Scientific and Technical Information of China (English)

    LIU Zhenghong; XU Zhongyuan; YANG Zhensheng

    2003-01-01

    The Daqingshan thrust system, to the south of the Shiguai Mesozoic basin, is a complex system of top-to- the-north thrusting tectonic sheets. The thrust system has a complicated evolution due to multi-stage thrusting. In order to date the thrusting events, syntectonic muscovite and biotite grains are respectively analyzed with normal 40Ar/39Ar dating and laser 40Ar/39Ar dating, which yield 2 isochron ages, i.e. 193.74 ± 3.88 Ma and 121.6 ± 1.6 Ma. These ages suggest that faults within the Daqingshan thrust system formed during 2 stages of thrusting, one the early Indosinian and the other the late Yanshanian. The isotopic dating is consistent with field geological relations. Indosinan deformation is evidenced by top-to-the-north thrusting, with the occurrence of a series of large-scale east-west trending thrust faults and folds, while the Yanshanian thrusting is characterized by top-to-the-NNW thrusting. It is superposed on and modifies early Indosinian thrust faults.

  20. "Ars Electronica 2009" / Raivo Kelomees

    Index Scriptorium Estoniae

    Kelomees, Raivo, 1960-

    2009-01-01

    30. "Ars Electronica" festival "Human Nature" ("Inimese loomus") Linzis. Osaka ülikooli professori Hiroshi Ishiguro mehaanilis-digitaalsest nukust. Hübriidkunsti kategoorias peapreemia saanud Eduardo Kaci inimtaimest. Konverentsidest. Näitusest "See this Sound", mis oli pühendatud helile kujutavas kunstis

  1. AR DOC: Augmented reality documentaries

    DEFF Research Database (Denmark)

    Vistisen, Peter

    2014-01-01

    Augmented Reality Documentaries (AR DOC) er et ’lille’ Shareplay projekt (ansøgte midler augmented reality cross media løsninger, til at skabe engagerende publikumsformidling...... indenfor oplevelsesindustrien. Projektet har genereret ny viden omkring, hvordan fysisk og digital formidling kan understøttes via Augmented Reality som formidlingsformat....

  2. Optical Emission Spectroscopic Studies of ICP Ar Plasma

    Institute of Scientific and Technical Information of China (English)

    QI Xuelian; REN Chunsheng; ZHANG Jian; MA Tengcai

    2007-01-01

    The ion line of 434.8 nm and atom line of 419.8 nm of Ar plasma produced by an inductively coupled plasma (ICP) were measured by optical emission spectroscopy and the influences from the working gas pressure, radio-frequency (RF) power and different positions in the discharge chamber on the line intensities were investigated in this study. It was found that the intensity of Ar atom line increased firstly and then saturated with the increase of the pressure. The line intensity of Ar+, on the other hand, reached a maximum value and then decreased along with the pressure. The intensity of the line in an RF discharge also demonstrated a jumping mode and a hysteresis phenomenon with the RF power. When the RF power increased to 400 W, the discharge jumped from the E-mode to the H-mode where the line intensity of Ar atom demonstrated a sudden increase, while the intensity of Ar+ ion only changed slightly. If the RF power decreased from a high value, e.g., 1000 W, the discharge would jump from the H-mode back to the E-mode at a power of 300 W. At this time the intensities of Ar and Ar+ lines would also decrease sharply. It was also noticed in this paper that the intensity of the ion line depended on the detective location in the chamber, namely at the bottom of the chamber the line was more intense than that in the middle of the chamber, but less intense than at the top, which is considered to be related to the capacitance coupling ability of the ICP plasma in different discharge areas.

  3. Preparing for faster filling

    CERN Multimedia

    CERN Bulletin

    2010-01-01

    Following the programmed technical stop last week, operators focussed on preparing the machine for faster filling, which includes multibunch injection and a faster pre-cycle phase.   The LHC1 screen shot during the first multibunch injection operation. The LHC operational schedule incorporates a technical stop for preventive maintenance roughly every six weeks of stable operation, during which several interventions on the various machines are carried out. Last week these included the replacement of a faulty magnet in the SPS pre-accelerator, which required the subsequent re-setting of the system of particle extraction and transfer to the LHC. At the end of last week, all the machines were handed back for operation and work could start on accommodating all the changes made into the complex systems in order for normal operation to be resumed. These ‘recovery’ operations continued through the weekend and into this week. At the beginning of this week, operators succeeded in pro...

  4. Bulk-Fill Resin Composites

    DEFF Research Database (Denmark)

    Benetti, Ana Raquel; Havndrup-Pedersen, Cæcilie; Honoré, Daniel;

    2015-01-01

    the restorative procedure. The aim of this study, therefore, was to compare the depth of cure, polymerization contraction, and gap formation in bulk-fill resin composites with those of a conventional resin composite. To achieve this, the depth of cure was assessed in accordance with the International Organization...... for Standardization 4049 standard, and the polymerization contraction was determined using the bonded-disc method. The gap formation was measured at the dentin margin of Class II cavities. Five bulk-fill resin composites were investigated: two high-viscosity (Tetric EvoCeram Bulk Fill, SonicFill) and three low......-viscosity (x-tra base, Venus Bulk Fill, SDR) materials. Compared with the conventional resin composite, the high-viscosity bulk-fill materials exhibited only a small increase (but significant for Tetric EvoCeram Bulk Fill) in depth of cure and polymerization contraction, whereas the low-viscosity bulk...

  5. Spectroscopy Study of Ar + CO2 Plasmas in ASTRAL.

    Science.gov (United States)

    Munoz, Jorge; Boivin, Robert; Kamar, Ola; Loch, Stuart; Ballance, Connor

    2006-10-01

    A spectroscopy study of the ASTRAL (Auburn Steady sTate Research fAciLity) helicon plasma source running Ar + CO2 gas mix is presented. ASTRAL produces Ar plasmas: ne = 10^10 to 10^13 cm-3, Te = 2 to 10 eV and Ti = 0.03 to 0.5 eV. A series of 7 large coils produce an axial magnetic field up to 1.3 kGauss. A fractional helix antenna is used to introduce rf power up to 2 kWatt. A spectrometer which features a 0.33 m Criss-Cross monochromator and a CCD camera is used for this study. Very different plasmas are produced following the relative importance of CO2 in the gas mixture. At low CO2 concentration, the plasmas are similar to those obtained with pure Ar with weak CO2, CO2^+, CO and CO^+ bands. The usual blue plasma core associated with intense Ar II transitions is observed with however a significant white glow coming from the outer plasma regions. At higher CO2 concentration, the plasma becomes essentially molecular and can be described as an intense white plasma column. Molecular dissociative processes associated with the production of strong C and O atomic lines are observed under specific plasma conditions. The atomic spectral lines are compared with ADAS modeling results. This study indicates the possible advantages of using a helicon source to control the CO2 plasma chemistry for industrial applications.

  6. 40Ar-39Ar age of the Shergotty achondrite and implications for its post-shock thermal history

    International Nuclear Information System (INIS)

    Analyses of 40Ar-39Ar have been made on a whole rock sample and a maskelynite (feldspar) separate of the shocked Shergotty achondrite. The maskelynite gave a plateau age of 254 +- 10 Myr. The whole rock sample gave a complex release with apparent ages between 240 and 640 Myr. The slightly younger Rb-Sr isochron age of 165 Myr for Shergotty suggests that the maskelynite as well as the whole rock was incompletely degassed. Reasonable Ar diffusion characteristics for Shergotty for shock heating temperatures of 0C indicate D/a2 of 10-11 to 10-13sec-1. The time required to lose 95% of the 40Ar from the plagioclase would be approximately 103 to 104 yr. When this gas diffusion time is introduced into a thermal model of a cooling ejecta blanket of variable thickness, a post-shock cooling time of >= 103 yr and a burial depth of >= 300 m are indicated for Shergotty. These conclusions are not seriously affected by uncertainties in the thermal model. Most likely the shock event occurred approximately 165 Myr ago, but no earlier than 250 Myr ago, when the Shergotty parent object experienced a collision in the asteroid belt. As a result of that collision, feldspar was converted to maskelynite, the K-Ar and Rb-Sr ages were completely or nearly completely reset, and the Shergotty meteorite was heated to 0C and left to cool slowly inside the parent body. (author)

  7. ARS - Helsinki - 2006 / Galina Balashova

    Index Scriptorium Estoniae

    Balashova, Galina

    2006-01-01

    Steven Holli projekteeritud Kiasma muuseumihoonest Helsingis. Kontseptuaalkunsti näitusest ARS 06 "Reaalsustunne" Kiasmas. Eestlastest esineb Mark Raidpere. Vene kunstnikegrupi AEC+F ja vene kunstnike Juri Vassiljevi ning Aleksandr Ponomarjovi töödest näitusel. Ka Gerda Steineri & Jörg Lenzlingeri (Šveits), Martin & Munoz'i (USA, Hispaania), arvutigraafik Charles Sandisoni (SB), videokunstnik Bill Viola (USA) jt. töödest

  8. Ars Industrialis, arsindustrialis.org

    Directory of Open Access Journals (Sweden)

    Frédérique Mingant

    2012-03-01

    Full Text Available The arsindustrialis.org website was created in 2005, when the association Ars Industrialis came into being. The association was founded by a group of philosophers and jurists, on the initiative of philosopher Bernard Stiegler, the former director of the IRCAM (Institut de Recherche et Coordination Acoustique/Musique–Institute of Research and Coordination on Acoustic/Music and the current director of the Department of cultural development at the Centre Georges Pompidou (French National Arts C...

  9. AR-39Ar-40 dating of basalts and rock breccias from Apollo 17 and the malvern achondrite

    Science.gov (United States)

    Kirsten, T.; Horn, P.

    1977-01-01

    The principles and the potential of the Ar-39/Ar-40 dating technique are illustrated by means of results obtained for 12 Apollo 17 rocks. Emphasis is given to methodical problems and the geological interpretation of lunar rock ages. Often it is ambigious to associate a given lunar breccia with a certain formation, or a formation with a basin. In addition, large-scale events on the Moon have not necessarily reset radiometric clocks completely. One rock fragment has a well-defined plateau age of 4.28 b.y., but the ages of two Apollo 17 breccias define an upper limit for the formation age of the Serenitatis basin at 4.05 b.y. Ages derived from five mare basalts indicate cessation of mare volcanism at Taurus-Littrow approximately 3.78 b.y. ago. Ca/Ar-37 exposure ages show that Camelot Crater was formed by an impact approximately 95 m.y. ago. After a short summary of the lunar timetable as it stands at the end of the Apollo program, we report about Ar-39/Ar-40 and rare gas studies on the Malvern meteorite. This achondrite resembles lunar highland breccias in texture as well as in rare-gas patterns. It was strongly annealed at some time between 3.4 and 3.8 b.y. ago. The results indicate that very similar processes have occurred on the Moon and on achondritic parent bodies at comparable times, leading to impact breccias with strikingly similar features, including the retention of rare-gas isotopes from various sources.

  10. arXiv.org and Physics Education

    Science.gov (United States)

    Ramlo, Susan

    2007-01-01

    The website arXiv.org (pronounced "archive") is a free online resource for full-text articles in the fields of physics, mathematics, computer science, nonlinear science, and quantitative biology that has existed for about 15 years. Available directly at http://www.arXiv.org, this e-print archive is searchable. As of Jan. 3, 2007, arXiv had open…

  11. 用双天平称重法实现高精度低浓度混和气的制备%Preparing Gas Mixture of Low Concentration and High Accuracy by the Double Balance Weighing Method

    Institute of Scientific and Technical Information of China (English)

    韦冠一; Adolf.G(o)tz; 张子斌; 李雪松; H.Gerken

    2004-01-01

    The brief procedure of how to get a gas mixture of low concentration and high accuracy with the double balance weighing method was described. This method requires two balances of both different ranges and high resolutions, also tow sets of equipment for introducing Ar, Ne, Kr, Xe, and the Nitrogen for balance gas. Two sets of equipment were fulfilled according to the described procedure without any backflow of the component gases. The residual gas in the filling equipment was analyzed to correct the mass of the component gases filled into the mixture gas. By this way, the concentration of Kr and Xe in the preparing mixture gas, is about 0.1%, with the maximum uncertainty of about 0.1%.

  12. Occurrences of Excess 40Ar in Hydrothermal Tourmaline:Interpretations from 40Ar-39Ar Dating Results by Stepwise Heating

    Institute of Scientific and Technical Information of China (English)

    QIU Huaning; PU Zhiping; DAI Tongmo

    2007-01-01

    The occurrences of excess 40Ar within a hydrothermal tourmaline is discussed in term of the analysis data of syngenetic muscovite and tourmaline from the Lushui hydrothermal tin-tungsten deposit in western Yunnan, China, using the 40Ar-39Ar stepwise heating technique. About 80% excess 40Ar was released in the last step when the tourmaline was fused, corresponding to a release of only ~3% 39Ar (K), which indicates that most excess 40Ar was held in the mineral lattice rather than in the channels parallel to the Z-axis. This suggests that the excess 40Ar was incorporated during crystallization and not diffused into the tourmaline during the post-crystallization history.

  13. A Refined Astronomically Calibrated 40Ar/39Ar Age for Fish Canyon Sanidine

    DEFF Research Database (Denmark)

    Rivera, Tiffany; Storey, Michael; Zeeden, Christian;

    2011-01-01

    , but more precise (±0.10%) than, the previous 40Ar/39Ar age determined by intercalibration with astronomically tuned tephras from the Melilla Basin (Morocco). Using this proposed age for FCs, combined with measurements using the A1Ts as the neutron fluence monitor, a weighted mean Bishop Tuff 40Ar/39Ar...

  14. A note on filled groups

    OpenAIRE

    Hart, Sarah; Anabanti, Chimere

    2015-01-01

    Let $G$ be a finite group and $S$ a subset of $G$. Then $S$ is {\\em product-free} if $S \\cap SS = \\emptyset$, and $S$ {\\em fills} $G$ if $G^{\\ast} \\subseteq S \\cup SS$. A product-free set is locally maximal if it is not contained in a strictly larger product-free set. Street and Whitehead [J. Combin. Theory Ser. A \\textbf{17} (1974), 219--226] defined a group $G$ as {\\em filled} if every locally maximal product-free set in $G$ fills $G$. Street and Whitehead classified all abelian filled grou...

  15. Ars Memorativa, Ars Oblivionis in Middle English Religious Plays

    Directory of Open Access Journals (Sweden)

    Ciobanu Estella Antoaneta

    2015-12-01

    Full Text Available This paper investigates the multi-layered violence of religious representation in the late medieval York biblical plays, with a focus on the Supper at Emmaus. I read Emmaus (Y40, a play which commemorates the Crucifixion and openly encourages strong anti-Judaism, alongside scenes in an early predecessor pageant, The Crucifixion (Y35, within their contemporary devotional and mnemonic practices, i.e. the confessional Book of Margery Kempe and Thomas Bradwardine’s tract on ars memorativa. Emmaus in particular demonstrates how a fundamentally violent ars memorativa, the legacy of ancient rhetoric to the Middle Ages, also underpins the instruction of the laity in the basics of Christian faith, here with the aid of highly musical prosody and repetition, and thereby hones a biased, intolerant and violence-inured Christian collective memory. To study the York play’s position relative to late medieval mnemonic practices, I frame my analysis within memory studies, enriched with the more specific insights offered by social-psychological, neurobiological and cognitivist studies of memory.

  16. Method for filling a reactor with a catalyst

    DEFF Research Database (Denmark)

    2013-01-01

    The invention relates to a method for filling a reactor with a catalyst for the carbonylation of carbonylated compounds in the gas phase. According to said method, a SILP catalyst is covered with a filling agent which is liquid under normal conditions and is volatile under carbonylation reaction...... conditions, and a thus-treated catalyst is introduced into the reactor and the reactor is sealed....

  17. Mineralogy and Ar-39 - Ar-40 of an old pristine basalt: Thermal history of the HED parent body

    Science.gov (United States)

    Takeda, Hiroshi; Mori, Hiroshi; Bogard, Donald D.

    1994-01-01

    Previous investigations of mineral chemistry and Rb-Sr and Sm-Nd ages indicated that clast,84 from eucrite Yamato 75011 had preserved the pristine nature of its initial crystallization during an early stage of the HED parent body. Microscale mineralogy and Ar-39-Ar-40 ages of this clast, however, revealed local disturbance of microtextures and partially reset ages. This evidence suggests that, in addition to initial crystallization and rapid cooling, the Y75011,84 clast experienced shock deformation, reheating of short duration at higher temperature, and brecciation. These characteristics suggest two or more impact events. Fe-rich olivine filling fractures in pyroxene may have been introduced during the accompanying shock fracturing. The inferred Ar-39-Ar-40 degassing ages for Y75011 matrix and clast, 84 are 3.94 +/- 0.04 Ga and 3.98 +/- 0.03 Ga, respectively. The suggested degassing age for a clast from Y790020, believed to be paired with Y75011, is approximately 4.03 Ga, but could be younger. We consider it likely that all three samples experienced a common degassing event 3.95 +/- 0.05 Ga ago, but we cannot rule out two or more events spaced over a approximately 0.1 Ga interval. Higher temperature extractions of the two clast samples show significantly older apparent ages up to approximately 4.5 Ga and suggest that the time/temperature regime of this event was not sufficient to degas Ar totally. Most likely, the K-Ar ages were reset by thermal metamorphism associated with one or more impact events associated with shock fracturing, formation of Fe-rich olivine veins, and/or meteorite brecciation. The pyroxene annealing that commonly occurs in many eucrites is likely to be a much earlier process than the impact-produced textural changes and reset K-Ar ages observed in these meteorites. The existence of mineralogical and chronological evidence for metamorphism in an otherwise pristine eucrite suggests that the HED parent body experienced an extensive degree of

  18. PF-AR upgrading project

    CERN Document Server

    Kasuga, T

    2002-01-01

    The upgrading project of the dedicated pulse X-ray source PF-AR has been completed by the end of the 2001 fiscal year. Machine commissioning exclusively using the injector linac was successfully accomplished in the beginning of January 2002. After fine tuning of the machine and cleaning of the vacuum system with the beams from the middle of January to the middle of March, routine operation for users has begun in April. The historical details, commissioning and results of the project are reported. (author)

  19. Study on Antigravity Mold Filling by Conservative Scalar Method

    Institute of Scientific and Technical Information of China (English)

    李日; 王友序; 杨根仓; 毛协民

    2003-01-01

    By SIMPLE method and Van-Leer scheme, a program on numerical simulation for 3D mold filling has been developed. The fluid flow field of gas and liquid is calculated in couples by a single phase N-S equation using SIMPLE method, and free surface control equation is handied by Van-Leer scheme. Then it is verified by an anti-gravity mold filling of thin wall plate. In order to demonstrate its ability to simulate 3D casting, an anti-gravity mould filling of a cube is computed by the program.

  20. The dynamic response of carbon fiber-filled polymer composites

    OpenAIRE

    Patterson B.; Orler E.B.; Furmanski J.; Rigg P.A.; Scharff R.J.; Stahl D.B.; Sheffield S.A.; Gustavsen R.L.; Dattelbaum D.M.; Coe J.D.

    2012-01-01

    The dynamic (shock) responses of two carbon fiber-filled polymer composites have been quantified using gas gun-driven plate impact experimentation. The first composite is a filament-wound, highly unidirectional carbon fiber-filled epoxy with a high degree of porosity. The second composite is a chopped carbon fiber- and graphite-filled phenolic resin with little-to-no porosity. Hugoniot data are presented for the carbon fiber-epoxy (CE) composite to 18.6 GPa in the through-thickness direction,...

  1. Mechanics of filled carbon nanotubes

    KAUST Repository

    Monteiro, A.O.

    2014-04-01

    The benefits of filling carbon nanotubes (CNTs) with assorted molecular and crystalline substances have been investigated for the past two decades. Amongst the study of new structural phases, defects, chemical reactions and varied types of host-guest interactions, there is one fundamental characterisation aspect of these systems that continues to be overlooked: the mechanical behaviour of filled CNTs. In contrast to their empty counterparts, the mechanics of filled CNTs is a subject where reports appear far and apart, this despite being key to the application of these materials in technological devices. In the following paragraphs, we review the work that has been carried out up to the present on the mechanics of filled CNTs. The studies discussed range from experimental resonant frequency essays performed within electron microscopes to modelling, via molecular dynamics, of three-point bending of nanotubes filled with gases. (C) 2014 Elsevier B.V. All rights reserved.

  2. 40Ar/39Ar dating of the Late Cretaceous

    International Nuclear Information System (INIS)

    As part of the wider European GTS Next project, I propose new constraints on the ages of the Late Cretaceous, derived from a multitude of geochronological techniques, and successful stratigraphic interpretations from Canada and Japan. In the Western Canada Sedimentary Basin, we propose a new constraint on the age of the K/Pg boundary in the Red Deer River section (Alberta, Canada). We were able to cyclo-stratigraphically tune sediments in a non-marine, fluvial environment utilising high-resolution proxy records suggesting a 11-12 precession related cyclicity. Assuming the 40Ar/39Ar method is inter-calibrated with the cyclo-stratigraphy, the apparent age for C29r suggests that the K/Pg boundary falls between eccentricity maxima and minima, yielding an age of the C29r between 65.89 ± 0.08 and 66.30 ± 0.08 Ma. Assuming that the bundle containing the coal horizon represents a precession cycle, the K/Pg boundary is within the analytical uncertainty of the youngest zircon population achieving a revised age for the K/Pg boundary as 65.75 ± 0.06 Ma. The Campanian - Maastrichtian boundary is preserved in the sedimentary succession of the Horseshoe Canyon Formation and has been placed 8 m below Coal nr. 10. Cyclo-stratigraphic studies show that the formation of these depositional sequences (alternations) of all scales are influenced directly by sea-level changes due to precession but more dominated by eccentricity cycles proved in the cyclo-stratigraphic framework and is mainly controlled by sand horizons, which have been related by auto-cyclicity in a dynamic sedimentary setting. Our work shows that the Campanian - Maastrichtian boundary in the Western Canada Sedimentary Basin coincides with 2.5 eccentricity cycles above the youngest zircon age population at the bottom of the section and 4.9 Myr before the Cretaceous - Palaeogene boundary (K/Pg), and thus corresponds to an absolute age of 70.65 ± 0.09 Ma producing an 1.4 Myr younger age than recent published ages

  3. Ars discendi, ars docendi : programme Pascal

    OpenAIRE

    Goyet, Thérèse

    2016-01-01

    Le latin de l’intitulé, c’est pour le plaisir, mais on peut lui donner quelques autres justifications. Ars évoque tout à la fois le savoir‑faire, le talent, la compétence professionnelle, le goût de la solution élégante. La parataxe permet le va-et-vient entre le thème et le prédicat (sujet et attribut). On interprétera au choix : savoir étudier, c’est savoir enseigner. Ou : pour apprendre, il faut enseigner ; ou : l’enseignement consiste en étude ; et d’autres variations communes sur une vér...

  4. The effects of retrograde reactions and of diffusion on 39Ar-40Ar ages of micas

    DEFF Research Database (Denmark)

    Allaz, Julien; Engi, Martin; Berger, Alfons;

    2011-01-01

    Effects of metamorphic reactions occurring during decompression were explored to understand their influence on 39Ar-40Ar ages of micas. Monometamorphic metasediments from the Lepontine Alps (Switzerland) were studied. Collected samples reached lower amphibolite facies during the Barrovian....... XRD-data indicated that some mineral separates prepared for Ar-Ar stepwise heating analysis were monomineralic, whereas others were composed of two white micas (muscovite with paragonite or margarite), or biotite and chlorite. In monomineralic samples 37Ar/39Ar and 38Ar/39Ar (proportional to Ca....../K and Cl/K ratios) did not change and the resulting ages can be interpreted unambiguously. In mineral separates containing two white micas, Ca/K and Cl/K ratios were variable, reflecting non-simultaneous laboratory degassing of the two heterochemical Ar-reservoirs. These ratios were used to identify each...

  5. Radiopacity of root filling materials

    International Nuclear Information System (INIS)

    A method for measuring the radiopacity of root filling materials is described. Direct measurements were made of the optic density values of the materials in comparison with a standard curve relating optic density to the thickness of an aluminium step wedge exposed simultaneously. By proper selection of film and conditions for exposure and development, it was possible to obtain a near-linear standard curve which added to the safety and reproducibility of the method. The technique of radiographic assessment was modified from clinical procedures in evaluating the obturation in radiographs, and it was aimed at detecting slits or voids between the dental wall and the filling material. This radiographic assessment of potensial leakage was compared with actual in vitro lekage of dye (basic fuchsin) into the roots of filled teeth. The result of the investigation show that root filling materials display a very wide range of radiopacity, from less than 3 mm to more than 12 mm of aluminium. It also seem that tooth roots that appear to be well obturated by radiographic evaluation, stand a good chance of beeing resistant to leakage in vitro, and that the type of filling material rather than its radiographic appearance, determines the susceptibility of the filled tooth to leakage in vitro. As an appendix the report contains a survey of radiopaque additives in root filling materials

  6. Subterranean production of neutrons, $^{39}$Ar and $^{21}$Ne: Rates and uncertainties

    OpenAIRE

    Šrámek, Ondřej; Stevens, Lauren; William F. McDonough; Mukhopadhyay, Sujoy; Peterson, R. J.

    2015-01-01

    Accurate understanding of the subsurface production of radionuclide $^{39}$Ar rate is necessary for argon dating techniques and noble gas geochemistry of the shallow and the deep Earth, and is also of interest to the WIMP dark matter experimental particle physics community. Our new calculations of subsurface production of neutrons, $^{21}$Ne, and $^{39}$Ar take advantage of the best available tools of nuclear physics to obtain reaction cross sections and spectra (TALYS) and to evaluate neutro...

  7. Ion species and electron behavior in capacitively coupled Ar and O2 plasma

    International Nuclear Information System (INIS)

    We investigated the change in electron density using the plasma frequency by the wave cutoff method, and the behavior of ion species with a quadrupole mass spectrometer (QMS) in pure Ar and O2 and mixed O2/Ar plasmas. The change in electron and ion density in pure Ar and O2 plasmas was evaluated while varying such process conditions as rf power and pressure. We found that electron density in a pure Ar and O2 discharge is closely correlated to loss and generation of ions. The electron densities in both pure Ar and O2 plasmas increase with rf plasma power but show different dependence on pressure due to different loss mechanism for each type of gas. The addition of Ar to an O2 plasma significantly enhances the electron density due to the rapid increase of Ar+ ions regardless of the pressure. Also, Ar addition results in more dissociation of O2, which gives more atomic O. These results indicate that the electron density calculated from the plasma frequency, measured by the wave cutoff method, is well explained by the ion behavior, as characterized by QMS

  8. Ars grammatica de Dionisio Tracio

    Directory of Open Access Journals (Sweden)

    Beltrán Jorge Enrique

    2003-06-01

    Full Text Available

    Ars Grammatica de Dionisio Tracio (170-90 a. C fue la primera gramática griega que se escribió. Su contenido y método fueron modelos que siguieron las gramáticas escolares posteriores. La versión española que se presenta ahora responde a la necesidad que se tenía en nuestro medio de una traducción completa de este texto. Finalmente, se acompaña la traducción de una introducción y de abundantes notas, en un intento por hacerla comprensible para el hablante del español, no necesariamente conocedor de la lengua griega.

  9. Thermal plasma properties for Ar-Al, Ar-Fe and Ar-Cu mixtures used in welding plasmas processes: I. Net emission coefficients at atmospheric pressure

    Science.gov (United States)

    Cressault, Y.; Gleizes, A.

    2013-10-01

    This article is devoted to the calculation of the net emission coefficient (NEC) of Ar-Al, Ar-Fe and Ar-Cu mixtures at atmospheric pressure for arc welding processes. The results are given in data tables for temperatures between 3 kK and 30 kK, for five plasma thicknesses (0, 0.5, 1, 2, 5 mm) and ten concentrations of metallic vapours (pure gas, 0.01%, 0.1%, 1%, 5%, 10%, 25%, 50%, 75% and pure metal vapours in mass proportions). The results are in good agreement with most of the works published on the subject for such mixtures. They highlight the influence of three parameters on the radiation of the plasma: the NEC is directly related to temperature and inversely related to plasma radius and is highly sensitive to the presence of metal vapours. Finally, numerical data are supplied in tables in order to develop accurate computational modelling of welding arc and to estimate both qualitatively and quantitatively the influence of each metallic vapour on the size and on the shape of the weld pool.

