WorldWideScience

Sample records for ar em tomografia

  1. Linfangiectasia renal: achado incidental em tomografia computadorizada multicorte e revisão da literatura

    Directory of Open Access Journals (Sweden)

    Rodrigo Abdalla de Vasconcelos

    2012-06-01

    Full Text Available Linfangiectasia renal é uma condição rara, caracterizada por coleções parapiélicas e perirrenais, que pode progredir de assintomática para insuficiência renal crônica. É apresentado um caso de achado incidental em tomografia computadorizada de linfangiectasia renal bilateral em paciente assintomático, com descrição dos principais achados à luz dos métodos de imagem e ampla revisão da literatura.

  2. Tomografia computadorizada na agenesia do corpo caloso: achados em 27 casos

    Directory of Open Access Journals (Sweden)

    MINGUETTI GUILBERTO

    1998-01-01

    Full Text Available Foi realizado estudo retrospectivo de tomografia computadorizada em 27 pacientes com anormalidades anatômicas definidas como agenesia total do corpo caloso, afastando-se os casos de agenesia parcial. Cada caso foi avaliado buscando-se as características tomográficas, incidência por sexo, idade, associação com a clínica e com outras malformações congênitas encefálicas. Nesta casuística, contudo, foram eliminados os casos de agenesia do corpo caloso associados a esquizencefalias, holoprosencefalias e malformações do complexo de Dandy-Walker.

  3. Estudo da dose nos exames de tomografia computadorizada abdominal em um equipamento de 6 cortes

    Directory of Open Access Journals (Sweden)

    Sónia Isabel Rodrigues

    2012-12-01

    Full Text Available OBJETIVO: Determinar a dose efetiva recebida nos exames de tomografia computadorizada abdominal e estudar a influência das características dos pacientes na dose recebida. MATERIAIS E MÉTODOS: Foram realizadas medições dos valores de dose com uma câmara de ionização em objetos simuladores, de forma a verificar se os valores obtidos estavam de acordo com os valores apresentados pelo equipamento de tomografia computadorizada e se estes não ultrapassavam os níveis de referência de dose recomendados. Posteriormente, foram medidos os valores de dose recebida pelos pacientes, com autonomia física, nos exames de tomografia computadorizada abdominal (n = 100 e a relação existente com as suas características antropométricas. Por último, foi simulada a dose nos órgãos por meio do método de Monte Carlo utilizando o software de simulação CT-Expo V 1.5, e estudado o efeito do controle automático de exposição nestes exames. RESULTADOS: As principiais características com influência direta na dose são a massa corporal, o perímetro abdominal e o índice de massa corporal do paciente, cuja relação é linear e positiva. CONCLUSÃO: A dose de radiação recebida nos exames abdominais depende de algumas características dos pacientes, sendo importante ajustar os parâmetros de aquisição às suas dimensões.

  4. Segmentação pulmonar em estudos de tomografia axial computorizada

    OpenAIRE

    Silva, José Silvestre Serra da

    2005-01-01

    A Tomografia Axial Computorizada (TAC) é um dos meios complementares de diagnóstico médico mais eficiente no estudo das regiões pulmonares. Os métodos de segmentação pulmonar em imagens produzidas por esta modalidade são necessários sempre que se pretenda determinar áreas ou volumes, ou obter informação densitómetria; podem ainda ser integrados no pré-processamento de uma aplicação que envolva a visualização dos pulmões. No âmbito deste trabalho foram desenvolvidos três méto...

  5. Estimativa dos valores de MSAD em procedimentos de tomografia computadorizada utilizando filmes radiocrômicos

    Directory of Open Access Journals (Sweden)

    Bruno Beraldo Oliveira

    2013-04-01

    Full Text Available OBJETIVO: Verificar a viabilidade de filmes radiocrômicos como um dosímetro alternativo para estimativa da dose média em cortes múltiplos a partir dos perfis de kerma. MATERIAIS E MÉTODOS: Os filmes foram distribuídos em cilindros posicionados no centro e nas regiões periféricas de um objeto simulador padrão de abdome utilizado para dosimetria em tomografia computadorizada. RESULTADOS: Os valores de dose média em cortes múltiplos calculados foram 13,6 ± 0,7, 13,5 ± 0,7 e 18,7 ± 1,0 mGy para os valores de passo (pitch de 0,75, 1,00 e 1,50, respectivamente. CONCLUSÃO: Apesar de os resultados mostrarem valores menores que o nível de referência de radiodiagnóstico de 25 mGy estabelecido pela legislação brasileira para exames de abdome, eles sugerem que há espaço para otimização dos procedimentos e uma revisão do valor para o nível de referência de radiodiagnóstico brasileiro.

  6. Simulação e reconstrução em tomografia cardio-torácica

    OpenAIRE

    Francesco, Sílvia de

    2009-01-01

    Esta dissertação aborda o tema da Tomografia Axial Computorizada com especial enfoque na reconstrução da imagem, ou seja, nos métodos matemáticos que, dado um conjunto de amostras da intensidade de radiação X transmitida, recolhidas segundo uma geometria de irradiação específica, permitem obter o mapa da distribuição tri-dimensional (3D) do coeficiente de atenuação linear no interior do objecto. Em termos mais formais, dado que, do ponto de vista matemático, o processo de aq...

  7. Otimização da imagem em tomografia computorizada no exame de tórax

    OpenAIRE

    Santos, Maria dos Anjos Pombo Batista dos

    2012-01-01

    A tomografia computorizada (TC) é um método de obtenção de diagnóstico por imagem mais utilizado em todo o mundo e em constante crescimento. A TC desempenha um papel relevante na avaliação morfológica e funcional das patologias torácicas. Em consonância, o crescente aumento da realização dos referidos exames conflui com a necessidade de otimização de protocolos de realização, no que refere à dose de exposição à radiação ionizante, sem perda significativa da qualidade da imagem. O objetivo des...

  8. Controle de qualidade e dosimetria em equipamentos de tomografia computadorizada Quality control and dosimetry in computed tomography units

    Directory of Open Access Journals (Sweden)

    Diana Rodrigues de Pina

    2009-06-01

    Full Text Available OBJETIVO: Avaliação de condições dos equipamentos e dosimetria em setores de tomografia computadorizada utilizando protocolos de cabeça, abdome e coluna lombar em pacientes adultos (em três equipamentos distintos e pediátricos com até um ano e meio de vida (em um dos equipamentos avaliados. MATERIAIS E MÉTODOS: Foram estimados o índice de dose em tomografia computadorizada e a dose média em cortes múltiplos, em exames com pacientes adultos, em três distintos equipamentos. Ainda foram estimadas as doses na superfície de entrada e as doses absorvidas em exame de cabeça para pacientes adultos e pediátricos em um dos equipamentos avaliados. RESULTADOS: Foram realizados testes de controle de qualidade, mecânicos, demonstrando que os equipamentos satisfazem as especificações de uso estabelecidas pelas normas vigentes. Os resultados da dosimetria mostraram que valores de dose média em cortes múltiplos excederam em até 109,0% os valores de níveis de referência, apresentando consideráveis variações entre os equipamentos avaliados neste estudo. As doses absorvidas obtidas com protocolos pediátricos são inferiores aos de pacientes adultos, apresentando redução de até 51,0% na tireoide. CONCLUSÃO: Neste estudo foram avaliadas as condições de operação de três equipamentos tomográficos, estabelecendo quais parâmetros devem ser trabalhados para a implantação de um programa de controle de qualidade nas instituições onde esta pesquisa foi desenvolvida.OBJECTIVE: Evaluation of equipment conditions and dosimetry in computed tomography services utilizing protocols for head, abdomen, and lumbar spine in adult patients (in three different units and pediatric patients up to 18 months of age (in one of the units evaluated. MATERIALS AND METHODS: Computed tomography dose index and multiple-scan average dose were estimated in studies of adult patients with three different units. Additionally, entrance surface doses as well as

  9. Stratus optical coherence tomography findings in patients with retinopathy of prematurity Tomografia de coerência óptica em pacientes com retinopatia da prematuridade

    Directory of Open Access Journals (Sweden)

    Aline do Lago

    2007-02-01

    Full Text Available PURPOSE: To describe morphological features of the macula in patients with retinopathy of prematurity. METHODS: Twelve premature babies with retinopathy of prematurity grades I, II and III underwent dilated fundus examination and optical coherence tomography evaluation. RESULTS: In all thirteen eyes of the twelve premature patients optical coherence tomography revealed a condensed retinal pigmented epithelial layer in the macular-foveal area shown by increased reflectivity. In these eyes the retinal layers were not well differentiated. Foveal depression was clearly evident in 23%. CONCLUSIONS: In premature patients with retinopathy of prematurity, optical coherence tomography revealed poorly differentiated layers in the macular region with increased reflectivity in retinal pigmented epithelial-choriocapillaris zone.OBJETIVO: Descrever os aspectos morfológicos da mácula em pacientes com retinopatia da prematuridade (ROP. MÉTODOS: Doze pacientes com retinopatia da prematuridade graus I, II and III foram submetidos a mapeamento de retina e avaliação por tomografia de coerência óptica. RESULTADOS: Em todos os treze olhos de 12 pacientes a tomografia de coerência óptica mostrou a camada do epitélio pigmentar hiperrefletiva, sendo a área macular com maior intensidade. Nesses olhos as camadas da retina não estavam totalmente diferenciadas. A depressão foveal ficou claramente evidente pela tomografia de coerência óptica em 23%. CONCLUSÃO: Nos pacientes prematuros com retinopatia da prematuridade, a tomografia de coerência óptica mostrou as camadas da retina pouco diferenciadas com aumento da refletividade na área macular do complexo epitélio retiniano pigmentar-coriocapilar.

  10. Papilomatose laringotraqueobrônquica: aspectos em tomografia computadorizada de tórax Laryngotracheobronchial papillomatosis: findings on computed tomography scans of the chest

    OpenAIRE

    Edson Marchiori; Cesar de Araujo Neto; Gustavo de Souza Portes Meirelles; Klaus Loureiro Irion; Gláucia Zanetti; Israel Missrie; Juliana Sato

    2008-01-01

    OBJETIVO: Apresentar os achados em tomografia computadorizada (TC) de tórax em pacientes com papilomatose laringotraqueobrônquica. MÉTODOS: Foram estudadas, retrospectivamente, as TCs de oito pacientes, cinco masculinos e três femininos, com idades variando de 5 a 18 anos, com média de 10,5 anos. Os exames foram analisados por dois radiologistas, de forma independente, e as decisões finais foram obtidas por consenso. RESULTADOS: Os achados mais comuns nas TCs foram as lesões nodulares da traq...

  11. Qualidade do ar interior em instalações desportivas

    OpenAIRE

    Marques, Liliana Rute Dias

    2013-01-01

    A Qualidade do Ar Interior (QAI) tem vindo a despertar cada vez mais o interesse da comunidade científica, pelo facto das sociedades modernas passarem a grande maioria do seu dia em ambientes interiores, sendo o ar que respiramos um fator determinante na saúde e bem-estar do ser humano. Os indivíduos que praticam desporto estão em particular risco de inalar poluentes, não só porque durante a atividade desportiva estão sujeitos a maiores taxas de consumo de ar mas também ao f...

  12. Medidas da umidade relativa do ar em um ambiente fechado

    OpenAIRE

    Costa Eden V.

    2003-01-01

    Umidade do ar e o vapor d'água presente na atmosfera. Neste trabalho medimos a umidade relativa do ar em um ambiente fechado onde a temperatura foi mantida constante. Nestas condições, a umidade cresce até o vapor d'água tornar-se saturado. Neste instante, a umidade é máxima. O aparato experimental utilizado consiste de recipiente fechado de vidro, higrômetro, termômetro e relógio. Trata-se, portanto, de um experimento simples, possível de ser realizado em um laboratório didático e capaz de p...

  13. Tomografia computadorizada em pacientes portadores de neurocisticercose com hipertensão intracraniana por hidrocefalia obstrutiva: comparação com ventriculografia com Dimer-X

    Directory of Open Access Journals (Sweden)

    Benedicto Oscar Colli

    1984-06-01

    Full Text Available Estudo das alterações observadas nas tomografias computadorizadas (TCs de 16 casos de neurocisticercose, com hipertensão intracraniana por hidrocefalia. Todos os casos foram submetidos a radiografias simples do crânio e 12, à ventriculografia com Dimer-X. Nas radiografias simples foram observados sinais de hipertensão intracraniana em 7, calcificações em um, e d foram normais. A TC mostrou parênquima cerebral normal em 9 casos e nos 7 restantes áreas hipodensas arredondadas de tamanho variado, com ou sem retenção de contraste na periferia, e/ou calcificações esparsas no parenquima. Hidrocefalia foi a única alteração observada no sistema ventricular nos casos em que o exame foi realizado previamente à derivação do LCR. As ventriculografias foram analisadas em trabalho anterior e permitiram localizar e determinar as características da obstrução e a presença de massas ocupando espaço dentro dos ventrículos. A comparação das ventriculografias e TCs realizadas na mesma época evidenciou que a primeira fornece melhores informações sobre o sistema ventricular mas, por outro lado, a tomografia fornece informações adicionais sobre o parênquima cerebral. A TC e a ventriculografia são exames que se completam na avaliação e no diagnóstico destes pacientes.

  14. Medidas da umidade relativa do ar em um ambiente fechado

    Directory of Open Access Journals (Sweden)

    Costa Eden V.

    2003-01-01

    Full Text Available Umidade do ar e o vapor d'água presente na atmosfera. Neste trabalho medimos a umidade relativa do ar em um ambiente fechado onde a temperatura foi mantida constante. Nestas condições, a umidade cresce até o vapor d'água tornar-se saturado. Neste instante, a umidade é máxima. O aparato experimental utilizado consiste de recipiente fechado de vidro, higrômetro, termômetro e relógio. Trata-se, portanto, de um experimento simples, possível de ser realizado em um laboratório didático e capaz de preencher a lacuna dos livros de texto de física, que, em geral, negligenciam este tópico.

  15. Microbiologia do ar : monitorização do ar em ambiente hospitalar

    OpenAIRE

    Santos, Ana Carina Marques dos

    2008-01-01

    O complexo ambiente hospitalar requer atenção especial, para assegurar uma saudável qualidade do ar interior, protegendo assim os profissionais de saúde e utentes de infecções nosocomiais e de doenças ocupacionais. Embora seja amplamente reconhecido que a contaminação de um bloco operatório seja a principal responsável pela complicação de uma cirurgia, em Portugal, estudos sobre microbiologia do ar a nível hospitalar são escassos. O objectivo deste estudo é investigar a vari...

  16. Relatório de estágio - Tomografia computorizada em Neurorradiologia traumática: Aspetos técnicos

    OpenAIRE

    Mata, Anicolette

    2015-01-01

    O presente relatório apresenta uma descrição e análise reflexiva das atividades desenvolvidas ao longo do estágio, que se realizou na Área de Diagnóstico por Imagem (ADPI) do Centro Hospitalar Lisboa Central - Pólo do Hospital de S. José (HSJ), num equipamento de Tomografia Computorizada (TC) de 16 cortes. O estágio foi especialmente dirigido para a Área de Neurorradiologia traumática. O relatório encontra-se dividido em quatro capítulos: (i) capítulo I - fundamentação teórica e persp...

  17. Análise das variações morfológicas da ATM em pacientes com artrite reumatóide através de tomografia computadorizada = Analysis of the morphologyc variations in the TMJ the patients with rheumatoid arthritis through the computer tomography

    Directory of Open Access Journals (Sweden)

    Vasconcelos, Belmiro Cavalcanti do Egito

    2005-01-01

    Full Text Available Realizou-se um estudo qualitativo e quantitativo enfocando as alterações morfométricas da articulação temporomandibular (ATM, em pacientes com o diagnóstico de artrite reumatóide (AR por meio de tomografia computadorizada. Foram analisados 6 casos onde são descritas as alterações estruturais dos componentes ósseos de 12 ATMs. Os resultados indicaram que todas as ATMs apresentaram alterações, sendo as alterações mais freqüentes a esclerose óssea subcondral, seguida do aplainamento da eminência articular. Todos os pacientes apresentaram distúrbio de mobilidade

  18. Propedêutica radiológica do impacto femoroacetabular em tempos de tomografia computadorizada e ressonância magnética: o que o radiologista precisa saber

    Directory of Open Access Journals (Sweden)

    Rafael Borges Nunes

    2011-08-01

    Full Text Available Após breve descrição dos tipos de impacto femoroacetabular, este trabalho demonstra o protocolo de radiologia convencional, tomografia computadorizada e ressonância magnética para os casos de impacto, desenvolvido nos últimos oito anos em parceria com serviços de referência em ortopedia. Demonstra-se a propedêutica radiológica básica de cada método, revisando os aspectos mais relevantes na avaliação do quadril.