  10. Removal of root filling materials.

    LENUS (Irish Health Repository)

    Duncan, H.F. Chong, B.S.

    2011-05-01

    Safe, successful and effective removal of root filling materials is an integral component of non-surgical root canal re-treatment. Access to the root canal system must be achieved in order to negotiate to the canal terminus so that deficiencies in the original treatment can be rectified. Since a range of materials have been advocated for filling root canals, different techniques are required for their removal. The management of commonly encountered root filling materials during non-surgical re-treatment, including the clinical procedures necessary for removal and the associated risks, are reviewed. As gutta-percha is the most widely used and accepted root filling material, there is a greater emphasis on its removal in this review.

  11. Seismic performance of hillside fills

    OpenAIRE

    Stewart, Jonathan P.; Bray, Jonathan D; McMahon, David J; Smith, Patrick M.; Kropp, Alan L

    2001-01-01

    Permanent ground deformations in unsaturated, compacted hillside fills under seismic loading conditions are discussed, with emphasis given to fill performance during the 1994 Northridge earthquake. These movements represent a significant yet often unrecognized hazard to developed hillside areas, as relatively modest deformations induced widespread damage totaling hundreds of millions of dollars during the Northridge event. The development of grading standards in the Los Angeles area is review...

  12. Safety Injection System Filling Using Dynamic Venting

    Energy Technology Data Exchange (ETDEWEB)

    Hong, Sung Je; Kim, Wong Bae; Huh, Jin; Lee, Joo Hee; Im, In Young; Kim, Eun kee [KEPCO Engineering and Construction Company, Daejeon (Korea, Republic of)

    2015-05-15

    In the APR+, the water-level elevation of the in-containment refueling water storage tank (IRWST) is lower than the highest piping of the SIS. Since the gravity filling of water from IRWST cannot fill all SIS piping, an SIP or an SCP test line is newly provided in order to allow the dynamic venting of the SIS. NEI 09-10 Revision 1a-A has concluded that use of dynamic venting is an effective means to remove gas from local high points and traps in piping when correctly based on the dynamic flow rate, void volume, Floude number, and the system water volume. In this study, feasibility of the dynamic vent is investigated. The work presented in this study evaluates the SIS and the SCS filling using the dynamic venting which is supposed to be applied to the APR+. The main ideas are as follows; 1. Dynamic venting using SIPs for the APR+ is not appropriate on the basis of 12 inches in diameter and with the flow rate, 1,460 gpm. 2. Because the high point of the SIS and the SCS is located at the piping that the two systems are sharing, the accumulated gas at the highest point can be removed by using the SCPs, and the dimension of the new piping will be determined by its length of them and the number of elbows. The calculated results are shown in Table 2. 3. The applicability of the dynamic venting methods using the SCPs that are mentioned above should be evaluated in the aspect of the system operation after the piping arrangements are settled in the APR+. The assessments to determine the pump operation time are also required.

  13. Development of a Low-Level Ar-37 Calibration Standard

    Energy Technology Data Exchange (ETDEWEB)

    Williams, Richard M.; Aalseth, Craig E.; Bowyer, Ted W.; Day, Anthony R.; Fuller, Erin S.; Haas, Derek A.; Hayes, James C.; Hoppe, Eric W.; Humble, Paul H.; Keillor, Martin E.; LaFerriere, Brian D.; Mace, Emily K.; McIntyre, Justin I.; Miley, Harry S.; Myers, Allan W.; Orrell, John L.; Overman, Cory T.; Panisko, Mark E.; Seifert, Allen

    2016-03-07

    Argon-37 is an important environmental signature of an underground nuclear explosion. Producing and quantifying low-level 37Ar standards is an important step in the development of sensitive field measurement instruments for use during an On-Site Inspection, a key provision of the Comprehensive Nuclear-Test-Ban Treaty. This paper describes progress at Pacific Northwest National Laboratory (PNNL) in the development of a process to generate and quantify low-level 37Ar standard material, which can then be used to calibrate sensitive field systems at activities consistent with soil background levels. The 37Ar used for our work was generated using a laboratory-scale, high-energy neutron source to irradiate powdered samples of calcium carbonate. Small aliquots of 37Ar were then extracted from the head space of the irradiated samples. The specific activity of the head space samples, mixed with P10 (90% stable argon:10% methane by mole fraction) count gas, is then derived using the accepted Length-Compensated Internal-Source Proportional Counting method. Due to the low activity of the samples, a set of three Ultra-Low Background Proportional-Counters designed and fabricated at PNNL from radio-pure electroformed copper was used to make the measurements in PNNL’s shallow underground counting laboratory. Very low background levels (<10 counts/day) have been observed in the spectral region near the 37Ar emission feature at 2.8 keV. Two separate samples from the same irradiation were measured. The first sample was counted for 12 days beginning 28 days after irradiation, the second sample was counted for 24 days beginning 70 days after irradiation (the half-life of 37Ar is 35.0 days). Both sets of measurements were analyzed and yielded very similar results for the starting activity (~0.1 Bq) and activity concentration (0.15 mBq/ccSTP argon) after P10 count gas was added. A detailed uncertainty model was developed based on the ISO Guide to the Expression of Uncertainty in

  14. XRD-based 40Ar/39Ar age correction for fine-grained illite, with application to folded carbonates in the Monterrey Salient (northern Mexico)

    Science.gov (United States)

    Fitz-Díaz, Elisa; Hall, Chris M.; van der Pluijm, Ben A.

    2016-05-01

    Due to their minute size, 40Ar/39Ar analysis of illite faces significant analytical challenges, including mineral characterization and, especially, effects of grain size and crystallography on 39Ar recoil. Quantifying the effects of 39Ar recoil requires the use of sample vacuum encapsulation during irradiation, which permits the measurement of the fraction of recoiled 39Ar as well as the 39Ar and 40Ar∗ retained within illite crystals that are released during step heating. Total-Gas Ages (TGA) are calculated by using both recoiled and retained argon, which is functionally equivalent to K-Ar ages, while Retention Ages (RA) only involve retained Ar in the crystal. Natural applications have shown that TGA fits stratigraphic constraints of geological processes when the average illite crystallite thickness (ICT) is smaller than 10 nm, and that RA matches these constraints for ICTs larger than 50 nm. We propose a new age correction method that takes into account the average ICT and corresponding recoiled 39Ar for a sample, with X-ray Corrected Ages (XCA) lying between Total-Gas and Retention Ages depending on ICT. This correction is particularly useful in samples containing authigenic illite formed in the anchizone, with typical ICT values between 10 and 50 nm. In three samples containing authigenic illite from Cretaceous carbonates in the Monterrey Salient in northern Mexico, there is a range in TGAs among the different size-fractions of 46-49, 36-43 and 40-52 Ma, while RAs range from 54-64, 47-52 and 53-54 Ma, respectively. XCA calculations produce tighter age ranges for these samples of 52.5-56, 45.5-48.5 and 49-52.5 Ma, respectively. In an apparent age vs ICT or %2M 1illite plot, authigenic illite grains show a slope that is in general slightly positive for TGA, slightly negative for RA, but close to zero for XCA, with thinner crystallites showing more dispersion than thicker ones. In order to test if dispersion is due to a different formation history or the result

  15. Laser vision based adaptive fill control system for TIG welding

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    The variation of joint groove size during tungsten inert gas (TIG) welding will result in the non-uniform fill of deposited metal. To solve this problem, an adaptive fill control system was developed based on laser vision sensing. The system hardware consists of a modular development kit (MDK) as the real-time image capturing system, a computer as the controller, a D/A conversion card as the interface of controlled variable output, and a DC TIG welding system as the controlled device. The system software is developed and the developed feature extraction algorithm and control strategy are of good accuracy and robustness. Experimental results show that the system can implement adaptive fill of melting metal with high stability, reliability and accuracy. The groove is filled well and the quality of the weld formation satisfies the relevant industry criteria.

  16. Time Dependant Weld Shape in Ar-O2 Shielded Stationary GTA Welding

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    The stationary gas tungsten arc welding (GTA) is carried out on SUS304 stainless steel under Ar-0.1%O2 and Ar-0.3%O2 mixed shielding to observe the evolution of the molten pool and investigate the role of Marangoni convection on the weld shape. After welding, the oxygen content in the weld metal was measured by using an oxygen/nitrogen analyzer. Small addition of oxygen to the argon based shielding gas can effectively adjust the weld pool oxygen content. Oxygen plays an important role as an surface active element in determining the pattern of Marangoni convection in the stainless steel weld pool. When the weld metal oxygen content is over the critical value, 0.01 wt pet, corresponding to the Ar-0.3%O2 mixed shielding gas, the Marangoni convection changes from outward to inward direction and the weld shape dramatically changes from wide shallow shape to narrow deep shape.

  17. 244-AR Vault Interim Stabilization Project Plan

    International Nuclear Information System (INIS)

    The 244-AR Vault Facility, constructed between 1966 and 1968, was designed to provide lag storage and treatment for the Plutonium-Uranium Extraction Facility (PUREX) tank farm sludges. Tank farm personnel transferred the waste from the 244-AR Vault Facility to B Plant for recovery of cesium and strontium. B Plant personnel then transferred the treatment residuals back to the tank farms for storage of the sludge and liquids. The last process operations, which transferred waste supporting the cesium/strontium recovery mission, occurred in April 1978. After the final transfer in 1978, the 244-AR facility underwent a cleanout. However, 2,271 L (600 gal) of sludge were left in Tank 004AR from an earlier transfer from Tank 241-AX-104. When the cleanout was completed, the facility was placed in a standby status. The sludge had been transferred to Tank 004AR to support Pacific Northwest National Laboratory [PNNL] vitrification work. Documentation of waste transfers suggests that a portion of the sludge may have been moved from Tank 004AR to Tank 002AR in preparation for transfer back to the AX Tank Farm; however, quantities of the sludge that were moved to Tank 002AR from that transfer must be estimated

  18. Study of the symbiotic star AR Pavonis

    Directory of Open Access Journals (Sweden)

    C. Quiroga

    2001-01-01

    Full Text Available We present a study of the optical spectra and linear polarization of the eclipsing binary AR Pavonis. The optical spectra were obtained between 1990 and 1998, and polarimetric data between 1995 and 1998. From spectroscopic variations along the orbital motion we analized the nature of the system. Polarimetric studies indicate that AR Pav has intrinsic polarization.

  19. REACTOR FILLED WITH CATALYST MATERIAL, AND CATALYST THEREFOR

    NARCIS (Netherlands)

    Sie, S.T.

    1995-01-01

    Abstract of WO 9521691 (A1) Described is a reactor (1) at least partially filled with catalyst granules (11), which is intended for catalytically reacting at least one gas and at least one liquid with each other. According to the invention the catalyst granules (11) are collected in agglomerates

  20. Ultrasonically determined fill pressure and density in closed spherical shells

    International Nuclear Information System (INIS)

    Experiments have been conducted in which the D2 fill pressure has been determined for several closed millimeter-size aluminum and beryllium shells. The vibrational resonance frequency spectrum of the shells was used to calculate the sound velocity of the interior gas. This velocity, along with the equation-of-state, determined the gas pressure and density. The accuracy in determining the fill conditions is within 0.5% in both pressure and density for near critical density (ρ approx-gt 9 mol/L) gas over a wide range of temperatures (190 K to 300 K). Reduced accuracy was apparent at low density. An attempt was made to determine the fill density of one shell by acoustic observation of the dew point temperature. While this temperature was recorded very accurately, the uncertainty in the saturated vapor density curve near the critical point yielded inaccurate results. These methods were shown to be unaffected by small deviations in the sphericity of the gas-filled cavity

  1. Variable leak gas source

    Science.gov (United States)

    Henderson, Timothy M.; Wuttke, Gilbert H.

    1977-01-01

    A variable leak gas source and a method for obtaining the same which includes filling a quantity of hollow glass micro-spheres with a gas, storing said quantity in a confined chamber having a controllable outlet, heating said chamber above room temperature, and controlling the temperature of said chamber to control the quantity of gas passing out of said controllable outlet. Individual gas filled spheres may be utilized for calibration purposes by breaking a sphere having a known quantity of a known gas to calibrate a gas detection apparatus.

  2. The Coronae of AR Lac

    CERN Document Server

    Huenemoerder, D P; Drake, J J; Sanz-Forcada, J; Canizares, Claude R.; Drake, Jeremy J.; Huenemoerder, David P.; Sanz-Forcada, Jorge

    2003-01-01

    We observed the coronally active eclipsing binary, AR Lac, with the High Energy Transmission Grating on Chandra for a total of 97 ks, spaced over five orbits, at quadratures and conjunctions. Contemporaneous and simultaneous EUV spectra and photometry were also obtained with the Extreme Ultraviolet Explorer. Significant variability in both X-ray and EUV fluxes were observed, dominated by at least one X-ray flare and one EUV flare. We saw no evidence of primary or secondary eclipses. X-ray flux modulation was largest at high temperature, indicative of flare heating of coronal plasma. Line widths interpreted in terms of Doppler broadening suggest that both binary stellar components are active. From line fluxes obtained from total integrated spectra, we have modeled the emission measure and abundance distributions. A strong maximum was found in the differential emission measure, characterized by peaks at log T = 6.9 and 7.4, together with a weak but significant cooler maximum near log T=6.2, and a moderately str...

  3. Analysis of Ar line spectra from indirectly-driven implosion experiments on SGII facility

    Institute of Scientific and Technical Information of China (English)

    Pu Yu-Dong; Zhang Ji-Yan; Yang Jia-Min; Huang Tian-Xuan; Ding Yong-Kun

    2011-01-01

    This paper reports on the indirectly-driven implosion experiments on SGII laser facility in which Ar emission spectrum from Ar-doped D-filled plastic capsule is recorded with the crystal spectrometer. Spectral features of Ar Heβ line and its associated satellites are analysed to extract the electron temperature and density of the implosion core. Non local thermal equilibrium (NLTE) collisional-radiative atomic kinetics and Strark broadening line shape are included in the present calculation. By comparing the calculated spectrum with the measured one, the core electron temperature and density are inferred to be 700 eV and 2.5 × 1023 cm-3 respectively. With these inferred values of electron temperature and density, neutron yield can be estimated to agree with the measured value in magnitude despite of the very simple model used for the estimation.

  4. Membrane lipid composition of pancreatic AR42J cells: modification by exposure to different fatty acids.

    Science.gov (United States)

    Audi, Nama'a; Mesa, María D; Martínez, María A; Martínez-Victoria, Emilio; Mañas, Mariano; Yago, María D

    2007-04-01

    Dietary fat type influences fatty acids in rat pancreatic membranes, in association with modulation of secretory activity and cell signalling in viable acini. We aimed to confirm whether AR42J cells are a valid model to study the interactions between lipids and pancreatic acinar cell function. For this purpose we have (i) compared the baseline fatty acid composition of AR42J cells with that of pancreatic membranes from rats fed a standard chow; (ii) investigated if fatty acids in AR42J membranes can be modified in culture; and (iii) studied if similar compositional variations that can be evoked in rats when dietary fat type is altered occur in AR42J cells. Weaning Wistar rats were fed for 8 weeks either a commercial chow (C) or semi-purified diets containing virgin olive oil (VOO) or sunflower oil (SO) as fat source. AR42J cells were incubated for 72 hrs in medium containing unmodified fetal calf serum (FCS, AR42J-C cells), FCS enriched with 18:1 n-9 (AR42J-O cells), or FCS enriched with 18:2 n-6 (AR42J-L cells). Fatty acids in crude membranes from rat pancreas and AR42J cells were determined by gas-liquid chromatography. Differences in membrane fatty acids between C rats and AR42J-C cells can be explained in part by variations in the amount of fatty acids in the extracellular environment. Supplementation of FCS with 18:1 n-9 or 18:2 n-6 changed the fatty acid spectrum of AR42J cells in a manner that resembles the pattern found, respectively, in VOO and SO rats, although AR42J-L cells were unable to accumulate 20:4 n-6. The AR42J cell line can be a useful tool to assess the effect of membrane compositional changes on acinar cell function. However, differences in baseline characteristics, and perhaps fatty acid metabolism, indicate that results obtained in AR42J cells should be confirmed with experiments in the whole animal.

  5. 40Ar/39Ar ages of lunar impact glasses: Relationships among Ar diffusivity, chemical composition, shape, and size

    CERN Document Server

    Zellner, N E B

    2015-01-01

    Lunar impact glasses, quenched melts produced during cratering events on the Moon, have the potential to provide not only compositional information about both the local and regional geology of the Moon but also information about the impact flux over time. We present in this paper the results of 73 new 40Ar/39Ar analyses of well-characterized, inclusion-free lunar impact glasses and demonstrate that size, shape, chemical composition, fraction of radiogenic 40Ar retained, and cosmic ray exposure (CRE) ages are important for 40Ar/39Ar investigations of these samples. Specifically, analyses of lunar impact glasses from the Apollo 14, 16, and 17 landing sites indicate that retention of radiogenic 40Ar is a strong function of post-formation thermal history in the lunar regolith, size, and chemical composition. Based on the relationships presented in this paper, lunar impact glasses with compositions and sizes sufficient to have retained 90% of their radiogenic Ar during 750 Ma of cosmic ray exposure at time-integra...

  6. 40Ar/39Ar and K-Ar data bearing on the metamorphic and tectonic history of western New England.

    Science.gov (United States)

    Sutter, J.F.; Ratcliffe, N.M.; Mukasa, S.B.

    1985-01-01

    40Ar/39Ar ages of coexisting biotite and hornblende from Proterozoic Y gneisses of the Berkshire and Green Mt massifs, as well as 40Ar/39Ar and K/Ar mineral and whole-rock ages from Palaeozoic metamorphic rocks, suggest that the thermal peaks for the dominant metamorphic recrystallization in western New England occurred 465 + or - 5 m.y. (Taconian). 40Ar/39Ar age data from a poorly-defined terrain along the eastern strip of the area suggests that the area has been retrograded during a metamorphism that peaked at least 376 + or - 5 m.y. (Acadian). Available age and petrological data from western New England indicate the presence of at least three separate metamorphic-structure domains of Taconic age: 1) a small area of relict high-P and low-T metamorphism, 2) a broad area of normal Barrovian metamorphism from chlorite to garnet grade characterized by a gentle metamorphic gradient and, 3) a rather narrow belt of steep-gradient, Barrovian series metamorphic rocks. Areas of maximum metamorphic intensity within the last domain coincide with areas of maximum crustal thickening in the later stage of Taconic orogeny. -L.di H

  7. New accurate measurement of 36ArH+ and 38ArH+ ro-vibrational transitions by high resolution IR absorption spectroscopy

    CERN Document Server

    Cueto, M; Barlow, M J; Swinyard, B M; Herrero, V J; Tanarro, I; Domenech, J L

    2014-01-01

    The protonated Argon ion, $^{36}$ArH$^{+}$, has been identified recently in the Crab Nebula (Barlow et al. 2013) from Herschel spectra. Given the atmospheric opacity at the frequency of its $J$=1-0 and $J$=2-1 rotational transitions (617.5 and 1234.6 GHz, respectively), and the current lack of appropriate space observatories after the recent end of the Herschel mission, future studies on this molecule will rely on mid-infrared observations. We report on accurate wavenumber measurements of $^{36}$ArH$^{+}$ and $^{38}$ArH$^{+}$ rotation-vibration transitions in the $v$=1-0 band in the range 4.1-3.7 $\\mu$m (2450-2715 cm$^{-1}$). The wavenumbers of the $R$(0) transitions of the $v$=1-0 band are 2612.50135$\\pm$0.00033 and 2610.70177$\\pm$0.00042 cm$^{-1}$ ($\\pm3\\sigma$) for $^{36}$ArH$^{+}$ and $^{38}$ArH$^{+}$, respectively. The calculated opacity for a gas thermalized at a temperature of 100 K and a linewidth of 1 km.s$^{-1}$ of the $R$(0) line is $1.6\\times10^{-15}\\times N$($^{36}$ArH$^+$). For column densities ...

  8. 40Ar/39Ar ages of lunar impact glasses: Relationships among Ar diffusivity, chemical composition, shape, and size

    Science.gov (United States)

    Zellner, N. E. B.; Delano, J. W.

    2015-07-01

    Lunar impact glasses, which are quenched melts produced during cratering events on the Moon, have the potential to provide not only compositional information about both the local and regional geology of the Moon but also information about the impact flux over time. We present in this paper the results of 73 new 40Ar/39Ar analyses of well-characterized, inclusion-free lunar impact glasses and demonstrate that size, shape, chemical composition, fraction of radiogenic 40Ar retained, and cosmic ray exposure (CRE) ages are important for 40Ar/39Ar investigations of these samples. Specifically, analyses of lunar impact glasses from the Apollo 14, 16, and 17 landing sites indicate that retention of radiogenic 40Ar is a strong function of post-formation thermal history in the lunar regolith, size, and chemical composition. This is because the Ar diffusion coefficient (at a constant temperature) is estimated to decrease by ∼3-4 orders of magnitude with an increasing fraction of non-bridging oxygens, X(NBO), over the compositional range of most lunar impact glasses with compositions from feldspathic to basaltic. Based on these relationships, lunar impact glasses with compositions and sizes sufficient to have retained ∼90% of their radiogenic Ar during 750 Ma of cosmic ray exposure at time-integrated temperatures of up to 290 K have been identified and are likely to have yielded reliable 40Ar/39Ar ages of formation. Additionally, ∼50% of the identified impact glass spheres have formation ages of ⩽500 Ma, while ∼75% of the identified lunar impact glass shards and spheres have ages of formation ⩽2000 Ma. Higher thermal stresses in lunar impact glasses quenched from hyperliquidus temperatures are considered the likely cause of poor survival of impact glass spheres, as well as the decreasing frequency of lunar impact glasses in general with increasing age. The observed age-frequency distribution of lunar impact glasses may reflect two processes: (i) diminished

  9. QENS investigation of filled rubbers

    CERN Document Server

    Triolo, A; Desmedt, A; Pieper, J K; Lo Celso, F; Triolo, R; Negroni, F; Arrighi, V; Qian, H; Frick, B

    2002-01-01

    The polymer segmental dynamics is investigated in a series of silica-filled rubbers. The presence of inert fillers in polymers greatly affects the mechanical and physical performance of the final materials. For example, silica has been proposed as a reinforcing agent of elastomers in tire production. Results from quasielastic neutron scattering and Dynamic Mechanical Thermal Analysis (DMTA) measurements are presented on styrene-ran-butadiene rubber filled with silica. A clear indication is obtained of the existence of a bimodal dynamics, which can be rationalized in terms of the relaxation of bulk rubber and the much slower relaxation of the rubber adsorbed on the filler surface. (orig.)

  10. QENS investigation of filled rubbers

    International Nuclear Information System (INIS)

    The polymer segmental dynamics is investigated in a series of silica-filled rubbers. The presence of inert fillers in polymers greatly affects the mechanical and physical performance of the final materials. For example, silica has been proposed as a reinforcing agent of elastomers in tire production. Results from quasielastic neutron scattering and Dynamic Mechanical Thermal Analysis (DMTA) measurements are presented on styrene-ran-butadiene rubber filled with silica. A clear indication is obtained of the existence of a bimodal dynamics, which can be rationalized in terms of the relaxation of bulk rubber and the much slower relaxation of the rubber adsorbed on the filler surface. (orig.)

  11. Morphology and photoluminescence properties of ZnO nanostructures fabricated with different given time of Ar

    Energy Technology Data Exchange (ETDEWEB)

    Wang, D.D. [Key Laboratory of Excited State Processes, Changchun Institute of Optics, Fine Mechanics and Physics, Chinese Academy of Sciences, Changchun (China); Graduate School of the Chinese Academy of Sciences, Beijing (China); Yang, J.H. [The Institute of Condensed Matter Physics, Jilin Normal University, Siping (China); Key Laboratory of Excited State Processes, Changchun Institute of Optics, Fine Mechanics and Physics, Chinese Academy of Sciences, Changchun (China); Graduate School of the Chinese Academy of Sciences, Beijing (China); Yang, L.L.; Zhang, Y.J.; Lang, J.H.; Gao, M. [The Institute of Condensed Matter Physics, Jilin Normal University, Siping (China)

    2008-10-15

    ZnO nanostructures were grown on Au-coated Si(100) substrates by carbonthermal reduction method with the help of Ar at the beginning of growth. The structural and optical properties of ZnO nanostructures strongly depended on the supply time of Ar. When the given time of Ar gas current was 90s, sample was ZnO nanowires with hexagonal morphology. The Raman spectroscopy revealed the low level of oxygen vacancies and Zn interstitials in samples. Room temperature photoluminescence (PL) spectra exhibited the intensity of green emission increased on the condition of rich oxygen (decrease given time of Ar) and the nanowire had strongest intensity of UV emission compared with other nanostructures. Green emission is ascribed to the electron transition from the bottom of the conduction band to the antisite defect O{sub Zn} level. (copyright 2008 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  12. arXiv.org and Physics Education

    Science.gov (United States)

    Ramlo, Susan

    2007-09-01

    The website arXiv.org (pronounced archive) is a free online resource for full-text articles in the fields of physics, mathematics, computer science, nonlinear science, and quantitative biology that has existed for about 15 years. Available directly at http://www.arXiv.org, this e-print archive is searchable. As of Jan. 3, 2007, arXiv had open access to 401,226 e-prints in the topic areas. Those who sign up for an ID and password can also sign up for daily submission abstract emails for specific subject classes of arXiv, including physics education, physics and society, and history of physics. Founded and developed by Paul Ginsparg when he was at Los Alamos National Laboratory, arXiv's original name was the LANL preprint archive or xxx.lanl.gov. The location and name changed after Ginsparg moved to the physics department at Cornell University. Today, arXiv is hosted and operated by Cornell University library. Mirror sites for arXiv exist worldwide.2

  13. Brain Responses to Filled Gaps

    Science.gov (United States)

    Hestvik, Arild; Maxfield, Nathan; Schwartz, Richard G.; Shafer, Valerie

    2007-01-01

    An unresolved issue in the study of sentence comprehension is whether the process of gap-filling is mediated by the construction of empty categories (traces), or whether the parser relates fillers directly to the associated verb's argument structure. We conducted an event-related potentials (ERP) study that used the violation paradigm to examine…

  14. Evacuation from smoke filled corridors

    NARCIS (Netherlands)

    Janse, E.W.; Leur, P.H.E. van de; Oerle, N.J. van

    1998-01-01

    underpinning compartmentation requirements in the Dutch regulations is that people can and will go through 30 m of smoke filled space. The hypothesis leads to the requirement that corridors are divided in compartments with a maximum length of 30 meters. This hypothesis was checked experimentally in

  15. Contemporary root canal filling strategies

    NARCIS (Netherlands)

    A.T. Moinzadeh

    2016-01-01

    Currently, clinicians can choose from a wide range of root canal filling materials and techniques, some of which have been evaluated in this thesis. Methacrylate resin-based sealers suffer from polymerization shrinkage stresses. This limitation may partly be overcome by a two-step cementation proced

  16. Gas filling pattern in Paleozoic marine carbonate reservoir of Ordos Basin%鄂尔多斯盆地海相碳酸盐岩层系天然气成藏研究

    Institute of Scientific and Technical Information of China (English)

    刘全有; 金之钧; 王毅; 韩品龙; 陶冶; 王起琮; 任站利; 李文厚

    2012-01-01

    Two sets of high quality marine source rocks in Ordos basin, including Upper Oidovician marl in Beiguoshan Formation and Middle Ordovician shale at middle and bottom parts of Pingliang Formation, were a progenitor of the past crude oil in marine carbonate reservoir and present oil-type gas which was sourced from oil cracking in Jingbian gas pooL Two sets of marine source rocks were distributed in the west and southwest of Ordos basin as " L" shape and absent in internal basin, with thickness of about 50 ~ 350m. TOC value in Middle Ordoviuian Pingiiang shale is in range of 0.5% -1.2% (average value = 0.9%), and Pingiiang limestone has TOC value of 0. 2% ~ 0. 4% (average value = 0. 3% ). TOC value in Upper Ordovician Beiguoshan source rock is more than that of Pingiiang source rock, with TOC value of 0. 22% - 3. 3% ( average value = 0.93% ). At end of Triassie, crude oil generated from two sets of high quality marine source rocks was migrated into the slope of Central Paleouplift and accumulated as an oil pooL At period of Jurassic and Early Craterous, large buried thickness and increasing geothermal gradient made not only high-over maturity of marine source rocks, but also temperature of oil reservoir more than 180t, and then the early etude oil started thermally cracking into natural gas. Increase of gas reservoir pressure which was formed by thermal cracking of oil and gas pushed natural gas diffused. At the IV episode of Yanshan Movement (corresponding to Later Cretaceous), large scale continue extrusion and uplift in the eastern part of Ordos Basin caused the structural reversion of gas reservoir from west high and east low to east high and west low, that is called as structural hinge. Thus, the predominance of oil and gas accumulation in the Central Paleo-uplift was changed. Oil cracking gas was migrated toward east or northeast, but gas was laterally blocked by salt, gypsum and fine carbonate in the eastern basin. The Carboniferous bauxitic mudstone beneath

  17. Instrumentation development for planetary in situ 40Ar/39Ar geochronology

    Science.gov (United States)

    Davidheiser-Kroll, B.; Morgan, L. E.; Munk, M.; Warner, N. H.; Gupta, S.; Slaybaugh, R.; Harkness, P.; Mark, D. F.

    2015-12-01

    The chronology of the Solar System, particularly the timing of formation of extraterrestrial bodies and their features, is a major outstanding problem in planetary science. Although various chronological methods for in situ geochronology have been proposed (e.g. Rb-Sr, K-Ar), and even applied (K-Ar, Farley et al., 2014), the reliability, accuracy, and applicability of the 40Ar/39Ar method makes it by far the most desirable chronometer for dating extraterrestrial bodies. The method however relies on the neutron irradiation of samples, and thus a neutron source. We will discuss the challenges and feasibility of deploying a passive neutron source to planetary surfaces for the in situ application of the 40Ar/39Ar chronometer. Requirements in generating and shielding neutrons, as well as analyzing samples are discussed, along with an exploration of limitations such as mass, power, and cost. Two potential solutions for the in situ extraterrestrial deployment of the 40Ar/39Ar method will be presented. Although this represents a challenging task, developing the technology to apply the 40Ar/39Ar method on planetary surfaces would represent a major advance towards constraining the timescale of solar system formation and evolution.

  18. Ars Baltica-verkoston puheenjohtajuus Suomeen Risto Ruohoselle

    Index Scriptorium Estoniae

    1999-01-01

    1990. a. loodud võrgustiku Ars Baltica sekretariaat (Ars Baltica Contact Point & Communication Center) tuleb Kielist Tallinnasse Eesti kultuuriministeeriumi kuni aastani 2002 (Suur-Karja 23). Ars Baltica (ühendus)

  19. Aging Studies of Filled and Unfilled VCE

    Energy Technology Data Exchange (ETDEWEB)

    Letant, S; Herberg, J; Alviso, C; Small, W; Mulcahy, H; Pearson, M; Wilson, T; Chinn, S; Maxwell, R

    2009-11-10

    This report presents data on the effects of temperature and gamma radiation on the chemical and structural properties of both filled and unfilled VCE material produced by the Kansas City Plant using WR-qualified processes. Thermal effects up to 300 C and gamma irradiation doses of 1 MRad and 25 MRad were investigated under atmospheric conditions. Characterization techniques used in the study comprise Thermogravimetric Analysis (TGA), Differential Scanning Calorimetry (DSC), X-ray Diffraction (XRD), Tensile Testing, Solid Phase MicroExtraction - Gas Chromatography/Mass Spectrometry (SPME-GC/MS), phenol extraction followed by HPLC, and various Nuclear Magnetic Resonance (NMR) techniques including: {sup 13}C, {sup 13}C {l_brace}{sup 1}H{r_brace} cross polarization (CP), {sup 1}H magic angle spinning (MAS), 13C{l_brace}{sup 1}H{r_brace} Wide-line-Separation (2D-WISE) and development of Center band-Only Detection of Exchange (CODEX).

  20. Numerical simulation and analysis of mould filling process in lost foam casting

    Institute of Scientific and Technical Information of China (English)

    Jiang Junxia; Wu Zhichao; Chen Liliang; Hao Jing

    2008-01-01

    In lost foam casting (LFC) the foam pattern is the key criterion, and the filling process is crucial to ensure the high quality of the foam pattern. Filling which lacks uniformity and denseness will cause various defects and affect the surface quality of the casting. The influential factors of the filling process are realized in this research. Optimization of the filling process, enhancement of efficiency, decrease of waste, etc., are obtained by the numerical simulation of the filling process using a computer. The equations governing the dense gas-solid two-phase flow are established, and the physical significance of each equation is discussed. The Euler/Lagrange numerical model is used to simulate the fluid dynamic characteristics of the dense two-phase flow during the mould filling process in lost foam casting. The experiments and numerical results showed that this method can be a very promising tool in the mould filling simulation of beads' movement.

  1. Ars ornata / Kadri Mälk

    Index Scriptorium Estoniae

    Mälk, Kadri, 1958-

    1998-01-01

    V rahvusvaheline ehtekunsti konverents 'Ars ornata Europeana' juuni lõpus Stockholmis. New Yorgis elava kuraatori Charon Kranseni ja prantsuse ehtekunstniku Christophe Burger' juhitud vestlusringidest. 1997. a. Pariisis loodud International Craft Design Association'ist (ICDA).

  2. ARS 01 Helsingi Kiasmas / Tarmo Virki

    Index Scriptorium Estoniae

    Virki, Tarmo

    2001-01-01

    Helsingis Kiasmas avatud rahvusvahelisest kunstinäitusest ARS 01 alapealkirjaga "Avanevaid perspektiive", kus esines oma töödega ka Marko Mäetamm. Näituse raames toimuvast Santiago Sierra kunstiprojektist kodututega

  3. Differential AR algorithm for packet delay prediction

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    Different delay prediction algorithms have been applied in multimedia communication, among which linear prediction is attractive because of its low complexity. AR (auto regressive) algorithm is a traditional one with low computation cost, while NLMS (normalize least mean square) algorithm is more precise. In this paper, referring to ARIMA (auto regression integrated with moving averages) model, a differential AR algorithm (DIAR) is proposed based on the analyses of both AR and NLMS algorithms. The prediction precision of the new algorithm is about 5-10 db higher than that of the AR algorithm without increasing the computation complexity.Compared with NLMS algorithm, its precision slightly improves by 0.1 db on average, but the algorithm complexity reduces more than 90%. Our simulation and tests also demonstrate that this method improves the performance of the average end-to-end delay and packet loss ratio significantly.

  4. "Ars Ornata" Mediterrania / Kadri Mälk

    Index Scriptorium Estoniae

    Mälk, Kadri, 1958-

    1999-01-01

    VI rahvusvaheline ehtekunstinäitus "Ars Ornata" juuni lõpus Barcelonas. Konverentsist, peanäitusest (osalejad Eestist), ehtekunstiõpetust andvast kõrgkoolist Escola Massana'st Barcelonas, õppejõude. Eesti ehtekunsti tulevikust.

  5. Stratigraphy and Ar/Ar geochronology of the Miocene lignite-bearing Tunçbilek-Domaniç Basin, western Anatolia

    Science.gov (United States)

    Helvacı, C.; Ersoy, E. Y.; Billor, M. Z.

    2016-08-01

    The Tunçbilek-Domaniç Basin is one of the Neogene basins containing economic coal deposits in western Anatolia, Turkey. The basin fill represents fluvial to lacustrine sedimentary units which are interlayered with volcanic rocks with bimodal composition. In order to reveal the stratigraphy and the exact ages of the basin fill and coal deposits, and to explore the tectonic evolution of the basin, we present new field data and Ar/Ar age data from the volcanic units. The field studies and the age data indicate that the whole basin fills were deposited between ~23 and ~19 Ma (Aquitanian-Early Burdigalian) without any unconformity. Taking into account the ages of the coal-bearing sedimentary units in the other Neogene basins in the region, it is concluded that most of the economic coal deposits in the western Anatolia were formed during Aquitanian. The field studies also show that the deposition of the sedimentary units in the basin was controlled by the NE-SW-trending strike- to oblique-slip normal faults. In a regional scale, tectonic evolution of the Tunçbilek-Domaniç Basin is linked to the differential stretching in the hanging wall of the southerly located, a crustal-scale low-angle detachment fault (the Simav detachment fault) that controlled the Early Miocene exhumation of the Menderes Extensional Core Complex.

  6. Reaction of Li with O2 in the presence of He or Ar

    International Nuclear Information System (INIS)

    The reaction of Li with O2 in the presence of He or Ar was studied at a temperature near 150 0C for inert gas pressures between 29 and 1500 Torr. In both cases, the rate of loss of free Li atoms was linear with O2 partial pressure between approximately 0.003 and 1.3 Torr, but had a more complex dependence on inert gas pressure. In He, the reaction probably proceeded by means of the energy transfer mechanism where the dominant intermediate was LiO2*. The results in Ar are consistent with a reaction occurring through both the energy transfer mechanism in which LiO2* plays an important role and the bound intermediate complex mechanism where LiAr is the primary intermediate

  7. Energy resolution of gas ionization chamber for high-energy heavy ions

    Science.gov (United States)

    Sato, Yuki; Taketani, Atsushi; Fukuda, Naoki; Takeda, Hiroyuki; Kameda, Daisuke; Suzuki, Hiroshi; Shimizu, Yohei; Nishimura, Daiki; Fukuda, Mitsunori; Inabe, Naohito; Murakami, Hiroyuki; Yoshida, Koichi; Kubo, Toshiyuki

    2014-01-01

    The energy resolution is reported for high-energy heavy ions with energies of nearly 340 MeV/nucleon and was measured using a gas ionization chamber filled with a 90%Ar/10%CH4 gas mixture. We observed that the energy resolution is proportional to the inverse of the atomic number of incident ions and to the inverse-square-root of the gas thickness. These results are consistent with the Bethe-Bloch formula for the energy loss of charged particles and the Bohr expression for heavy ion energy straggling. In addition, the influence of high-energy δ-rays generated in the detector on the energy deposition is discussed.

  8. The mass of $^{32}Ar$ and $^{33}Ar$ for fundamental tests

    CERN Document Server

    Blaum, K; Beck, D; Bollen, G; Herfurth, F; Kellerbauer, A G; Kluge, H J; Sauvan, E; Schwarz, S

    2003-01-01

    Masses of the short-lived radionuclides ^32Ar (T_1/2=98 ms) and ^33Ar (T_1/2=173 ms) have been determined with the Penning trap mass spectrometer ISOLTRAP. Relative uncertainties of 6.0 x 10_-8 (deltam=1.8 keV) and 1.4 x 10_-8 (deltam=0.44 keV), respectively, have been achieved. At present, these new mass data serve as the most stringent test of the quadratic form of the isobaric-multiplet mass equation IMME. Furthermore, the improved accuracy for the mass of ^32Ar yields a better constraint on scalar contributions to the weak interaction. New mass values have also been measured for ^44Ar and ^45Ar, and a 20sigma deviation for ^44Ar from the literature value was found and interpreted.

  9. 3c/4e [small sigma, Greek, circumflex]-type long-bonding competes with ω-bonding in noble-gas hydrides HNgY (Ng = He, Ne, Ar, Kr, Xe, Rn; Y = F, Cl, Br, I): a NBO/NRT perspective.

    Science.gov (United States)

    Zhang, Guiqiu; Li, Hong; Weinhold, Frank; Chen, Dezhan

    2016-03-21

    Noble-gas hydrides HNgY are frequently described as a single ionic form (H-Ng)(+)Y(-). We apply natural bond orbital (NBO) and natural resonance theory (NRT) analyses to a series of noble-gas hydrides HNgY (Ng = He, Ne, Ar, Kr, Xe, Rn; Y = F, Cl, Br, I) to gain quantitative insight into the resonance bonding of these hypervalent molecules. We find that each of the studied species should be better represented as a resonance hybrid of three leading resonance structures, namely, H-Ng(+ -):Y (I), H:(- +)Ng-Y (II), and H^Y (III), in which the "ω-bonded" structures I and II arise from the complementary donor-acceptor interactions nY → σ*HNg and nH → σ*NgY, while the "long-bond" ([small sigma, Greek, circumflex]-type) structure III arises from the nNg → [small sigma, Greek, circumflex]*HY/[small sigma, Greek, circumflex]HY interaction. The bonding for all of the studied molecules can be well described in terms of the continuously variable resonance weightings of 3c/4e ω-bonding and [small sigma, Greek, circumflex]-type long-bonding motifs. Furthermore, we find that the calculated bond orders satisfy a generalized form of "conservation of bond order" that incorporates both ω-bonding and long-bonding contributions [viz., (bHNg + bNgY) + bHY = bω-bonding + blong-bonding = 1]. Such "conservation" throughout the title series implies a competitive relationship between ω-bonding and [small sigma, Greek, circumflex]-type long-bonding, whose variations are found to depend in a chemically reasonable manner on the electronegativity of Y and the outer valence-shell character of the central Ng atom. The calculated bond orders are also found to exhibit chemically reasonable correlations with bond lengths, vibrational frequencies, and bond dissociation energies, in accord with Badger's rule and related empirical relationships. Overall, the results provide electronic principles and chemical insight that may prove useful in the rational design of noble-gas hydrides of

  10. Development of a laser detection system for Ar-39 and application to oceanographic mixing studies. Final report, October 1, 1980-March 31, 1984

    International Nuclear Information System (INIS)

    The report describes research aimed at developing an Ar-39 detector sensitive enough to be used in tracer studies of oceanic mixing, air-sea exchange processes, and deep-sea exchange processes. The concept of a generalized noble gas detector was accepted as the approach most likely to produce an Ar-39 detector. Reasons for the failure to achieve an Ar-39 detector and its future prospects are discussed

  11. 40Ar - 39Ar dating of meteorites and the history of chondrite parent bodies

    International Nuclear Information System (INIS)

    The 40Ar-39Ar analyses of eleven ordinary chondrites and the unique meteorite Pontylyfni are presented. Results of previous 40Ar-39Ar age analyses have shown that the uncertainty in the calculated ages arises principally from the difficulties of interpretation of release patterns obtained from stepped heating experiments. For this reason considerable attention is paid to identifying the causes of complicating features in the age spectra. The ages obtained range from 4.52Ga to a lower limit of 4.38Ga and it is inferred that these date the time of cooling of the chondrites after formation and metamorphism. (author)

  12. Ar-39-Ar-40 Evidence for Early Impact Events on the LL Parent Body

    Science.gov (United States)

    Dixon, E. T.; Bogard, D. D.; Garrison, D. H.; Rubin, A. E.

    2006-01-01

    We determined Ar-39-Ar-40 ages of eight LL chondrites, and one igneous inclusion from an LL chondrite, with the object of understanding the thermal history of the LL-chondrite parent body. The meteorites in this study have a range of petrographic types from LL3.3 to LL6, and shock stages from S1 to S4. These meteorites reveal a range of K-Ar ages from 23.66 to 24.50 Ga, and peak ages from 23.74 to 24.55 Ga. Significantly, three of the eight chondrites (LL4, 5, 6) have K-Ar ages of -4.27 Ga. One of these (MIL99301) preserves an Ar-39-Ar-40 age of 4.23 +/- 0.03 Ga from low-temperature extractions, and an older age of 4.52 +/- 0.08 Ga from the highest temperature extractions. In addition, an igneous-textured impact melt DOM85505,22 has a peak Ar-39-Ar-40 age of >= 4.27 Ga. We interpret these results as evidence for impact events that occurred at about 4.27 Ga on the LL parent body that produced local impact melts, reset the Ar-39-Ar-40 ages of some meteorites, and exhumed (or interred) others, resulting in a range of cooling ages. The somewhat younger peak age of 3.74 Ga from GR095658 (LL3.3) suggests an additional impact event close to timing of impact-reset ages of some other ordinary chondrites between 3.6-3.8 Ga. The results from MIL99301 suggest that some apparently unshocked (Sl) chondrites may have substantially reset Ar-39-Ar-40 ages. A previous petrographic investigation of MIL99301 suggested that reheating to temperatures less than or equal to type 4 petrographic conditions (600C) caused fractures in olivine to anneal, resulting in a low apparent shock stage of S1 (unshocked). The Ar-39-Ar-40 age spectrum of MIL99301 is consistent with this interpretation. Older ages from high-T extractions may date an earlier impact event at 4.52 +/- 0.08 Ga, whereas younger ages from lower-T extractions date a later impact event at 4.23 Ar-39-Ar-40 0.03 Ga that may have caused annealing of feldspar and olivine

  13. Multiple Electron Capture Processes in Slow Collisions of Ar9+ Ions with Na Atoms

    Institute of Scientific and Technical Information of China (English)

    ZhuXiaolong; ShaShan; LiuHuiping; WeiBaoren; MaXinwen; WangZhengling; CaoShiping; QianDongbing; YangZhihu

    2003-01-01

    Slow collisions of highly charged ions with neutral atoms and molecules are of great importance in basic atomic collision physics, Recently, we built a new research facility for atomic physics at the Institute of Modern Physics. We report here the multiple electron transfer processes in collisions of Ar9+ with Na gas target at energy of 180 keV.

  14. Contemporary root canal filling strategies

    OpenAIRE

    Moinzadeh, A.T.

    2016-01-01

    Currently, clinicians can choose from a wide range of root canal filling materials and techniques, some of which have been evaluated in this thesis. Methacrylate resin-based sealers suffer from polymerization shrinkage stresses. This limitation may partly be overcome by a two-step cementation procedure. This alternative placement technique results in an increase and homogenization of the adhesion of the material to intraradicular dentin. Subsequent research should aim at developing sealers wi...

  15. 40Ar/39Ar ages in deformed potassium feldspar: evidence of microstructural control on Ar isotope systematics

    Science.gov (United States)

    Reddy, Steven M.; Potts, Graham J.; Kelley, Simon P.

    2001-05-01

    Detailed field and microstructural studies have been combined with high spatial resolution ultraviolet laser 40Ar/39Ar dating of naturally deformed K-feldspar to investigate the direct relationship between deformation-related microstructure and Ar isotope systematics. The sample studied is a ~1,000 Ma Torridonian arkose from Skye, Scotland, that contains detrital feldspars previously metamorphosed at amphibolite-facies conditions ~1,700 Ma. The sample was subsequently deformed ~430 Ma ago during Caledonian orogenesis. The form and distribution of deformation-induced microstructures within three different feldspar clasts has been mapped using atomic number contrast and orientation contrast imaging, at a range of scales, to identify intragrain variations in composition and lattice orientation. These variations have been related to thin section and regional structural data to provide a well-constrained deformation history for the feldspar clasts. One hundred and forty-three in-situ 40Ar/39Ar analyses measured using ultraviolet laser ablation record a range of apparent ages (317-1030 Ma). The K-feldspar showing the least strain records the greatest range of apparent ages from 420-1,030 Ma, with the oldest apparent ages being found close to the centre of the feldspar away from fractures and the detrital grain boundary. The most deformed K-feldspar yields the youngest apparent ages (317-453 Ma) but there is no spatial relationship between apparent age and the detrital grain boundary. Within this feldspar, the oldest apparent ages are recorded from orientation domain boundaries and fracture surfaces where an excess or trapped 40Ar component resides. Orientation contrast images at a similar scale to the Ar analyses illustrate a significant deformation-related microstructural difference between the feldspars and we conclude that deformation plays a significant role in controlling Ar systematics of feldspars at both the inter- and intragrain scales even at relatively low

  16. Electron Cyclotron Resonance-Reactive Ion Etching of III-V Semiconductors by Cyclic Injection of CH4/H2/Ar and O2 with Constant Ar Flow

    Science.gov (United States)

    Haneji, Nobuo; Segami, Goh; Ide, Tomoyoshi; Suzuki, Tatsuya; Arakawa, Taro; Tada, Kunio; Shimogaki, Yukihiro; Nakano, Yoshiaki

    2003-06-01

    Electron cyclotron resonance-reactive ion etching (ECR-RIE) is very useful for fabricating semiconductor photonic devices and integrated circuits (PICs). The mixture gas of CH4/H2 is used for etching III-V semiconductors, but the carbon polymer film deposited on the surface during the etching process presents some problems. Thus, the polymer film must be ashed off using an O2 plasma. We introduced the cyclic injection of CH4/H2/Ar and O2 to ECR-RIE, and demonstrated that it was very useful for etching of InP. However, compound semiconductors containing Al (e.g., AlGaAs and InAlAs) react with oxygen and an alumina layer is formed, which cannot be etched by CH4/H2 etching. Therefore, we used a new cyclic etching process with constant Ar flow in the chamber to remove this alumina layer by Ar ion etching, and obtained good results for etching rate and surface morphology for the compound semiconductors containing Al. We also proposed a suitable combination of three cyclic etching procedures (continuous etching, cyclic etching without constant Ar flow and cyclic etching with constant Ar flow) for etching the multilayer heterostructure of III-V semiconductors including InP and/or compound semiconductors containing Al.

  17. ArDroneXT - Ar.Drone 2 eXTension for swarming and service hosting

    OpenAIRE

    Autefage, Vincent; Chaumette, Serge

    2013-01-01

    This is an Operating System Setup Guide. This report explains how to upgrade an Ar.Drone 2 for swarming and services hosting. In other words, it gives the technical information required to easily create a swarm of Ar.Drone 2 sharing a Wi-Fi network. Moreover, it describes the process to install new services and applications on the drone.

  18. A refined astronomically calibrated 40Ar/39Ar age for Fish Canyon sanidine

    NARCIS (Netherlands)

    Rivera, T.A.; Storey, M.; Zeeden, C.; Hilgen, F.J.; Kuiper, K.

    2011-01-01

    Intercalibration between the astronomical and radio-isotopic dating methods provides a means to improving accuracy and reducing uncertainty of an integrated, multi-chronometer geologic timescale. Here we report a high-precision 40Ar/39Ar age for the FishCanyon sanidine (FCs) neutron fluence monitor,

  19. Application of Cl2/BCl3/Ar Plasma Treatment in the Improvement of Ti/Al/Mo/Au Ohmic Contacts

    Directory of Open Access Journals (Sweden)

    Jacek Gryglewicz

    2016-01-01

    Full Text Available Significant improvement of Ti/Al/Mo/Au ohmic contacts deposited on previously Cl2/BCl3/Ar plasma treated surface was observed. The standard deviation of contact resistance was crucially reduced due to the incorporation of Cl2/BCl3/Ar plasma treatment. The Cl2:BCl3:Ar gas mixture was used in order to thin the top of AlGaN layer prior to deposition of Ti/Al/Mo/Au ohmic contacts. The surface morphology of AlGaN was investigated using scanning electron microscopy and atomic force microscopy. TLM measurements revealed a consequential decrease of contact resistivity.

  20. Application of Cl2/BCl3/Ar Plasma Treatment in the Improvement of Ti/Al/Mo/Au Ohmic Contacts

    OpenAIRE

    Jacek Gryglewicz; Wojciech Macherzynski; Andrzej Stafiniak; Bogdan Paszkiewicz; Regina Paszkiewicz

    2016-01-01

    Significant improvement of Ti/Al/Mo/Au ohmic contacts deposited on previously Cl2/BCl3/Ar plasma treated surface was observed. The standard deviation of contact resistance was crucially reduced due to the incorporation of Cl2/BCl3/Ar plasma treatment. The Cl2:BCl3:Ar gas mixture was used in order to thin the top of AlGaN layer prior to deposition of Ti/Al/Mo/Au ohmic contacts. The surface morphology of AlGaN was investigated using scanning electron microscopy and atomic force microscopy. TLM ...

  1. Modeling Augmented Reality User Interfaces with SSIML/AR

    Directory of Open Access Journals (Sweden)

    Arnd Vitzthum

    2006-06-01

    Full Text Available Augmented Reality (AR technologies open up new possibilities especially for task-focused domains such as assembly and maintenance. However, it can be noticed that there is still a lack of concepts and tools for a structured AR development process and an application specification above the code level. To address this problem we introduce SSIML/AR, a visual modeling language for the abstract specification of AR applications in general and AR user interfaces in particular. With SSIML/AR, three different aspects of AR user interfaces can be described: The user interface structure, the presentation of relevant information depending on the user’s current task and the integration of the user interface with other system components. Code skeletons can be generated automatically from SSIML/AR models. This enables the seamless transition from the design level to the implementation level. In addition, we sketch how SSIML/AR models can be integrated in an overall AR development process.

  2. AR-40 AR-39 Age of an Impact-Melt Lithology in DHOFAR 961

    Science.gov (United States)

    Frasl, B.; Cohen, B. A.; Li, Z.-H.; Jolliff, B.; Korotev, R.; Zeigler, R.

    2016-01-01

    The South Pole-Aitken (SPA) basin is the stratigraphically oldest identifiable lunar basin and is therefore one of the most important targets for absolute age-dating to help understand whether ancient lunar bombardment history smoothly declined or was punctuated by a cataclysm. The SPA basin also has another convenient property, a geochemically distinct interior, unobscured by extensive mare basalt fill. A case has been made for the possible origin of the Dhofar 961 lunar meteorite in the South Pole-Aitken (SPA) basin, based on comparing its composition with Lunar Prospector gamma-ray data for the interior of the SPA basin. Dhofar 961 contains several different impact-melt (IM) lithologies. Jolliff et al. described two classes of mafic impact-melt lithologies, one dominated by olivine (Lithology A) and the other by plagioclase (An 95-96.5) (Lithology B). Broad-beam analyses of these lithologies yielded (is) approximately 14.0 wt% FeO, 11.7 wt% MgO, and 15.4 wt% Al2O3. Lithologies A and B differ by approximately 2.5% Al2O3, 1.5% FeO and 1.5% MgO, consistent with the occurrence of olivine phenocrysts in A and plagioclase clasts in B. Both lithologies are considerably more mafic than the Apollo mafic impact-melt breccias, corresponding to olivine gabbronorite. Joy et al. used U-Pb dating to investigate phosphate fragments in the Dhofar 961 matrix and impact-melt clasts. Matrix phosphates have 4.34 to 4 Ga ages, consistent with ancient KREEP-driven magmatic episodes and Pre-Nectarian ((is) greater than 3.92 Ga). Phosphates found within Dhofar 961 crystalline impact melt breccia clasts range from 4.26 to 3.89 Ga, potentially recording events throughout the basin forming epoch of lunar history. The youngest reset ages in the Dhofar 961 sample represent an upper limit for the time of formation of the meteorite. Joy et al suggested this age represents the final impact that mixed and consolidated several generations of precursor rocks into the Dhofar meteorite group

  3. Numerical simulation of mould filling process for pressure plate and valve handle in LFC

    Directory of Open Access Journals (Sweden)

    Jiang Junxia

    2010-11-01

    Full Text Available In lost foam casting (LFC, the distribution of polymer beads during the bead filling process is not uniform, and the collision between polymer beads determines the distribution of two-phase flow of gas and solid. The interaction between the gas and solid phases reveals as coupling effect of the force that gas exerts on particles or vice versa, or that among particles. The gas-solid flow in filling process is nonlinearity, which makes the coupling effect an essential point to carry out a simulation properly. Therefore, information of each particle’s motion is important for acquiring the law of filling process. In bead filling process, compressed air is pressed into mold cavity, and discharged from gas vent, creating a pressure difference between outer and inner space near the gas vent. This pressure difference directly changes the spatial distribution and motion trace of gas and solid phases. In this paper, Discrete Element Method (DEM and Computational Fluid Dynamics (CFD are employed to simulate the fluid dynamic character based on Newton’s Third Law of Motion. The simulation results of some casting products such as pressure plate and valve handle are compared with the result obtained from practical experiment in order to test the feasibility of DEM. The comparison shows that this DEM method can be a very promising tool in the mould filling simulation of beads’ movement.

  4. Accurate and precise 40Ar/39Ar dating by high-resolution, multi-collection, mass spectrometry

    DEFF Research Database (Denmark)

    Storey, Michael; Rivera, Tiffany; Flude, Stephanie

    analog enabling precise measurement of very small 36Ar signals for accurate correction for atmospheric-derived 40Ar; (iii) higher mass resolution allows pseudo resolution of hydrocarbon isobaric interferences from 36Ar through to 40Ar; (iv) multi-collection, allowing more data to be gathered in a fixed...

  5. Neutrino Capture Reactions on $^{40}$Ar

    CERN Document Server

    Suzuki, Toshio

    2012-01-01

    Gamow-Teller (GT) strength in $^{40}$Ar is studied by shell-model calculations with monopole-based universal intearction, which has tensor components of $\\pi$\\rho$-meson exchanges. Calculated GT strength is found to be consistent with the experimental data obtained by recent ($p, n$) reactions. Neutrino capture cross sections on $^{40}$Ar for solar neutrinos from $^{8}$B are found to be enhanced compared with previous calculations. The reaction cross sections for multipoles other than $0^{+}$ and $1^{+}$ are obtained by random-phase approximation (RPA). Their contributions become important for neutrino energies larger than 50 MeV.