  19. Aspectos da tomografia computadorizada no linfoma em pacientes abaixo de 20 anos de idade Computed tomography findings in patients less than 20 years old with lymphoma

    Directory of Open Access Journals (Sweden)

    Adriana Moreira Viana Borba

    2007-04-01

    Full Text Available OBJETIVO: Descrever os achados gerais do linfoma em pacientes abaixo de 20 anos de idade e por subtipo histológico. MATERIAIS E MÉTODOS: Estudo retrospectivo do arquivo digital de tomografia computadorizada do Centro de Controle do Câncer do Hospital Universitário Pedro Ernesto da Universidade do Estado do Rio de Janeiro, no período de março de 2003 a julho de 2005. Dos 22 casos - 16 do sexo masculino e 6 do sexo feminino, com média de idade de 11,5 anos -, 12 eram do subtipo Hodgkin e 10 eram não-Hodgkin. RESULTADOS: Dos achados gerais, verificamos as linfonodomegalias mediastinais como o mais freqüente (59%, com predomínio no grupo Hodgkin (75%, seguido por hepatoesplenomegalia (50% e linfonodomegalias cervicais e retroperitoneais (27,3%. No subtipo Hodgkin houve predomínio do acometimento linfonodal, em sucessivas cadeias, seguido pela hepatoesplenomegalia (50%. Verificamos um caso de massa tonsilar unilateral, opacidade pulmonar em "vidro-fosco" e nódulos renais. No subtipo não-Hodgkin houve predomínio extranodal caracterizado por hepatoesplenomegalia (50%, espessamento de alça intestinal (40%, derrame pleural (30%, nódulo pulmonar (20%, ascite (10%, derrame pericárdico (10% e lesões ósseas mistas (10%. CONCLUSÃO: A tomografia computadorizada é de grande valia no diagnóstico, estadiamento e seguimento do linfoma, com achados de alerta como massa linfonodal, notadamente mediastinal, hepatoesplenomegalia, massa unilateral na tonsila e espessamento parietal de alça intestinal.OBJECTIVE: To describe the general findings of lymphoma and their histological patterns in patients less than 20 years old. MATERIALS AND METHODS: Twenty-two cases (16 male and 6 female, mean age 11.5 years from the digital archive of computed tomography at the Cancer Control Center of "Hospital Universitário Pedro Ernesto - Universidade do Estado do Rio de Janeiro", Rio de Janeiro, RJ, Brazil, were retrospectively analyzed in the period between

  20. Pneumonia lipoídica em adultos: aspectos na tomografia computadorizada de alta resolução Lipoid pneumonia in adults: findings on high-resolution computed tomography

    OpenAIRE

    Edson Marchiori; Gláucia Zanetti; Dante L. Escuissato; Arthur Soares Souza Jr.; César de Araújo Neto; Luiz Felipe Nobre; Klaus L. Irion; Rosana Rodrigues; Alexandre Dias Mançano; Domenico Capone; Suzane Mansur Fialho; Carolina Althoff Souza

    2007-01-01

    OBJETIVO: Apresentar os aspectos na tomografia computadorizada de alta resolução do tórax da pneumonia lipoídica exógena por aspiração de óleo mineral, em pacientes adultos MATERIAIS E MÉTODOS: Foram estudados oito pacientes adultos - quatro mulheres e quatro homens - com média de idade de 69,4 anos, todos usuários de óleo mineral para tratamento de constipação intestinal. Os exames foram avaliados por dois radiologistas, de forma independente RESULTADOS: Os achados tomográficos mais comuns f...

  1. Prognóstico visual de 'crosslinking' para ceratocone com base em tomografia de córnea pré-operatória

    Directory of Open Access Journals (Sweden)

    Lopes Bernardo

    2014-08-01

    Full Text Available Objetivo: Verificar índices tomográficos do pré-operatório de pacientes com ceratocone submetidos à crosslinking corneano (CXL como fatores preditivos para a melhora na acuidade visual corrigidas (AVc após um ano. Métodos: Estudo retrospectivo que incluiu 63 olhos de 53 pacientes com ceratocone progressivo submetidos à CXL segundo o protocolo de Dresden: deseptelização corneana, riboflavina 0,1% por 30 minutos e luz ultra-violeta A (UVA a uma irradiância de 3mW/cm2 por 30 minutos. Foram avaliados exames de tomografia corneana com sistema de Scheimpflug rotacional (Pentacam, Oculus antes do CXL e a acuidade visual corrigida antes e após a cirurgia. A análise estatística foi feita com o teste de Kolmorov-Smirnov, teste t de student e curvas de característica operador-receptor (ROC. Resultados: Houve diferença estatisticamente significante (p<0,05 entre os pacientes que obtiveram melhora de AVc em um ano e os que não experimentaram melhora na AVc nesse período nos índices tomográficos pré-operatórios relacionados com espessura e volume corneano. Entre os pacientes que obtiveram melhora na AVc todos possuíam volume corneano em 6,0mm maior que 14,55mm3 e 97,2% deles possuíam volume corneano em 6,5mm maior que 17,76mm3. Assim como, 94,29% desses pacientes apresentavam paquimetria média em 4,0mm maior que 487 μm e 82,86% paquimetria no ponto mais fino maior de 421 μm. Conclusão: Pacientes com ceratocone menos avançado (volume e espessura da córnea maiores no período pré-operatório obtiveram mais chances de ter melhora da AVc um ano após CXL. Estudos prospectivos envolvendo outras variáveis relacionadas com a aberrometria total e o estudo biomecânico da córnea são relevantes para se aumentar a capacidade prognóstica do resultado após CXL.

  2. Estimativa dos valores de MSAD em procedimentos de tomografia computadorizada utilizando filmes radiocrômicos Estimation of MSAD values in computed tomography scans using radiochromic films

    Directory of Open Access Journals (Sweden)

    Bruno Beraldo Oliveira

    2013-04-01

    Full Text Available OBJETIVO: Verificar a viabilidade de filmes radiocrômicos como um dosímetro alternativo para estimativa da dose média em cortes múltiplos a partir dos perfis de kerma. MATERIAIS E MÉTODOS: Os filmes foram distribuídos em cilindros posicionados no centro e nas regiões periféricas de um objeto simulador padrão de abdome utilizado para dosimetria em tomografia computadorizada. RESULTADOS: Os valores de dose média em cortes múltiplos calculados foram 13,6 ± 0,7, 13,5 ± 0,7 e 18,7 ± 1,0 mGy para os valores de passo (pitch de 0,75, 1,00 e 1,50, respectivamente. CONCLUSÃO: Apesar de os resultados mostrarem valores menores que o nível de referência de radiodiagnóstico de 25 mGy estabelecido pela legislação brasileira para exames de abdome, eles sugerem que há espaço para otimização dos procedimentos e uma revisão do valor para o nível de referência de radiodiagnóstico brasileiro.OBJECTIVE: To evaluate the feasibility of using radiochromic films as an alternative dosimeter to estimate the multiple scan average dose on the basis on kerma profiles. MATERIALS AND METHODS: The radiochromic films were distributed in cylinders positioned in the center and in four peripheral bores of a standard abdominal phantom utilized for computed tomography dosimetry. RESULTS: Values for multiple scan average dose values corresponded to 13.6 ± 0.7, 13.5 ± 0.7 and 18.7 ± 1.0 mGy for pitch of 0.75, 1.00 and 1.50, respectively. CONCLUSION: In spite of results showing lower values than the reference level for radiodiagnosis (25 mGy established by the Brazilian regulations for abdominal studies, it is suggested that there is room to optimize procedures and review the reference level for radiodiagnosis in Brazil.

  3. Tomografia computadorizada na avaliação da aspergilose pulmonar angioinvasiva em pacientes com leucemia aguda Computed tomography in the assessment of angioinvasive pulmonary aspergillosis in patients with acute leukemia

    Directory of Open Access Journals (Sweden)

    Renata Carneiro Leão

    2006-10-01

    Full Text Available OBJETIVO: O objetivo deste trabalho foi avaliar os principais achados na tomografia computadorizada de pacientes portadores de leucemia aguda complicada com aspergilose pulmonar angioinvasiva. MATERIAIS E MÉTODOS: Foram estudadas, retrospectivamente, as tomografias computadorizadas de 19 pacientes, avaliando-se a presença de consolidações, nódulos e massas, com ou sem sinal do halo, escavação e sinal do crescente aéreo. RESULTADOS: Áreas de consolidação foram o achado mais comum, ocorrendo em 12 dos 19 casos. A maioria delas apresentou o sinal do halo, enquanto escavação foi encontrada em 5 dos 12 casos com consolidações, sendo um deles com sinal do crescente aéreo. Nódulos e massas ocorreram em, respectivamente, seis e quatro casos, a maioria com sinal do halo. Escavação foi encontrada em apenas um caso de massa. Outros achados observados foram pavimentação em mosaico (dois casos, áreas de vidro fosco esparsas (três casos e envolvimento pleural (sete casos, sob a forma de derrame ou espessamento. CONCLUSÃO: Áreas de consolidação, massas ou nódulo, mesmo solitário, com sinal do halo, quando vistos na tomografia computadorizada em um contexto clínico apropriado, são altamente sugestivos de aspergilose angioinvasiva.OBJECTIVE: The aim of this study was to evaluate the main findings of computed tomography in patients presenting acute leukemia complicated by angioinvasive aspergillosis. MATERIALS AND METHODS: Computed tomography images of 19 patients were retrospectively studied for the presence of consolidations, nodules and masses, with or without presentation of halo sign, cavitation and air crescent sign. RESULTS: Consolidation was the most frequent finding, occurring in 12 of the 19 cases, most of them presenting the halo sign; cavitation was found in 5 of 12 cases, one of them with air crescent sign. Nodules and masses occurred respectively in six and four cases, most of them with halo sign. Cavitation was found

  4. Avaliação da concordância interobservador na análise da tomografia computadorizada sem contraste no diagnóstico da urolitíase em pacientes com cólica renal aguda Interobserver agreement on non-contrast computed tomography interpretation for diagnosis of urolithiasis in patients with acute flank pain

    OpenAIRE

    Luís Ronan Marquez Ferreira de Souza; Salomão Faintuch; Daniel Bekhor; Dario Ariel Tiferes; Suzan Menasce Goldman; Jacob Szejnfeld

    2006-01-01

    OBJETIVO: Avaliar a reprodutibilidade da tomografia computadorizada sem contraste na avaliação da litíase ureteral e os sinais secundários de obstrução do sistema coletor em pacientes com cólica renal aguda. MATERIAIS E MÉTODOS: Estudo prospectivo de 52 pacientes com diagnóstico clínico de cólica renal aguda submetidos a exame de tomografia computadorizada de abdome sem contraste. Os exames foram realizados com técnica helicoidal e posteriormente analisados por três observadores independentes...

  5. O efeito da "sedação multifásica" no exame de tomografia computadorizada e ressonância magnética em crianças, pais e anestesiologistas

    Directory of Open Access Journals (Sweden)

    Guray Demir

    2012-08-01

    Full Text Available JUSTIFICATIVA E OBJETIVOS: O nosso objetivo foi investigar o efeito da "sedação multifásica" em crianças submetidas à Tomografia Computadorizada (TC ou Ressonância Magnética (RM, em seus pais e nos anestesiologistas responsáveis. "Sedação multifásica" foi definida como "o nível de sedação pretendido obtido com um ou mais agentes através da mesma via ou vias diferentes com mais de uma administração". MATERIAL E MÉTODOS: Cem crianças e seus respectivos pais foram randomicamente designados para um dos dois grupos de estudo. Na fase 1, os pacientes do Grupo I receberam midazolam (0,5 mg.kg-1 em 5 mL de suco de frutas e os pacientes do Grupo II (grupo controle receberam apenas suco de frutas. Na fase 2, após a canulação intravenosa (iv, bolus de propofol foi administrado para alcançar a sedação adequada para realização do exame de imagem. Os escores de ansiedade das crianças e de seus pais foram registrados usando a escala de Oucher e o IDATE, respectivamente, e a satisfação dos pais foi avaliada pela escala analógica visual (EAV. O número de tentativas para canulação iv, tempo de preparação e quantidade de hipnóticos foram registrados. RESULTADOS: O estado de ansiedade das crianças foi semelhante entre os grupos antes da pré-medicação, porém mais tarde esse nível foi menor no Grupo I. Antes do procedimento, o escore dos pais no IDATE foi semelhante, mas depois foi menor no Grupo I. A satisfação dos pais no Grupo I foi maior que no Grupo II. O número de tentativas de canulação iv e a dose necessária de propofol foi menor no Grupo I. CONCLUSÃO: O procedimento de "sedação multifásica" diminui a dor e a ansiedade das crianças e a ansiedade dos pais, aumentando a sua satisfação. Ele fornece uma sedação confortável e segura, pois possui um processo de preparação curto e sem problemas também para o anestesiologista responsável.

  6. New molecular targets for PET and SPECT imaging in neurodegenerative diseases Novos alvos moleculares para tomografia por emissão de pósitrons (PET e tomografia computadorizada por emissão de fóton único (SPECT em doenças neurodegenerativas

    Directory of Open Access Journals (Sweden)

    Marcel Benadiba

    2012-10-01

    Full Text Available The pathophysiology of neurodegenerative diseases (ND such as Alzheimer's disease (AD and Parkinson's disease (PD has not yet been completely elucidated. However, in the past few years, there have been great knowledge advances about intra-and extracellular proteins that may display impaired function or expression in AD, PD and other ND, such as amyloid beta (Aβ, α-synuclein, tau protein and neuroinflammatory markers. Recent developments in the imaging techniques of positron emission tomography (PET and single photon emission computed tomography (SPECT now allow the non-invasive tracking of such molecular targets of known relevance to ND in vivo. This article summarizes recent findings of PET and SPECT studies using these novel methods, and discusses their potential role in the field of drug development for ND as well as future clinical applications in regard to differential diagnosis of ND and monitoring of disease progression.A fisiopatologia das doenças neurodegenerativas (DN, tais como a doença de Alzheimer (DA e a doença de Parkinson (DP, ainda não é completamente compreendida. No entanto, nos últimos anos, houve grandes avanços em termos do conhecimento sobre proteínas intra e extracelulares, tais como beta-amiloide (Aβ, α-sinucleína, proteína tau e marcadores neuroinflamatórios, que podem ter sua função ou expressão prejudicada na DA, DP ou em outras DN. Progressos recentes nas técnicas de tomografia por emissão de pósitrons (PET e tomografia computadorizada por emissão de fóton único (SPECT permitem hoje em dia a identificação não invasiva de tais alvos moleculares in vivo. Este artigo resume descobertas recentes de estudos de PET e SPECT cerebral usando esses alvos moleculares inovadores e discute o papel potencial dessas técnicas no campo do desenvolvimento de novos medicamentos para as DN, bem como futuras aplicações clínicas em relação ao diagnóstico diferencial e monitoramento da progressão dessas

  7. VARIABILIDADE TEMPORAL DA TEMPERATURA DO AR EM JABOTICABAL – SP

    Directory of Open Access Journals (Sweden)

    GARCIA, Anice

    2015-05-01

    Full Text Available The study aimed to obtain a monthly average temperature equation estimated from the analysis of the variability of temperatures (maximum, average and minimum, to Jaboticabal /SP. The analysis of the parameters was made monthly, seasonal, annual and interannual. Data (1971-2013 were collected in a Agrometeorological Station of the Universidade Estadual Paulista (UNESP at Jaboticabal Campus(Lat; 21o14’05”S; Long: 48o17’09”O;. Alt: 616.01m. On the data were applied statistical methods (mean, standard deviation and coefficient of variation. Were also correlated the monthly averages obtained by the standard method (INMET and by the method of extreme temperatures. The results showed that standard deviation of the temperatures had a slow variations with low coefficient of variation. The equations obtained between the mean values of standard INMET and the mean of the extreme, can be used for micro region of Jaboticabal with good accuracy in results. Este estudo teve como objetivo analisar a variabilidade de temperatura e obter uma equação mensal de estimativa de temperatura média do ar a partir da análise das temperaturas (máxima, média e mínima, para Jaboticabal –SP. A análise dos elementos foi feita mensal, sazonal, anual e interanualmente. Os dados, referentes ao período de 1971 a 2013, foram coletados na Estação Agroclimatológica da Universidade Estadual Paulista (UNESP – Campus de Jaboticabal (Lat; 21o14’05”S; Long: 48o17’09”O;. Alt: 616.01m. Sobre os dados foram aplicados métodos estatísticos (média, desvio padrão e coeficiente de variação. Foram, também, correlacionadas as médias mensais obtidas pelo método padrão (INMET e pelo método das temperaturas extremas. Os resultados obtidos mostraram que os desvios das temperaturas (máximas, medias e mínimas tiveram variações discretas com consequentes coeficientes de variação baixos para os elementos estudados. As equações obtidas entre as m

  8. Avaliação microbiológica do ar em ambiente hospitalar

    OpenAIRE

    Silva, Emília Rosa Sousa dos Santos

    2008-01-01

    A contaminação do ar é um dos factores apontados como estando na origem de infecções das suturas operatórias, infecções nosocomiais e de outro tipo de patologias como a asma, as rinites e as alergias. A existência de situações epidemiológicas ocorridas em ambientes hospitalares, torna-se altamente perniciosa, uma vez que pode causar mortalidade ou morbilidade dos pacientes, principalmente em indivíduos imunocomprometidos. O presente trabalho reporta sobre um estudo microbiol...