  6. Improved Ar(II) transition probabilities

    OpenAIRE

    Danzmann, K.; de Kock, M

    1986-01-01

    Precise Ar(II) branching ratios have been measured on a high current hollow cathode with a 1-m Fourier transform spectrometer. Absolute transition probabilities for 11 Ar(II) lines were calculated from these branching ratios and lifetime measurements published by Mohamed et al. For the prominent 4806 Å line, the present result is Aik = 7.12×107s-1 ±2.8%, which is in excellent agreement with recent literature data derived from pure argon diagnostics, two-wavelength-interferometry, and Hβ-diagn...

  7. AR-扩增实境

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    1、什么是AR-扩增实境?AR-扩增实境(Augmented Reality,简称AR),简单地说,就是把虚拟的物体和现实的场景进行嫁接。这是一种实时地计算摄影机影像的位置及角度并加上相应图像的技术,这种技术的目标是在屏幕上把虚拟世界套在现实世界并进行互动。

  8. Towards understanding the differences in irradiation effects of He, Ne and Ar plasma by investigating the physical origin of their clustering in tungsten

    Science.gov (United States)

    Kong, Xiang-Shan; You, Yu-wei; Li, Xiang-yan; Wu, Xuebang; Liu, C. S.; Chen, Jun-Ling; Luo, G.-N.

    2016-10-01

    While inert gas seeding to improve energy confinement has been successfully applied in many tokamak experiments, questions remain as to the irradiation effects of inert gases on tungsten. In this paper, we have systematically investigated the clustering behaviors of the inert gas atoms He, Ne and Ar in plasma-facing tungsten using first-principles calculations. Small interstitial clusters, He m , Ne m , and Ar m , can form due to the attraction between the atoms and tend to expand along the (1 1 0) planes. The inert gas clusters induce strong lattice distortions and so it is energetically favorable for a self-interstitial atom to be emitted from the clusters when the numbers of atoms are above six, three, three for He m , Ne m , and Ar m respectively. The clustering behaviors can be well explained by the intrinsic repulsive interaction between the inert gas atoms and the attractive interaction coming from the reduced valence-electron density by interstitial inert gas atoms. Compared to He, the much greater attraction between the Ne/Ar atoms and the lower trigger condition of ‘self-trapping process’ for Ne/Ar clusters provide a reasonable explanation for the difference of irradiation effects on tungsten between He and Ne/Ar plasmas, i.e. Ne/Ar plasmas cannot result in the formation of holes/bubbles and fiber-form nanostructures on tungsten surface under the same irradiation conditions as He plasma.

  9. Penning ionization : In benzene · Ar and fluorobenzene · Ar van der waals molecules and in collisions of benzene with metastable Ar atoms

    Science.gov (United States)

    Rühl, E.; Bisling, P.; Brutschy, B.; Beckmann, K.; Leisen, O.; Morgner, H.

    1986-08-01

    The photoion efficiency curves of the van der Waals complexes benzene ·Ar (Bz·Ar) and fluorobenzene·Ar (Fb·Ar) exhibit sharp resonances, which correspond to excitation to the Ar 2P 3/24s and 2P 1/24s resonance states. The peaks are redshifted relative to their asymptotic values (Bz·Ar, Δ E = -70 ± 10 meV; Fb·Ar, Δ E = -40 ± 10 meV). These findings are supported by electron spectroscopy studies of the Penning ionization of benzene by state-selected metastable Ar ( 3p 2, 3p 0) atoms. Strong evidence is presented that Penning ionization is the process observed in both cases.

  10. Effect of gas pressure on ionization of ambient gas

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    An Nd: YAG pulsed laser (145 mJ) was used to ablate aluminum target and Ar was used as protecting gas. Time-and space-resolved spectra of the plasmas under pressure 100 Pa, 1 kPa, 10 kPa and 100 kPa were acquired with time- and space-resolved technique. The characteristics of the plasma radiating under each pressure were briefly described, and the laws of Ar characteristical radiaton were analyzed in detail. Based on the profile of Ar characteristical radiation under these pressure, the relation between protecting gas pressure and its ionization was briefly discussed, and explained with quantum theory. Farther more, the mechanism of ambient gas ionization was investigated. As the result, it was suggested that the main mechanism inducing protecting gas to ionize should be the absorption of the plasma continuum radiation by the gas.

  11. 7 CFR 58.923 - Filling containers.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Filling containers. 58.923 Section 58.923 Agriculture... Procedures § 58.923 Filling containers. (a) The filling of small containers with product shall be done in a sanitary manner. The containers shall not contaminate or detract from the quality of the product in any...

  12. Comparative 40Ar/39Ar and K-Ar dating of illite-type clay minerals: A tentative explanation for age identities and differences

    Science.gov (United States)

    Clauer, Norbert; Zwingmann, Horst; Liewig, Nicole; Wendling, Raymond

    2012-10-01

    The 40K/40Ar (K-Ar) and 40Ar/39Ar dating methods are applied here to the same, very small, micrometric illite-type particles that crystallized under low-temperature (samples with a total of fifteen size fractions from advantages, such as the plateaus obtained by incremental step heating of the various size fractions, even if not translatable straight as ages of the illite populations; they allow identification of two generations of authigenic illite that formed at about 200 and 175 Ma, and one detrital generation. However, 40Ar/39Ar dating of clay minerals remains challenging as technical factors, such as the non-standardized encapsulation, may have potential unexpected effects. Both dating methods have their limitations: (1) K-Ar dating requires relatively large samples (ca. 10-20 mg) incurring potential sample homogeneity problems, with two aliquots required for K and Ar analysis for an age determination, also inducing a higher analytical uncertainty; (2) an identified drawback of 40Ar/39Ar dating is Ar recoil and therefore potential loss that occurs during neutronic creation of 39Ar from 39K, mostly in the finer mineral particles. If all the recoiled 39Ar is redistributed into adjacent grains/minerals, the final 40Ar/39Ar age of the analyzed size fraction remains theoretically identical, but it is not systematic in clay-type material. The finest grain sizes (e.g., convenient and straightforward use supported by a standardized and well-controlled technical approach. The present comparison of the two Ar-dating methods as applied to clay material shows that neither method is presently outdated, and that they are even of reciprocal use. Both methods have distinct application fields in clay geochronology and complementary application fields in clay crystallography.

  13. Modification of stearic acid in Ar and Ar-O{sub 2} pulsed DC discharges

    Energy Technology Data Exchange (ETDEWEB)

    Bernardelli, E.A.; Souza, T.; Maliska, A.M.; Kleinjohann, K.J.; Bendo, T. [Federal University of Santa Catarina (UFSC), Florianopolis, SC (Brazil); Mafra, M. [Nancy-Universite (France). Institut Jean Lamour; CNRS, Nancy (France); Belmonte, T. [Federal University of Technology from Parana (UTFPR), Curitiba, PR (Brazil)

    2010-07-01

    Stearic acid (C{sub 1}8H{sub 36}O{sub 2}) was treated into Ar and Ar-O{sub 2}(10%) pulsed DC discharge created by a cathode-anode confined system. The samples were placed at the floating potential. The results show that the mass variation of the stearic acid samples after Ar-O{sub 2} plasma exposure is more important than the pure Ar plasma treatments. This comportment demonstrate that the oxygen actives species (O and O{sub 2} in all states) strongly enhance the etching process with regards to A{sup *} species, regardless of their concentration. After treatment by Ar and Ar-O{sub 2} plasma, analyses by X-ray diffraction show a significant structural modification of the samples surface, utilizing Ar-O{sub 2} plasma the modification was more pronounced. The chemical composition evolution shows that the acid function is etched preferentially in the beginning of the treatment (about 5 min) and that after 10 min the carbonic chains seems to be functionalized by oxygen. (author)

  14. Collective dipole response of proton-rich nuclei 32Ar and 34Ar

    International Nuclear Information System (INIS)

    The earlier observation of low-lying dipole strength in neutron rich nuclei and its interpretation with respect to basic nuclear properties (symmetry energy, skin thickness) initiated the investigation of this phenomenon in proton-rich nuclei. Macroscopically this strength could be explained with the resonant dipole oscillation of a proton skin against the isospin-symmetric core. For nuclei like 32Ar the occurrence of pronounced dipole strength is predicted in the low-energy region between 8-10 MeV excitation energy. For the 34Ar the pygmy strength is expected to drop sharply and vanish entirely for the N=Z nucleus 36Ar. The experiment S327 has been performed in August 2008 at the GSI Darmstadt in Cave C using the LAND reaction setup. Fragmentation of a 800 A MeV primary 36Ar beam on a Be target was used to produce the radioactive isotopes 34Ar and 32Ar. After passing the FRS (Fragment Separator) the ions impinged on a Pb target. The dipole response is observed using the Coulomb excitation method in inverse kinematics. The concept and the experimental method will be shown in the context of the underlying physics case in 32,34Ar.

  15. Effect of expansive fillings on fracture seepage

    Institute of Scientific and Technical Information of China (English)

    CHEN Jin-gang; YANG Jun-li; ZHANG Jing-fei

    2009-01-01

    Based on an investigation of the damage process of fractures filled with expansion media, samples of filling media col-lected on the spot, were obtained. The physical water properties of fracture fillings were tested by a WZ-2 type Dilatometer. Given our test results of the hydrated properties of fracture fillings and the mechanical parameters of altered rock mass collected from the Daye Iron Mine and comparisons between the expansion stress of fracture fillings and mechanical parameters of altered rock mass, the effects of the mechanical response of fillings on fracture seepage are discussed. The results show that the ratio of filling swell pressure to tensile strength of altered rock specimen varied between 11.79 and 36.77 and the ratio of filling swell pressure to shear strength of these rock specimen ranged from 72.11 to 171.18. Therefore, fillings have an important effect on fracture seepage, and the effect of deformation of the fracture caused by swell pressure of the filling mechanics cannot be ignored either. The multiple hydraulic coupling effects of fillings on the impact of fracture permeability are discussed according to theoretical analyses. It is shown that the effect of expansion of fracture fillings greatly affects the deformation of altered rock masses. Both tensile effect and shear effect produced by fracture fillings greatly increase the permeability of fractures. The plastic and liquefaction effects of frac-ture fillings also improve the permeability of fractures. On the basis of this analysis, a mechanical seepage model of filled fracture is established.

  16. Potassium Isotopic Compositions of NIST Potassium Standards and 40Ar/39Ar Mineral Standards

    Science.gov (United States)

    Morgan, Leah; Tappa, Mike; Ellam, Rob; Mark, Darren; Higgins, John; Simon, Justin I.

    2013-01-01

    Knowledge of the isotopic ratios of standards, spikes, and reference materials is fundamental to the accuracy of many geochronological methods. For example, the 238U/235U ratio relevant to U-Pb geochronology was recently re-determined [1] and shown to differ significantly from the previously accepted value employed during age determinations. These underlying values are fundamental to accurate age calculations in many isotopic systems, and uncertainty in these values can represent a significant (and often unrecognized) portion of the uncertainty budget for determined ages. The potassium isotopic composition of mineral standards, or neutron flux monitors, is a critical, but often overlooked component in the calculation of K-Ar and 40Ar/39Ar ages. It is currently assumed that all terrestrial materials have abundances indistinguishable from that of NIST SRM 985 [2]; this is apparently a reasonable assumption at the 0.25per mille level (1s) [3]. The 40Ar/39Ar method further relies on the assumption that standards and samples (including primary and secondary standards) have indistinguishable 40K/39K values. We will present data establishing the potassium isotopic compositions of NIST isotopic K SRM 985, elemental K SRM 999b, and 40Ar/39Ar biotite mineral standard GA1550 (sample MD-2). Stable isotopic compositions (41K/39K) were measured by the peak shoulder method with high resolution MC-ICP-MS (Thermo Scientific NEPTUNE Plus), using the accepted value of NIST isotopic SRM 985 [2] for fractionation [4] corrections [5]. 40K abundances were measured by TIMS (Thermo Scientific TRITON), using 41K/39K values from ICP-MS measurements (or, for SRM 985, values from [2]) for internal fractionation corrections. Collectively these data represent an important step towards a metrologically traceable calibration of 40K concentrations in primary 40Ar/39Ar mineral standards and improve uncertainties by ca. an order of magnitude in the potassium isotopic compositions of standards.

  17. The tectonic significance of pre-Scandian 40Ar/39Ar phengite cooling ages in the Caledonides of western Norway

    Science.gov (United States)

    Andersen, T.B.; Berry, H.N.; Lux, D.R.; Andresen, A.

    1998-01-01

    Pre-Silurian continental-margin deposits in western Norway, non-conformably overlying allochthonous continental orthogneisses retain Ordovician 40Ar/39Ar cooling ages for phengites, implying either rapid cooling immediately after a Late Ordovician orogenic event, or less likely, a slow cooling following an Early Ordovician or older orogeny. The Dalsfjord Suite-H??yvik Group basement-cover pair are probably a lateral equivalent to Late Proterozoic sandstones ('sparagmites') covering the Jotun Nappe gneisses of the Middle Allochthon in central-south Norway. The H??yvik Group underwent polyphase deformation, greenschist-facies metamorphism (Tmax Baltica and Laurentia. Phengitic white micas from the H??yvik Group yield cooling ages of 446.1 ?? 3.0, 449.1 ?? 2.2 and 447.5 ?? 4.0 Ma, respectively, identical within experimental error. One sample gives a plateau over 72% of the gas analysed, whereas the other samples were slightly disturbed after initial cooling, as indicated by systematically lower apparent ages at low experimental extraction temperatures. Minor 40Ar loss probably occurred during subsequent Scandian deformation and late to post-orogenic extension. The H??yvik Group rocks were unroofed before the Wenlock time (423-428 Ma) and cooled through the temperature for argon retention in phengite at c. 447 ?? 4 Ma, indicating a maximum cooling rate between 14 and 22??C/Ma-1 through Ashgill and Llandovery times before being subjected to low-grade metamorphism during the Scandian orogeny. Rapid pre-Scandian cooling, combined with peak metamorphic conditions of 450??C or less, may indicate that the Dalsfjord-H??yvik basement-cover pair were affected by an orogenic event during the Late Ordovician (Caradoc) time. The data also suggest that the Caledonian margin of Baltica may have experienced a more protracted tectonism during the Caledonian cycle than previously models focusing on Early Caledonian and Tremadoc (or older) ophiolite obduction and the Scandian

  18. Age of Cu-Au mineralisation, Cloncurry district, eastern Mt Isa Inlier, Queensland, as determined by 40Ar/39Ar dating

    International Nuclear Information System (INIS)

    The 40Ar/39Ar dating of alteration biotite. muscovite and amphibole from a number of post-peak metamorphic Cu-Au deposits and alteration systems in the Cloncurry district. north Queensland has determined the timing of mineralisation and hydrothermal activity. Alteration biotite from the Ernest Henry Cu-Au, Starra Au-Cu, and Mt Elliott Cu-Au deposits, sericite associated with hematite breccias in the Wimberu Granite, muscovite from an albitite pipe that intrudes the Gilded Rose Breccia. And sericite from a granitoid near the Osborne Cu-Au deposit. yield ages which are broadly contemporaneous with the late ca 1510-1485 Ma phases of the Williams and Naraku Batholiths. Hornblende and biotite alteration, which pre-date Cu-Au mineralisation at Osborne. give a maximum age of ca 1540 Ma for the deposit. which is also a probable minimum age for peak metamorphism. Metamorphic minerals from the vicinity of Osborne yield dates which are significantly older (ca 1590-1570 Ma) than those from the hydrothermal phases. Dating by the K-Ar method of red. Hematitic K-feldspars which are regionally common in the Cloncurry district was not effective as the mineral yields ages up to 300 million years younger than coexisting alteration sericite. The 40Ar/39Ar age spectra obtained from most hydrothermal phases in the Eastern Fold Belt. Mt Isa Inlier commonly contain flat parts which comprise a large proportion of the released gas and are indicative of rapid cooling through the temperature of partial closure to Ar diffusion for the respective minerals. Copyright (1998) Blackwell Science Asia

  19. "Ars Dictaminis" and Modern Rhetorical Practice.

    Science.gov (United States)

    Sewell, Ernestine P.

    Although not all the problems of writing are solved by practice in letter writing, a review of the classical texts on "ars dictaminis"--letter writing--creates a strong argument for its increased use as an exercise in college composition classrooms. By incorporating the lessons of dictamen as a device for achieving rhetorical modes--narration,…

  20. 78 FR 9448 - Arkansas Disaster #AR-00061

    Science.gov (United States)

    2013-02-08

    ... ADMINISTRATION Arkansas Disaster AR-00061 AGENCY: U.S. Small Business Administration. ACTION: Notice SUMMARY: This is a Notice of the Presidential declaration of a major disaster for Public Assistance Only for the... Disaster Assistance, U.S. Small Business Administration, 409 3rd Street SW., Suite 6050, Washington,...

  1. "ARS 01", perspektiivide avamine / Helen Kivisoo

    Index Scriptorium Estoniae

    Kivisoo, Helen

    2001-01-01

    30. IX 2001-20. I 2002 Kiasmas kuuendat korda toimuvast rahvusvahelisest näitusest "ARS", kus Eestist osaleb Marko Mäetamm. Kuraatorid Tuula Arkio, Maaretta Jaukkuri, Patrik Nyberg, Jari-Pekka Vanhala. Teemaks "kolmas ruum". Näituse kajastamisest.

  2. Ionization of Argon n=2 (Ar+9 to Ar+16) by a 'relativistic' laser field

    International Nuclear Information System (INIS)

    The high field photoionization cross sections for the (n=2) shell of argon were measured with pulsed 800 nm radiation (27±5 fs duration) at an intensity of 1.5x1019 W/cm2±1x1019 W/cm2. The pondermotive energy for an electron at these field intensities is approximately 1 MeV. The best agreement with a calculated AC tunneling model was at an intensity of 0.6x1019 W/cm2. The difference between experimental and calculated relative charge state yields is less than an order of magnitude for Ar+9 to Ar+14 and Ar+16

  3. Subterranean production of neutrons, $^{39}$Ar and $^{21}$Ne: Rates and uncertainties

    CERN Document Server

    Šrámek, Ondřej; McDonough, William F; Mukhopadhyay, Sujoy; Peterson, R J

    2015-01-01

    Accurate understanding of the subsurface production of radionuclide $^{39}$Ar rate is necessary for argon dating techniques and noble gas geochemistry of the shallow and the deep Earth, and is also of interest to the WIMP dark matter experimental particle physics community. Our new calculations of subsurface production of neutrons, $^{21}$Ne, and $^{39}$Ar take advantage of the best available tools of nuclear physics to obtain reaction cross sections and spectra (TALYS) and to evaluate neutron propagation in rock (MCNP6). We discuss our method and results in relation to previous studies and show the relative importance of various neutron, $^{21}$Ne, and $^{39}$Ar nucleogenic production channels. Uncertainty in nuclear reaction cross sections, which is the major contributor to overall calculation uncertainty, is estimated from variability in existing experimental and library data. Depending on selected rock composition, on the order of $10^7$-$10^{10}$ {\\alpha} particles are produced in one kilogram of rock pe...

  4. A study of the 40Ar(p,γ)41K reaction

    International Nuclear Information System (INIS)

    This experiment has been undertaken to gain information on 40Ar(p,γ)41K resonances and the 41K nucleus. The targets were prepared by implanting high purity argon gas into tantalum backings. Proton beams were produced by the 2,6 MeV Van de Graaff accelerator at the Potchefstroom University for CHE. The spread in beam energy was 1 keV at 1 MeV. The excitation curve for the 40Ar(p,γ)41K reaction has been measured in the energy range 0,9 MeV 40Ar(p,γ)41K resonances. The gamma decay of these resonances have been studied utilizing a large Ge(Li) detector. The uncertain 4.03→2.32 and 4.75→1.70 keV transitions are confirmed. 9 figs., 30 refs., 5 tabs

  5. Theoretical prediction on vibrational spectra of [Ar…Ar-H]+

    Institute of Scientific and Technical Information of China (English)

    李巍; 赵新生

    2003-01-01

    Centrosymmetric linear [Ar-H-Ar]+ and asymmetric linear [Ar…Ar-H]+ are two stable configurations of [Ar2H]+. Based on the global potential energy surface of [Ar2H]+ provided by our group recently, we calculated the vibrational spectra of [Ar…Ar-H]+ with total angular momentum J = 0 by time-dependent quantum mechanical method, and the influence of quantum tunneling effect on vibrational spectra was found. With the help of the observation on the eigenstate functions and the modified potential energy surface, assignments were made to the spectra. The strong coupling between the excited bending mode of [Ar-H-Ar]+ and the vibrational states of [Ar…Ar-H]+ was discussed.

  6. Modified bunch filling scheme for Indus-2

    International Nuclear Information System (INIS)

    Currently Indus-2 is operated with all bunches filled mode. It may be required to fill the ring with different bunch filling patterns in future as per requirements of the users and also to mitigate the problems of ion trapping and beam instabilities. In Indus-2 one can store beam current in maximum of 291 bunches. A bunch-filling scheme has been evolved in which, it is possible to fill Indus-2 with different filling patterns. In the earlier scheme, three patterns of bunch filling are proposed namely all bunches, three symmetric bunches and a single bunch. In this scheme there is problem of bunch overlapping in the buckets, if more than one bunch is extracted from the booster. In the new scheme, a formulation has been derive to avoid the overlapping of bunches. (author)

  7. Growth of mica porphyroblasts under low-grade metamorphism - A Taiwanese case using in-situ40Ar/39Ar laser microprobe dating

    Science.gov (United States)

    Chen, Chih-Tung; Chan, Yu-Chang; Lo, Ching-Hua; Lu, Chia-Yu

    2016-11-01

    Mica porphyroblasts, a common metamorphic microstructure, are analyzed in the slate belt of northern Taiwan where large fish-like growths are found within a meta-pyroclastics. With constraints on the time-temperature history from deposition through peak metamorphic state to exhumation, in-situ40Ar/39Ar laser microprobe dating was carried out on muscovite and corrensite fibers of mm-scale mica porphyroblasts grown on a pressure-solution seam. Because the peak metamorphic temperature and the porphyroblast formation condition (∼250 °C) remained far below the closure temperature of the K-Ar radioisotope system in muscovite, and the absence of muscovite in the mafic protolith, the dating results likely document the growth of the mica porphyroblast fabrics. The syn-kinematic nature of the analyzed porphyroblasts is confirmed by the ∼6 to ∼2.5 Ma growth ages, suggesting that the host rock was continuously deformed during the earlier two-thirds of the Taiwan Orogeny. The pattern of fiber growth, in contrast to outward-decreasing ages normally observed in peripheral recrystallization, appears random and resembles void fills in boudin openings. We postulate that syntaxial crack-seal following tensile micro-boudinage, along with slips on sub-grain boundaries, as a viable mechanism for the development of mica porphyroblasts and fish especially in lower-grade metamorphic rocks.

  8. Fluid/Gas Process Controller

    Science.gov (United States)

    Ramos, Sergio

    1989-01-01

    Fluid/gas controller, or "Super Burper", developed to obtain precise fill quantities of working fluid and noncondensable gas in heat pipe by incorporating detachable external reservoir into system during processing stage. Heat pipe filled with precise quantities of working fluid and noncondensable gas, and procedure controlled accurately. Application of device best suited for high-quality, high performance heat pipes. Device successfully implemented with various types of heat pipes, including vapor chambers, thermal diodes, large space radiators, and sideflows.

  9. Integrated routing and fill for self-aligned double patterning (SADP) using grid-based design

    Science.gov (United States)

    Song, Youngsoo; Lee, Jeemyung; Lee, Seongmin; Shin, Youngsoo

    2016-03-01

    Self-aligned double patterning (SADP) has been proposed as an alternative patterning solution for sub-10nm technology because of delay of advanced lithography beyond 193nm ArF. In conventional SADP, line and space style of dummy metal fills are inserted once main design is complete. A large buffer distance is required around the main design because no further verification of main design (in presence of fills) is performed. This causes irregular pattern density, which becomes a source of process variations. We propose integrated-fill, in which main design and dummy fill insertion are performed together. This requires a change in overall design flow, which we discuss. Integrated-fill is demonstrated in M2 layer of SADP process; M2 density increases by 15.7% with 2.3% reduction in standard deviation of density distribution; metal thickness variation is also reduced by 24%. More dummy fills cause increased coupling capacitance, which however is shown to be insignificant.

  10. Ionization satellites of the ArHe dimer

    Energy Technology Data Exchange (ETDEWEB)

    Miteva, Tsveta; Klaiman, Shachar; Gokhberg, Kirill [Theoretische Chemie, Physikalisch-Chemisches Institut, Universität Heidelberg, Im Neuenheimer Feld 229, D-69120 Heidelberg (Germany); Gromov, Evgeniy V., E-mail: Evgeniy.Gromov@pci.uni-heidelberg.de [Theoretische Chemie, Physikalisch-Chemisches Institut, Universität Heidelberg, Im Neuenheimer Feld 229, D-69120 Heidelberg (Germany); Laboratory of Quantum Chemistry, Computer Center, Irkutsk State University, K. Marks 1, 664003 Irkutsk (Russian Federation)

    2014-05-28

    Ionization satellites are key ingredients in the control of post ionization processes such as molecular dissociation and interatomic Coulombic decay. Here, using the high-level ab initio method of multi-reference configuration interaction up to triple excitations, we study the potential energy curves (PECs) of the ionization satellites of the ArHe dimer. With this model system, we demonstrate that the simple model used in alkaline earth metal and rare gas complexes to describe the satellites as a Rydberg electron moving on top of a dicationic core does not fully hold for the rare gas clusters. The more complex valence structure in the rare gas atom leads to the mixing of different electronic configurations of the dimer. This prevents one from assigning a single dicationic parent state to some of the ionization satellites. We further analyze the structure of the different PECs, demonstrating how the density of the Rydberg electron is reflected in the structure of the PEC wherever the simple model is applicable.

  11. Fabrication of ZnO photonic crystals by nanosphere lithography using inductively coupled-plasma reactive ion etching with CH4/H2/Ar plasma on the ZnO/GaN heterojunction light emitting diodes

    International Nuclear Information System (INIS)

    This article reports fabrication of n-ZnO photonic crystal/p-GaN light emitting diode (LED) by nanosphere lithography to further booster the light efficiency. In this article, the fabrication of ZnO photonic crystals is carried out by nanosphere lithography using inductively coupled plasma reactive ion etching with CH4/H2/Ar plasma on the n-ZnO/p-GaN heterojunction LEDs. The CH4/H2/Ar mixed gas gives high etching rate of n-ZnO film, which yields a better surface morphology and results less plasma-induced damages of the n-ZnO film. Optimal ZnO lattice parameters of 200 nm and air fill factor from 0.35 to 0.65 were obtained from fitting the spectrum of n-ZnO/p-GaN LED using a MATLAB code. In this article, we will show our recent result that a ZnO photonic crystal cylinder has been fabricated using polystyrene nanosphere mask with lattice parameter of 200 nm and radius of hole around 70 nm. Surface morphology of ZnO photonic crystal was examined by scanning electron microscope.

  12. Planar defects as Ar traps in trioctahedral micas: A mechanism for increased Ar retentivity in phlogopite

    Science.gov (United States)

    Camacho, A.; Lee, J. K. W.; Fitz Gerald, J. D.; Zhao, J.; Abdu, Y. A.; Jenkins, D. M.; Hawthorne, F. C.; Kyser, T. K.; Creaser, R. A.; Armstrong, R.; Heaman, L. W.