  9. Detection of beetle damage in forests by X-ray CT image processing Detecção de danos causados por besouro em florestas com processamento de imagens de tomografia computadorizada de raios X

    Directory of Open Access Journals (Sweden)

    Paulo Estevão Cruvinel

    2003-10-01

    Full Text Available Some beetle species can have devastating economic impacts on forest and nursery industries. A recent example is Anophophora glabripennis, a species of beetle known in the United States as the ''Asian Longhorrned beetle'', which has damaged many American forests, and is a threat which can unintentionally reach south American countries, including Brazil. This work presents a new method based on X-ray computerized tomography (CT and image processing for beetle injury detection in forests. Its results show a set of images with correct identification of the location of beetles in living trees as well as damage evaluation with time.Algumas espécies de besouros têm elevado impacto econômico em florestas e indústrias de móveis. Exemplo recente é aquele produzido pelo besouro Anophophora glabripennis, uma espécie conhecida nos Estados Unidos como Asian Longhorn, que tem produzido danos significativos em várias florestas americanas, representando uma ameaça que poderá encontrar transporte não-intencional para países da América do Sul, inclusive para o Brasil. Neste trabalho é apresentado um novo método com base no uso de tomografia de raios X computadorizada (CT e processamento de imagens digitais para detecção de injúrias causadas por besouros em florestas. Os resultados mostram a correta identificação da localização de besouros em árvores vivas, como também fornecem uma avaliação do estrago temporal causado.

  10. Estudo comparativo entre tomografia computadorizada de alta resolução e radiografia de tórax no diagnóstico da silicose em casos incipientes

    Directory of Open Access Journals (Sweden)

    CARNEIRO ANA PAULA SCALIA

    2001-01-01

    Full Text Available Introdução:A radiografia de tórax (RX ainda é, no dias atuais, o principal método de diagnóstico da silicose, seguindo-se as normas da Organização Internacional do Trabalho (OIT. A interpretação radiológica de casos iniciais é difícil, podendo ocorrer divergências mesmo entre leitores experientes. Recentemente, tem sido considerada a possibilidade de utilização da tomografia computadorizada com técnica de alta resolução (TCAR para avaliação de casos incipientes. Objetivo: Comparar os resultados da RX com a TCAR. Material e métodos: Foi avaliado um grupo inicial de 135 ex-mineiros, cujas radiografias foram examinadas por três leitores, no período de novembro de 1997 a dezembro de 1999. Indicou-se TCAR para 68 pacientes, cuja mediana de três leituras radiológicas foi menor ou igual a 1/0. As tomografias foram avaliadas por dois leitores e, em casos de divergência, houve participação de um terceiro leitor. As TCAR foram classificadas de acordo com a profusão de micronódulos em categorias de 0 a 3. Os resultados de TCAR e RX foram comparados através do teste de McNemar, coeficiente Kappa ponderado e modelos log-lineares. Resultados e conclusão: Houve boa concordância entre os métodos quanto à classificação na categoria 0, ou seja, os dois métodos mostraram-se equivalentes para excluir o diagnóstico de silicose. Porém, para o diagnóstico da doença, caracterizado por classificação na categoria 1 ou superior, não foi obtida boa concordância entre os métodos.

  11. Tomografia computorizada : análise e optimização das práticas na realização de exames em adultos e pediátricos : análise do nível de adequação às recomendações internacionais

    OpenAIRE

    Silva, Ricardo Alexandre Crispim da

    2014-01-01

    A Tomografia Computorizada (TC) é uma modalidade de imagem com crescente utilização em diagnóstico, tendo sofrido desenvolvimentos tecnológicos importantes nas últimas duas décadas. Na última década, em Portugal, verificou-se um crescimento anual do número de equipamentos de TC instalados e do número de exames realizados. Apesar do aumento da utilização, a TC constitui a fonte de radiodiagnóstico que mais contribui para a dose efectiva da população e para o aumento dos riscos, estocásticos...

  12. Fibrose maciça progressiva em trabalhadores expostos à sílica: achados na tomografia computadorizada de alta resolução Progressive massive fibrosis in silica-exposed workers: high-resolution computed tomography findings

    Directory of Open Access Journals (Sweden)

    Ângela Santos Ferreira

    2006-12-01

    Full Text Available OBJETIVO: Avaliar as características radiológicas das massas conglomeradas pela tomografia computadorizada de alta resolução de tórax. MÉTODOS: Foram selecionados 75 pacientes silicóticos, a maioria jateadores de areia, portadores de fibrose maciça progressiva, atendidos no Hospital Universitário Antônio Pedro entre 1986 e 2004. Os pacientes foram submetidos a avaliação clínica, radiografia simples de tórax e tomografia computadorizada de alta resolução. RESULTADOS: Mais da metade dos pacientes com silicose complicada mostrou na radiografia de tórax grandes opacidades dos tipos B e C, denotando a gravidade da doença nesses pacientes. Dos 75 casos, apenas um apresentou massa unilateral simulando câncer de pulmão. Quarenta e quatro pacientes realizaram tomografia computadorizada de alta resolução do tórax. As massas predominaram nos terços superiores e posteriores (88,6%. Broncograma aéreo e calcificações no interior das massas foram observados em 70,4% e 63,8% dos casos, respectivamente. História de tuberculose foi relatada em 52% dos pacientes estudados. CONCLUSÃO: Na grande maioria dos casos as massas eram bilaterais, predominando nas regiões póstero-superiores dos pulmões, com broncogramas aéreos e calcificações de permeio. Associação com calcificações linfonodais foi um achado freqüente. A exposição a elevadas concentrações de poeira e a tuberculose foram consideradas fatores de risco para o desenvolvimento da fibrose maciça progressiva.OBJECTIVE: To evaluate the radiological characteristics of conglomerate masses using high-resolution computed tomography of the chest. METHODS: From among the patients treated between 1986 and 2004 at the Antonio Pedro University Hospital, 75 patients with silicosis and massive fibrosis, most working in the field of sandblasting, were selected for study. These patients were submitted to a clinical evaluation, chest X-ray and high-resolution computed tomography of

  13. Tuberculose pulmonar: achados na tomografia computadorizada de alta resolução do tórax em pacientes com doença em atividade comprovada bacteriologicamente Pulmonary tuberculosis: findings on high resolution computerized tomography of active disease on patients with bacteriological confirmation

    Directory of Open Access Journals (Sweden)

    CRISTIANE ALÓ CAMPOS

    2002-01-01

    Full Text Available Objetivo: Descrever os achados em pacientes com tuberculose pulmonar em atividade na tomografia computadorizada de alta resolução e o padrão de distribuição das lesões pelo parênquima pulmonar. Casuística e método: Foram analisadas retrospectivamente as tomografias de alta resolução de 42 pacientes com diagnóstico bacteriológico de tuberculose pulmonar ou forte suspeita clínica, com posterior confirmação bacteriológica. Resultados: Os principais sinais sugestivos de atividade encontrados foram nódulos do espaço aéreo (83%, nódulos centrolobulares (74%, aspecto de árvore em brotamento (67%, cavitações (67%, espessamento das paredes brônquicas (55%, consolidações (48%, opacidade em vidro fosco (21%, e espessamento do interstício pulmonar (9%. Conclusão: A tomografia computadorizada de alta resolução do tórax pode sugerir fortemente atividade da doença, sendo particularmente útil nos pacientes com baciloscopias negativas e/ou radiografias indeterminadas, permitindo a instituição de tratamento adequado, antes mesmo do crescimento da micobactéria em meio de cultura.Background: The aim of this study was to describe the signs of active tuberculosis in patients submitted to high resolution computerized tomography and the distribution of lesions along the pulmonary parenchyma. Material and methods: The high resolution CTs performed on 42 patients with tuberculosis either bacteriologically diagnosed or clinical suspected and later confirmed by bacteriological tests were studied. Results: The signs of disease activity observed were airspace nodule (83%, centrilobular nodule (74%, tree-in-bud pattern (67%, cavitations (67%, bronchial thickening (55%, parenchymal consolidations (48%, ground glass opacity (21% and thickening of the inter and intralobular septa (9%. Conclusion: High resolution computed tomography can be strongly suggestive of disease activity, is particularly helpful in patients with negative smear and

  14. Immediate adverse reactions to intravenous iodinated contrast media in computed tomography Reacciones adversas inmediatas al contraste yodado intravenoso en tomografía computarizada Reações adversas imediatas ao contraste iodado intravenoso em tomografia computadorizada

    Directory of Open Access Journals (Sweden)

    Beatriz Cavalcanti Juchem

    2007-02-01

    ório-descritiva, de caráter não experimental, com o objetivo de conhecer as reações adversas imediatas ao contraste iodado intravenoso em pacientes hospitalizados, submetidos a tomografia computadorizada num hospital-escola no Sul do Brasil. Durante o período de estudo, todas as reações adversas manifestaram-se na intensidade leve, com freqüência de 12,5% com o uso de contraste iodado iônico e 1% com contraste não iônico. Extravasamento do meio radiopaco ocorreu em 2,2% das injeções em veia periférica, não havendo complicações em nenhum dos casos. Os resultados encontram-se dentro dos limites citados na literatura internacional e sugere-se que os serviços de tomografia conheçam as próprias taxas de reações adversas ao contraste iodado e as condições em que elas ocorrem, a fim de obter evidências para a avaliação dos respectivos processos assistenciais.

  15. Esvaziamento gástrico após administração oral de contraste em tomografia computadorizada do abdômen: descrição de seis casos

    Directory of Open Access Journals (Sweden)

    Martins Fernando Antonio Nogueira da Cruz

    2004-01-01

    Full Text Available JUSTIFICATIVA E OBJETIVOS: A lesão pulmonar secundária à aspiração do conteúdo gástrico é complicação associada à perda dos reflexos protetores das vias aéreas. Neste contexto, a realização de exames tomográficos que incluem a contrastação do trato digestivo exige particular atenção em crianças abaixo de cinco anos, que necessitam anestesia geral ou sedação para assegurar imobilidade durante o procedimento. A indução da anestesia ou sedação, após ingestão da solução de contraste pode trazer risco substancial para a broncoaspiração do conteúdo gástrico. Isto faz com que se opte por administrar o contraste por sonda gástrica após a intubação traqueal, uma vez que não se conhece o tempo de esvaziamento gástrico após utilização de solução contrastante. Esta conduta representa aumento do tempo de anestesia, o que resulta em constante questionamento sobre a possibilidade de esvaziamento do conteúdo gástrico em tempo inferior a uma hora. Seis casos de pacientes submetidos à tomografia de abdômen foram avaliados quanto ao esvaziamento gástrico por meio da realização de cortes tomográficos na topografia do estômago, com o objetivo de determinar a presença ou ausência de conteúdo residual líquido nesse órgão, após a administração da solução de contraste. RELATO DOS CASOS: Foram avaliadas seis crianças submetidas à tomografia contrastada do abdômen. Duas, não anestesiadas, apresentaram expressivo resíduo líquido gástrico decorridos 50 e 45 minutos, respectivamente, da ingestão de contraste. Quatro, submetidas à anestesia geral, também apresentaram resíduo líquido gástrico decorridos 40 a 50 minutos da administração de contraste via sonda oro/nasogástrica. Em duas destas persistiu apreciável resíduo líquido no estômago, mesmo após a aspiração do conteúdo pela sonda. CONCLUSÕES: Nos casos observados, o período de 40 a 50 minutos foi insuficiente para o esvaziamento do

  16. Optic coherence tomography in a patient with diffuse unilateral subacute neuroretinitis Tomografia de coerência óptica em neuretinite subaguda difusa unilateral

    Directory of Open Access Journals (Sweden)

    Alexandre Henrique Gomes

    2009-04-01

    Full Text Available PURPOSE: To measure retinal nervous fiber layer (RNFL thickness using OCT3 (Carl-Zeiss in patients with diffuse unilateral subacute neuroretinitis (DUSN with or without live worm and correlate it with visual acuity. METHODS: RNFL thickness, using RNFL thickness 3.4 program and best corrected visual acuity were measured in patients with DUSN between January 2005 and December 2006. RESULTS: Thirty-eight patients, aged 9 - 42 years were selected, of whom 20 had live worm. Mean RNFL was 71.55 ± 27.26 in the DUSN eye and 103.07 ± 20.66 in the contralateral eye (pOBJETIVO: Avaliar o uso do OCT3 (Carl-Zeiss para medir a espessura da camada de fibras nervosas em pacientes com neuroretinite unilateral subaguda difusa (DUSN e correlacionar com a acuidade visual. MÉTODOS: Foi medido a espessura da camada de fibras nervosas, utilizando programa "RNFL thickness 3.4" e a melhor acuidade visual de pacientes com DUSN entre janeiro de 2005 e dezembro 2006. RESULTADOS: Trinta e oito pacientes, com idade entre 9-42 anos foram selecionados para este estudo, sendo que 20 casos apresentavam larva viva localizada. A média da RNFL foi 71,55 ± 27,26 nos olhos com DUSN e 103,07 ± 20,66 nos olhos contralaterais (p<0,001. Correlação de Pearson entre a acuidade visual e a espessura da camada de fibras nervosas foi r= -0,522 (p<0,001 nos olhos com DUSN e r= -0,097 (p=0,509 nos olhos contralaterais. CONCLUSÃO: A espessura da camada de fibras nervosas de pacientes com DUSN apresenta uma correlação diretamente proporcional com a acuidade visual. Novos estudos são necessários para reforçar a correlação entre a acuidade visual e a espessura da camada de fibras nervosas nos pacientes com DUSN com a finalidade de acompanhar os pacientes após o tratamento.

  17. Diagnóstico de rinossinusite crônica em pacientes com fibrose cística: correlação entre anamnese, nasofibroscopia e tomografia computadorizada Diagnosis of chronic rhinosinusitis in patients with cystic fibrosis: correlation between anamnesis, nasal endoscopy and computed tomography

    Directory of Open Access Journals (Sweden)

    Letícia Boari

    2005-12-01

    Full Text Available O comprometimento nasossinusal é uma das principais manifestações otorrinolaringológicas da fibrose cística. Na literatura, é descrita a alta incidência de rinossinusite crônica nesses pacientes. Apesar de mais de 90% dos casos apresentarem panopacificação dos seios da face em exames de imagem, tais achados são raramente acompanhados de sintomas. Por isso, o profissional tem dificuldade de diagnosticar a doença nasossinusal em pacientes com fibrose cística. Dentre os métodos disponíveis para essa avaliação, o questionário (sintomas, a nasofibroscopia (sinais e a tomografia computadorizada têm grande importância. OBJETIVO: Avaliar o diagnóstico de rinossinusite crônica em pacientes portadores de fibrose cística por meio de questionário (anamnese; nasofibroscopia e tomografia computadorizada de seios da face e comparar os seus achados. FORMA DE ESTUDO: Clínico prospectivo transversal. MATERIAL E MÉTODO: Avaliação de 34 pacientes - maiores de 6 anos de idade e portadores de fibrose cística - por meio de questionário, nasofibroscopia (escore de Lund-Kennedy e tomografia computadorizada de seios da face (escore de Lund-Mackay. RESULTADOS: Observou-se que o diagnóstico de rinossinusite crônica foi positivo em: 20,58% dos casos pelo questionário; 73,52% dos casos pela nasofibroscopia e 93,54% dos casos pela tomografia computadorizada. A diferença entre os resultados foi estatisticamente significante. Verificou-se uma correlação de 55,1% entre as estratificações dos escores de nasofibroscopia e de tomografia computadorizada. CONCLUSÃO: O diagnóstico positivo da rinossinusite crônica foi predominantemente observado pela tomografia computadorizada. O diagnóstico negativo foi predominante na avaliação pelo questionário. Houve diferença estatisticamente significante entre os meios de avaliação. A nasofibroscopia é um excelente recurso que deve ser utilizado na avaliação de rinossinusite crônica em fibrose

  18. Opacidades em vidro fosco nas doenças pulmonares difusas: correlação da tomografia computadorizada de alta resolução com a anatomopatologia Ground-glass opacity in diffuse lung diseases: high-resolution computed tomography-pathology correlation

    OpenAIRE

    Maria Lúcia de Oliveira Santos; Edson Marchiori; Alberto Domingues Vianna; Arthur Soares Souza Jr.; Heleno Pinto de Moraes

    2003-01-01

    Opacidade em vidro fosco é achado freqüentemente visto na tomografia computadorizada de alta resolução do tórax e se traduz pelo aumento do coeficiente de atenuação dos pulmões, mas sem apagar as marcas broncovasculares. Por sua inespecificidade, a associação com outros achados radiológicos, clínicos e anatomopatológicos deve ser considerada para uma interpretação diagnóstica mais correta. Neste trabalho foram analisados 62 exames tomográficos de pacientes com doenças pulmonares difusas, de 1...

  19. Pneumonia lipoídica em adultos: aspectos na tomografia computadorizada de alta resolução Lipoid pneumonia in adults: findings on high-resolution computed tomography

    Directory of Open Access Journals (Sweden)

    Edson Marchiori

    2007-10-01

    Full Text Available OBJETIVO: Apresentar os aspectos na tomografia computadorizada de alta resolução do tórax da pneumonia lipoídica exógena por aspiração de óleo mineral, em pacientes adultos MATERIAIS E MÉTODOS: Foram estudados oito pacientes adultos - quatro mulheres e quatro homens - com média de idade de 69,4 anos, todos usuários de óleo mineral para tratamento de constipação intestinal. Os exames foram avaliados por dois radiologistas, de forma independente RESULTADOS: Os achados tomográficos mais comuns foram as consolidações com áreas de densidade de gordura de permeio, e o padrão de pavimentação em mosaico. As lesões foram bilaterais em seis pacientes, e unilaterais em dois CONCLUSÃO: O encontro de consolidações pulmonares com áreas de densidade de gordura de permeio, associado à história clínica do uso de óleo mineral, é diagnóstico de pneumonia lipoídica exógena.OBJECTIVE: The present study was aimed at describing the findings on high-resolution computed tomography in patients with exogenous lipoid pneumonia secondary to mineral oil aspiration MATERIALS AND METHODS: Eight adult patients - four men and four women - with mean age of 69.4 years were studied. All of the patients were users of mineral oil for treating intestinal constipation. High-resolution computed tomography studies of these patients were blindly evaluated by two radiologists. RESULTS: Air-space consolidation with areas of fat density and crazy paving pattern were the most frequent findings. The lesions were bilateral in six cases and unilateral in two CONCLUSION: Air-space consolidation with areas of fat density, associated with a clinical history of mineral oil ingestion virtually indicates a diagnosis of exogenous lipoid pneumonia.

  20. Validation of computed tomography protocols for simulated mandibular lesions: a comparison study Validação de protocolos de tomografia computadorizada para lesões simuladas em mandíbula: estudo comparativo

    Directory of Open Access Journals (Sweden)

    Andréia Perrella

    2007-06-01

    Full Text Available Computed tomography is the choice technique to assess oral and maxillofacial osseous lesions because it provides hard and soft tissues visualization in one examination without superimposition of surrounding structures. This examination offers a significant advance in maxillofacial lesions detection with an excellent anatomic resolution. The aim of this research was to evaluate the validity of two protocols, in axial sections, in simulated mandibular lesions. Two CT protocols were obtained in dry mandibles in which perforations were done simulating lesions. Two observers, previously calibrated, evaluated the images according to different parameters. The results indicated that the sensitivity and specificity in lesion detection were 100% for both protocols, but the detection of loci number of multilocular lesions and the location and detection of medullar invasion obtained reduced validity values, which were influenced by the acquisition protocol. We concluded that thinner axial slices and reconstructions were more effective in detecting early medullar invasion and loci number. Thicker protocols were not considered appropriate to detect multilocular lesions and early stages of medullar invasion.A tomografia Computadorizada é a técnica de escolha no exame de lesões ósseas orais e maxilo-faciais porque proporciona a visualização de tecidos duros e moles em aquisição única e sem sobreposição de estruturas adjacentes. Este exame oferece um avanço significativo na detecção de lesões maxilo-faciais, com excelente resolução anatômica. O objetivo desta pesquisa foi avaliar a validade de dois protocolos, em secções axiais, em lesões simuladas de mandíbula. Dois protocolos de TC foram obtidos em mandíbulas secas em que foram feitas perfurações, simulando lesões. Dois observadores previamente calibrados avaliaram as imagens seguindo parâmetros diversos. Como resultados pudemos observar que a sensibilidade e a especificidade foram

  1. Computed tomography scan of the head in patients with migraine or tension-type headache Tomografia computadorizada do crânio em pacientes com migrânea ou cefaléia tensional

    Directory of Open Access Journals (Sweden)

    Marcelo Moraes Valença

    2002-09-01

    Full Text Available A retrospective study was performed in order to evaluate the frequency of abnormalities found by computed tomography (CT scan of the head in 78 patients with migraine or tension-type headache. In the present study CT scan was normal in 61.5% of the patients with migraine or tension-type headache. A number of abnormalities were encountered in more than one third of the patients studied, including inflammatory sinus disease (19.2%, cysticercosis (3.9%, unruptuted cerebral aneurysm (2.6%, basilar impression (2.6%, intracranial lipoma (2.6%, arachnoid cyst (2.6%, empty sella (2.6%, intracranial neoplasm (2.6%, and others (2.6%. None of these lesions were symptomatic or responsible by the headache picture, therefore, considered incidental findings. In conclusion, the fortuitous encounter of some abnormalities on CT scan of the head is often higher than what we could predict in patients suffering migraine or tension-type headache. We briefly discuss clinical, epidemiologic, and practical management of some of the abnormalities detected by CT scan as well as the indication to request a neuroimaging investigation.Um estudo retrospectivo foi realizado visando avaliar a frequência de anormalidades encontradas durante a realização de estudo por tomografia computadorizada (TC em 78 pacientes com migrânea ou cefaléia do tipo tensional. A TC foi normal em 61,5% dos pacientes examinados. Em um terço dos pacientes estudados foram detectadas anormalidades, como doença inflamatória dos seios paranasais (19,2%, cisticercose (3,9%, aneurisma cerebral não-roto (2,6%, impressão basilar (2,6%, lipoma intracraniano (2,6%, cisto aracnoideo (2,6%, sela vazia (2,6%, neoplasia intracraniana (2,6% e outras afecções (2,6%. Nenhuma destas lesões era sintomática (achado incidental. Concluindo, o encontro fortuito de algumas anormalidades na TC é frequentemente mais elevado do que se prediz em pacientes com cefaléia primária. Nós discutimos brevemente alguns

  2. Estudo exploratorio da qualidade do ar em escolas de educacao basica, Coimbra, Portugal

    Directory of Open Access Journals (Sweden)

    Ana Maria Conceicao Ferreira

    2013-12-01

    Full Text Available OBJETIVO : Analisar a qualidade do ar em escolas de educação básica e suas condições estruturais e funcionais. MÉTODOS : Foi avaliada a qualidade do ar de 51 escolas (81 salas de aula de educação básica da cidade de Coimbra, Portugal, tanto na parte interior das salas como na exterior, durante as quatro estações do ano, de 2010 a 2011. Foram avaliadas a temperatura (Tº, umidade relativa (Hr, concentrações de monóxido de carbono (CO, dióxido de carbono (CO 2 , ozona (O 3 , dióxido de nitrogênio (NO 2 , dióxido de enxofre (SO 2 , compostos orgânicos voláteis (COV, formaldeído e material particulado (PM 10 , de novembro de 2010 a fevereiro de 2011 (outono/inverno e de março de 2011 a junho de 2011 (primavera/verão. Procedeu-se ao preenchimento de uma grelha de caracterização das condições estruturais e funcionais das escolas. Aplicaram-se os testes estatísticos t- Student para amostras emparelhadas e o teste t de Wilcoxon. RESULTADOS : Em 47 escolas, as concentrações médias de CO 2 encontravam-se acima da concentração máxima de referência (984 ppm mencionada na legislação portuguesa. Os valores máximos de concentração encontrados no interior das salas foram críticos, principalmente no outono/inverno (5.320 ppm. As concentrações médias de COV e de PM 10 no interior ultrapassaram a concentração máxima de referência legislada em algumas escolas. Não foram detetados valores relevantes (risco de CO, formaldeído, NO 2 , SO 2 e O 3 . CONCLUSÕES : Houve maior concentração de poluentes no interior das salas, comparativamente com o exterior. A inadequada ventilação está associada à elevada concentração de CO 2 nas salas de aula.

  3. Tomografia por emissão de fóton único em epilepsia temporal: estudos intercríticos e críticos com análise visual e semi quantitativa Single photon emission tomography in temporal lobe epilepsy: visual and semi quantitative analysis in interictal and ictal studies

    OpenAIRE

    Elza Márcia T. Yacubian; Lilian Y.I. Yamaga; Rosa Maria F. Valério; Lia A. Fiore; Carmen Lisa Jorge; Buchpiguel, Carlos A.

    1995-01-01

    Vinte e oito estudos intercríticos e 9 críticos/pós críticos de tomografia por emissão de fóton único (SPECT) foram realizados em 27 pacientes com epilepsia do lobo temporal e esclerose mesial temporal. Estudos intercríticos localizaram corretamente a área epileptogênica em 19 (67%) dos pacientes pela análise visual e 16 (61,5%) pela semi quantitativa, com 10,7 e 15,3%, de falsa lateralização respectivamente. Todos os 9 estudos críticos/ pós críticos detectaram o hemisfério epileptogênico e p...

  4. Redução de dose e aumento na vida útil do tubo de raios X em tomografia computadorizada Dose reduction and increase of X-ray tube life in computed tomography

    Directory of Open Access Journals (Sweden)

    José Augusto Marconato

    2004-10-01

    Full Text Available OBJETIVO: Reduzir a dose de radiação e aumentar a vida útil do tubo de raios X em exames de tomografia computadorizada. MATERIAIS E MÉTODOS: Foram avaliados exames de crânio, abdome superior e tórax. Foi verificado se a técnica utilizada poderia ser alterada, foram sugeridos novos protocolos, e feitas comparações de qualidade da imagem, dose de radiação e aquecimento do tubo de raios X. RESULTADOS: Uma redução no mAs pôde ser feita sem comprometer a qualidade do diagnóstico, proporcionando redução de até 20% na dose média dos exames de crânio em adultos e de até 45% em crianças com idade de 0 a 6 meses; pacientes com menos de 50 kg tiveram redução de aproximadamente 37% na dose média de radiação para os exames de abdome superior; para o exame de tórax de rotina a redução chegou a 54%. O aquecimento do tubo de raios X para os exames de crânio, abdome superior e tórax teve redução estimada em aproximadamente 13%, 23% e 41%, respectivamente. CONCLUSÃO: Uma alteração nos protocolos dos exames descritos acarretará diminuição significativa na dose de radiação e aumento na vida útil do tubo de raios X, sem comprometer o diagnóstico.OBJECTIVE: To reduce radiation dose and increase x-ray tube life in computed tomography. MATERIALS AND METHODS: Head, upper abdomen and chest scans were evaluated. We assessed the techniques employed and if these could be changed, suggested new protocols and compared the quality of the images, the radiation dose and the x-ray tube heating. RESULTS: A mAs reduction could be done without interfering with the diagnostic quality, allowing a decrease of up to 20% in the average dose for adults' head exams and up to 45% for 0 to 6 years old children; patients with less than 50 kg had a reduction of 37% on the upper abdomen radiation average dose; for chest routine scans the reduction was 54%. The decrease in the heating of the x-ray tube for head, upper abdomen and chest scans was

  5. Planosol soil sample size for computerized tomography measurement of physical parameters Tamanho de amostras para a determinação de parâmetros físicos em planossolo por tomografia computadorizada

    Directory of Open Access Journals (Sweden)

    Alceu Pedrotti

    2003-12-01

    Full Text Available Computerized tomography (CT is an important tool in Soil Science for noninvasive measurement of density and water content of soil samples. This work aims to describe the aspects of sample size adequacy for Planosol (Albaqualf and to evaluate procedures for statistical analysis, using a CT scanner with a 241Am source. Density errors attributed to the equipment are 0.051 and 0.046 Mg m-3 for horizons A and B, respectively. The theoretical value for sample thickness for the Planosol, using this equipment, is 4.0 cm for the horizons A and B. The ideal thickness of samples is approximately 6.0 cm, being smaller for samples of the horizon B in relation to A. Alternatives for the improvement of the efficiency analysis and the reliability of the results obtained by CT are also discussed, and indicate good precision and adaptability of the application of this technology in Planosol (Albaqualf studies.A técnica da tomografia computadorizada (TC permite medir a densidade e a umidade de amostras de solo, constituindo uma importante ferramenta na Ciência do Solo. Este trabalho tem como objetivos descrever os aspectos da adequação do tamanho de amostras de um Planossolo e os procedimentos de avaliação e estudos por análise estatística, empregando-se um minitomógrafo computadorizado de raios gama com fonte de 241Am. O valor do erro atribuído ao equipamento são 0,051 e 0,046 Mg m-3, respectivamente, para os horizontes A e B. O valor teórico da espessura da amostra do Planossolo para uso na técnica de TC com fonte de 241Am é, aproximadamente, 4,0 cm para os horizontes A e B. Já a espessura ideal de amostras é de aproximadamente 6,0 cm, sendo menor para amostras do horizonte B em relação ao A. Obteve-se boa precisão e adaptabilidade no emprego da TC para estudos de Planossolos.

  6. Obstrução em alça fechada com ruptura do ceco: aspectos na tomografia computadorizada - relato de um caso Computed tomography findings in closed obstruction of the small bowel associated with rupture of the cecum: a case report

    OpenAIRE

    Sheila Jandhyra Vianna Crespo; Edson Marchiori; Luis Fernando Mendes

    2001-01-01

    A obstrução intestinal em alça fechada determina uma situação de extrema gravidade, com conseqüências sérias, podendo por vezes levar ao óbito. Os autores descrevem um caso de obstrução intestinal secundária a câncer no sigmóide, destacando a importância da tomografia computadorizada na análise das alterações patológicas na rotina de abdome agudo.Closed loop obstruction of the bowel is an extremely grave condition that may lead to serious consequences and even be fatal. The authors describe a...

  7. Obstrução em alça fechada com ruptura do ceco: aspectos na tomografia computadorizada - relato de um caso Computed tomography findings in closed obstruction of the small bowel associated with rupture of the cecum: a case report

    Directory of Open Access Journals (Sweden)

    Sheila Jandhyra Vianna Crespo

    2001-06-01

    Full Text Available A obstrução intestinal em alça fechada determina uma situação de extrema gravidade, com conseqüências sérias, podendo por vezes levar ao óbito. Os autores descrevem um caso de obstrução intestinal secundária a câncer no sigmóide, destacando a importância da tomografia computadorizada na análise das alterações patológicas na rotina de abdome agudo.Closed loop obstruction of the bowel is an extremely grave condition that may lead to serious consequences and even be fatal. The authors describe a case of a patient with intestinal obstruction secondary to cancer of the sigmoid and highlight the importance of computed tomography in the analysis of the pathological changes in routine management of patients with acute abdomen.

  8. Efeitos da embalagem em ar, sob vácuo e em atmosfera modificada sobre a qualidade de filetes de peixe-porco Balistes capriscus

    OpenAIRE

    Guerra, Luís Miguel Valadas Horta Silva

    2013-01-01

    Dissertação de mest, Tecnologia de Alimentos, Instituto Superior de Engenharia, Univ. do Algarve, 2013 Este trabalho teve como objetivo o estudo do efeito de diferentes modos de embalagem (em ar, sob vácuo e em atmosfera modificada) sobre a qualidade (em termos físico-químicos e microbiológicos) e o tempo de conservação útil de filetes de peixe-porco (Balistes capriscus). Para tal, foram estudados parâmetros físicos (textura e cor) e químicos (pH e azoto básico volátil total, ABVT) em funç...