    2012-08-01

    The effects of planar defects and composition on Ar mobility in trioctahedral micas have been investigated in samples from a small marble outcrop (∼500 m2) in the Frontenac Terrane, Grenville Province, Ontario. These micas crystallized during amphibolite-facies metamorphism at ∼1170 Ma and experienced a thermal pulse ∼100 Ma later at shallow crustal levels associated with the emplacement of plutons. 87Rb/86Sr ages of the phlogopites range from ∼950 to ∼1050 Ma, consistent with resetting during the later thermal event. The same phlogopites however, give 40Ar/39Ar ages between ∼950 and 1160 Ma, spanning the age range of the two thermal events. This result is intriguing because these micas have undergone the same thermal history and were not deformed after peak metamorphic conditions. In order to understand this phenomenon, the chemical, crystallographical, and microstructural nature of four mica samples has been characterized in detail using a wide range of analytical techniques. The scanning electron microscope (SEM), electron microprobe (EMP), and laser ablation inductively coupled plasma mass spectrometry (LA-ICP-MS) data show that the micas are chemically homogeneous (with the exception of Ba) and similar in composition. The Fourier transform infrared spectroscopy and Mossbauer results show that the M sites for three of the micas are dominated by divalent cations and the Fe3+/(Fe2++Fe3+) ratio for all four phlogopites ranges from 0.10 to 0.25. The stable-isotopic data for calcite indicate that this outcrop was not affected by hydrothermal fluids after peak metamorphism. No correlation between chemical composition and 87Rb/86Sr and 40Ar/39Ar age or between crystal size and 40Ar/39Ar age is observed. The only major difference among all of the micas was revealed through transmitted electron microscope (TEM), which shows that the older 1M micas contain significantly more layer stacking defects, associated with crystallization, than the younger micas. We

  13. Retrograde metamorphism of the eclogite in North Qaidam, western China:Constraints by joint 40Ar/39Ar in vacuo crushing and stepped heating

    Institute of Scientific and Technical Information of China (English)

    Rongguo Hu; Jan Wijbrans; Fraukje Brouwer; Linghao Zhao; Min Wang; Huaning Qiu

    2015-01-01

    Two amphiboles and a syn-metamorphic quartz vein from the Yuka terrane, North Qaidam, western China, have been analyzed by joint 40Ar/39Ar crushing in vacuo and stepwise heating techniques. The crushing in vacuo results provide information to directly constrain the timing of fluid activity and the age of amphibolite-facies retrogression. The stepwise heating results could further be used to decipher the thermal history of the UHP rocks. Amphiboles from amphibolites and quartz vein within garnet-amphibolite lens analyzed by in vacuo crushing yield similarly shaped age spectra and exhibit rela-tively flat age plateaus for the last several steps. The characteristics of gas release patterns and geochronological data testify to the presence of significant excess 40Ar within the fluid inclusions. The age plateaux with weighted mean ages (WMA) ranges from 488 to 476 Ma for amphiboles and 403 Ma for quartz (2s). These data points constitute amphibole WMA yielding excellent isochrons with isochron ages of 469 and 463 Ma with initial 40Ar/36Ar ratios of 520 and 334, respectively. The isochron ages are interpreted to represent initial amphibolite-facies retrogression. The data points constituting the quartz age plateaux give an isochron age of 405 Ma with initial 40Ar/36Ar ratio of 295, recording a significant aqueous fluid flow episode during the early Devonian. Age spectra obtained by stepwise heating of amphibole residues remaining after crushing experiments are characterized by younger and relatively complex age spectra, which are probably influenced by the combined effects of resetting argon and/or mineral inclusions. Nevertheless, we note that the spectra shapes have features in common: excluding the last two steps, minimum apparent ages are found at temperatures of around 500 ?C, corresponding to 319 and 249 Ma, perhaps representing the time of isotopic resetting or resulting from release gas from mineral inclusions of, e.g., biotite or feldspar. Maximum apparent ages

  14. Ar-Ar Dating of Martian Meteorite, Dhofar 378: An Early Shock Event?

    Science.gov (United States)

    Park, J.; Bogard, D. D.

    2006-01-01

    Martian meteorite, Dhofar 378 (Dho378) is a basaltic shergottite from Oman, weighing 15 g, and possessing a black fusion crust. Chemical similarities between Dho378 and the Los Angeles 001 shergottite suggests that they might have derived from the same Mars locale. The plagioclase in other shergottites has been converted to maskelenite by shock, but Dho378 apparently experienced even more intense shock heating, estimated at 55-75 GPa. Dho378 feldspar (approximately 43 modal %) melted, partially flowed and vesiculated, and then partially recrystallized. Areas of feldspathic glass are appreciably enriched in K, whereas individual plagioclases show a range in the Or/An ratio of approximately 0.18-0.017. Radiometric dating of martian shergottites indicate variable formation times of 160-475 Myr, whereas cosmic ray exposure (CRE) ages of shergottites indicate most were ejected from Mars within the past few Myr. Most determined Ar-39-Ar-40 ages of shergottites appear older than other radiometric ages because of the presence of large amounts of martian atmosphere or interior Ar-40. Among all types of meteorites and returned lunar rocks, the impact event that initiated the CRE age very rarely reset the Ar-Ar age. This is because a minimum time and temperature is required to facilitate Ar diffusion loss. It is generally assumed that the shock-texture characteristics in martian meteorites were produced by the impact events that ejected the rocks from Mars, although the time of these shock events (as opposed to CRE ages) are not directly dated. Here we report Ar-39-Ar-40 dating of Dho378 plagioclase. We suggest that the determined age dates the intense shock heating event this meteorite experienced, but that it was not the impact that initiated the CRE age.

  15. Effect of Ar bubbling during plasma electrolytic oxidation of AZ31B magnesium alloy in silicate electrolyte

    Science.gov (United States)

    Lee, Junghoon; Kim, Yonghwan; Chung, Wonsub

    2012-10-01

    Argon gas was bubbled during plasma electrolytic oxidation (PEO) treatment of magnesium alloy in a silicate solution. The appearance of arcs and plasma discharging was locally concentrated on the magnesium alloy surface and phase fraction of Mg2SiO4 in the oxide layer was increased due to Argon gas bubbling. The higher energy density of the Ar plasma atmosphere is believed to contribute to the effective formation of the high temperature phase (Mg2SiO4), particularly in the inner layer. Furthermore, the PEO treated Mg alloy with Ar bubbling showed improved corrosion resistance by a change of open pores structure.

  16. Ar/39Ar age spectrum analysis of detrital microclines from the southern San Joaquin Basin, California

    International Nuclear Information System (INIS)

    Detrital microcline grains from sedimentary strata preserve a record of thermal evolution in the temperature range approx.= 1000 to 2000C which can be revealed by 40Ar/39Ar age spectrum analysis. Microcline separates from deep drill hole intersections with Eocene to Miocene sediments in the Basin and Tejon Blocks of the southern San Joaquin Valley, California, analysed by the age spectrum approach show radiogenic 40Ar (40Ar*) gradients that record both the slow cooling of the uplifting sediment source approx.= 65 Ma ago, and a recent thermal event. This information, in conjunction with the observation of fission track annealing in the coexisting apatites, allows estimation of the temperature-time conditions of this thermal event at about 1400C for approx.= 200 ka. Present and paleotemperature data is in accord with heating related to several kilometers of Pleistocene sediment deposition. Heat flow calculations suggest that this recent subsidence has depressed the thermal gradient from about 300C km-1 to the present apparent gradient of 240C km-1. 40Ar/39Ar analysis of detrital microcline crystals yields thermochronological information in the temperature-time range of petroleum maturation and provides this technique with potential as both a useful exploration tool and as a means of probing the fundamental geodynamic processes of basin evolution. (orig.)

  17. Ar-Ar Dating on the Metallogenesis of the Dongchuang Gold Deposit in the Xiaoqinling Area

    Institute of Scientific and Technical Information of China (English)

    李强之; 陈衍景; 钟增球; 李文良; 李绍如; 郭晓东; 金宝义

    2002-01-01

    The Dongchuang gold deposit in the Xiaoqinling area is an orogenic-type lode gold deposit. It is one ofthe few superlarge (>100 t Au) deposits in China. Although it has been argued that it was formed in the Mesozoic,related isotopic age data have not been reported in previous studies. Based on detailed geological study, the authors havecarried out isotopic dating on various metallogenic generations. The ore-forming process of the Dongchuang golddeposit consists of four stages: coarse-grained pyrite-bearing quartz veins (stageⅠ), fine-grained pyrite-quartz veinlets(stage Ⅱ), multi-sulfides (stage Ⅲ) and carbonate-quartz veinlets (stage Ⅳ). Ar-Ar dating on mineral separates of stagesⅠ, Ⅱ and Ⅲ yields plateau ages of 142.9±2.9 Ma, 132.2±2.6 Ma and 128.3±6.2 Ma, respectively. Sericite separates fromstage Ⅱ assemblage also yield an Ar-Ar isochron age of 132.6±2.7 Ma, similar to the Ar-Ar plateau age. These resultssuggest that the Dongchuang gold deposit was mainly formed during 143-128 Ma, coinciding with the authors'geological observations and previous hypothesis. This ore formation is coeval with the regional-tectonic transition fromcollisional compression to extension, strongly showing that the decompression-geothermal increase regime duringcompression-to-extension transition is the most conducive geodynamic environment to orogenic-type goldmineralization.

  18. Theoretical analysis of ion kinetic energies and DLC film deposition by CH4+Ar (He) dielectric barrier discharge plasmas

    Institute of Scientific and Technical Information of China (English)

    Liu Yan-Hong; Zhang Jia-Liang; Ma Teng-Cai; Li Jian; Liu Dong-Ping

    2007-01-01

    The kinetic energy of ions in dielectric barrier discharge plasmas are analysed theoretically using the model of binary collisions between ions and gas molecules. Langevin equation for ions in other gases, Blanc law for ions in mixed gases, and the two-temperature model for ions at higher reduced field are used to determine the ion mobility. The kinetic energies of ions in CH4 + Ar(He) dielectric barrier discharge plasma at a fixed total gas pressure and various Ar (He)concentrations are calculated. It is found that with increasing Ar (He) concentration in CH4 + Ar (He) from 20% to 83%,the CH4+ kinetic energy increases from 69.6 (43.9) to 92.1 (128.5)eV, while the Ar+ (He+) kinetic energy decreases from 97 (145.2) to 78.8 (75.5)eV. The increase of CH4+ kinetic energy is responsible for the increase of hardness of diamond-like carbon films deposited by CH4 + Ar (He) dielectric barrier discharge without bias voltage over substrates.

  19. Absorption spectra of e-beam-excited Ne, Ar, and Kr, pure and in binary mixtures.

    Science.gov (United States)

    Levchenko, A O; Ustinovskii, N N; Zvorykin, V D

    2010-10-21

    A technique using the broadband emission of a laser plume as probe radiation is applied to record UV-visible (190-510 nm) absorption spectra of Ne, Ar, and Kr, pure and in binary mixtures under moderate e-beam excitation up to 1 MW/cm(3). In all the rare gases and mixtures, the absorption spectra show continuum related to Rg(2) (+) homonuclear ions [peaking at λ∼285, 295, and 320 nm in Ne, Ar, and Kr(Ar/Kr), respectively] and a number of atomic lines related mainly to Rg(∗)(ms) levels, where m is the lowest principal quantum number of the valence electron. In argon, a continuum related to Ar(2) (∗) (λ∼325 nm) is also recorded. There are also trains of narrow bands corresponding to Rg(2) (∗)(npπ (3)Π(g))←Rg(2) (∗)(msσ (3)Σ(u) (+)) transitions. All the spectral features mentioned above were reported in literature but have never been observed simultaneously. Although charge transfer to a homonuclear ion of the heavier additive is commonly believed to dominate in binary rare-gas mixtures, it is found in this study that in Ne/Kr mixture, the charge is finally transferred from the buffer gas Ne(2) (+) ion not to Kr(2) (+) but to heteronuclear NeKr(+) ion.

  20. Dedicated composite fillings − inlays

    Directory of Open Access Journals (Sweden)

    Šaulić Slobodan

    2003-01-01

    Full Text Available Background. The aim of the study was to evaluate the quality and persistance of esthetics of dedicated inlay by clinical methods. Methods. The paper reviews the clinical significance and technique of preparing particular composite inlays before and after the construction of the metallic framework partial denture. On the basis of indications the total of 30 inlays were placed into cavities under relatively dry working conditions. Six, twelve eighteen and twenty-four months after the placement of filling, control check-up was carried out by Ryge criteria. Results. After two years marginal discoloration as well as the change of the colour occured in 3.3% of inlays. There was neither detectable secondary caries, nor the symtoms of pulpal damage. The requirements to be fulfilled concerning the composite materials in order that they can be implemented for this purpose, were also discussed. Conclusion. From the clinical point of view, purpouse inlays from Herculite XRV lab C8B in combination with Opti Bond System and composite cement Porcelite Dual Cure showed high functional and esthetic values in the observational period of two years.

  1. NUMERICAL SIMULATION OF CASTING'S MOLD FILLING PROCESS

    Institute of Scientific and Technical Information of China (English)

    J.X. Zhou; R.X. Liu; L.L. Chen; D.M. Liao; H.S. Wei

    2005-01-01

    Numerical simulation of casting's mold filling process is the main and the most important aspect of the foundry CAE technology. But it is time-consuming; it may take dozens of hours or several days. While with the development of computer hardware, numerical simulation of casting' s mold filling process has made rapid progress. The simulation results, therefore, have become more and more practical. This study tries to find some clues of the computational time of mold filling process. Firstly, this paper introduces mathematic model and the basic route of numerical simulation of casting's mold filling process. Then the computational time of mold filling process has been carefully studied, and some new and useful results have been gained from the study of the computational time. Finally, this paper has given some real applications of numerical simulation of casting's mold filling process.

  2. A natural laboratory for 40Ar/39Ar geochronology: ICDP cores from Lake Van, Turkey

    Science.gov (United States)

    Engelhardt, Jonathan; Sudo, Masafumi; Oberhänsli, Roland

    2015-04-01

    Pore water samples from ICDP Paleovan cores indicate a limited pore water exchange within Quaternary lake sediments. The core's volcaniclastic sections bear unaltered K-rich ternary feldspar and fresh to altered glass shards of predominantly rhyolitic composition. Whereas applying the 40Ar/39Ar method on feldspars resulted in ages timing a late-stage crystallization, glass shards had the potential to date the eruption. Volcanic glass is prone to modifications such as hydrous alteration (palagonitization) and devitrification (Cerling et al., 1985). These modifications affect the glass' chemistry and challenge the application of the 40Ar/39Ar method. Gaining precise radiometric ages from two phases has the potential to strengthen a climate-stratigraphic age-model (Stockhecke et al., 2014), and to significantly increase the temporal resolution on the deposition of the lake sediments. Vice versa the core's previous age model has the ability to question the reliability of 40Ar/39Ar eruption ages derived from ternary feldspars and glass shards. Multi- and single-grain total fusion on alkali feldspars from six volcaniclastic deposits resulted in Pleistocene ages that are in good agreement with the predicted age model. Feldspar phenocrysts from three ashes in the core's youngest section yielded consistent isochron ages that are significantly older than the model's prediction. Several distinct stratigraphic and paleomagnetic time markers of similar stratigraphic positions contradict to the older radiometric dates (Stockhecke et al., 2014). Partial resorption features of inherited feldspar domains and the involvement of excess 40Ar indicate incomplete degassing of older domains. To evaluate the magmatic history of the different domains EMPA mappings of trace elements that could be interpreted as Ar diffusion couples are currently conducted. Geochronology on Paleovan cores offers unique opportunities to monitor the effect of alteration on the Ar-systematics of volcanic glass

  3. Dicty_cDB: FC-AR02 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR02 (Link to dictyBase) - - - Contig-U15981-1 FC-AR02P (Li...nk to Original site) FC-AR02F 518 FC-AR02Z 247 FC-AR02P 764 - - Show FC-AR02 Library FC (Link to library) Clone ID FC-AR...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR02Q.Seq.d/ Representative seq. ID FC-AR...02P (Link to Original site) Representative DNA sequence >FC-AR02 (FC-AR02Q) /CSM/FC/FC-AR/FC-AR...logy vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR02 (FC-AR02Q) /CSM/FC/FC-AR/FC-AR

  4. Surfaces that become isotopic after Dehn filling

    CERN Document Server

    Bachman, David; Sedgwick, Eric

    2010-01-01

    We show that after generic filling along a torus boundary component of a 3-manifold, no two closed, 2-sided, essential surfaces become isotopic, and no closed, 2-sided, essential surface becomes inessential. That is, the set of essential surfaces (considered up to isotopy) survives unchanged in all suitably generic Dehn fillings. Furthermore, for all but finitely many non-generic fillings, we show that two essential surfaces can only become isotopic in a constrained way.

  5. On concentration of $^{42}$Ar in the Earth's atmosphere

    CERN Document Server

    Barabash, A S

    2016-01-01

    Data from the DBA liquid argon ionization chamber experiment have been used to obtain an estimate on the concentration of $^{42}$Ar in the Earth's atmosphere, $6.8^{+1.7}_{-3.2}\\cdot10^{-21}$ atoms of $^{42}$Ar per atom of $^{40}$Ar corresponding to the $^{42}$Ar activity of $1.2^{+0.3}_{-0.5}$ $\\mu$Bq per cubic meter of air.

  6. High-spin yrast levels of 38Ar

    NARCIS (Netherlands)

    Aarts, H.J.M.; Engelbertink, G.A.P.; Eggenhuisen, H.H.; Ekström, L.P.

    1979-01-01

    High-spin states of 38Ar have been studied with the 35Cl(α, pγ)38Ar reaction at Eα = 18 MeV and with the 24Mg(16O, 2pγ)38Ar reaction at E(16O) = 38 and 45 MeV. The 38Ar level scheme is obtained with the former reaction from a proton-γ coincidence measurement. Gamma-gamma coincidence, γ-ray angular d

  7. Growth Rate Estimates of Supergene Manganese Nodule by 40Ar/39Ar Isotopic Dating

    Institute of Scientific and Technical Information of China (English)

    Li Jianwei; Vasconcelos P M

    2004-01-01

    Increasing world-class, high-grade, and metals-enriched supergene manganese ore deposits have been discovered in the last two decades, making them more and more economically important. However, data on the timing and duration of their formation are sparse, mainly due to the difficulties extracting datable minerals suited to traditional radiometric dating methods. Hollandite, cryptomelane, coronadite, todorokite, and manjiroite are common manganese oxide minerals in supergene environments. These minerals host potassium of variable amounts from 0.1 wt% to 5.0 wt% in their structural sites. This geochemical property provides possibility to date supergene manganese ores by using K-Ar and 40Ar/39Ar methods. In this study, we perform 40Ar/39Ar dating on a 7.1-cm-thick botryoidal manganese nodule from an ancient weathering profile at Mount Tabor, central Queensland, Australia. Laser microprobe incremental analyses of distinct growth bands, from the inner core through the intermediate bands to the outermost crusts of the nodule, have yielded high quality 40Ar/39Ar ages at 27.3 Ma, 20.9 Ma, 19.2 Ma, and 16.1 Ma, respectively. The age results permit preliminary estimates on the average growth rates of the nodule varying from 4.7×10-3 mm/ka to 7.6×10-3 mm/ka to 9.0×10-3 mm/ka, from the core to the rim. Results of this study are of significance in our understanding of the mode, mechanism, process, and climatic conditions in the formation of supergene manganese ore deposits.

  8. Electrical and optical properties of Ar/NH3 atmospheric pressure plasma jet

    Science.gov (United States)

    Chang, Zheng-Shi; Yao, Cong-Wei; Chen, Si-Le; Zhang, Guan-Jun

    2016-09-01

    Inspired by the Penning effect, we obtain a glow-like plasma jet by mixing ammonia (NH3) into argon (Ar) gas under atmospheric pressure. The basic electrical and optical properties of an atmospheric pressure plasma jet (APPJ) are investigated. It can be seen that the discharge mode transforms from filamentary to glow-like when a little ammonia is added into the pure argon. The electrical and optical analyses contribute to the explanation of this phenomenon. The discharge mode, power, and current density are analyzed to understand the electrical behavior of the APPJ. Meanwhile, the discharge images, APPJ's length, and the components of plasma are also obtained to express its optical characteristics. Finally, we diagnose several parameters, such as gas temperature, electron temperature, and density, as well as the density number of metastable argon atoms of Ar/NH3 APPJ to help judge the usability in its applications.

  9. LHCB RICH gas system proposal

    CERN Document Server

    Bosteels, Michel; Haider, S

    2001-01-01

    Both LHCb RICH will be operated with fluorocarbon as gas radiator. RICH 1 will be filled with 4m^3 of C4F10 and RICH 2 with 100m^3 of CF4. The gas systems will run as a closed loop circulation and a gas recovery system within the closed loop is planned for RICH 1, where the recovery of the CF4 will only be realised during filling and emptying of the detector. Inline gas purification is foreseen for the gas systems in order to limit water and oxygen impurities.

  10. Antarlides: A New Type of Androgen Receptor (AR) Antagonist that Overcomes Resistance to AR-Targeted Therapy.

    Science.gov (United States)

    Saito, Shun; Fujimaki, Takahiro; Panbangred, Watanalai; Igarashi, Yasuhiro; Imoto, Masaya

    2016-02-18

    Prostate cancer is treated with androgen receptor (AR) antagonists but most patients experience disease progression after long-term treatment with these compounds. Therefore, new AR antagonists are required for patient follow-up treatment. In the course of screening for a new AR antagonist, we isolated the novel compounds antarlides A-E (1-5) from Streptomyces sp. BB47. Antarlides are mutually isomeric with respect to the double bond and have a 22-membered-ring macrocyclic structure. The full stereostructure of 1 was established by chemical modifications, including methanolysis, the Trost method, acetonide formation, and the PGME method. 1-5 inhibited the binding of androgen to ARs in vitro. In addition, 2 inhibited the transcriptional activity of not only wild-type AR but also mutant ARs, which are seen in patients with acquired resistance to clinically used AR antagonists. Therefore, antarlides are a potent new generation of AR antagonists that overcome resistance.

  11. Airborne contamination during blow-fill-seal pharmaceutical production.

    Science.gov (United States)

    Whyte, W; Matheis, W; Dean-Netcher, M; Edwards, A

    1998-01-01

    The routes of airborne contamination, during Blow-Fill-Seal (BFS) production, were studied using tracer gas, particles and bacteria. The prevention of airborne contamination, by the air shower at the point of fill, was effective (> 99.2% efficient). However, microbe-carrying particles could gain access, by deposition or air exchange, when the containers were cut open and before they shuttled under the protection of the air shower. The use of SF6 tracer gas demonstrated that when the air shower was not on, 50% of the air within the containers came from the area round the machine. When the air shower was switched on, only about 5% of the air came from the surroundings. Airborne microbial contamination of containers is in proportion to: the number of airborne microbes around the machine, the time the container is open, the neck area and the amount of air left within the container. The likely microbial contamination rate can be calculated from a model incorporating these variables. Microbial contamination of containers during BFS manufacturing is normally very low, but by increasing the naturally occurring bacteria in the air of the production rooms by about 100-fold, it was possible to verify the accuracy of this model. The contamination model agrees well with the observation that microbial contamination levels of between 1 in 10(5) and in 10(7) will be found when small containers (< 10 ml) are filled in conventionally ventilated rooms. To achieve similar contamination rates when filling of larger bottles, it is likely that unidirectional flow, or barrier technology will be required. PMID:9691671

  12. Detonation and transition to detonation in partially water-filled pipes

    OpenAIRE

    Bitter, Neal P.; Shepherd, Joseph E.

    2012-01-01

    Detonations and deflagration-to-detonation transition (DDT) are experimentally studied in horizontal pipes which are partially filled with water. The gas layer above the water is stoichiometric hydrogen-oxygen at 1 bar. For detonation cases, ignition and transition occur outside of the water-filled section. For DDT cases, ignition and transition occur over the surface of the water. Pressure and hoop strain are measured incrementally along the pipe, with pressure transducers located both above...

  13. A Gas Target with a Tritium Gas Handling System

    International Nuclear Information System (INIS)

    A detailed description is given of a simple tritium gas target and its tritium gas filling system, and how to put it into operation. By using the T (p,n) He reaction the gas target has been employed for production of monoenergetic fast neutrons of well defined energy and high intensity. The target has been operated successfully for a long time

  14. Etching Mechanism of Niobium in Coaxial Ar/Cl2 RF Plasma

    OpenAIRE

    Upadhyay, J.; Im, Do; Popović, S.; Valente-Feliciano, A. -M.; Phillips, L.; Vušković, L.

    2014-01-01

    The understanding of the Ar/Cl2 plasma etching mechanism is crucial for the desired modification of inner surface of the three dimensional niobium (Nb) superconductive radio frequency cavities. Uniform mass removal in cylindrical shaped structures is a challenging task, because the etch rate varies along the direction of gas flow. The study is performed in the asymmetric coaxial RF discharge with two identical Nb rings acting as a part of the outer electrode. The dependence of etch rate unifo...

  15. Dicty_cDB: FC-AR12 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR12 (Link to dictyBase) - - - Contig-U15450-1 FC-AR12E (Li...nk to Original site) - - - - - - FC-AR12E 643 Show FC-AR12 Library FC (Link to library) Clone ID FC-AR12 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR12Q.Seq.d/ Representative seq. ID FC-AR...12E (Link to Original site) Representative DNA sequence >FC-AR12 (FC-AR12Q) /CSM/FC/FC-AR/FC-AR12Q.Seq....cid sequence KMSAKAATKNATKVAVKAPEATTPVETKKSKKDNVMRGLRIEKLVLNICVGESGDRLVRA AKVLEQLTGQTPVYSKARYTVRSFNIRRNEQIAA

  16. Dicty_cDB: FC-AR03 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR03 (Link to dictyBase) - - - Contig-U14922-1 FC-AR03E (Li...nk to Original site) - - - - - - FC-AR03E 619 Show FC-AR03 Library FC (Link to library) Clone ID FC-AR03 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR03Q.Seq.d/ Representative seq. ID FC-AR...03E (Link to Original site) Representative DNA sequence >FC-AR03 (FC-AR03Q) /CSM/FC/FC-AR/FC-AR03Q.Seq....MGELTSAGLSFSSCEIPVRQDIANGYQRLTEVENNIRQGMEDLSNNEQG YFEEGIRDYLRAISSVKELLNDRLDALMSMQNNERNVAAKKEKAAKTTGAKAANMQKEVD DAVRKLTEATTEYEKISASAR

  17. The thermal history of the Lhasa Block, South Tibetan Plateau based on FTD and Ar-Ar dating

    CERN Document Server

    Yang, T F; Lo Chong Huah; Chung, S L; Tien, R L; Xu, R; Deng, W

    1999-01-01

    Twelve basement samples were collected from South Tibet Plateau for FTD and Ar-Ar analysis to demonstrate their uplifting history since Cenozoic era. The preliminary results from different minerals with different closure temperatures, including apatite and zircon for fission-track dating, and K-feldspar, biotite for Ar-Ar dating, show that at least four stages of thermal history can be recognized in the studied area.

  18. A test of the 40Ar/39Ar age spectrum technique on some terrestrial materials

    Science.gov (United States)

    Lanphere, M.A.; Brent, Dalrymple G.

    1971-01-01

    40Ar/39Ar age spectra were determined for 10 terrestrial rock and mineral samples whose geologic history is known from independent evidence. The spectra for six mineral and whole rock samples, including biotite, feldspar, hornblende, muscovite, and granodiorite, that have experienced post-crystallization heating did not reveal the age of crystallization in any obvious way. Minima in the spectra, however, give reasonable maximum ages for reheating and high-temperature maxima can be interpreted as minimum crystallization ages. High-temperature ages of microcline and albite that have not been reheated are approximately 10% younger than the known crystallization age. Apparently there are no domains in these feldspars that have retained radiogenic 40Ar quantitatively. Spectra from two diabase samples that contain significant quantities of excess argon might mistakenly be interpreted as spectra from reheated samples and do not give the age of emplacement. The 40Ar/39Ar age spectrum technique may be a potentially valuable tool for the study of geologic areas with complex histories, but the interpretation of age spectra from terrestrial samples seems to be more difficult than suggested by some previous studies. ?? 1971.

  19. Phase behavior of mixed Ar-Kr, Ar-Xe and Kr-Xe monolayer films on graphite: a Monte Carlo study.

    Science.gov (United States)

    Patrykiejew, A

    2013-01-01

    Using Monte Carlo simulation methods in the grand canonical ensemble we have studied the behavior of mixed Ar-Kr, Ar-Xe and Kr-Xe monolayer films on the graphite basal plane. We have considered the adsorption of the lighter component, either argon or krypton, under the condition of a fixed chemical potential of the heavier component (krypton or xenon), as well as on the graphite surface with preadsorbed small amounts of a heavier noble gas. In both types of simulation the composition of the adsorbed layer is not conserved. We discuss the phase behavior of mixed films emerging from both types of 'computer experiment'. We also demonstrate that Monte Carlo simulation allows us to estimate the effects of preadsorbed xenon on the commensurate-incommensurate transition in the krypton monolayer film and gives the results that are in good quantitative agreement with experimental data.