  9. Qualidade da cama e do ar em diferentes condições de alojamento de frangos de corte

    Directory of Open Access Journals (Sweden)

    Thayla Morandi Ridolfi de Carvalho

    2011-04-01

    Full Text Available O objetivo deste trabalho foi avaliar as condições iniciais de alojamento de aves, de um dia de idade, em termos da qualidade da cama de frango reutilizada e do ar, em aviários comerciais de produção com diferentes sistemas de ventilação mínima e tipologia, por meio de análise geoestatística. O experimento foi realizado em quatro aviários: Blue House I (T1 e Blue House II (T2, Dark House (T3 e Convencional (T4. As variáveis analisadas foram: pH, umidade, temperatura superficial e concentração de amônia, tendo-se coletado as amostras na altura dos frangos, em 80 pontos equidistantes no interior do pinteiro. A análise geoestatística auxiliou a identificação de pontos críticos no controle dos ambientes estudados. O manejo da ventilação mínima não é suficiente para garantir a qualidade do ar nos pinteiros. A cama reutilizada de casca de café e arroz (T1 e T2 apresenta melhor qualidade do que a cama reutilizada de maravalha fina (T3 e T4. O sistema de ventilação mínima, em T2 e T4, é o mais eficiente quanto à renovação do ar nos pinteiros.

  10. Qualidade da cama e do ar em diferentes condições de alojamento de frangos de corte

    OpenAIRE

    Thayla Morandi Ridolfi de Carvalho; Daniella Jorge de Moura; Zigomar Menezes de Souza; Gustavo Soares de Souza; Leda Gobbo de Freitas Bueno

    2011-01-01

    O objetivo deste trabalho foi avaliar as condições iniciais de alojamento de aves, de um dia de idade, em termos da qualidade da cama de frango reutilizada e do ar, em aviários comerciais de produção com diferentes sistemas de ventilação mínima e tipologia, por meio de análise geoestatística. O experimento foi realizado em quatro aviários: Blue House I (T1) e Blue House II (T2), Dark House (T3) e Convencional (T4). As variáveis analisadas foram: pH, umidade, temperatura superficial e concentr...

  11. Análise por tomografia computadorizada do teto etmoidal: importante área de risco em cirurgia endoscópica nasal Computed tomography assessment of the ethmoid roof: a relevant region at risk in endoscopic sinus surgery

    OpenAIRE

    Soraia Ale Souza; Marcia Maria Ale de Souza; Marcos Idagawa; Ângela Maria Borri Wolosker; Sérgio Aron Ajzen

    2008-01-01

    OBJETIVO: Avaliar a profundidade das fossas olfatórias e a freqüência de assimetria na altura e na inclinação lateral do contorno do teto etmoidal. MATERIAIS E MÉTODOS: Estudo retrospectivo de 200 tomografias computadorizadas dos seios da face no plano coronal realizadas no período de agosto a dezembro de 2006. As profundidades das fossas olfatórias foram classificadas segundo Keros. O teto etmoidal foi avaliado quanto à simetria entre os lados. RESULTADOS: O tipo de Keros mais encontrado foi...

  12. Aspectos Tectônicos das Intrusões dos Granitos do Cerne, Passa Três e Rio Abaixo, Sudeste do Pré-cambriano Paranaense. Estudo Baseado em Datações 39Ar-40Ar em Micas

    Directory of Open Access Journals (Sweden)

    Leonardo Fadel Cury

    2008-04-01

    Full Text Available Os stocks graníticos do Cerne, Passa Três e Rio Abaixo são representados por corpos elípticos, alongados segundo NE-SW(granitos do Cerne e Passa Três e com formas “ovóides” (Granito Rio Abaixo, intrusivos nas seqüências metavulcanossedimentaresda porção sudeste do Cinturão Ribeira, no Estado do Paraná. Esses corpos são representados principalmente por biotitasienogranitos,monzogranitos e quartzo-sienitos porfiríticos, com megacristais de microclínio, isótropos ou com foliação de fluxomagmático, podendo apresentar termos deformados em regiões restritas às zonas de contato. Mostram afinidades petrológicas,geoquímicas e geocronológicas, com características semelhantes aos granitos tipo-A, porém, enriquecidos em Ba, Sr e Zr. Análises40Ar-39Ar em biotitas do Granito do Cerne indicaram idade integrada de 557 ± 2 Ma, valor este relativamente próximo à idade decristalizaç��o dos zircões de aproximadamente 563 Ma, definida por Cury (2003. Determinações 40Ar-39Ar obtidas em rochasencaixantes (muscovitas xistos das vizinhanças do Granito do Cerne apresentam idades mais antigas (800-1200 Ma, o quepermite concluir que a intrusão do granito, bem como o evento metamórfico regional ocorrido durante o Ciclo Brasiliano, nãoatingiram temperaturas suficientes para apagar o registro isotópico das muscovitas (T < 300oC. Os stocks graníticos do Cerne,Passa Três e Rio Abaixo representam magmatismo tardi-orogênico no contexto das deformações presentes no Domínio Apiaí eao arco-magmático Três Córregos-Cunhaporanga (630-590 Ma, relacionado aos estágios finais de transpressão, onde suacolocação é intimamente associada às zonas de cisalhamento transcorrente e desenvolvimento das grandes antiformas e sinformas.Tal período (Proterozóico Superior/Cambriano representa um importante marco na região, associado aos ajustes finais relacionadosà aglutinação do Supercontinente Gondwana.

  13. Macronutrientes em folhas e frutos de cultivares de café arábica de porte baixo Macronutrients in leaves and fruits of dwarf arabica coffee cultivars

    OpenAIRE

    Valdemar Valarini; Ondino Cleante Bataglia; Luiz Carlos Fazuoli

    2005-01-01

    O presente trabalho teve como objetivo avaliar a mobilização de macronutrientes de folhas para frutos em diferentes cultivares de café arábica, através de análises foliares periódicas. O experimento foi plantado em 1994 em solo Rhodic Hapludox, em Campinas Estado de São Paulo, Brasil. Foram coletadas folhas de ramos plagiotrópicos com frutos, o terceiro par a partir do ápice, para determinação de macronutrientes, em dezembro de 2002, fevereiro e maio de 2003. A colheita do experimento e a amo...

  14. Especiação química de arsénio em arroz e pescado

    OpenAIRE

    Coelho, Inês; Gueifão, Sandra

    2011-01-01

    A importância da especiação química em alimentos prende-se com o facto de ser hoje sobejamente reconhecido, que quer a toxicidade quer a biodisponibilidade de um elemento são dependentes da forma química em que este se apresenta. No caso particular do arsénio, as espécies inorgânicas são mais tóxicas que as orgânicas e, dentro destas, nem todas apresentam o mesmo nível de toxicidade. Algumas espécies orgânicas são inclusive consideradas não tóxicas como é o caso da arsenobetaina (AsB) e arsen...

  15. Estudo da drenagem linfática e eficácia da tomografia computadorizada na detecção de metástases linfonodais em pacientes clinicamente N0 com carcinoma espinocelular de boca e orofaringe Lymphatic drainage and efficiency of computed tomography in the detection of lymph node metastasis in N0 staged patients with squamous cell carcinoma of the mouth and oropharynx

    Directory of Open Access Journals (Sweden)

    Addah Regina da Silva Freire

    2002-03-01

    Full Text Available O exame clínico não é suficiente para avaliar, com precisão, o envolvimento linfonodal em carcinomas de boca e orofaringe. Avaliamos 21 pacientes portadores de carcinoma espinocelular de boca e orofaringe, estadiados clinicamente como N0. Em todos os pacientes foi feita tomografia computadorizada de face e pescoço, e linfocintilografia. A sensibilidade e a especificidade da tomografia computadorizada foram de 16% e 73% para o lado homolateral, e 0% e 90% para o contralateral, respectivamente. Drenagem linfática foi vista em 76,2% dos casos. A não-migração ocorreu em casos de difícil injeção do radiofármaco, como fossa amigdaliana e região retromolar. A migração bilateral ocorreu apenas em casos de soalho bucal, em que havia envolvimento da linha mediana. A partir desses resultados conclui-se que a tomografia computadorizada foi menos eficiente que o exame clínico. Porém, o tomógrafo utilizado foi o não-helicoidal e, portanto, a eficácia do tomógrafo helicoidal não foi avaliada. A linfocintilografia foi útil na avaliação de pacientes clinicamente N0 e estamos utilizando o método para avaliar linfonodo sentinela nos carcinomas de boca.Clinical examination alone is not sufficient to precisely evaluate lymph node involvement in head and neck cancer. The results of computed tomography of the neck and lymphoscintigraphy were evaluated in 21 patients with carcinoma of the mouth and oropharynx staged N0. Nine patients were treated by homolateral and 12 by bilateral neck dissection. Sensitivity and specificity of computed tomography were 16% and 73% for homolateral side and 0% and 90% for contralateral side, respectively. Lymphatic drainage was observed in 76.2% of the cases. No-migration was associated with cases involving the retromolar region and tonsillar fossa, where injection of the 99mTc-Dextran 500 is more difficult. Bilateral migration occurred only in carcinomas of the floor of the mouth, with involvement of the

  16. Avaliação da concordância interobservador na análise da tomografia computadorizada sem contraste no diagnóstico da urolitíase em pacientes com cólica renal aguda Interobserver agreement on non-contrast computed tomography interpretation for diagnosis of urolithiasis in patients with acute flank pain

    Directory of Open Access Journals (Sweden)

    Luís Ronan Marquez Ferreira de Souza

    2006-10-01

    Full Text Available OBJETIVO: Avaliar a reprodutibilidade da tomografia computadorizada sem contraste na avaliação da litíase ureteral e os sinais secundários de obstrução do sistema coletor em pacientes com cólica renal aguda. MATERIAIS E MÉTODOS: Estudo prospectivo de 52 pacientes com diagnóstico clínico de cólica renal aguda submetidos a exame de tomografia computadorizada de abdome sem contraste. Os exames foram realizados com técnica helicoidal e posteriormente analisados por três observadores independentes, com a concordância interobservador avaliada pelo método estatístico kappa (kapa. Foram analisados os parâmetros: a presença, localização e mensuração dos cálculos ureterais; b dilatação do sistema coletor intra-renal; c heterogeneidade da gordura perirrenal; d dilatação ureteral; e edema da parede ureteral (sinal do halo. RESULTADOS: Foram encontrados 40 cálculos ureterais na tomografia computadorizada (77%. A concordância interobservador para a identificação do cálculo ureteral e da dilatação ureteral foi quase perfeita (kapa = 0,89 e kapa = 0,87, respectivamente, substancial para dilatação do sistema coletor intra-renal (kapa = 0,77 e moderada para heterogeneidade da gordura perirrenal e para edema da parede ureteral (kapa = 0,55 e kapa = 0,56, respectivamente. CONCLUSÃO: A tomografia computadorizada de abdome sem contraste apresenta elevada reprodutibilidade na avaliação da litíase ureteral e dos sinais secundários de obstrução do sistema coletor.OBJECTIVE: To evaluate the interobserver agreement on non-contrast computed tomography interpretation by a group of experienced abdominal radiologists, for the study of urolithiasis in patients presenting acute flank pain. MATERIALS AND METHODS: Prospective study of 52 patients submitted to non-contrast enhanced helical computed tomography. The images were subsequently analyzed by three independent observers, with the interobserver agreement assessed by means of the

  17. Carcinoma de células transicionais do trato urinário: aspectos da tomografia computadorizada

    Directory of Open Access Journals (Sweden)

    Almeida Junior José Guiomar de

    2003-01-01

    Full Text Available Embora relativamente incomum, o carcinoma de células transicionais do trato urinário é o segundo tumor mais freqüente do rim. Neste trabalho foram analisadas, de forma retrospectiva, as tomografias computadorizadas de dez pacientes com carcinoma de células transicionais confirmado por exame histopatológico. A bexiga foi acometida em 60% dos casos, o sistema pielocalicinal em 60% e o ureter em 10% deles. Lesões sincrônicas estiveram presentes em 40% das vezes. Os aspectos encontrados foram lesões vegetantes, espessamento da parede do ureter e lesões infiltrativas do rim. Foram descritos dois casos de tumores calcificados e um carcinoma de células transicionais surgindo no interior de um divertículo de bexiga. A tomografia computadorizada detectou extensão local do tumor em 80% dos pacientes e lesão a distância em 20%. A tomografia computadorizada permitiu caracterizar a extensão da doença, localmente e a distância, possibilitando que um grupo selecionado de pacientes pudesse ser tratado de forma conservadora.

  18. AVALIAÇÕES DA QUALIDADE DO AR EM PAULÍNIA-SP*

    OpenAIRE

    Mirian Ramos Gutjahr; José Roberto Tarifa

    2004-01-01

    A obtenção de dados relativos à poluição do ar é sistematicamentedifícil. O presente trabalho aborda a utilizaçãode dados ‘proxi’ ou indiretos e sua comparaçãocom dados de monitoramento da qualidade do ar, como propósito de avaliar a qualidade do ar no municípiode Paulínia/SP. Levantamentos pontuais de poluição doar foram realizados pela agência ambiental na RegiãoMetropolitana de São Paulo – RMSP, Cubatão e outros17 municípios do Estado, que tem sido alvo de maioratenção quanto à qualidade a...

  19. Curvas de isodose no ar em uma sala de mamografia Air isodose curves in a mammography room

    Directory of Open Access Journals (Sweden)

    Maria Cecília Baptista Todeschini Adad

    2008-08-01

    Full Text Available OBJETIVO: O objetivo deste trabalho foi obter a distribuição da dose absorvida no ar numa sala de mamografia durante a simulação de um exame mamográfico, visando a reavaliar a necessidade do uso de barreiras de proteção radiológica nessas salas e a exposição das pacientes. MATERIAIS E MÉTODOS: Os dados da dose absorvida no ar foram coletados mediante simulação de exame mamográfico de um simulador de mama de BR12, em um equipamento Senograph 600T-Senix HF. Para tal, 158 pastilhas de CaSO4 foram distribuídas em malhas retangulares em torno do bucky, em três alturas distintas. RESULTADOS: O valor mais elevado da dose absorvida no ar, registrado no ponto central da superfície do simulador, centralizado no feixe primário, foi de 8,33 mGy, enquanto o menor valor registrado, devido exclusivamente ao espalhamento, foi de 0,008 mGy. CONCLUSÃO: Estes resultados indicam que o uso de blindagem adicional nas salas de mamografia pode não ser necessário na incidência crânio-caudal, desde que as distâncias consideradas neste trabalho sejam observadas. No entanto, eles enfatizam a necessidade de proteção da paciente.OBJECTIVE: The present study was aimed at evaluating the absorbed dose in air in a medical examination room during a mammography simulation, to re-evaluate the level of patients' exposure as well as the necessity of radiological protection barriers. MATERIALS AND METHODS: Data regarding absorbed dose in air were collected during mammography simulation with a BR12 breast phantom in a Senograph 600T-Senix HF mammograph. For this purpose, 158 CaSO4 dosimeters were distributed over rectangular grids around the bucky at three different heights. RESULTS: The highest value for absorbed dose in air recorded on the center of the phantom surface and centralized on the primary beam was 8.33 mGy, while the lowest value recorded exclusively due to radiation scattering was 0.008 mGy. CONCLUSION: These results indicate that the utilization

  20. Perfusão miocárdica dinâmica por tomografia computadorizada de dupla fonte de raio X

    Directory of Open Access Journals (Sweden)

    José Rodrigues Parga Filho

    2012-03-01

    Full Text Available Relatamos caso de perfusão dinâmica e quantitativa pela tomografia computadorizada de múltiplos detectores de dupla fonte de Raio X em um paciente de 44 anos, com diagnóstico prévio de doença coronariana. A tomografia demonstrou quantitativamente déficit de perfusão miocárdica nos territórios irrigados por artérias com estenoses significativas confirmadas pela angiotomografia e pela cineangiocoronariografia. A tomografia computadorizada com dupla fonte de Raio X permitiu a avaliação dinâmica perfusional e anatômica, em um único estudo, durante o controle evolutivo desse paciente.

  1. Efeitos Tóxicos de Arsênio em Eisenia Andrei em Exposição a Solos do Entorno de Minerações de Ouro

    Directory of Open Access Journals (Sweden)

    Rodrigo Henrique Alves

    2015-06-01

    Full Text Available Os produtos das atividades de mineração têm grande relevância econômica no Estado de Minas Gerais, Brasil. No entanto, seus inúmeros danos à biota, incluindo a fauna edáfica, resultam na necessidade de recuperação e biomonitoramento dessas áreas e do seu entorno. Considerando a importância ecológica e o potencial bioindicador das minhocas, o objetivo deste estudo foi avaliar a toxicidade de arsênio presente em solos do entorno de minerações de ouro, nas bacias dos rios Doce e São Francisco, a oligoquetas da espécie Eisenia andrei Bouché. Amostras de solos dessas áreas foram caracterizadas em relação às suas propriedades físicas e químicas, incluindo os metais Fe, Al, Cu, Ni, Zn e Mn e do metaloide As; com elas, foram conduzidos bioensaios, que avaliaram a sobrevivência, reprodução e variação da biomassa dos organismos. Também foram realizados testes de sensibilidade dessa espécie ao As adicionado a solo artificial tropical e em solo natural. Houve evidente efeito tóxico sobre a reprodução dessa espécie, que esteve altamente correlacionado com as concentrações de As nas amostras (r = -0,80. Amostras de solos naturais de locais avaliados nas duas áreas apresentaram concentrações de As acima do limite estipulado pela Resolução Conama nº 420 de 2009, chegando a 2.388,2 mg kg-1. A CL50 do As em solo artificial tropical (207,4 mg kg-1 foi seis vezes menor que a do solo natural (1.248,1 mg kg-1. A menor biodisponibilidade do As nos solos naturais foi atribuída a sua associação com o minério de Fe presente nas amostras. Concluiu-se que os solos do entorno de áreas de mineração causaram toxicidade crônica a E. andrei, em termos de sua reprodução, o que demonstrou o potencial de danos dessas atividades sobre a fauna edáfica dessas áreas. O estudo também forneceu informações ecotoxicológicas que podem ser úteis em avaliações de risco ambiental em solos tropicais.

  2. Image quality and volume computed tomography air kerma index (C{sub vol}) evaluation in Recife; Avaliacao da qualidade de imagem e do indice volumetrico de Kerma ar em tomografia computadorizada (C{sub vol}) em Recife

    Energy Technology Data Exchange (ETDEWEB)

    Andrade, Marcos Ely Almeida

    2008-07-01

    The Computed Tomography (CT) is an important diagnostic imaging method, widely used. However, in spite of all the advantages and technologic advances within the CT scanners, the tomographic procedures result in high absorbed doses to patients. The main objective of this work was to perform a dosimetric study of CT scanners located at Recife and to evaluate the image quality on CT examinations in these equipment. The volume CT air kerma index (C{sub VOL}) and air kerma length product (P{sub KL,CT}) were estimated. These values were calculated using normalized weighted air kerma indexes in CT standard dosimetry phantoms ({sub n}C{sub W}), supplied by ImPACT group for several CT scanners, and the scan parameters of routine head, routine chest and hi-resolution chest CT exams performed at 20 institutions. The irradiation parameters of 15 adult patients for each CT procedure were registered at six participating centres, at which the phantom from the American College of Radiology (ACR) CT accreditation protocol was used for the image quality measurements. For routine head exams, the C{sub VOL} values varied between 12 and 58 mGy (at the posterior fossa) and 15 to 58 mGy (at the cerebrum) and the P{sub KL,CT}, from 150 to 750 mGy{center_dot}cm. The C{sub VOL} values for routine chest procedures varied from 3 to 26 mGy and the P{sub KL,CT}, between 120 and 460 mGy{center_dot}cm. In relation to Hi-resolution chest exams, C{sub VOL} values were from 1.0 to 2.7 mGy and the P{sub KL,CT} values varied between 24 and 67 mGy{center_dot}cm. The image quality evaluations results showed that almost all scanners presented at least one inadequacy. One of the equipment presented faults at 70% of the tests. With regard to the image noise, only two scanners presented acceptable results. From these results, it is possible to conclude that the volume CT air kerma index values are lower than the European reference levels. However, the image quality of these CT scanners does not attend the ACR requirements, suggesting the need to implement quality assurance programs at the evaluated institutions. (author)

  3. Efeitos Tóxicos de Arsênio em Eisenia Andrei em Exposição a Solos do Entorno de Minerações de Ouro

    OpenAIRE

    Rodrigo Henrique Alves; Arnola Cecilia Rietzler

    2015-01-01

    Os produtos das atividades de mineração têm grande relevância econômica no Estado de Minas Gerais, Brasil. No entanto, seus inúmeros danos à biota, incluindo a fauna edáfica, resultam na necessidade de recuperação e biomonitoramento dessas áreas e do seu entorno. Considerando a importância ecológica e o potencial bioindicador das minhocas, o objetivo deste estudo foi avaliar a toxicidade de arsênio presente em solos do entorno de minerações de ouro, nas bacias dos rios Doce e São Francisco, a...

  4. Edema pulmonar hidrostático: aspectos na tomografia computadorizada de alta resolução Hydrostatic pulmonary edema: high-resolution computed tomography aspects

    OpenAIRE

    Cláudia Maria Cunha Ribeiro; Edson Marchiori; Rosana Rodrigues; Emerson Gasparetto; Arthur Soares de Souza Júnior; Dante Escuissato; Luiz Felipe Nobre; Gláucia Zanetti; César de Araujo Neto; Klaus Irion

    2006-01-01

    OBJETIVO: A proposta deste estudo foi caracterizar por meio de tomografia computadorizada de alta resolução do tórax as principais alterações pulmonares do edema pulmonar hidrostático. MÉTODOS: Foram analisadas, retrospectivamente, as tomografias de quinze pacientes com quadro clínico de edema pulmonar hidrostático, divididos em cinco principais grupos etiológicos: insuficiência cardíaca congestiva, valvulopatia mitral aguda, infarto agudo do miocárdio, miocardite e mediastinite fibrosante, t...

  5. Quantificação em escala de bancada do volume de ar em ligações prediais de água Measuring air volume in household pipes by means of a pilot scale study

    OpenAIRE

    Ney Procópio Lopes; Márcia Lara; Marcelo Libânio

    2011-01-01

    A presente pesquisa em escala piloto, simulando trecho de uma rede interligada a um ramal predial, visou quantificar o volume de ar aferido pelos hidrômetros residenciais. Para tal fim, testaram-se ventosas, bloqueadores de ar e válvulas eliminadoras de ar. Sob condições normais de operação da rede, o volume de ar medido pelos hidrômetros é comparável ao encontrado na água natural, não justificando a instalação de equipamento de eliminação de ar de qualquer natureza. Todavia, logo após esvazi...

  6. Aspectos da tomografia de coerência óptica na doença de Stargardt: relato de caso Optical coherence tomography aspects of Stargardt's disease: case report

    Directory of Open Access Journals (Sweden)

    Enéias Bezerra Gouveia

    2006-08-01

    Full Text Available O termo fundus flavimaculatus (doença de Stargardt descreve um grupo de distrofias maculares hereditárias caracterizadas por múltiplos "flecks" amarelados em nível do epitélio pigmentar da retina. Os autores descrevem os achados de tomografia de coerência óptica (OCT em paciente portador de doença de Stargardt e sugerem que a OCT tem validade como exame subsidiário no estudo das características da retina de pacientes portadores da doença de Stargardt, embora estudos envolvendo maior número de pacientes sejam indicados para permitir traçar-se o perfil das alterações mais comuns nestes casos.The term fundus flavimaculatus (Stargardt disease describes a group of inherited macular dystrophies characterized by multiple yellow to yellow-white flecks at the level of the retinal pigment epithelium. The authors describe findings in the patient with Stargardt's disease using optical coherence tomography (OCT, and suggest the examination to be valid as subsidiary method in the study of the characteristics of the retina in Stargardt's disease patients, but studies involving a series of patients should be able to show the most frequent findings in these cases.

  7. ALTERAÇÕES FÍSICAS EM GRÃOS DE GIRASSOL APÓS SECAGEM COM DIFERENTES TEMPERATURAS DO AR

    Directory of Open Access Journals (Sweden)

    CORADI, Paulo Carteri

    2015-11-01

    Full Text Available The knowledge of the physical properties of the grains is important for optimizing of the post-harvest operations. This work aimed to evaluate the effects of convective drying with different air temperatures (45, 55, 65 and 75 °C the physical properties of sunflower grains. Drying of the sunflower grains was performed in convection oven with forced air. In natural conditions, samples of 5 kg of pellets were used for each repetition drying. During the drying process, the grain samples were weighed periodically until they reach 10% (w.b., and then were subjected to evaluations of physical properties. The drying air temperatures alter the physical properties of sunflower grains. The length, thickness and projected area, volume, thousand kernel weights to the angle of repose of the sunflower grains were reduced with increased drying air temperature. The porosity, apparent specific gravity, the weight of a thousand grains, the coefficient of drag, roundness, sphericity, and the width of sunflower grains did not change in function of the drying air temperature. O conhecimento das propriedades físicas dos grãos é importante para otimização das operações de pós-colheita. Este trabalho teve como objetivo avaliar os efeitos da secagem com diferentes temperaturas do ar (45, 55, 65 e 75 °C nas propriedades físicas de grãos de girassol. A secagem dos grãos foi realizada em estufa de convecção com ar forçado. Amostras de 5 kg de grãos foram utilizadas em cada repetição. Durante o processo de secagem, as amostras foram pesadas, periodicamente até atingirem 10% (b.u., em seguida foram submetidos às avaliações das propriedades físicas. As temperaturas do ar de secagem alteraram as propriedades físicas dos grãos de girassol. O comprimento, a espessura, a área projetada, o volume, o peso de mil grãos, o ângulo de repouso dos grãos de girassol foram reduzidos com o aumento da temperatura do ar de secagem. A porosidade, a massa espec

  8. Opacidades em vidro fosco nas doenças pulmonares difusas: correlação da tomografia computadorizada de alta resolução com a anatomopatologia Ground-glass opacity in diffuse lung diseases: high-resolution computed tomography-pathology correlation

    Directory of Open Access Journals (Sweden)

    Maria Lúcia de Oliveira Santos

    2003-12-01

    Full Text Available Opacidade em vidro fosco é achado freqüentemente visto na tomografia computadorizada de alta resolução do tórax e se traduz pelo aumento do coeficiente de atenuação dos pulmões, mas sem apagar as marcas broncovasculares. Por sua inespecificidade, a associação com outros achados radiológicos, clínicos e anatomopatológicos deve ser considerada para uma interpretação diagnóstica mais correta. Neste trabalho foram analisados 62 exames tomográficos de pacientes com doenças pulmonares difusas, de 14 etiologias diferentes, em que opacidades em vidro fosco foram o achado único ou predominante, e feita correlação anatomopatológica por meio de biópsias ou necropsias. Na pneumocistose as opacidades em vidro fosco corresponderam, histologicamente, à ocupação alveolar por material espumoso contendo parasitos; no carcinoma bronquíolo-alveolar, a espessamento dos septos alveolares e ocupação de sua luz por muco e células tumorais; na paracoccidioidomicose, a espessamento dos septos alveolares, áreas de fibrose e alvéolos contendo exsudato broncopneumônico; na sarcoidose, a fibrose ou a acúmulo de granulomas; na fibrose pulmonar idiopática, a espessamento dos septos alveolares por fibrose; na bronquiolite obliterante com pneumonia em organização, a pneumonia intersticial com áreas de organização intra-alveolar. A ocupação alveolar por sangue foi observada nos casos de leptospirose, hemossiderose idiopática, metástases de tumor renal e na aspergilose invasiva; por vacúolos de gordura na pneumonia lipídica; por material protéico e lipoprotéico na silicoproteinose e na proteinose alveolar; e por líquido de edema na insuficiência cardíaca congestiva.Ground-glass opacity is a finding frequently seen in high-resolution computed tomography examinations of the chest and is characterized by hazy increased attenuation of lung, however without blurring of bronchial and vascular margins. Due to its unspecificity

  9. Lesões traumáticas do parênquima pulmonar: aspectos na tomografia computadorizada Traumatic lung lesions: computed tomography findings

    Directory of Open Access Journals (Sweden)

    Alessandro Severo Alves de Melo

    2003-06-01

    Full Text Available As lesões pulmonares são achados freqüentes no trauma torácico, sendo cada vez mais diagnosticadas pela tomografia computadorizada, em especial pelo rápido tempo de aquisição decorrente da técnica helicoidal, que permite a avaliação de pacientes em estado grave, possibilitando a adoção de conduta terapêutica eficiente. Os autores estudaram 150 pacientes vítimas de trauma torácico submetidos a tomografia computadorizada, que apresentaram lesões pulmonares, representadas por contusões, atelectasias, lacerações e hematomas pulmonares. As contusões pulmonares se caracterizaram por consolidações e atenuação em vidro fosco, sendo as lesões pulmonares mais comuns. As atelectasias foram observadas com os padrões subsegmentar e compressiva, e foram a segunda lesão mais comum. As lacerações se apresentaram como consolidações com ar ou nível líquido no interior. Os hematomas pulmonares representaram a lesão pulmonar mais rara, presentes em apenas cinco casos, caracterizados por opacidades arredondadas. Neste trabalho o trauma torácico fechado predominou, com 120 casos, enquanto o trauma aberto ocorreu em 30 casos. As causas de trauma fechado, em ordem decrescente de freqüência, foram: colisão automobilística, atropelamento, queda de altura, acidente de motocicleta e espancamento. A forma penetrante de traumatismo torácico decorreu de duas causas de agressão: lesão por arma de fogo e lesão por arma branca.Traumatic lesions of the lung are common findings in patients with thoracic trauma. These lesions are increasingly diagnosed using computed tomography, mostly due to the fast acquisition time helical techniques that allow evaluation of critically ill patients and an efficient therapeutic management. The authors studied 150 patients with thoracic trauma submitted to computed tomography that demonstrated lung contusions, atelectasies, lacerations and hematomas. Lung contusions were the most frequent lesions

  10. Avaliação da tomografia de coerência óptica em pacientes portadores de degeneração macular relacionada à idade tratada com terapia fotodinâmica com verteporfina Ocular coherence tomography in age-related macular degeneration patients treated with photodynamic therapy with vertepofirin

    Directory of Open Access Journals (Sweden)

    Arnaldo Furman Bordon

    2008-12-01

    Full Text Available OBJETIVO: Identificar os achados na tomografia de coerência óptica (OCT e suas variações ao longo de 12 meses, em pacientes portadores de degeneração macular relacionada à idade (DRMI, submetidos à terapia fotodinâmica com verteporfina (TFD. DESENHO DO ESTUDO: Série de casos, aberto, não aleatório e intervencionista. MÉTODOS: Pacientes acima de 50 anos, portadores de DMRI neovascular foram submetidos ao exame oftalmológico completo, angiofluoresceinografia e OCT antes do início do tratamento (V0 e 3, 6, 9 e 12 meses após (V3, V6, V9 e V12, respectivamente. O tratamento empregado foi a TFD. A acuidade visual (AV foi mensurada usando-se a tabela do ETDRS. Realizaram-se as medições das espessuras foveais: espessura intraretiniana foveal (FIRT, espessura foveal do complexo coriocapilar - EPR (FCC-EPRT e espessura foveal total (TFT. Realizaram-se as mensurações das espessuras extrafoveais, em um raio de 1500 µ da fóvea: espessura intraretiniana extrafoveal (EFIRT, espessura extrafoveal do complexo coriocapilar - EPR (EFCC-EPRT e espessura extrafoveal total (TEFT. Análise estatística foi realizada usando-se a análise de variância em blocos. RESULTADOS: Vinte e três olhos de 23 pacientes foram avaliados. Foram identificados nove achados à OCT: 1º espessamento das camadas intraretinianas na fóvea; 2º espessamento das camadas intraretinianas na região extrafoveal; 3º espessamento do complexo coriocapilar-EPR (FCC-EPRT na fóvea; 4º espessamento do complexo coriocapilar-EPR na área extrafoveal; 5º presença de fluido sub-EPR; 6º presença de fluido sub-retiniano; 7º presença de fluido intraretiniano; 8º presença da membrana hialóide posterior aderida à retina; 9º presença da depressão foveal. Na visita inicial a FIRT e a TFT foram respectivamente 398,5 µ e 639,2 µ. Em V12 foram 173,7 µ e 423,9 µ. A variação foi estatisticamente significante (p = 0,008 e p = 0,003, respectivamente. As outras espessuras

  11. Controle de fungos presentes no ar e em sementes de feijão durante armazenamento Control of fungi present in the air and bean seeds during storage

    OpenAIRE

    Flávio M. Borém; Osvaldo Resende; José da C Machado; Isa M. R. Fontenelle; Frederico F. de Sousa

    2006-01-01

    Objetivou-se, no presente trabalho, avaliar a eficácia de um equipamento redutor de inóculo (ERI) na preservação da qualidade sanitária de sementes de feijão (Phaseolus vulgaris L.) durante o armazenamento em estruturas herméticas com circulação de ar forçado. A presença de inóculo no ar foi monitorada a partir da exposição de placas de Petri com meio de cultura BDA salino, contando-se o número de unidades formadoras de colônias (UFC) dos fungos Aspergillus spp. e Penicillium spp. As análises...