  20. Hugoniot-based equations of state for two filled EPDM rubbers

    International Nuclear Information System (INIS)

    Particle-filled elastomers are commonly used as engineering components due to their ability to provide structural support via their elastic mechanical response. Even small amounts of particle fillers are known to increase the mechanical strength of elastomers due to polymer-filler interactions. In this work, the shock response of two filled (SiO2 or silica and KevlarTMfillers) ethylene-propylene-diene (EPDM) rubbers were studied using single and two-stage gas gun-driven plate impact experiments. Hugoniot states were determined using standard plate impact methods. Both filled-EPDM elastomers exhibit high compressibility under shock loading and have a response similar to adiprene rubber.

  1. Dry etching of new phase-change material Al1.3Sb3Te in CF4/Ar plasma

    Institute of Scientific and Technical Information of China (English)

    Zhang Xu; Cheng Yan; Wu Liangcai; Song Zhitang; Feng Songlin; Rao Feng; Liu Bo; Peng Cheng; Zhou Xilin; Yao Dongning; Guo Xiaohui; Song Sannian; Wang Liangyong

    2012-01-01

    The dry etching characteristic of Al1.3Sb3Te film was investigated by using a CF4/Ar gas mixture.The experimental control parameters were gas flow rate into the chamber,CF4/Ar ratio,the O2 addition,the chamber background pressure,and the incident RF power applied to the lower electrode.The total flow rate was 50 sccm and the behavior of etch rate of Al1.3Sb3Te thin films was investigated as a function of the CF4/Ar ratio,the O2 addition,the chamber background pressure,and the incident RF power.Then the parameters were optimized.The fast etch rate was up to 70.8 nm/min and a smooth surface was achieved using optimized etching parameters of CF4 concentration of 4%,power of 300 W and pressure of 80 mTorr.

  2. 7 CFR 58.730 - Filling containers.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Filling containers. 58.730 Section 58.730 Agriculture... Procedures § 58.730 Filling containers. Hot fluid cheese from the cookers may be held in hotwells or hoppers... shall effectively measure the desired amount of product into the pouch or container in a sanitary...

  3. Influence of template fill in graphoepitaxy DSA

    Science.gov (United States)

    Doise, Jan; Bekaert, Joost; Chan, Boon Teik; Hong, SungEun; Lin, Guanyang; Gronheid, Roel

    2016-03-01

    Directed self-assembly (DSA) of block copolymers (BCP) is considered a promising patterning approach for the 7 nm node and beyond. Specifically, a grapho-epitaxy process using a cylindrical phase BCP may offer an efficient solution for patterning randomly distributed contact holes with sub-resolution pitches, such as found in via and cut mask levels. In any grapho-epitaxy process, the pattern density impacts the template fill (local BCP thickness inside the template) and may cause defects due to respectively over- or underfilling of the template. In order to tackle this issue thoroughly, the parameters that determine template fill and the influence of template fill on the resulting pattern should be investigated. In this work, using three process flow variations (with different template surface energy), template fill is experimentally characterized as a function of pattern density and film thickness. The impact of these parameters on template fill is highly dependent on the process flow, and thus pre-pattern surface energy. Template fill has a considerable effect on the pattern transfer of the DSA contact holes into the underlying layer. Higher fill levels give rise to smaller contact holes and worse critical dimension uniformity. These results are important towards DSA-aware design and show that fill is a crucial parameter in grapho-epitaxy DSA.

  4. Ar + NO microwave plasmas for Escherichia coli sterilization

    Energy Technology Data Exchange (ETDEWEB)

    Hueso, Jose L; Rico, Victor J; Cotrino, Jose; Gonzalez-Elipe, Agustin R [Instituto de Ciencia de Materiales de Sevilla, Centro Mixto CSIC-Universidad de Sevilla, Centro de Investigaciones Cientificas Isla de la Cartuja, Avda. Americo Vespucio 49, 41092 Sevilla (Spain); Frias, Jose E [Instituto de BioquImica Vegetal y FotosIntesis (IBVF-CSIC). Centro de Investigaciones CientIficas Isla de la Cartuja. Avda Americo Vespucio, 49, 41092 Sevilla (Spain)], E-mail: jhueso@icmse.csic.es

    2008-05-07

    Ar + NO microwave discharges are used for sterilization and the results are compared with additional experiments with Ar, O{sub 2} and N{sub 2}-O{sub 2} plasma mixtures. The NO{sup *} species produced in the Ar-NO mixtures remain up to long distances from the source, thus improving the sterilization efficiency of the process. E. coli individuals exposed to the Ar + NO plasma undergo morphological damage and cell lysis. Combined effects of etching (by O{sup *} and Ar{sup *} species) and UV radiation (from deactivation of NO{sup *} species) are responsible for the higher activity found for this plasma mixture. (fast track communication)

  5. Space-filling curves of self-similar sets (I): iterated function systems with order structures

    Science.gov (United States)

    Rao, Hui; Zhang, Shu-Qin

    2016-07-01

    This paper is the first part of a series which provides a systematic treatment of the space-filling curves of self-similar sets. In the present paper, we introduce a notion of linear graph-directed IFS (linear GIFS in short). We show that to construct a space-filling curve of a self-similar set, it amounts to exploring its linear GIFS structures. Compared to the previous methods, such as the L-system or recurrent set method, the linear GIFS approach is simpler, more rigorous and leads to further studies on this topic. We also propose a new algorithm for the beautiful visualization of space-filling curves. In a series of papers Dai et al (2015 arXiv:1511.05411 [math.GN]), Rao and Zhang (2015) and Rao and Zhang (2015), we investigate for a given self-similar set how to get ‘substitution rules’ for constructing space-filling curves, which was obscure in the literature. We solve the problem for self-similar sets of finite type, which covers most of the known results on constructions of space-filling curves.

  6. Weak Symplectic Fillings and Holomorphic Curves

    CERN Document Server

    Niederkrüger, Klaus

    2010-01-01

    We prove several results on weak symplectic fillings of contact 3-manifolds, including: (1) Every weak filling of any planar contact manifold can be deformed to a blow up of a Stein filling. (2) Contact manifolds that have planar torsion with an extra homological condition are not weakly fillable -this gives many new examples of contact manifolds without Giroux torsion that have no weak fillings. (3) Weak fillability is preserved under splicing of contact manifolds along symplectic pre-Lagrangian tori - this gives many new examples of contact manifolds without Giroux torsion that are weakly but not strongly fillable. We establish the obstructions to weak fillings via two parallel approaches using holomorphic curves. In the first approach, we generalize the original Gromov-Eliashberg "Bishop disk" argument to study the special case of Giroux torsion via a Bishop family of holomorphic annuli with boundary on an "anchored overtwisted annulus". The second approach uses punctured holomorphic curves, and is based o...

  7. Argon defect complexes in low energy Ar irradiated molybdenum

    Energy Technology Data Exchange (ETDEWEB)

    van Veen, A.; Buters, W.T.M.; van der Kolk, G.J.; Caspers, L.M. (Interuniversitair Reactor Instituut, Delft (Netherlands)); Armstrong, T.R. (Victoria Univ., Wellington (New Zealand). Dept. of Physics)

    1982-03-15

    Thermal desorption spectrometry has been used to study the defects created in Mo irradiated along the <110> direction with Ar ions ranging in energy from 0.1 to 2 keV. In addition to monitoring the release of the implanted Ar, additional information has been obtained by decoration of the defects with low energy helium and subsequent monitoring of the helium release. The studies show evidence that the Ar can be trapped in both substitutional sites and in a configuration in which the Ar is associated with vacancies (ArVsub(n), n >= 2). Most of the Ar implanted at high energy is released at approx. equal to 1500 K by thermal vacancy assisted diffusion. Argon trapped closer to the surface is released at lower temperatures via at least three different surface related release mechanisms. Additional results are presented on the interaction of self interstitial atoms (introduced by 100 eV Xe bombardment) with the Ar defects. Substitutional Ar is found to convert to interstitial Ar which seems to be mobile at room temperature. The Ar-vacancy complexes are found to be reduced to substitutional Ar. The results of atomistic calculations of the release mechanisms will also be presented.

  8. MEIS1 functions as a potential AR negative regulator

    Energy Technology Data Exchange (ETDEWEB)

    Cui, Liang [Department of Urology, Chinese PLA Medical School/Chinese PLA General Hospital, Beijing 100853 (China); Department of Urology, Civil Aviation General Hospital/Civil Aviation Medical College of Peking University, Beijing 100123 (China); Li, Mingyang [Department of Gastroenterology, Nan Lou Division, Chinese PLA Medical School/Chinese PLA General Hospital, Beijing 100853 (China); Feng, Fan [Department of Pharmacy, General Hospital of Shenyang Military Command, Shenyang 110016 (China); Yang, Yutao [Beijing Institute for Neuroscience, Capital Medical University, Beijing 100069 (China); Hang, Xingyi [National Scientific Data Sharing Platform for Population and Health, Beijing 100730 (China); Cui, Jiajun, E-mail: cuijn@ucmail.uc.edu [Department of Cancer and Cell Biology, University of Cincinnati College of Medicine, Cincinnati, OH 45267 (United States); Gao, Jiangping, E-mail: jpgao@163.com [Department of Urology, Chinese PLA Medical School/Chinese PLA General Hospital, Beijing 100853 (China)

    2014-10-15

    The androgen receptor (AR) plays critical roles in human prostate carcinoma progression and transformation. However, the activation of AR is regulated by co-regulators. MEIS1 protein, the homeodomain transcription factor, exhibited a decreased level in poor-prognosis prostate tumors. In this study, we investigated a potential interaction between MEIS1 and AR. We found that overexpression of MEIS1 inhibited the AR transcriptional activity and reduced the expression of AR target gene. A potential protein–protein interaction between AR and MEIS1 was identified by the immunoprecipitation and GST pull-down assays. Furthermore, MEIS1 modulated AR cytoplasm/nucleus translocation and the recruitment to androgen response element in prostate specific antigen (PSA) gene promoter sequences. In addition, MEIS1 promoted the recruitment of NCoR and SMRT in the presence of R1881. Finally, MEIS1 inhibited the proliferation and anchor-independent growth of LNCaP cells. Taken together, our data suggests that MEIS1 functions as a novel AR co-repressor. - Highlights: • A potential interaction was identified between MEIS1 and AR signaling. • Overexpression of MEIS1 reduced the expression of AR target gene. • MEIS1 modulated AR cytoplasm/nucleus translocation. • MEIS1 inhibited the proliferation and anchor-independent growth of LNCaP cells.

  9. The polystyrene microsphere filling with hydrogen isotopes through the fill tube with consequent freezing

    Science.gov (United States)

    Izgorodin, V. M.; Solomatina, E. Y.; Pepelyaev, A. P.; Rogozhina, M. A.; Osetrov, E. I.

    2016-09-01

    Process of spherical polystyrene capsules filling with hydrogen isotopes through the fill tube for the purpose of a cryogenic target building is described. The scheme of the stand for researches and a technique of carrying out of experiments is represented. Results of capsules filling and subsequent freezing for protium, deuterium and protium- deuterium mixture are shown.

  10. Argon in hornblende, biotite and muscovite in geologic cooling - Ar-40/Ar-39-investigations

    International Nuclear Information System (INIS)

    The results of the Ar-40/Ar-39 studies are discussed under the aspect of whether the age data of the minerals indicate a cooling process. The author hopes that isotope dating of minerals with different closing temperatures will describe the temperature/time history of an area in the temperature range of 600 to 2000C. The findings are analyzed under three aspects: How much do they contribute to the initial methodological question, what do they contribute to the regional geology of the areas investigated, and in what respects do they extent the present knowledge of the geochronological analysis, i.e. its techniques and interpretation. (orig.)

  11. Ar-Ar Dating of Martian Chassignites, NWA2737 and Chassigny, and Nakhlite MIL03346

    Science.gov (United States)

    Bogard, D. D.; Garrison, D. H.

    2006-01-01

    Until recently only three nakhlites and one chassignite had been identified among martian meteorites. These four exhibit very similar radiometric ages and cosmic ray exposure (CRE) ages, indicating that they may have derived from a common location on Mars and were ejected into space by a single impact. This situation is quite different from that of martian shergottites, which exhibit a range of radiometric ages and CRE ages (1). Recently, several new nakhlites and a new martian dunite (NWA2737) have been recognized. Here we report our results of Ar-39-Ar-40 dating for the MIL03346 nakhlite and the NWA2737 "chassignite", along with new results on Chassigny.

  12. Microbiologia do ar : monitorização do ar em ambiente hospitalar

    OpenAIRE

    Santos, Ana Carina Marques dos

    2008-01-01

    O complexo ambiente hospitalar requer atenção especial, para assegurar uma saudável qualidade do ar interior, protegendo assim os profissionais de saúde e utentes de infecções nosocomiais e de doenças ocupacionais. Embora seja amplamente reconhecido que a contaminação de um bloco operatório seja a principal responsável pela complicação de uma cirurgia, em Portugal, estudos sobre microbiologia do ar a nível hospitalar são escassos. O objectivo deste estudo é investigar a vari...

  13. Multidiffusion mechanisms for noble gases (He, Ne, Ar) in silicate glasses and melts in the transition temperature domain: Implications for glass polymerization

    Science.gov (United States)

    Amalberti, Julien; Burnard, Pete; Laporte, Didier; Tissandier, Laurent; Neuville, Daniel R.

    2016-01-01

    Noble gases are ideal probes to study the structure of silicate glasses and melts as the modifications of the silicate network induced by the incorporation of noble gases are negligible. In addition, there are systematic variations in noble gas atomic radii and several noble gas isotopes with which the influence of the network itself on diffusion may be investigated. Noble gases are therefore ideally suited to constrain the time scales of magma degassing and cooling. In order to document noble gas diffusion behavior in silicate glass, we measured the diffusivities of three noble gases (4He, 20Ne and 40Ar) and the isotopic diffusivities of two Ar isotopes (36Ar and 40Ar) in two synthetic basaltic glasses (G1 and G2; 20Ne and 36Ar were only measured in sample G1). These new diffusion results are used to re-interpret time scales of the acquisition of fractionated atmospheric noble gas signatures in pumices. The noble gas bearing glasses were synthesized by exposing the liquids to high noble gas partial pressures at high temperature and pressure (1750-1770 K and 1.2 GPa) in a piston-cylinder apparatus. Diffusivities were measured by step heating the glasses between 423 and 1198 K and measuring the fraction of gas released at each temperature step by noble gas mass spectrometry. In addition we measured the viscosity of G1 between 996 and 1072 K in order to determine the precise glass transition temperature and to estimate network relaxation time scales. The results indicate that, to a first order, that the smaller the size of the diffusing atom, the greater its diffusivity at a given temperature: D(He) > D(Ne) > D(Ar) at constant T. Significantly, the diffusivities of the noble gases in the glasses investigated do not display simple Arrhenian behavior: there are well-defined departures from Arrhenian behavior which occur at lower temperatures for He than for Ne or Ar. We propose that the non-Arrhenian behavior of noble gases can be explained by structural modifications

  14. Multiplication factors in ethylene-filled proportional counters.

    Science.gov (United States)

    Loyola, H; Birstein, L; Hevia, A

    2008-01-01

    Gas multiplication factors were measured in a proportional counter filled with high-purity ethylene in the pressure range 10-40 Torr. The multiplication factors were measured as a function of the reduced electric field S(a). The results show that, within the range of the high values of reduced electric field applied in this work (2648 Townsend coefficient alpha/P for ethylene may still be considered a function of S(a) alone. Good agreement was found with a model proposed by Akande. PMID:18682404

  15. SUMER-IRIS Observations of AR11875

    Science.gov (United States)

    Schmit, Donald; Innes, Davina

    2014-05-01

    We present results of the first joint observing campaign of IRIS and SOHO/SUMER. While the IRIS datasets provide information on the chromosphere and transition region, SUMER provides complementary diagnostics on the corona. On 2013-10-24, we observed an active region, AR11875, and the surrounding plage for approximately 4 hours using rapid-cadence observing programs. These datasets include spectra from a small C -class flare which occurs in conjunction with an Ellerman-bomb type event. Our analysis focusses on how the high spatial resolution and slit jaw imaging capabilities of IRIS shed light on the unresolved structure of transient events in the SUMER catalog.

  16. Effects of Reduced Solar Radiation on Chlorophyll Fluorescence Parameters and Gas Exchange in Winter Wheat of Grain Filling Periods%太阳辐射减弱对冬小麦灌浆期叶绿素荧光及气体交换的影响

    Institute of Scientific and Technical Information of China (English)

    郑有飞; 倪艳利; 麦博儒; 冯妍; 孙健; 李健; 徐静馨

    2011-01-01

    In the recent years, global dimming of solar irradiance is growing due to the increase of aerosols, air pollutants and population density. In order to elucidate the effects of reduced solar irradiance on chlorophyll fluorescence parameters and gas exchange of winter wheat cultivar, we conducted a field experiment in Nanjing city by using the Triticum aestivum L. (cv.Yang mai 13) as the experimental plants. Five reduced solar radiation treatments were set up in the experiments, including 15%(T4), 20%(T3), 40%(T2), 60%(T1 )and 100%(CK)of natural solar radiation, while using Diving-PAM chlorophyll fluorometer and Lcpro+ photosynthesis to measured at different grain filling stages of crop chlorophyll fluorescence and gas exchange of the dynamic changes. The results showed that reducing solar radiation significantly increased chlorophyll and lutein content of winter wheat in the grain filling stage, but the Chla/Chlb and photosynthetic rate( Pn) continued to decrease. Fv/Fm, qP, Y( NO), ( 1 -qP)INPQ and the actual photochemical efficiency(Yield) increased with solar radiation intensity decreased, and show a downward trend, but NPQ, Y (NPQ) and L (PFD) rised. Visible, less solar radiationis cut in winter wheat leaves, when the primary photochemical reaction of PS II electron transfers efficiency met the energy shortage of stress( a decline in photochemical quenching qP). Meanwhile, reducing the electronic delivery of the body (PQ) activity (quantum efficiency Yield was lower), was to increase the heat dissipation leaves, resulting in reduced photosynthetic capacity.%以冬小麦为供试材料,在大用试验条件下研究了模拟太阳辐射减弱对冬小麦旗叶光合色素、叶绿素荧光参数及气体交换的影响.试验中设计了15%、20% 、40% 、60%和100%(CK)自然太阳总辐射5种太阳总辐射处理,同时采用Diving-PAM叶绿素荧光仪和LCpro+光合仪测定了不同灌浆阶段作物叶绿素荧光及气体交换参数的动态

  17. High-order harmonic generation in Ar and Ne with a 45fs intense laser field

    Institute of Scientific and Technical Information of China (English)

    徐至展; 王迎松; 翟侃; 李学信; 刘亚青; 杨晓东; 张正泉; 李儒新; 张文琦

    1999-01-01

    Experimental results of high-order harmonic generation (HHG) in Ar and Ne gas driven with a 45fs Ti: sapphire laser are presented. The shortest-wavelength harmonic emission corresponding to the 91st order harmonic (8.63nm) is observed in argon. In neon, the harmonics up to order 131 (5.99nm) is also observed. The effects of gas density, laser intensity, free electron and the focusing geometry parameters of the laser beam on the process of harmonic generation are investigated. The direct experimental evidence that an increased electron density causes a degenerated harmonic radiation is obtained.

  18. Properties and etching rates of negative ions in inductively coupled plasmas and dc discharges produced in Ar/SF6

    DEFF Research Database (Denmark)

    Draghici, Mihai; Stamate, Eugen

    2010-01-01

    Negative ion production is investigated in a chamber with transversal magnetic filter operated in dc or inductively coupled plasma (ICP) modes in Ar/SF6 gas mixtures. Plasma parameters are evaluated by mass spectrometry and Langmuir probe for different discharge conditions. The density ratio of n...

  19. Dicty_cDB: FC-AR10 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR10 (Link to dictyBase) - - - Contig-U15065-1 FC-AR10P (Li...nk to Original site) FC-AR10F 417 FC-AR10Z 438 FC-AR10P 855 - - Show FC-AR10 Library FC (Link to library) Clone ID FC-AR...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR10Q.Seq.d/ Representative seq. ID FC-AR...10P (Link to Original site) Representative DNA sequence >FC-AR10 (FC-AR10Q) /CSM/FC/FC-AR/FC-AR...DILSYI*k*kk*k*kpi*i*i*ik Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR10 (FC-AR

  20. Dicty_cDB: FC-AR05 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR05 (Link to dictyBase) - G24049 DDB0188590 Contig-U15127-1 FC-AR...05Z (Link to Original site) - - FC-AR05Z 510 - - - - Show FC-AR05 Library FC (Link to library) Clone ID FC-AR...7-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR05Q.Se...q.d/ Representative seq. ID FC-AR05Z (Link to Original site) Representative DNA sequence >FC-AR05 (FC-AR05Q) /CSM/FC/FC-AR/FC-AR...C-AS24Q) /CSM/FC/FC-AS/FC-AS24Q.Seq.d/ 381 e-105 FC-AR05 (FC-AR05Q) /CSM/FC/FC-AR/FC-AR05Q.Seq.d/ 381 e-105

  1. Dicty_cDB: FC-AR16 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR16 (Link to dictyBase) - - - Contig-U15457-1 FC-AR16E (Li...nk to Original site) - - - - - - FC-AR16E 387 Show FC-AR16 Library FC (Link to library) Clone ID FC-AR16 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR16Q.Seq.d/ Representative seq. ID FC-AR...16E (Link to Original site) Representative DNA sequence >FC-AR16 (FC-AR16Q) /CSM/FC/FC-AR/FC-AR16Q.Seq....26 0.0 VFG822 (VFG822Q) /CSM/VF/VFG8-A/VFG822Q.Seq.d/ 726 0.0 FC-AR16 (FC-AR16Q) /CSM/FC/FC-AR/FC-AR16Q.Seq.

  2. Dicty_cDB: FC-AR17 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR17 (Link to dictyBase) - - - Contig-U15982-1 FC-AR17P (Li...nk to Original site) FC-AR17F 264 FC-AR17Z 543 FC-AR17P 807 - - Show FC-AR17 Library FC (Link to library) Clone ID FC-AR...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR17Q.Seq.d/ Representative seq. ID FC-AR...17P (Link to Original site) Representative DNA sequence >FC-AR17 (FC-AR17Q) /CSM/FC/FC-AR/FC-AR...gy vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR17 (FC-AR

  3. Dicty_cDB: FC-AR01 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR01 (Link to dictyBase) - - - Contig-U15659-1 FC-AR01Z (Li...nk to Original site) - - FC-AR01Z 467 - - - - Show FC-AR01 Library FC (Link to library) Clone ID FC-AR01 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR01Q.Seq.d/ Representative seq. ID FC-AR...01Z (Link to Original site) Representative DNA sequence >FC-AR01 (FC-AR01Q) /CSM/FC/FC-AR/FC-AR01Q.Seq....es producing significant alignments: (bits) Value FC-AR01 (FC-AR01Q) /CSM/FC/FC-AR/FC-AR01Q.Seq.d/ 910 0.0 S

  4. Dicty_cDB: FC-AR23 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR23 (Link to dictyBase) - - - Contig-U15115-1 FC-AR23Z (Li...nk to Original site) - - FC-AR23Z 557 - - - - Show FC-AR23 Library FC (Link to library) Clone ID FC-AR23 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR23Q.Seq.d/ Representative seq. ID FC-AR...23Z (Link to Original site) Representative DNA sequence >FC-AR23 (FC-AR23Q) /CSM/FC/FC-AR/FC-AR23Q.Seq....vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR23 (FC-AR23Q) /CSM/FC/FC-AR/FC-AR

  5. The role of mitochondrial fusion and StAR phosphorylation in the regulation of StAR activity and steroidogenesis.

    Science.gov (United States)

    Castillo, Ana F; Orlando, Ulises; Helfenberger, Katia E; Poderoso, Cecilia; Podesta, Ernesto J

    2015-06-15

    The steroidogenic acute regulatory (StAR) protein regulates the rate-limiting step in steroidogenesis, i.e. the delivery of cholesterol from the outer (OMM) to the inner (IMM) mitochondrial membrane. StAR is a 37-kDa protein with an N-terminal mitochondrial targeting sequence that is cleaved off during mitochondrial import to yield 30-kDa intramitochondrial StAR. StAR acts exclusively on the OMM and its activity is proportional to how long it remains on the OMM. However, the precise fashion and the molecular mechanism in which StAR remains on the OMM have not been elucidated yet. In this work we will discuss the role of mitochondrial fusion and StAR phosphorylation by the extracellular signal-regulated kinases 1/2 (ERK1/2) as part of the mechanism that regulates StAR retention on the OMM and activity.

  6. HXeI and HXeH in Ar, Kr, and Xe matrices: experiment and simulation.

    Science.gov (United States)

    Zhu, Cheng; Niimi, Keisuke; Taketsugu, Tetsuya; Tsuge, Masashi; Nakayama, Akira; Khriachtchev, Leonid

    2015-02-01

    Experimental and theoretical studies of HXeI and HXeH molecules in Ar, Kr, and Xe matrices are presented. HXeI exhibits the H-Xe stretching bands at 1238.0 and 1239.0 cm(-1) in Ar and Kr matrices, respectively, that are blue-shifted from the HXeI band observed in a Xe matrix (1193 cm(-1)) by 45 and 46 cm(-1). These shifts are larger than those observed previously for HXeCl (27 and 16 cm(-1)) and HXeBr (37 and 23 cm(-1)); thus, the matrix effect is stronger for less stable molecules. The results for HXeI are qualitatively different from all previous results on noble-gas hydrides with respect to the frequency order between Ar and Kr matrices. For previously studied HXeCl, HXeBr, and HXeCCH, the H-Xe stretching frequency is reliably (by >10 cm(-1)) higher in an Ar matrix than in a Kr matrix. In contrast, the H-Xe stretching frequency of HXeI in an Ar matrix is slightly lower than that in a Kr matrix. HXeH absorbs in Ar and Kr matrices at 1203.2 and 1192.1 cm(-1) (the stronger band for a Kr matrix), respectively. These bands are blue-shifted from the stronger band of HXeH in a Xe matrix (1166 cm(-1)) by 37 and 26 cm(-1), and this frequency order is the same as observed for HXeCl, HXeBr, and HXeCCH but different from HXeI. The present hybrid quantum-classical simulations successfully describe the main experimental findings. For HXeI in the 〈110〉 (double substitution) site, the order of the H-Xe stretching frequencies (ν(Xe) Kr)) is in accord with the experimental observations, and also the frequency shifts in Ar and Kr matrices from a Xe matrix are well predicted (30 and 34 cm(-1)). Both in the theory and experiment, the order of the H-Xe stretching frequencies differs from the case of HXeCl, which suggests the adequate theoretical description of the matrix effect. For HXeH in the 〈100〉 (single substitution) site, the order of the frequencies is ν(Xe) Kr) Kr matrices with respect to a Xe matrix (36 and 23 cm(-1)) are in a good agreement with the experiments

  7. Estimation of (41)Ar activity concentration and release rate from the TRIGA Mark-II research reactor.

    Science.gov (United States)

    Hoq, M Ajijul; Soner, M A Malek; Rahman, A; Salam, M A; Islam, S M A

    2016-03-01

    The BAEC TRIGA research reactor (BTRR) is the only nuclear reactor in Bangladesh. Bangladesh Atomic Energy Regulatory Authority (BAERA) regulations require that nuclear reactor licensees undertake all reasonable precautions to protect the environment and the health and safety of persons, including identifying, controlling and monitoring the release of nuclear substances to the environment. The primary activation product of interest in terms of airborne release from the reactor is (41)Ar. (41)Ar is a noble gas readily released from the reactor stacks and most has not decayed by the time it moves offsite with normal wind speed. Initially (41)Ar is produced from irradiation of dissolved air in the primary water which eventually transfers into the air in the reactor bay. In this study, the airborne radioisotope (41)Ar generation concentration, ground level concentration and release rate from the BTRR bay region are evaluated theoretically during the normal reactor operation condition by several governing equations. This theoretical calculation eventually minimizes the doubt about radiological safety to determine the radiation level for (41)Ar activity whether it is below the permissible limit or not. Results show that the estimated activity for (41)Ar is well below the maximum permissible concentration limit set by the regulatory body, which is an assurance for the reactor operating personnel and general public. Thus the analysis performed within this paper is so much effective in the sense of ensuring radiological safety for working personnel and the environment. PMID:26736180

  8. N 2-Ar-He compositions in fluid inclusions: Indicators of fluid source

    Science.gov (United States)

    Norman, David I.; Musgrave, John A.

    1994-02-01

    A quadrupole mass spectrometer was used to measure bulk samples of conservative gas species N 2, Ar, and He in fluid inclusions from a variety of hydrothermal systems. Analyses of these tracer elements help determine (1) if gases extracted by bulk inclusion analyses can provide accurate measurement of N 2-Ar-He in active and fossil geothermal systems, (2) if hydrothermal fluids associated with paleogeothermal systems in a continental setting follow N 2ArHe systematics similar to th the western Pacific Rim active geothermal systems, specifically New Zealand, and (3) whether different deposit types systematically vary with regard to N 2ArHe. The N 2ArHe ratios of fluid inclusion volatiles released from recently deposited minerals from the Valles system are similar to those of present day Valles thermal waters. Those inclusion samples from deep within the Valles system, below a regional aquitard, increase in N 2. Compositions for inclusions from the Questa and Copper Flat-porphyry deposits are N 2-rich, similar to those of arc-related volcanic gases, whereas those from Taylor Creek Sn deposit appear to be mixtures of magmatic and crustal components. N 2-Ar-He ratios of the Precambrian Tribag deposit suggest a basalt source, but significant levels of self-generated He from U and Th in the inclusion fluids are also possible. Inclusions from two epithermal deposits with low-salinity inclusions have N 2-Ar-He ratios trending towards air-saturated meteoric waters (ASW), and those inclusions with higher salinities indicate minor to no ASW component. The N 2-Ar-He ratios in Fresnillo and Cochiti inclusions, which have magmatic helium isotopic ratios, indicate additions of magmatic gases to meteoric fluids. Inclusions from sediment-hosted deposits that contain hydrocarbon-bearing brines are He-rich, as are meteoric waters with a long residence time in the crust. At relevant pressure-temperature-composition conditions, Henry's Law constants of N 2, Ar, and He

  9. Electron swarm and transport coefficients for the binary mixtures of SF6 with Ar and Xe

    International Nuclear Information System (INIS)

    A pulsed Townsend technique was used to measure the electron drift velocity, the longitudinal diffusion, and the effective ionization coefficients, and the limiting field strength for the binary mixtures of SF6 with Ar and Xe. This paper covered a wide range of the density-reduced electric field strength E/N between 50 and 700 Td (1 Townsend (Td) = 10-17 V cm2). The content of SF6 in the gas mixtures was varied over the range 1-90%. For the SF6-Ar mixture, the electron drift velocities were found to be higher than those for pure SF6, and conversely for the SF6-Xe mixture. The above can be explained in terms of the larger momentum transfer cross-section for electrons in Xe than in Ar. The limiting field strength for the SF6-Xe mixture was found to be higher than that for the SF6-Ar one, but still lower than that for the SF6-N2 mixture

  10. New high-precision 40Ar/39Ar ages on Oligocene volcanic rocks of northwestern Kenya

    Science.gov (United States)

    Brown, Francis H.; Jicha, Brian R.

    2016-02-01

    New, high-precision 40Ar/39Ar ages from volcanic rocks in northwestern Kenya are provided for some areas of exposure in this remote area. We report seven 40Ar/39Ar ages generated from single crystal total fusion experiments on alkali feldspar separated from volcanic rocks in the Mogila, Songot, and Lokwanamur Ranges and the Gatome valley. A rhyolite from the lower part of the sequence in the Mogila Range yielded ages of 32.31 ± 0.06 Ma and 32.33 ± 0.07 Ma, and a rhyolite near the top of that sequence yielded 31.67 ± 0.04 Ma. A single sample from the Songot Range yielded an age of 32.49 ± 0.07 Ma, slightly older than the rocks collected from Mogila. In both ranges the early Oligocene rhyolites are underlain by basalts, as is also the case in the Labur Range. Ages of 25.95 ± 0.03 Ma, 25.91 ± 0.04 Ma, and 27.15 ± 0.03 Ma were measured on alkali feldspar from rhyolites from the Lokwanamur Range, and the nearby Gatome valley. All of these rocks are part of an episode of widespread volcanism in northwestern Kenya in the mid-to late Oligocene that is not currently known from the Ethiopian Rift Valley.

  11. An aging study of triple GEMs in Ar-CO sub 2

    CERN Document Server

    Guirl, L; May, J; Miyamoto, J; Shipsey, I

    2002-01-01

    An aging study was performed using triple GEMs and a print circuit board (PCB) with an intense X-ray radiation source. The GEM chamber consists of three identical GEMs and a large gas gain (6000) was shared by them. The chamber and its gas circulation line was carefully cleaned and constructed with stainless steel materials. The detector was irradiated continuously about 750 h without interruption until a large amount of charge was accumulated. A single-wire counter served as a monitoring device to check the beam and ambient conditions. The quality of the Ar-CO sub 2 gas was checked by gas chromatography and no measurable amount of hydrocarbons were found. 27 mC/mm sup 2 was accumulated with no noticeable degradation and no deposit or discoloration was found in an optical check.

  12. Discrete self similarity in filled type I strong explosions

    Science.gov (United States)

    Yalinewich, Almog; Sari, Re'em

    2013-12-01

    We present new solutions to the strong explosion problem in a non power law density profile. The unperturbed self similar solutions developed by Sedov, Taylor, and Von Neumann describe strong Newtonian shocks propagating into a cold gas with a density profile falling off as r-ω, where ω le 7-γ /γ +1 (filled type I solutions), and γ is the adiabatic index of the gas. The perturbations we consider are spherically symmetric and log periodic with respect to the radius. While the unperturbed solutions are continuously self similar, the log periodicity of the density perturbations leads to a discrete self similarity of the perturbations, i.e., the solution repeats itself up to a scaling at discrete time intervals. We discuss these solutions and verify them against numerical integrations of the time dependent hydrodynamic equations. This is an extension of a previous investigation on type II solutions and helps clarifying boundary conditions for perturbations to type I self similar solutions.

  13. Androgen Receptor-Mediated Growth Suppression of HPr-1AR and PC3-Lenti-AR Prostate Epithelial Cells.

    Directory of Open Access Journals (Sweden)

    Young-Chae Kim

    Full Text Available The androgen receptor (AR mediates the developmental, physiologic, and pathologic effects of androgens including 5α-dihydrotestosterone (DHT. However, the mechanisms whereby AR regulates growth suppression and differentiation of luminal epithelial cells in the prostate gland and proliferation of malignant versions of these cells are not well understood, though they are central to prostate development, homeostasis, and neoplasia. Here, we identify androgen-responsive genes that restrain cell cycle progression and proliferation of human prostate epithelial cell lines (HPr-1AR and PC3-Lenti-AR, and we investigate the mechanisms through which AR regulates their expression. DHT inhibited proliferation of HPr-1AR and PC3-Lenti-AR, and cell cycle analysis revealed a prolonged G1 interval. In the cell cycle, the G1/S-phase transition is initiated by the activity of cyclin D and cyclin-dependent kinase (CDK complexes, which relieve growth suppression. In HPr-1AR, cyclin D1/2 and CDK4/6 mRNAs were androgen-repressed, whereas CDK inhibitor, CDKN1A, mRNA was androgen-induced. The regulation of these transcripts was AR-dependent, and involved multiple mechanisms. Similar AR-mediated down-regulation of CDK4/6 mRNAs and up-regulation of CDKN1A mRNA occurred in PC3-Lenti-AR. Further, CDK4/6 overexpression suppressed DHT-inhibited cell cycle progression and proliferation of HPr-1AR and PC3-Lenti-AR, whereas CDKN1A overexpression induced cell cycle arrest. We therefore propose that AR-mediated growth suppression of HPr-1AR involves cyclin D1 mRNA decay, transcriptional repression of cyclin D2 and CDK4/6, and transcriptional activation of CDKN1A, which serve to decrease CDK4/6 activity. AR-mediated inhibition of PC3-Lenti-AR proliferation occurs through a similar mechanism, albeit without down-regulation of cyclin D. Our findings provide insight into AR-mediated regulation of prostate epithelial cell proliferation.

  14. The dynamic response of carbon fiber-filled polymer composites

    Directory of Open Access Journals (Sweden)

    Patterson B.

    2012-08-01

    Full Text Available The dynamic (shock responses of two carbon fiber-filled polymer composites have been quantified using gas gun-driven plate impact experimentation. The first composite is a filament-wound, highly unidirectional carbon fiber-filled epoxy with a high degree of porosity. The second composite is a chopped carbon fiber- and graphite-filled phenolic resin with little-to-no porosity. Hugoniot data are presented for the carbon fiber-epoxy (CE composite to 18.6 GPa in the through-thickness direction, in which the shock propagates normal to the fibers. The data are best represented by a linear Rankine-Hugoniot fit: Us = 2.87 + 1.17 ×up(ρ0 = 1.536g/cm3. The shock wave structures were found to be highly heterogeneous, both due to the anisotropic nature of the fiber-epoxy microstructure, and the high degree of void volume. Plate impact experiments were also performed on a carbon fiber-filled phenolic (CP composite to much higher shock input pressures, exceeding the reactants-to-products transition common to polymers. The CP was found to be stiffer than the filament-wound CE in the unreacted Hugoniot regime, and transformed to products near the shock-driven reaction threshold on the principal Hugoniot previously shown for the phenolic binder itself. [19] On-going research is focused on interrogating the direction-dependent dyanamic response and dynamic failure strength (spall for the CE composite in the TT and 0∘ (fiber directions.

  15. Contraction stresses of composite resin filling materials.

    Science.gov (United States)

    Hegdahl, T; Gjerdet, N R

    1977-01-01

    The polymerization shrinkage of composite resin filling materials and the tensile stresses developed when the shrinkage is restrained were measured in an in vitro experiment. This allows an estimation to be made of the forces exerted upon the enamel walls of cavities filled with the resin in the acid etch technique. The results indicate that the stresses acting on the enamel are low compared to the tensile strength of the enamel.

  16. Identification and analysis of ARS function of six plant MARs

    Institute of Scientific and Technical Information of China (English)

    LI Hong; YANG Yutao; ZHANG Kewei; ZHENG Chengchao

    2004-01-01

    Six plant MARs isolated from tobacco and Arabdiposis were investigated for their ARS activity in yeast.The results showed that among the six plant MARs, only TM1 and AM4 had strong ARS activity which was almost the same as that of ARS from yeast chromosome. In order to further identify the core region of the two MARs for the ARS activity, a series of subclones were created by PCR strategy,and the corresponding subclones were designated as TM1-1,TM1-2, TM1-3, AM4-1, AM4-2 and AM4-3, respectively. Our studies revealed that TM1-3 and AM4-3 not only had higher ARS activity, but also displayed higher transformation frequency, plasmid stability and growth rate compared to their intact MARs, TM1 and AM4. These data present an important clue for further elucidating the relationship between MAR and ARS.

  17. Atmospheric pressure plasma polymerization using double grounded electrodes with He/Ar mixture

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Dong Ha; Kim, Hyun-Jin; Park, Choon-Sang; Tae, Heung-Sik, E-mail: hstae@ee.knu.ac.kr [School of Electronics Engineering, College of IT Engineering, Kyungpook National University, Daegu, 702-701 (Korea, Republic of); Shin, Bhum Jae [Department of Electronics Engineering, Sejong University, Seoul 143-747 (Korea, Republic of); Seo, Jeong Hyun [Department of Electronics Engineering, Incheon National University, Incheon 406-772 (Korea, Republic of)

    2015-09-15

    In this study, we have proposed the double grounded atmospheric pressure plasma jet (2G-APPJ) device to individually control the plasmas in both fragmentation (or active) and recombination (or passive) regions with a mixture of He and Ar gases to deposit organic thin films on glass or Si substrates. Plasma polymerization of acetone has been successfully deposited using a highly energetic and high-density 2G-APPJ and confirmed by scanning electron microscopy (SEM). Plasma composition was measured by optical emission spectroscopy (OES). In addition to a large number of Ar and He spectra lines, we observed some spectra of C{sub 2} and CH species for fragmentation and N{sub 2} (second positive band) species for recombination. The experimental results confirm that the Ar gas is identified as a key factor for facilitating fragmentation of acetone, whereas the He gas helps the plume of plasma reach the substrate on the 2{sup nd} grounded electrode during the plasma polymerization process. The high quality plasma polymerized thin films and nanoparticles can be obtained by the proposed 2G-APPJ device using dual gases.

  18. Calibration of Nu-Instruments Noblesse multicollector mass spectrometers for argon isotopic measurements using a newly developed reference gas

    Science.gov (United States)

    Coble, M.A.; Grove, M.; Calvert, A.T.

    2011-01-01

    The greatest challenge limiting 40Ar/39Ar multicollection measurements is the availability of appropriate standard gasses to intercalibrate detectors. In particular, use of zoom lens ion-optics to steer and focus ion beams into a fixed detector array (i.e., Nu Instruments Noblesse) makes intercalibration of multiple detectors challenging because different ion-optic tuning conditions are required for optimal peak shape and sensitivity at different mass stations. We have found that detector efficiency and mass discrimination are affected by changes in ion-optic tuning parameters. Reliance upon an atmospheric Ar standard to calibrate the Noblesse is problematic because there is no straightforward way to relate atmospheric 40Ar and 36Ar to measurements of 40Ar and 39Ar if they are measured on separate detectors. After exploring alternative calibration approaches, we have concluded that calibration of the Noblesse is best performed using exactly the same source, detector, and ion-optic tuning settings as those used in routine 40Ar/39Ar analysis. To accomplish this, we have developed synthetic reference gasses containing 40Ar, 39Ar and 38Ar produced by mixing gasses derived from neutron-irradiated sanidine with an enriched 38Ar spike. We present a new method for calibrating the Noblesse based on use of both atmospheric Ar and the synthetic reference gasses. By combining atmospheric Ar and synthetic reference gas in different ways, we can directly measure 40Ar/39Ar, 38Ar/39Ar, and 36Ar/39Ar correction factors over ratios that vary from 0.5 to 460. These correction factors are reproducible to better than ??0.5??? (2?? standard error) over intervals spanning ~24h but can vary systematically by ~4% over 2weeks of continuous use when electron multiplier settings are held constant. Monitoring this variation requires daily calibration of the instrument. Application of the calibration method to 40Ar/39Ar multicollection measurements of widely used sanidine reference materials

  19. Comparison of vacuum ultra-violet emission of Ar/CF4 and Ar/CF3I capacitively coupled plasmas

    Science.gov (United States)

    Zotovich, A.; Proshina, O.; el Otell, Z.; Lopaev, D.; Rakhimova, T.; Rakhimov, A.; de Marneffe, J.-F.; Baklanov, M. R.

    2016-10-01

    Spectra in the vacuum-ultra violet range (VUV, 30 nm-200 nm) as well as in the ultra-violet(UV) and visible ranges (UV+vis, 200 nm-800 nm) were measured from Ar/CF3I and Ar/CF4 discharges. The discharges were generated in an industrial 300 mm capacitively coupled plasma source with 27 MHz radio-frequency power. It was seen that the measured spectra were strongly modified. This is mainly due to absorption, especially by CF3I, and Ar self-trapping along the line of sight, towards the detector and in the plasma itself. The estimated unabsorbed VUV spectra were revealed from the spectra of mixtures with low fluorocarbon gas content by means of normalization with unabsorbed I* emission, at 206 nm, and CF2\\ast band (1B1(0,v‧,0){{\\to}1} A1(0,{{\\text{v}}\\prime \\prime} ,0)) emission between 230 nm and 430 nm. Absolute fluences of UV CF2\\ast emission were derived using hybrid 1-dimensional (1D) particle-in-cell (PIC) Monte-Carlo (MC) model calculations. Absolute calibration of the VUV emission was performed using these calculated values from the model, which has never been done previously for real etch conditions in an industrial chamber. It was seen that the argon resonant lines play a significant role in the VUV spectra. These lines are dominant in the case of etching recipes close to the standard ones. The restored unabsorbed spectra confirm that replacement of conventional CF4 etchant gas with CF3I in low-k etching recipes leads to an increase in the overall VUV emission intensity. However, emission from Ar exhibited the most intense peaks. Damage to low-k SiCOH glasses by the estimated VUV was calculated for blanket samples with pristine k-value of 2.2. The calculations were then compared with Fourier transform infrared (FTIR) data for samples exposed to the similar experimental conditions in the same reactor. It was shown that Ar emission plays the most significant role in VUV-induced damage.

  20. Plasma AR and abiraterone-resistant prostate cancer.

    Science.gov (United States)

    Romanel, Alessandro; Gasi Tandefelt, Delila; Conteduca, Vincenza; Jayaram, Anuradha; Casiraghi, Nicola; Wetterskog, Daniel; Salvi, Samanta; Amadori, Dino; Zafeiriou, Zafeiris; Rescigno, Pasquale; Bianchini, Diletta; Gurioli, Giorgia; Casadio, Valentina; Carreira, Suzanne; Goodall, Jane; Wingate, Anna; Ferraldeschi, Roberta; Tunariu, Nina; Flohr, Penny; De Giorgi, Ugo; de Bono, Johann S; Demichelis, Francesca; Attard, Gerhardt

    2015-11-01

    Androgen receptor (AR) gene aberrations are rare in prostate cancer before primary hormone treatment but emerge with castration resistance. To determine AR gene status using a minimally invasive assay that could have broad clinical utility, we developed a targeted next-generation sequencing approach amenable to plasma DNA, covering all AR coding bases and genomic regions that are highly informative in prostate cancer. We sequenced 274 plasma samples from 97 castration-resistant prostate cancer patients treated with abiraterone at two institutions. We controlled for normal DNA in patients' circulation and detected a sufficiently high tumor DNA fraction to quantify AR copy number state in 217 samples (80 patients). Detection of AR copy number gain and point mutations in plasma were inversely correlated, supported further by the enrichment of nonsynonymous versus synonymous mutations in AR copy number normal as opposed to AR gain samples. Whereas AR copy number was unchanged from before treatment to progression and no mutant AR alleles showed signal for acquired gain, we observed emergence of T878A or L702H AR amino acid changes in 13% of tumors at progression on abiraterone. Patients with AR gain or T878A or L702H before abiraterone (45%) were 4.9 and 7.8 times less likely to have a ≥50 or ≥90% decline in prostate-specific antigen (PSA), respectively, and had a significantly worse overall [hazard ratio (HR), 7.33; 95% confidence interval (CI), 3.51 to 15.34; P = 1.3 × 10(-9)) and progression-free (HR, 3.73; 95% CI, 2.17 to 6.41; P = 5.6 × 10(-7)) survival. Evaluation of plasma AR by next-generation sequencing could identify cancers with primary resistance to abiraterone.

  1. Modeling of Filling and Solidification Process for TiAl Exhaust Valves During Suction Casting

    Institute of Scientific and Technical Information of China (English)

    Chao XIONG; Yingche MA; Bo CHEN; Kui LIU; Yiyi LI

    2013-01-01

    Investment and suction casting (ISC) represents an economic and promising process route to fabricate automotive exhaust valves ofγ-TiAl based alloys,but information available on the metal flow and the temperature changes during mould filling and solidification process for the ISC process is meager.A sequentially coupled mathematical flow-thermal model,based on the commercial finite-volume/finite-difference code FLOW-3D and the finite-element code PROCAST,has been developed to investigate the ISC process.In term of calculating the flow and temperature fields during the filling and solidification stages,potential defects including the gas bubbles and the surface air entrainment occurred in the mould filling process and the shrinkage porosities formed in the solidification process are predicted and the reasons for the formation of these defects are also analyzed.The effects of filling pressure difference control methods and moulds on gas bubble and surface air entrainment behavior are presented.It is found that by changing the filling pressure difference control methods from general suction casting to "air leakage" suction casting and reducing air leakage flow rates,the gas bubbles are eliminated effectively,and the surface air entrainment attenuate dramatically.With resort to a mould with a tetragonal runner,the surface air entrainment decrease to the lowest level.Finally,the water analogue and suction casting experiments of exhaust valves are implemented for further validation of the simulation results.

  2. Perturbed Coupled-Cluster theory to calculate dipole polarizabilities of closed shell systems: Application to Ar, Kr, Xe and Rn

    CERN Document Server

    Chattopadhyay, S; Angom, D

    2012-01-01

    We use perturbed relativistic coupled-cluster (PRCC) theory to calculate the electric dipole polarizability of noble gas atoms Ar, Kr, Xe and Rn. We also provide a detailed description of the nonlinear terms in the PRCC theory and consider the Dirac-Coulomb-Breit atomic Hamiltonian for the calculations. We find that the largest contribution from Breit interaction to the electric dipole polarizability is 0.1%, in the case of Rn. As we go from Ar to Rn, based on the pattern in the random phase approximation effects, the contraction of the outermost $p_{1/2}$ due to relativistic corrections is discernible without any ambiguity.

  3. Negative ion gas-phase chemistry of arenes.

    Science.gov (United States)

    Danikiewicz, Witold; Zimnicka, Magdalena

    2016-01-01

    Reactions of aromatic and heteroaromatic compounds involving anions are of great importance in organic synthesis. Some of these reactions have been studied in the gas phase and are occasionally mentioned in reviews devoted to gas-phase negative ion chemistry, but no reviews exist that collect all existing information about these reactions. This work is intended to fill this gap. In the first part of this review, methods for generating arene anions in the gas phase and studying their physicochemical properties and fragmentation reactions are presented. The main topics in this part are as follows: processes in which gas-phase arene anions are formed, measurements and calculations of the proton affinities of arene anions, proton exchange reactions, and fragmentation processes of substituted arene anions, especially phenide ions. The second part is devoted to gas-phase reactions of arene anions. The most important of these are reactions with electrophiles such as carbonyl compounds and α,β-unsaturated carbonyl and related compounds (Michael acceptors). Other reactions including oxidation of arene anions and halogenophilic reactions are also presented. In the last part of the review, reactions of electrophilic arenes with nucleophiles are discussed. The best known of these is the aromatic nucleophilic substitution (SN Ar) reaction; however, other processes that lead to the substitution of a hydrogen atom in the aromatic ring are also very important. Aromatic substrates in these reactions are usually but not always nitroarenes bearing other substituents in the ring. The first step in these reactions is the formation of an anionic σ-adduct, which, depending on the substituents in the aromatic ring and the structure of the attacking nucleophile, is either an intermediate or a transition state in the reaction path. In the present review, we attempted to collect the results of both experimental and computational studies of the aforementioned reactions conducted since the

  4. Preliminary Ar-40/Ar-39 age spectrum and laser probe dating of the M1 core of the Manson Impact Structure, Iowa: A K-T boundary crater candidate

    Science.gov (United States)

    Kunk, M. J.; Snee, L. W.; French, B. M.; Harlan, S. S.; Mcgee, J. J.

    1993-01-01

    Preliminary Ar-40/Ar-39 age spectrum and laser probe dating results from new drill core from the 35-km-diameter Manson Impact Structure (MIS), Iowa indicates a reasonable possibility that the MIS is a Cretaceous-Tertiary (K-T) boundary impact event. Several different types of samples from a melt-matrix breccia, a unit of apparent crater fill intersected by the M1 core, were analyzed. Ar-40/Ar-39 results from these samples indicate a maximum age for the MIS of about 65.4 plus or minus 0.4(2 sigma) Ma. Petrographic analyses of the samples indicate a high probability that all the dated samples from the melt-matrix breccia contain relict grains that were not entirely melted or degassed at the time of impact, suggesting that the actual age of the MIS could be somewhat younger than our preliminary results indicate. The results are consistent with a previously published age estimate of shocked microcline from the MIS central uplift of 65.7 plus or minus 1.0 Ma.

  5. High radon levels in subterranean environments: monitoring and technical criteria to ensure human safety (case of Castañar cave, Spain)

    International Nuclear Information System (INIS)

    Castañar cave contains the highest radon gas (222Rn) concentration in Spain with an annual average of 31.9 kBq m−3. Seasonal variations with summer minimums and maximum values in fall were recorded. The reduction of air-filled porosity of soil and rock by condensation or rainfalls hides the radon exchange by gas diffusion, determining this seasonal stair-step pattern of the radon activity concentration in underground air. The effective total dose and the maximum hours permitted have been evaluated for the guides and public safety with a highly detailed radon measurement along 2011 and 2012. A network of 12 passive detectors (kodalphas) has been installed, as well as, two radon continuous monitoring in the most interesting geological sites of the subterranean environment. A follow up of the recommended time (max. 50 min) inside the underground environment has been analysed since the reopen to public visitors for not surpassing the legal maximum effective dose for tourists and guides. Results shown that public visitors would receive in fall a 12.1% of the total effective dose permitted per visit, whereas in summer it is reduced to 8.6%, while the cave guide received a total effective dose of 6.41 mSv in four months. The spatial radon maps allow defining the most suitable touristic paths according to the radon concentration distribution and therefore, appropriate fall and summer touristic paths are recommended. - Highlights: • Castañar cave contains the highest radon concentration in Spain (average: 31.9 kBq m−3). • The Rn concentration decreases by advection processes during the dry periods (Text > Tcave). • The most connected areas inside the cave accumulate more Rn in winter and ventilate more in summer. • Public visitors received 12.1% of the total effective dose permitted per visit based on legal constrains. • Passive Rn detectors introduce a significant error in the effective dose calculations

  6. Ar-39 - Ar-40 Evidence for an Approximately 4.26 Ga Impact Heating Event on the LL Parent Body

    Science.gov (United States)

    Dixon, E. T.; Bogard, D. D.; Rubin, A. E.

    2003-01-01

    Miller Range 99301 is a type 6, unbrecciated LL chondrite. MIL 99301 is of interest because some compositional and petrographic features suggest it experienced rather high shock grades, whereas other features suggest it is relatively unshocked. Inconsistent shock indicators could be explained if MIL 99301 was shocked but then partly annealed by heat produced by impacts on the parent body. The hypothesis that MIL 99301 experienced high temperature metamorphism (type 6) followed by a later shock event that heated, but did not melt, the constituent feldspar can be evaluated using (39)Ar-(40)Ar chronology. This is because (39)Ar-(40)Ar ages of shocked ordinary chondrites are generally <4.2 Ga, whereas (39)Ar-(40)Ar ages of unshocked meteorites are generally older, and between 4.52 - 4.38 Ga.

  7. Development of wavelength shifter coated reflectors for the ArDM argon dark matter detector

    CERN Document Server

    Boccone, V; Mavrokoridis, K; Regenfus, C; Amsler, C; Badertscher, A; Bueno, A; Cabrera, H; Carmona-Benitez, M C; Daniel, M; Daw, E J; Degunda, U; Dell'Antone, A; Gendotti, A; Epprecht, L; Horikawa, S; Kaufmann, L; Knecht, L; Laffranchi, M; Lazzaro, C; Lussi, D; Lozano, J; Marchionni, A; Melgarejo, A; Mijakowski, P; Natterer, G; Navas-Concha, S; Otyugova, P; de Prado, M; Przewlocki, P; Resnati, F; Robinson, M; Rochet, J; Romero, L; Rondio, E; Rubbia, A; Spooner, N J C; Strauss, T; Ulbricht, J; Viant, T

    2009-01-01

    To optimise the design of the light readout in the ArDM 1-ton liquid argon dark matter detector, a range of reflector and WLS coating combinations were investigated in several small setups, where argon scintillation light was generated by radioactive sources in gas at normal temperature and pressure and shifted into the blue region by tetraphenyl butadiene (TPB). Various thicknesses of TPB were deposited by spraying and vacuum evaporation onto specular 3M{\\small\\texttrademark}-foil and diffuse Tetratex{\\small\\textregistered} (TTX) substrates. Light yields of each reflector and TPB coating combination were compared. Reflection coefficients of TPB coated reflectors were independently measured using a spectroradiometer in a wavelength range between 200 and 650~nm. WLS coating on the PMT window was also studied. These measurements were used to define the parameters of the light reflectors of the ArDM experiment. Fifteen large $120\\times 25$~cm$^2$ TTX sheets were coated and assembled in the detector. Measurements...