  12. A tomografia computadorizada de alta resolução na avaliação da toxicidade pulmonar por amiodarona High-resolution computed tomography of amiodarone pulmonary toxicity

    OpenAIRE

    Daniela Peixoto Consídera; Edson Marchiori; Arthur Soares Souza Jr.; Gláucia Zanetti; Dante L. Escuissato; Emerson L. Gasparetto; César de Araújo Neto; Ronaldo de Souza Leão Lima; Sérgio Salles Xavier; Roberto Coury Pedrosa

    2006-01-01

    OBJETIVO: Avaliar as principais alterações identificadas na tomografia computadorizada de alta resolução do tórax em pacientes com toxicidade pulmonar pela amiodarona. MATERIAIS E MÉTODOS: Foram avaliadas dez tomografias computadorizadas de alta resolução de tórax de pacientes com pneumonite pela amiodarona, seis desses pacientes do sexo masculino e quatro do sexo feminino, com idade média de 73,5 anos. RESULTADOS: Os achados tomográficos mais relevantes foram opacidades lineares ou reticular...

  13. Modelagem matemática do crescimento de fungos filamentosos sobre superfícies úmidas e nutritivas em contato com o ar

    OpenAIRE

    Coradin, Juliana Hey

    2010-01-01

    Resumo: O crescimento de fungos filamentosos sobre superfícies úmidas e nutritivas em contato com o ar é um fenômeno importante em processos de grande destaque, como na fermentação no estado sólido (FES) e na decomposição da matéria orgânica. Ele ocorre por meio do aumento de biomassa através de estruturas fúngicas individuais que se assemelham a “tubos” microscópicos, conhecidas como hifas. Dentro delas ocorre um conjunto de fenômenos físicos e biológicos que já estão bem caracterizados iso...

  14. Tomografia por emissão de pósitrons (PET) no tórax: resultados preliminares de uma experiência brasileira

    OpenAIRE

    TERRA FILHO MÁRIO; BOMBARDA SIDNEY; SOARES JÚNIOR JOSÉ; MENEGHETTI JOSÉ CLÁUDIO

    2000-01-01

    Novos métodos não invasivos estão sendo desenvolvidos para a detecção de neoplasias malignas pulmonares. Dentre estes destaca-se a tomografia por emissão de pósitrons (PET), que utiliza como radiotraçador a deoxi-2-D glicose marcada com fluor-18 (FDG). Objetivo: Avaliar os resultados do FDG-PET, realizado em câmara híbrida com circuito de coincidência em pacientes portadores de doenças pleuropulmonares infecciosas ou tumorais. Material e Métodos: Foram avaliados 15 pacientes divididos em: gru...

  15. Malária pulmonar: aspectos na tomografia computadorizada de alta resolução - relato de caso

    Directory of Open Access Journals (Sweden)

    Rodrigues Rosana

    2004-01-01

    Full Text Available Neste trabalho é relatado o caso de paciente do sexo masculino, de 38 anos de idade, que desenvolveu quadro de malária com comprometimento pulmonar. A tomografia computadorizada de alta resolução evidenciou espessamento de septos interlobulares e de bainhas peribroncovasculares, com áreas esparsas de atenuação em vidro fosco e de consolidações, além de derrame pleural bilateral, aspectos compatíveis com edema pulmonar. O paciente recebeu tratamento específico, evoluindo bem e tendo alta 11 dias após a internação.

  16. Malária pulmonar: aspectos na tomografia computadorizada de alta resolução - relato de caso

    OpenAIRE

    Rodrigues Rosana; Marchiori Edson; Souza Daniel Andrade Tinoco de

    2004-01-01

    Neste trabalho é relatado o caso de paciente do sexo masculino, de 38 anos de idade, que desenvolveu quadro de malária com comprometimento pulmonar. A tomografia computadorizada de alta resolução evidenciou espessamento de septos interlobulares e de bainhas peribroncovasculares, com áreas esparsas de atenuação em vidro fosco e de consolidações, além de derrame pleural bilateral, aspectos compatíveis com edema pulmonar. O paciente recebeu tratamento específico, evoluindo bem e tendo alta 11 di...

  17. CARCINOMA BRONQUÍOLO-ALVEOLAR: ASPECTOS NA TOMOGRAFIA COMPUTADORIZADA DE ALTA RESOLUÇÃO

    Directory of Open Access Journals (Sweden)

    Moreira Luiza Beatriz Melo

    2002-01-01

    Full Text Available O carcinoma bronquíolo-alveolar é um tipo de carcinoma broncogênico de crescimento insidioso, que surge nas paredes das vias aéreas distais e se dissemina utilizando o septo alveolar como um estroma, preservando a arquitetura pulmonar. Neste trabalho foram analisadas as tomografias computadorizadas de alta resolução de 17 pacientes com carcinoma bronquíolo-alveolar. Ao contrário do relatado na literatura, foram observados predomínio no sexo masculino (71% e maior freqüência da associação das formas de consolidação e multinodular (53% em relação à forma nodular solitária (12%, multinodular (12% e de consolidação (23%. Os aspectos mais encontrados foram: áreas de consolidação (76%, broncograma aéreo (71%, áreas de baixa atenuação provavelmente devidas à presença de muco (60%, espessamento de septos interlobulares, opacidades em vidro fosco e nódulos confluentes (54% cada, e pavimentação em mosaico (36%. Os nódulos cavitados, a atelectasia, o sinal do halo e o aspecto de "árvore em brotamento" foram observados em apenas um caso cada.

  18. Práticas cirúrgicas baseadas em evidências: tomografia computadorizada helicoidal no diagnóstico da apendicite aguda Evidence-based surgical practices: helical computed tomography in acute appendicitis diagnosis

    Directory of Open Access Journals (Sweden)

    Carlos Alberto Guimarães

    2008-08-01

    Full Text Available Os cirurgiões são instados a não somente ler os artigos dos periódicos, mas também a compreendê-los e analisá-los criticamente quanto à validade. Eles cuidam melhor dos seus pacientes se são capazes de analisar criticamente a literatura e aplicar os resultados a sua prática. Este é o segundo artigo de uma série - Práticas Cirúrgicas Baseadas em Evidência - que tem por objetivo apresentar a avaliação crítica de um teste diagnóstico.Surgeons are told that they need not only read journal articles, but also understand them and make a critical appraisal of their validity. They offer better care if they are able to appraise critically the original literature and apply the results to their practice. This is the second article of a series - Evidence-Based Surgical Practices - which focus on critical appraisal of a diagnostic test.

  19. Ars disyecta Ars disyecta

    Directory of Open Access Journals (Sweden)

    Alejandra Castillo

    2012-07-01

    Full Text Available Bajo la nominación Ars Disyecta se busca exponer el vínculo entre artes visuales, feminismo y metamorfosis. Las prácticas artísticas feministas aquí presentadas se proponen perturbar el espacio metafórico heredado de la diferencia sexual (pensemos, por ejemplo, en las palabras engendramiento, matriz, vida, compenetración o invaginamiento. En este sentido, la nominación Ars disyecta pone en escena un conjunto de prácticas e intervenciones que intentan interrumpir la matriz de la diferencia, desestabilizando lo femenino desde aquellas figuras que se resisten a la lógica de la totalidad y de un tiempo propio. Buscando seguir la huella de un arte disyecto es que interrogaré en este ensayo aquellas autorías feministas que en el arte contemporáneo trafican con las huellas del contagio, la mutación y la alteridad.This article aims to present the relation between visual arts, feminism I and metamorphosis. The feminist artistic practices portrayed in this article attempt to question categories inherited from the metaphor of sexual difference such as engendering, matrix and life. From this perspective, Ars disyecta will establish a set of artistic practices and interventions that intend to interrupt the proper idea of «feminine difference». Following this line of argument, I will discuss in this article a few contemporary feminist works of art that could be defined by words such as contagious, mutation and otherness.

  20. Quantificação em escala de bancada do volume de ar em ligações prediais de água Measuring air volume in household pipes by means of a pilot scale study

    Directory of Open Access Journals (Sweden)

    Ney Procópio Lopes

    2011-12-01

    Full Text Available A presente pesquisa em escala piloto, simulando trecho de uma rede interligada a um ramal predial, visou quantificar o volume de ar aferido pelos hidrômetros residenciais. Para tal fim, testaram-se ventosas, bloqueadores de ar e válvulas eliminadoras de ar. Sob condições normais de operação da rede, o volume de ar medido pelos hidrômetros é comparável ao encontrado na água natural, não justificando a instalação de equipamento de eliminação de ar de qualquer natureza. Todavia, logo após esvaziamento da rede interligada ao ramal, a sobremedição pode atingir até 21% em condições de pressão máxima na rede de distribuição (500 kPa. Por fim, verificou-se que a menor vazão afluente associa-se ao maior volume de ar aferido pelo hidrômetro. Dessa forma, é possível supor que os consumidores situados na menor faixa de consumo sejam os mais prejudicados pela situação de desabastecimento.The purpose of the present work is to evaluate the volume of air measured in domestic water supply pipe connections. Tests were performed to evaluate the efficiency and applicability of air reducing valves in domestic water supply connections. The results obtained under regular water supply conditions showed that the volume of air in the water measured by the hydrometers is comparable to the one found in natural waters. On the other hand, other tests, right after emptying the network connected to the domestic water supply pipe, revealed that the volume of water which gets to the gauged reservoir comprehends up to 21% of the total air-water volume recorded by the hydrometer for the experiments performed under pressure of 500 kPa.

  1. Complicações pulmonares após uso de crack: achados na tomografia computadorizada de alta resolução do tórax Pulmonary complications of crack cocaine use: high-resolution computed tomography of the chest

    OpenAIRE

    Alexandre Mançano; Edson Marchiori; Gláucia Zanetti; Dante Luiz Escuissato; Beatriz Cunha Duarte; Lourenço de Araujo Apolinário

    2008-01-01

    Relatamos os achados na tomografia computadorizada de alta resolução de um paciente que, após uso de cocaína fumada (crack), desenvolveu quadro de hemoptise, dispnéia e dor torácica súbitas. As radiografias de tórax mostravam consolidações predominando em lobos superiores. A tomografia de alta resolução evidenciava opacidades em vidro fosco, consolidações e nódulos do espaço aéreo. Nova tomografia de controle, após suspensão da droga e uso de corticóides, mostrou regressão parcial das lesões ...

  2. Adaptabilidade e estabilidade fenotípica de cultivares de café arábica em Minas Gerais

    OpenAIRE

    Cesar Elias Botelho; Juliana Costa de Rezende; Gladyston Rodrigues de Carvalho; Alex Mendonça de Carvalho; Vinicius Teixeira Andrade; Cintia Reis Barbosa

    2010-01-01

    O objetivo deste trabalho foi avaliar a adaptabilidade e a estabilidade fenotípicas para a produtividade de cultivares de cafeeiro do grupo Catuaí, pela metododologia de Annicchiarico. Foram instalados e conduzidos experimentos em Três Pontas, Campos Altos e Capelinha, em Minas Gerais. O delineamento foi o de blocos ao acaso, com quatro repetições e seis plantas por parcela. Os tratamentos foram constituídos por 15 cultivares do grupo Catuaí e cinco testemunhas. As avaliações da produtividade...

  3. Uso da poeira e do ar como indicadores de contaminação ambiental em áreas circunvizinhas a uma fonte de emissão estacionária de chumbo

    Directory of Open Access Journals (Sweden)

    Quiterio Simone Lorena

    2001-01-01

    Full Text Available Neste trabalho, determinou-se o nível de chumbo (Pb presente no ar em ambientes externos e na poeira doméstica de residências localizadas próximo a uma reformadora de baterias (RB. Uma das principais fontes de exposição ao Pb são empresas do setor de RB, que ainda utilizam processos e tecnologia obsoletos em instalações precárias. Na área externa à RB foram realizadas coletas em seis pontos localizados a aproximadamente 25m e a 500m da RB. Os resultados obtidos mostram que o limite para Pb no ar atmosférico (Pb-Ar de 1,5µg Pb.m-3 foi excedido em 50% das amostras coletadas, variando de 0,03 a 183,3µg Pb.m-3. As coletas nas dependências internas e externas das residências foram realizadas em seis pontos de quatorze residências localizadas a aproximadamente 25m, 50m e a 500m da RB. O limite de Pb na poeira doméstica (Pb-Pd de 1.500µg Pb.m-2 foi excedido em 44% das amostras coletadas, apresentando valores variáveis de 2,2 a 54.338,9µg Pb.m-2.

  4. Anatomic considerations for C2 pedicle screw placement: the use of computerized tomography measurements Consideraciones anatómicas de la cocalización de los tornillos pediculares en C2: uitlización de las medidas de la tomografia computadorizada Considerações anatômicas sobre a localização dos parafusos pediculares em C2: utilização das medidas da tomografia computadorizada

    Directory of Open Access Journals (Sweden)

    Adebukoa Onibokun

    2009-03-01

    eje del pedículo y el ángulo transverso del pedículo (ángulo entre el eje del pedículo y la línea media del cuerpo vertebral. RESULTADOS: el valor promedio del ancho pedicular fue de 5.8 1.2mm. En el sexo masculino el valor promedio del ancho del pedículo (6.0 1.3mm fue mayor comparado con el sexo femenino (5.6 1.1mm, sin embargo no fue observada una diferencia estadística. El valor promedio del ángulo transverso del pedículo fue de 43.9 3.9 grados, siendo de 43.2 3.8 grados en el sexo masculino y 44.7 3.7 grados en el sexo femenino. CONCLUSIÓN: la proyección y determinación en el periodo preoperatorio de las dimensiones anatómicas del pedículo C2 son importantes para la determinación de la trayectoria y dimensiones del local donde el implante será colocado.OBJETIVO: o conhecimento detalhado das características anatômicas do pedículo de C2 é necessário para minimizar os riscos relacionados com a colocação dos parafusos. O objetivo deste trabalho é avaliar as medidas lineares e angulares do eixo axial verdadeiro do pedículo de C2 utilizando tomografia computadorizada. MÉTODOS: foram utilizadas tomografias computadorizadas axiais de 93 pacientes (47 do sexo masculino e 46 do sexo feminino com média de idade de 48 anos. As imagens axiais do pedículo de C2 foram selecionadas para o estudo e os parâmetros estudados foram: largura do pedículo (diâmetro mediolateral do istmo do pedículo perpendicular ao eixo do pedículo e o ângulo tranverso do pedículo (ângulo entre o eixo do pedículo e a linha média do corpo vertebral. RESULTADOS: o valor médio da largura do pedículo foi 5,81,2mm. Nos pacientes de sexo masculino o valor médio da largura do pedículo (6,01,3mm foi maior que nos pacientes de sexo feminino (5,61,1mm. No entanto, não foi observada diferença estatística. O valor médio do ângulo transverso do pedículo foi de 43,93,9 graus, sendo de 43,23,8 graus no sexo masculino e 44,73,7 graus no sexo feminino. CONCLUSÃO: o

  5. El ensayo <em>Ars Medicaem> de John Locke, y la influencia de sus ideas médicas sobre la filosofía empirista

    OpenAIRE

    Sánchez González, Miguel Ángel

    2014-01-01

    John Locke’s essay Ars medica of 1669, is presented, analyzed and translated into Spanish. This essay shows the medical problems that prompted Locke´s philosophy and provides essential clues to understanding the motives, aims and characteristics of the empiricist`s theory of knowledge. Ideas originated in medicine that profoundly influenced subsequent Locke`s works were: 1) Trust in the perfectibility of science and elucidation of the role that philosophical thinking could play. 2) Rejection ...