  8. Analysis of Electron Temperature in DC Ar/SF6 Plasma Using Cylindrical and Planar Probes

    Science.gov (United States)

    Kim, Jin-Woo; Cho, Soon-Gook; Bae, Min-Keun; Kim, Hyung-Jin; Chung, Tae Hun; Chung, Kyu-Sun

    2013-11-01

    Electronegative plasmas are generated by adding SF6 gas to a background argon (Ar) DC plasma with parameters of n0 = 1×1010 cm3 and Te = 2 eV. The heating current of the thoriated filament was in the range of 20.5-21.5 A and the plasmas were generated under a discharge condition of 100 V/0.4 A. The amount of negative ions was controlled by adjusting the ratio of flow rate of SF6 = 0-10% to that of Ar. Plasma parameters were measured using cylindrical and planar electric probes. The behavior of electrons, which means the change in a parameter due to negative ion production, is characterized by measuring the floating and plasma potentials, and electron temperature. Electron temperature seems to increase and the potentials decrease with SF6 flow rate.

  9. Reactivation episodes of the romeral fault system in the northwestern part of central andes, colombia, through 39ar-40ar and k-ar results

    OpenAIRE

    VINASCO VALLEJO, CESAR JAVIER; Cordani, Umberto

    2013-01-01

    Direct dating of reactivation of the San Jerónimo Fault (SJF), easternmost limit of the Romeral fault system (RFS), is presented through 39Ar-40Ar and K-Ar results in neo-formed micas and mylonitic bands of strongly hidrothermalized gabbros. Published cooling and crystallization ages from sin-tectonic magmatic rocks exposed in the western fl ank of the Central Cordillera have suggest that tectonic evolution of the paleo-fault system began since Triassic and Lower Jurassic before the installat...

  10. Ab Initio Potential Curve for ArH+%ArH+势能曲线的从头计算

    Institute of Scientific and Technical Information of China (English)

    王胜龙; 屈军艳; 郭锐; 赵新生

    2001-01-01

    The molecular parameters of ArH+ have been calculated with different quantum chemistry methods and basis sets.Based on the data from QCISD/Aug cc pVTZ ab initio calculation for different configurations of ArH+ and the experimental data,an accurate potential curve for ArH+ has been constructed.The molecular properties,such as dissociation energy,equilibrium bond length,and vibrational energy levels,can be accurately reproduced.

  11. 40Ar/39Ar Age of the Lathrop Wells Volcanic Center, Yucca Mountain, Nevada.

    Science.gov (United States)

    Turrin, B D; Champion, D; Fleck, R J

    1991-08-01

    Paleomagnetic and (40)Ar/(39)Ar analyses from the Lathrop Wells volcanic center, Nevada, indicate that two eruptive events have occurred there. The ages (136 +/- 8 and 141 +/- 9 thousand years ago) for these two events are analytically indistinguishable. The small angular difference (4.7 degrees ) between the paleomagnetic directions from these two events suggests they differ in age by only about 100 years. These ages are consistent with the chronology of the surficial geological units in the Yucca Mountain area. These results contradict earlier interpretations of the cinder-cone geomorphology and soil-profile data that suggest that at least five temporally discrete eruptive events occurred at Lathrop Wells approximately 20,000 years ago. PMID:17772371

  12. 40Ar-39Ar age of carbonatite-alkaline magmatism in Sung Valley, Maghalaya, India

    Indian Academy of Sciences (India)

    Jyotiranjan S Ray; Kanchan Pande

    2001-09-01

    40Ar-39Ar analyses of one alkali pyroxenite whole rock and two phlogopite separates of calcite carbonatites from the Sung Valley carbonatite-alkaline complex, which is believed to be a part of the Rajmahal-Bengal-Sylhet (RBS) ood basalt province, yielded indistinguishable plateau ages of 108.8 ± 2.0 Ma, 106:4 ± 1.3 Ma and 107.5 ± 1.4 Ma, respectively. The weighted mean of these ages, 107.2 ± 0.8 Ma, is the time of emplacement of this complex. This implies that Sung Valley complex and probably other such complexes in the Assam-Meghalaya Plateau postdate the main ood basalt event (i.e., the eruption of tholeiites) in the RBS province by ∼10 Ma.

  13. Development of Gas Electron Multiplier(GEM) for digital radiographic system

    CERN Document Server

    Moon, B S; Lee, J W

    2000-01-01

    Two computer programs SHOWFIELD and IMAGEQUAL have been developed. SHOWFIELD is used to draw electric field lines for GEM detectors and IMAGEQUAL is used to study the spatial resolution of x-ray images. Various simulation runs have been carried out using EGS4 to study the characteristics of electrons generated by micro-channel plates and Ar, Xe gases. A prototype GEM detector was developed through this project. The GEM detector is composed of a pair of GEM plates, a micro-channel plate, readout circuit in a gas filled chamber. GEM plate were made in CERN to meet KAERI's design specification and the micro-channel plates were purchased from Proxitronic company.

  14. 40Ar/39Ar dating and paleo-magnetism of traps from Ethiopia, Deccan and Siberia

    International Nuclear Information System (INIS)

    Recent studies have shown that major flood basalt provinces have been emplaced as short events (∼ 1 Myr), more or less synchronous with climatic crises and mass extinctions. We present new geochronologic (40Ar/39Ar) and magneto-stratigraphic results for the Ethiopian traps, one of the last remaining flood basalts for which little of such data were available. The ages obtained in a 2000 m thick section are indistinguishable. Moreover, magneto-stratigraphy reveals a simple 3-chron reverse-normal-reverse sequence. Although magnetic chrons cannot be yet unambiguously identified, there is more likelihood for the normal sub-chron in the main basaltic pile to correspond to 11N, supporting a brief duration (less than 1.5 Ma). The Ethiopian traps erupted near 30 Ma at or near the time of the cold and dry climate, major Antarctic ice sheet advance, and the largest sea-level drop in the Tertiary. Bhandari et al. (GRL, 1995) have discovered inter-traps sediments with a triple iridium anomaly in a series of seven basaltic lava flows in the Kutch area of the North Western Deccan traps of India. Plagioclases from three flows above the iridium bearing sediments yield 39Ar/40Ar plateau ages near 65.0 Ma: these flows have unambiguously reversed magnetic polarity interpreted as chron 29R. As a preliminary summary, evidence of the KTB asteroid impact is confirmed in the Deccan traps, showing that they are coeval events in a general sense (in a Ma long window) though clearly with vastly different time constants. This is compatible with paleontologic evidence of two scales of extinctions, one quasi-instantaneous and the other on the order of 105 to 106 yrs. Clearly, the impact cannot have caused trap eruptions. On the other hand, the exact age and significance of the lower flows more altered remains to be analyzed further as they pertained to the much debated question of duration of Deccan trap volcanism. (author)

  15. 40 Ar/ 39 Ar radiometric dating to constrain the volcanic stratigraphy: The Mt. Etna methodological case.

    OpenAIRE

    De Beni, E.; Istituto Nazionale di Geofisica e Vulcanologia, Sezione Catania, Catania, Italia; Groppelli, G.; Istituto per la Dinamica dei Processi Ambientali–Sezione di Milano, Consiglio Nazionale delle Ricerche, via Mangiagalli 34, 20133 Milano, Italy

    2010-01-01

    Although ~50 radiometric age analyses have been performed on Etna, and there are many historical references, these are not enough to temporally constrain the geo- logical evolution of the volcano. In particular, a new stratigraphic framework based on lithostratigraphic and unconformity-bounded units has pointed out the presence of some stratigraphic uncertainty that can be resolved only with radiometric dating. For this reason, a dating project applying the 40 Ar/ ...

  16. Using the energy from land fill gases reduces the greenhouse effect of methane

    International Nuclear Information System (INIS)

    Several Norwegian land fills have established systems for utilisation of the energy from the gases extracted from the waste. The energy is used to produce electricity and heating. This is becoming more profitable as the energy price increases. The gas contains about 50 percent methane and its greenhouse effect is 20 times that of carbon dioxide. Thus, using it also reduces the greenhouse effect

  17. Spatial autocorrelation method using AR model; Kukan jiko sokanho eno AR model no tekiyo

    Energy Technology Data Exchange (ETDEWEB)

    Yamamoto, H.; Obuchi, T.; Saito, T. [Iwate University, Iwate (Japan). Faculty of Engineering

    1996-05-01

    Examination was made about the applicability of the AR model to the spatial autocorrelation (SAC) method, which analyzes the surface wave phase velocity in a microtremor, for the estimation of the underground structure. In this examination, microtremor data recorded in Morioka City, Iwate Prefecture, was used. In the SAC method, a spatial autocorrelation function with the frequency as a variable is determined from microtremor data observed by circular arrays. Then, the Bessel function is adapted to the spatial autocorrelation coefficient with the distance between seismographs as a variable for the determination of the phase velocity. The result of the AR model application in this study and the results of the conventional BPF and FFT method were compared. It was then found that the phase velocities obtained by the BPF and FFT methods were more dispersed than the same obtained by the AR model. The dispersion in the BPF method is attributed to the bandwidth used in the band-pass filter and, in the FFT method, to the impact of the bandwidth on the smoothing of the cross spectrum. 2 refs., 7 figs.

  18. Dicty_cDB: FC-AR21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR21 (Link to dictyBase) - - - Contig-U16455-1 FC-AR21Z (Li...nk to Original site) - - FC-AR21Z 528 - - - - Show FC-AR21 Library FC (Link to library) Clone ID FC-AR21 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR21Q.Seq.d/ Representative seq. ID FC-AR...21Z (Link to Original site) Representative DNA sequence >FC-AR21 (FC-AR21Q) /CSM/FC/FC-AR/FC-AR21Q.Seq....omology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR21 (FC-AR

  19. INFLUENCE OF FILLING WATER ON AIR CONCENTRATION

    Institute of Scientific and Technical Information of China (English)

    WU Jian-hua; MA Fei; DAI Hui-chao

    2011-01-01

    The filling water inside the cavity below an aerator occurs for the flow of low Froude number or the small bottom slope of a spillway.The aerator may cease to protect against cavitation damages,and may even act as a generator of cavitation if it is fully filled by water.The experiments were conducted to investigate the influences of the geometric parameters,and then the filling water on the air concentration.The results show that the filling water,or the net cavity length,is closely related to the plunging jet length for a given aerator,and the air concentration at some section is proportional to the ratio Ln/Lj at a fixed Lj for different geometric parameters of aerators.Secondly,at the same ratio of Ln / Lj,the aerator with a larger height or a larger angle of ramp,or a larger bottom slope,would have a larger plunging jet length,and then a larger net cavity length based on the ratio of Ln / Lj.As a result,the large space of cavity,or the high air concentration of the flow could be obtained although the filling water increases also based on the fact that Lf=Lj- Ln.It is the space of the cavity that is the dominant factor to affect the air concentration of the flow.

  20. Gas migration from oil and gas fields and associated hazards

    International Nuclear Information System (INIS)

    The migration of gas from oil and gas formations to the surface is a problem that greatly affects those surface areas where human activity exists. Underground gas storage facilities and oil fields have demonstrated a long history of gas migration problems. Experience has shown that the migration of gas to the surface creates a serious potential risk of explosion, fires, noxious odors and potential emissions of carcinogenic chemicals. These risks must be seriously examined for all oil and gas operations located in urban areas. This paper presents the mechanics of gas migration, paths of migration and a review of a few of the risks that should be considered when operating a gas facility in an urban area. The gas can migrate in a continuous or discontinuous stream through porous, water-filled media to the surface. The primary force in this migration of gas is the difference between specific weights of gas and water

  1. ArF short-pulse extraction studies. Final technical report, 18 September 1981-18 February 1983

    International Nuclear Information System (INIS)

    The experimental apparatus including e-beam pulse diagnostics is discussed. The relative fluorescence and laser output for various gas mixtures is presented and the significant improvement in laser performance for Ne buffered mixtures, allowing scaling to high pressures and high Joules per liter, is discussed. The energy deposition measurements for Ar and Ne buffered mixtures are presented. Accurate deposition measurements are necessary for a meaningful measure of the laser output efficiency. Background absorption measurements important for accessing the scalability of the ArF system are presented. The sidelight suppression experiments are discussed and the laser efficiency measurements are shown. Finally, a discussion of the measurements with their implications for the ArF system is presented in the concluding section

  2. Measurement of 37Ar to support technology for On-site Inspection under the Comprehensive Nuclear-Test-Ban Treaty

    CERN Document Server

    Aalseth, C E; Haas, D A; Hoppe, E W; Hyronimus, B J; Keillor, M E; Mace, E K; Orrell, J L; Seifert, A; Woods, V T

    2010-01-01

    On-Site Inspection (OSI) is a key component of the verification regime for the Comprehensive Nuclear-Test-Ban Treaty (CTBT). Measurements of radionuclide isotopes created by an underground nuclear explosion are a valuable signature of a Treaty violation. Argon-37 is produced from neutron interaction with calcium in soil, 40Ca(n,{\\alpha})37Ar. For OSI, the 35-day half-life of 37Ar provides both high specific activity and sufficient time for completion of an inspection before decay limits sensitivity. This paper presents a low-background internal-source gas proportional counter with an 37Ar measurement sensitivity level equivalent to 45.1 mBq/SCM in whole air.

  3. Optical diagnostics and mass spectrometry on the afterglow of an atmospheric pressure Ar/O$_2$ radiofrequency plasma used for polymer surface treatment

    CERN Document Server

    Duluard, Corinne Y; Hubert, Julie; Reniers, François

    2016-01-01

    In the context of polymer surface treatment, the afterglow of an atmospheric pressure Ar/O$_2$ radiofrequency plasma is characterized by optical emission spectroscopy, laser induced fluorescence and mass spectrometry. The influence of the O$_2$ gas flow rate and the source power on the plasma properties (gas temperature, Ar excitation temperature, relative concentrations of O atoms and OH radicals) are evaluated. We show that for plasma torch-to-substrate distances lower than 6 mm, the afterglow creates a protective atmosphere, thus the plasma gas composition interacting with the substrate is well controlled. For higher distances, the influence of ambient air can no longer be neglected and gradients in Ar, O$_2$ and N$_2$ concentrations are measured as a function of axial and vertical position.

  4. Market Assessment and Demonstration of Lignite FBC Ash Flowable Fill Applications

    Energy Technology Data Exchange (ETDEWEB)

    Alan E. Bland

    2003-09-30

    Montana-Dakota Utilities (MDU) and Western Research Institute (WRI) have been developing flowable fill materials formulated using ash from the Montana-Dakota Utilities R. M. Heskett Station in Mandan, North Dakota. MDU and WRI have partnered with the U.S. Department of Energy (DOE) and the North Dakota Industrial Commission (NDIC) to further the development of these materials for lignite-fired fluidized-bed combustion (FBC) facilities. The MDU controlled density fill (CDF) appears to be a viable engineering material and environmentally safe. WRI is pursuing the commercialization of the technology under the trademark Ready-Fill{trademark}. The project objectives were to: (1) assess the market in the Bismarck-Mandan area; (2) evaluate the geotechnical properties and environmental compatibility; and (3) construct and monitor demonstrations of the various grades of flowable fill products in full-scale demonstrations. The scope of initial phase of work entailed the following: Task I--Assess Market for MDU Flowable Fill Products; Task II--Assess Geotechnical and Environmental Properties of MDU Flowable Fill Products; and Task III--Demonstrate and Monitor MDU Flowable Fill Products in Field-Scale Demonstrations. The results of these testing and demonstration activities proved the following: (1) The market assessment indicated that a market exists in the Bismarck-Mandan area for structural construction applications, such as sub-bases for residential and commercial businesses, and excavatable fill applications, such as gas line and utility trench filling. (2) The cost of the MDU flowable fill product must be lower than the current $35-$45/cubic yard price if it is to become a common construction material. Formulations using MDU ash and lower-cost sand alternatives offer that opportunity. An estimated market of 10,000 cubic yards of MDU flowable fill products could be realized if prices could be made competitive. (3) The geotechnical properties of the MDU ash-based flowable

  5. Market Assessment and Demonstration of Lignite FBC Ash Flowable Fill Applications

    International Nuclear Information System (INIS)

    Montana-Dakota Utilities (MDU) and Western Research Institute (WRI) have been developing flowable fill materials formulated using ash from the Montana-Dakota Utilities R. M. Heskett Station in Mandan, North Dakota. MDU and WRI have partnered with the U.S. Department of Energy (DOE) and the North Dakota Industrial Commission (NDIC) to further the development of these materials for lignite-fired fluidized-bed combustion (FBC) facilities. The MDU controlled density fill (CDF) appears to be a viable engineering material and environmentally safe. WRI is pursuing the commercialization of the technology under the trademark Ready-Fill(trademark). The project objectives were to: (1) assess the market in the Bismarck-Mandan area; (2) evaluate the geotechnical properties and environmental compatibility; and (3) construct and monitor demonstrations of the various grades of flowable fill products in full-scale demonstrations. The scope of initial phase of work entailed the following: Task I--Assess Market for MDU Flowable Fill Products; Task II--Assess Geotechnical and Environmental Properties of MDU Flowable Fill Products; and Task III--Demonstrate and Monitor MDU Flowable Fill Products in Field-Scale Demonstrations. The results of these testing and demonstration activities proved the following: (1) The market assessment indicated that a market exists in the Bismarck-Mandan area for structural construction applications, such as sub-bases for residential and commercial businesses, and excavatable fill applications, such as gas line and utility trench filling. (2) The cost of the MDU flowable fill product must be lower than the current $35-$45/cubic yard price if it is to become a common construction material. Formulations using MDU ash and lower-cost sand alternatives offer that opportunity. An estimated market of 10,000 cubic yards of MDU flowable fill products could be realized if prices could be made competitive. (3) The geotechnical properties of the MDU ash-based flowable

  6. RECONSTRUCTION OF AR DEPTH PROFILES FROM PIXE MEASUREMENTS

    NARCIS (Netherlands)

    OSIPOWICZ, T; LIEW, SC; LOH, KK; ORLIC, [No Value; TANG, SM; WEBER, T

    1994-01-01

    We report on the application of an iterative maximum likelihood algorithm [1] to the reconstruction of depth profiles from PIXE measurements. PIXE spectra of 450 and 800 keV Ar implanted Al samples were taken at 1.5 and 1.3 MeV He+ energy and at angles ranging from 18 to 83-degrees. The measured Ar

  7. Experimental introduction of excess Ar40 into a granitic melt

    Science.gov (United States)

    Fyfe, W.S.; Lanphere, M.A.; Dalrymple, G.B.

    1969-01-01

    Samples of a Precambrian granite were melted in sealed capsules to produce a radiogenic Ar40 atmosphere over the melt. The amount of Ar40 incorporated in the quenched charge was then determined. Under these experimental conditions the amount of argon dissolved in the quenched melt was appreciable and could be an important source of error in potassiumargon dating. ?? 1969 Springer-Verlag.

  8. In Vitro Activity of AR-709 against Streptococcus pneumoniae▿

    OpenAIRE

    Jansen, W.T.M.; Verel, A.; Verhoef, J.; Milatovic, D.

    2008-01-01

    We investigated the in vitro activity of AR-709, a novel diaminopyrimidine antibiotic currently in development for treatment of community-acquired upper and lower respiratory tract infections, against 151 Streptococcus pneumoniae strains from various European countries. AR-709 showed excellent activity against both drug-susceptible and multidrug-resistant pneumococci.

  9. Aspects of What Makes or Breaks a Museum AR Experience

    DEFF Research Database (Denmark)

    Madsen, Claus B.; Madsen, Jacob Boesen; Morrison, Ann

    2012-01-01

    The paper critically evaluates central aspects of an iPad AR application developed for a museum context. The application is designed for children aged 8 to 12 and mixes AR and mini-game elements to convey dramatized historical events. The game has been deployed for roughly 3 months and the findin...

  10. Geographic Trough Filling for Internet Datacenters

    CERN Document Server

    Xu, Dan

    2011-01-01

    To reduce datacenter energy consumption and cost, current practice has considered demand-proportional resource provisioning schemes, where servers are turned on/off according to the load of requests. Most existing work considers instantaneous (Internet) requests only, which are explicitly or implicitly assumed to be delay-sensitive. On the other hand, in datacenters, there exist a vast amount of delay-tolerant jobs, such as background/maintainance jobs. In this paper, we explicitly differentiate delay-sensitive jobs and delay tolerant jobs. We focus on the problem of using delay-tolerant jobs to fill the extra capacity of datacenters, referred to as trough/valley filling. Giving a higher priority to delay-sensitive jobs, our schemes complement to most existing demand-proportional resource provisioning schemes. Our goal is to design intelligent trough filling mechanisms that are energy efficient and also achieve good delay performance. Specifically, we propose two joint dynamic speed scaling and traffic shifti...

  11. Non-Linear MDT Drift Gases like Ar/CO2

    CERN Document Server

    Aleksa, Martin

    1998-01-01

    Detailed measurements and simulations have been performed, investigating the properties of Ar/CO2 mixtures as a MDT drift gas. This note presents these measurements and compares them to other drift gases that have been simulated using GARFIELD, HEED and MAGBOLTZ.This note also describes systematic errors to be considered in the operation of precision drift chambers using such gases. In particular we analyze effects of background rate variations, gas-density changes, variations of the gas composition, autocalibration, magnetic field differences and non-concentricity of the wire. Their impact on the reconstructed muon momentum resolution was simulated with DICE/ATRECON.The different properties of linear and non-linear drift gases and their relative advantages and disadvantages are discussed in detail.

  12. Ar-40/Ar-39 age constraints for the Jaramillo Normal Subchron and the Matuyama-Brunhes geomagnetic boundary

    Science.gov (United States)

    Izett, Glen A.; Obradovich, John D.

    1994-02-01

    Our mid-Pleistocene Ar-40/Ar-39 age recalibration of the geomagnetic polarity timescale is nearly in accord with the oxygen isotope, climate record calibration of the astronomical timescale proposed by Johnson (1982) and Shackleton et al. (1990). Ar-40/Ar-39 ages of a normally magnetized rhyolite dome in the Valles caldera, northern Mexico, yielded a weighted-mean age of 1.004 +/- 0.019 Ma. A K-Ar age of 0.909 +/- 0.019 Ma for this rock by Doell and Dalrymple (1966) was the linchpin for the recognition and calibration of the Jaramillo Normal Subchron (JNS). Other Ar-40/Ar-39 ages from the Valles caldera and Ar-40/Ar-39 ages of Ivory Coast tektites indicate that the JNS began at about 1.11 Ma and ended before 0.92 Ma, probably near 0.97 Ma. The Matuyama-Brunhes boundary occurred between 0.79 Ma and 0.76 Ma on the basis of Ar-40/Ar-39 sanidine ages from (1) three reversely magnetized rhyolite domes of the Valles caldera (0.793 +/- 0.018 Ma, 0.794 +/- 0.007 Ma, and 0.812 +/- 0.023 Ma) and pumice (0.789 +/- 0.006 Ma) from the reversely magnetized Oldest Toba Tuff of Sumatra and (2) pumice (0.764 +/- 0.005 Ma and 0.757 +/- 0.009 Ma) from the lower and upper units of the normally magnetized Bishop Tuff. The age of the boundary may be close to 0.77 Ma as deduced from rates of sedimentation in ancient Lake Bonneville, Utah.

  13. Touch interface for markless AR based on Kinect

    Science.gov (United States)

    Hsieh, Ching-Tang; Kuo, Tai-Ku; Wang, Hui-Chun; Wu, Yeh-Kuang; Chang, Liung-Chun

    2014-01-01

    We develop an augmented reality (AR) environment with hidden-marker via touch interface using Kinect device, and then also set up a touch painting game with the AR environment. This environment is similar to that of the touch screen interface which allows user to paint picture on a tabletop with his fingers, and it is designed with depth image information from Kinect device setting up above a tabletop. We incorporate support vector machine (SVM) to classify painted pictures which correspond to the inner data and call out its AR into the tabletop in color images information from Kinect device. Because users can utilize this similar touch interface to control AR, we achieve a marker-less AR and interactive environment.

  14. Investigation of Hardened Filling Grout Samples

    DEFF Research Database (Denmark)

    Sørensen, Eigil V.

     Suzlon Wind Energy A/S requested on August 28, 2007 an investigation of 2 samples of a hardened filling grout to be carried out, comprising drilling and strength determination of 4 test cylinders, and description of the surface characteristics of the samples....... Suzlon Wind Energy A/S requested on August 28, 2007 an investigation of 2 samples of a hardened filling grout to be carried out, comprising drilling and strength determination of 4 test cylinders, and description of the surface characteristics of the samples....

  15. Alkaline earth filled nickel skutterudite antimonide thermoelectrics

    Science.gov (United States)

    Singh, David Joseph

    2013-07-16

    A thermoelectric material including a body centered cubic filled skutterudite having the formula A.sub.xFe.sub.yNi.sub.zSb.sub.12, where A is an alkaline earth element, x is no more than approximately 1.0, and the sum of y and z is approximately equal to 4.0. The alkaline earth element includes guest atoms selected from the group consisting of Be, Mb, Ca, Sr, Ba, Ra and combinations thereof. The filled skutterudite is shown to have properties suitable for a wide variety of thermoelectric applications.

  16. Experimental study on capillary filling in nanochannels

    Science.gov (United States)

    Yang, Min; Cao, Bing-Yang; Wang, Wei; Yun, He-Ming; Chen, Bao-Ming

    2016-10-01

    We investigated the capillary filling kinetics of deionized water in nanochannels with heights of 50-120 nm. The measured position of the moving meniscus was proportional to the square root of time, as predicted by the LW equation. However, the extracted slopes were significantly smaller than the predictions based on the bulk properties. This unusual behavior was found to be mainly caused by the electro-viscous effect and dynamic contact angle, which was significantly larger than the static angle. In addition, when the filling distance reached about 600 μm, bubbles tended to be formed, leading to the main meniscus was almost immobile.

  17. Creep of granulated loose-fill insulation

    DEFF Research Database (Denmark)

    Rasmussen, Torben Valdbjørn

    This report presents a proposal for a standardised method for creep tests and the necessary theoretical framework that can be used to describe creep of a granulated loose-fill material. Furthermore results from a round robin test are shown. The round robin test was carried out in collaboration...... with SP-Building Physics in Sweden and VTT Building Technology in Finland. For the round robin test a cellulosic fibre insulation material was used. The proposed standardised method for creep tests and theories are limited to cases when the granulated loose-fill material is exposed to a constant...

  18. 30 CFR 816.72 - Disposal of excess spoil: Valley fills/head-of-hollow fills.

    Science.gov (United States)

    2010-07-01

    ..., 6-hour precipitation event. (b) Rock-core chimney drains. A rock-core chimney drain may be used in a... as the fill is not located in an area containing intermittent or perennial streams. A rock-core... upstream drainage is diverted around the fill. The alternative rock-core chimney drain system shall...

  19. AR Sco: A White Dwarf Synchronar

    CERN Document Server

    Katz, J I

    2016-01-01

    The emission of the white dwarf-M dwarf binary AR Sco is driven by the rapid synchronization of its white dwarf, rather than by accretion. This requires a comparatively large magnetic field $\\sim 100$ gauss at the M dwarf and $\\sim 10^8$ gauss on the white dwarf, larger than the fields of most intermediate polars but within the range of fields of known magnetic white dwarfs. The spindown power is dissipated in the atmosphere of the M dwarf by magnetic reconnection, accelerating particles that produce the observed synchrotron radiation. The displacement of the optical maximum from conjunction may be explained either by dissipation in a bow wave as the white dwarf's magnetic field sweeps past the M dwarf or by a misaligned white dwarf's rotation axis and oblique magnetic moment. In the latter case the rotation axis precesses with a period of decades, predicting a drift in the orbital phase of maximum. Binaries whose emission is powered by synchronization may be termed synchronars, in analogy to magnetars.

  20. Search for massive neutrinos in the recoil spectrum of 37Cl following electron capture decay of 37Ar

    International Nuclear Information System (INIS)

    We are developing an experiment to measure the spectrum of recoil velocities of 37CI ions following the electron capture (EC) decay of 37Ar. One of the initial aims of this experiment is to search for massive neutrinos (mv ∼ 200-250 keV) which might be emitted in the decay, with a mixing probability of 37Ar source was produced via the 36Ar(n,γ) reaction at the BNL reactor. The gas was bled into an ultra high vacuum system at MSU and 1-2 monolayers were adsorbed on a Au-coated Si(111) surface cooled to 20 K. The Auger electrons associated with the EC decay of 37Ar were detected in a Channeltron detector. The recoiling 37Cl ions were detected in a microchannel-plate detector. We are currently preparing a fresh 37Ar sample, and plan to measure the time-of-flight spectrum of the recoils by detecting them in delayed coincidence with the Auger electrons