  6. Tomografia por emissão de pósitrons com FDG-18F na avaliação de pacientes com artrite reumatoide – revisão sistemática

    Directory of Open Access Journals (Sweden)

    Dalton Alexandre dos Anjos

    2014-12-01

    Full Text Available Introdução A artrite reumatoide (AR é uma doença caracterizada pela inflamação da membrana sinovial. Diversos autores têm investigado o papel da tomografia por emissão de pósitrons (PET com flúor-18 (FDG-18F na AR. Objetivos Revisão sistemática da literatura atual sobre o papel do PET com FDG-18F no diagnóstico, determinação da atividade da doença e avaliação da resposta ao tratamento em pacientes com AR. Métodos Foram realizadas buscas nas bases de dados Medline, Biblioteca Cochrane, Lilacs, Pubmed e Scopus nos idiomas português, inglês e espanhol, utilizando as palavras-chave «artrite reumatoide», «sinovite», «FDG», «PET», «metabolismo glicolítico» e «atividade da doença». Resultados 142 artigos foram inicialmente identificados, dos quais apenas 40 relacionavam-se diretamente ao tema. Foram selecionados 12 artigos originais e três relatos de caso que preenchiam os critérios de inclusão. Discussão A presença de fibroblastos e macrófagos ativados no pannus é responsável pela intensa captação periarticular de FDG-18F. Os padrões de captação não permitem o diagnóstico diferencial com outras artrites. A intensidade de captação e o número de articulações envolvidas são parâmetros metabólicos de atividade da doença que apresentam boa correlação com os índices compostos. Estudos longitudinais de PET têm se mostrado úteis na avaliação da resposta ao tratamento com anti-TNF. Quando realizado precocemente, PET pode predizer a resposta terapêutica. Conclusão Embora o real papel dessa nova técnica na investigação da AR ainda não esteja estabelecido, PET com FDG-18F é uma ferramenta promissora na determinação da atividade e na predição de resposta ao tratamento de pacientes com AR.

  7. Adjuvantes e assistência de ar em pulverizador de barras sobre a deposição da calda e controle de Phakopsora pachyrhizi (Sydow & Sydow

    Directory of Open Access Journals (Sweden)

    Hélio Oliveira Aguiar Júnior

    2011-09-01

    Full Text Available Com o intuito de melhorar a cobertura da pulverização e diminuir as perdas na produtividade da cultura da soja, o estudo objetivou avaliar o efeito da adição de adjuvantes à calda combinado ou não ao uso da assistência de ar sobre a deposição da pulverização, controle de Phakopsora pachyrhizi H. Sydow & P. Sydow, perdas de produção (peso de 1000 grãos e produtividade da cultura (kg ha-1. Dois experimentos a campo foram conduzidos na cultura da soja, variedade Conquista, safra agrícola 2008/09. Um deles no delineamento em blocos ao acaso com três doses de adjuvantes associados a um marcador cúprico combinadas a dois níveis de ar na barra de pulverização (0 e 29 km h-1, totalizando 6 tratamentos e 4 repetições. Outro experimento foi instalado no mesmo local do anterior. O delineamento experimental utilizado foi o de blocos ao acaso com 7 tratamentos: fungicida e dois adjuvantes associados ao fungicida, combinados a dois níveis de ar na barra de pulverização (0 e 29 km h-1, mais testemunha, e 4 repetições. Após a pulverização do fungicida piraclostrobina + epoxiconazole com diferentes tecnologias, procedeu-se a avaliação da severidade da doença através da estimativa da área abaixo da curva de progresso da doença (AACPD e da produtividade da cultura da soja. A assistência de ar na velocidade máxima gerada pelo ventilador (29 km h-1, combinada ao fungicida piraclostrobina + epoxiconazole mais o adjuvante organosiliconado Silwet L-77 contribuiu para melhor controle da ferrugem asiática, proporcionando incremento na produtividade e no peso de 1000 grãos.

  8. Controle de fungos presentes no ar e em sementes de feijão durante armazenamento Control of fungi present in the air and bean seeds during storage

    Directory of Open Access Journals (Sweden)

    Flávio M. Borém

    2006-09-01

    Full Text Available Objetivou-se, no presente trabalho, avaliar a eficácia de um equipamento redutor de inóculo (ERI na preservação da qualidade sanitária de sementes de feijão (Phaseolus vulgaris L. durante o armazenamento em estruturas herméticas com circulação de ar forçado. A presença de inóculo no ar foi monitorada a partir da exposição de placas de Petri com meio de cultura BDA salino, contando-se o número de unidades formadoras de colônias (UFC dos fungos Aspergillus spp. e Penicillium spp. As análises sanitárias das sementes foram realizada pelo método do papel de filtro (Blotter test, calculando-se o índice de ocorrência de Aspergillus spp. e Penicillium spp. Durante o período de armazenamento, houve um aumento na incidência de fungos nas sementes, independente da presença dos ERI. Nas amostragens realizadas na entrada da caixa com a presença dos ERI, não foram encontradas unidades formadoras de colônias. Com o aumento do fluxo de ar utilizado no sistema, notou-se que este efeito foi transferido para a saída da caixa. Nas condições especificadas, os ERI foram incapazes de controlar os fungos de armazenamento, Aspergillus spp e Penicillium spp, nas sementes de feijão, porém foram eficazes no controle dos seus esporos presentes no ar.The objective of the present work was to evaluate the efficiency of inoculum reducing equipment (IRE in the maintenance of quality of bean seeds during storage in hermetic structures with circulation of forced air. The inoculum's presence in the air was monitored by the exposition of Petri dishes with culture medium (saline BDA by counting the number of colonies units of Aspergillus and Penicillium. The quality analysis of seeds were performed by the blotter test. The occurrence index was calculated for Aspergillus spp and Penicillium spp. The fungal occurrence increased during the storage period, in spite of the IRE presence. Fungal colonies were not found in the air samples collected at the box

  9. Qualidade do ar em ambientes internos hospitalares: estudo de caso e análise crítica dos padrões atuais Indoor air quality in hospitals: a case study and a critical review of current standards

    OpenAIRE

    Marina Eller Quadros; Henrique de Melo Lisboa; Vetúria Lopes de Oliveira; Waldir Nagel Schirmer

    2009-01-01

    O objetivo deste trabalho foi avaliar a qualidade do ar em três categorias de ambientes hospitalares: unidade de terapia intensiva (UTI) adulto, UTI neonatal (UTN) e centro cirúrgico de um hospital em Florianópolis, Brasil. Avaliaram-se a concentração de dióxido de carbono, a vazão e renovação de ar nas salas do centro cirúrgico. A concentração de bioaerossóis foi estimada em um dia de avaliação para cada ambiente. Não se observou relação entre a concentração de bioaerossóis e o tempo de uso ...

  10. Diagnóstico auxiliado por computador na detecção de nódulos pulmonares pela tomografia computadorizada com múltiplos detectores: estudo preliminar de 24 casos Detection of pulmonary nodules by computer-aided diagnosis in multidetector computed tomography: preliminary study of 24 cases

    OpenAIRE

    Julia Capobianco; Dany Jasinowodolinski; Gilberto Szarf

    2008-01-01

    OBJETIVOS: Avaliar o desempenho de um programa para auxílio na detecção de nódulos pulmonares em tomografia computadorizada com múltiplos detectores (TCMD). MÉTODOS: Foram avaliadas 24 tomografias computadorizadas de tórax consecutivas realizadas no Centro de Medicina Diagnóstica Fleury no período de 07/10/2006 a 19/10/2006 usando um tomógrafo helicoidal multidetectores de 64 canais. O estudo compreendeu 12 pacientes do sexo feminino e 12 do sexo masculino, com idades variando entre 35 e 77 a...

  11. Distribuição vertical e horizontal de temperaturas do ar em ambientes protegidos Vertical and horizontal distribution of air temperature in a plastic greenhouse

    Directory of Open Access Journals (Sweden)

    Raquel A. Furlan

    2002-04-01

    Full Text Available Este trabalho foi realizado na área experimental do Departamento de Engenharia Rural da Escola Superior de Agricultura "Luiz de Queiroz", Piracicaba, SP, Brasil, em dois ambientes protegidos construídos no sentido leste-oeste, com área total de 112 m² e coberto com plástico (150 micra, tratado contra raios ultravioleta. Para caracterizar a distribuição espacial da temperatura do ar no ambiente protegido, instalaram-se termopares (cobre-constantã formando malhas, com espaçamento horizontal entre eles de 3,0 m e nas alturas de 0,5, 1,0, 2,0, 3,0 e 4,0 m em relação ao solo. Os dados foram armazenados a cada 15 min por sistemas automáticos de aquisição de dados nos ambientes protegidos. O sistema de nebulização constituiu-se de duas linhas com 70 bocais totais, instalados a uma altura de 3,0 m, utilizando-se uma pressão de trabalho de 200 kPa. A nebulização não afetou o gradiente vertical de temperatura, que manteve a tendência de aumento de temperatura com a altura, em relação ao nível do solo, enquanto o efeito na redução de temperatura pelo sistema de nebulização somente foi eficaz durante a realização da mesma. Para a representação da distribuição espacial de temperatura do ar no ambiente protegido nos diferentes níveis de altura, construiu-se superfícies isotérmicas a partir dos resultados. Verifica-se que a nebulização apresentou maior efeito na homogeneização da distribuição de temperatura no ambiente protegido no nível referente a 2,0 m de altura, em relação ao solo.This work was conducted in the experimental area of the Department of Rural Engineering of "Escola Superior de Agricultura Luiz de Queiroz", University of São Paulo, Piracicaba, São Paulo, Brazil. Two greenhouses were installed in the east-west direction, with 6.4 m of width, 17.5 m of length and 3.0 m high, with total area of 112 m²; covered by plastic of 150 micra thickness, treated against ultra violet rays. To characterize the

  12. Macronutrientes em folhas e frutos de cultivares de café arábica de porte baixo Macronutrients in leaves and fruits of dwarf arabica coffee cultivars

    Directory of Open Access Journals (Sweden)

    Valdemar Valarini

    2005-01-01

    Full Text Available O presente trabalho teve como objetivo avaliar a mobilização de macronutrientes de folhas para frutos em diferentes cultivares de café arábica, através de análises foliares periódicas. O experimento foi plantado em 1994 em solo Rhodic Hapludox, em Campinas Estado de São Paulo, Brasil. Foram coletadas folhas de ramos plagiotrópicos com frutos, o terceiro par a partir do ápice, para determinação de macronutrientes, em dezembro de 2002, fevereiro e maio de 2003. A colheita do experimento e a amostragem de frutos para análise química ocorreram em junho de 2003. Houve decréscimo no teor dos macronutrientes nas folhas do cafeeiro, durante a estação de crescimento do fruto, a exceção do cálcio que apresentou aumento, observando-se maior evidencia para o potássio. As cultivares de alta produtividade mostraram concentrações de macronutrientes ligeiramente superiores às de média produtividade. A diferença mais marcante ocorreu para o cálcio que acumulou mais nas ccultivares mais produtivas. Na casca e no grão de café, pela análise estatística, não houve diferença significativa na composição química entre as cultivares, à exceção para o cálcio presente na casca. Verificou-se uma relação inversa entre produtividade e o índice relativo de remobilização de nutrientes das folhas. Cultivares mais produtivas conseguiram produzir a mesma quantidade de matéria seca de grãos com valores mais baixos de remobilização dos nutrientes N, P e K das folhas dos cafeeiro.Macronutrient mobilization from leaves to fruits in dwarf arabica coffee cultivars was studied, through serial leaf and fruit samplings. The experiment was set in 1994 in a Rhodic Hapludox soil at Campinas, State of São Paulo, Brazil. Third leaf from the apex of reproductive branches with fruits was collected for macronutrient determinations in December 2002, February and May 2003. Ripe fruits were sun drayed being grain and husks milled separately for

  13. Teor de arsênio e adsorção competitiva arsênio/fosfato e arsênio/sulfato em solos de Minas Gerais, Brasil Arsenate content, and arsenate/phosphate and arsenate/sulphate competitive adsorption in soils from Minas Gerais, Brazil

    Directory of Open Access Journals (Sweden)

    Mari Lucia Campos

    2013-06-01

    Full Text Available A alta toxicidade de As para homens e animais gera a necessidade de estudos do comportamento químico do arsenato nos solos que possam auxiliar na mitigação de áreas contaminadas com arsênio. Este trabalho teve por objetivo avaliar o teor total e a adsorção de As na ausência e presença dos ânions fosfato e sulfato em seis diferentes classes de solos do estado de Minas Gerais, Brasil. Os solos alvo deste estudo são: o Neossolo Flúvico (RU, Gleissolo Háplico (GX, Gleissolo Melânico (GM, Latossolo Vermelho Distrófico (LVd, coletados em Lavras; Neossolo Quartzarênico (RQ, coletado em Itutinga e o Latossolo Amarelo Distrófico (LAd, coletado em Rosário, no estado de Minas Gerais. As amostras de solo foram secas, moídas e peneiradas em peneira de 2,0mm para execução do teste de adsorção e peneiradas em peneira plástica com malha de 1,5mm para determinação do teor de As, o qual foi determinado pelo método 3051A. A adsorção de As foi avaliada na dose de1500µmol L-1 de As, 1500µmol L-1 de As + 1500µmol L-1 de P e 1500µmol L-1 de As + 750µmolL-1 de S, em relação solo:solução final de 1:100, a pH 5,5 e força iônica de 15mmol L-1. Os seis solos apresentaram teor médio de As entre 0,14 e 9,3mgkg-1. A porcentagem adsorvida de arsênio na ausência dos outros ânions seguiu a sequência GM>LVd=RU=LAd=GX=RQ. A adição de fosfato e sulfato reduziu a porcentagem de arsênio adsorvido e, por consequência, houve um aumentou na concentração de arsênio disponível na solução do solo.The high toxicity of arsenic to humans and animals creates the need to study the chemical behavior of arsenate in soils that can help in the mitigation of areas contaminated with arsenic. This work aimed to evaluate the total content and adsorption in the absence and presence of phosphate and sulfate anions in six different soil classes in the state of Minas Gerais, Brazil. Soils aim of this study are: Fluvic Neosol (RU, Haplic Gleysol (GX

  14. Tomografia por emissão de pósitrons (PET) no tórax: resultados preliminares de uma experiência brasileira Thoracic positron emission tomography: preliminary results of a Brazilian experiment

    OpenAIRE

    MÁRIO TERRA FILHO; SIDNEY BOMBARDA; JOSÉ SOARES JÚNIOR; JOSÉ CLÁUDIO MENEGHETTI

    2000-01-01

    Novos métodos não invasivos estão sendo desenvolvidos para a detecção de neoplasias malignas pulmonares. Dentre estes destaca-se a tomografia por emissão de pósitrons (PET), que utiliza como radiotraçador a deoxi-2-D glicose marcada com fluor-18 (FDG). Objetivo: Avaliar os resultados do FDG-PET, realizado em câmara híbrida com circuito de coincidência em pacientes portadores de doenças pleuropulmonares infecciosas ou tumorais. Material e Métodos: Foram avaliados 15 pacientes divididos em: gru...

  15. Densidade de um planossolo sob sistemas de cultivo avaliada por meio da tomografia computadorizada de raios gama Bulk density of an alfisol under cultivation systems in a long-term experiment evaluated with gamma ray computed tomography

    OpenAIRE

    Adilson Luís Bamberg; Eloy Antonio Pauletto; Algenor da Silva Gomes; Luís Carlos Timm; Luiz Fernando Spinelli Pinto; Ana Cláudia Rodrigues de Lima; Thiago Rech da Silva

    2009-01-01

    A sustentabilidade do arroz (Oryza sativa L.) irrigado em solos de várzea está alicerçada na utilização da rotação e sucessão de culturas, fundamentais para o controle do arroz-vermelho e preto. Os reflexos sobre os atributos dos solos de várzea merecem estudos em especial sobre a compactação do solo. O objetivo deste trabalho foi identificar camadas compactadas em Planossolo submetido a diferentes sistemas de cultivo e preparo, avaliando-se a densidade do solo (Ds) pela Tomografia Computador...

  16. Deposição e perdas da calda em feijoeiro em aplicação com assistência de ar na barra pulverizadora Spray deposition and spray loss using air-assistance boom on bean plants

    Directory of Open Access Journals (Sweden)

    Carlos Gilberto Raetano

    2004-01-01

    Full Text Available Com o objetivo de avaliar a influência da assistência de ar na deposição da calda de pulverização, em plantas de feijoeiro (Phaseolus vulgaris aos 26 dias após a emergência (DAE, com pontas de pulverização de jato cônico vazio (JA-0,5 e JA-1 e jato plano (AXI-110015, e volumes de calda, foi realizado um experimento em delineamento inteiramente casualizado, utilizando como traçador o íon cobre. Alvos coletores (papel de filtro com 3 x 3 cm foram afixados nas superfícies adaxial e abaxial de folíolos posicionados nas partes superior e inferior das plantas. Para aplicar a solução traçadora, utilizou-se pulverizador com barras de 14 metros, com e sem assistência de ar, volumes de 60 e 100 L.ha-1, e velocidade do ar correspondente a 50% da rotação máxima do ventilador. Após a aplicação, os coletores foram lavados individualmente em solução extratora de ácido nítrico a 1,0 mol.L-1, e a quantificação dos depósitos através de espectrofotometria. A assistência de ar não influenciou na deposição da calda tanto a 60 quanto a 100 L.ha-1. O maior volume proporcionou maiores depósitos, sendo constatadas elevadas perdas para o solo (mais de 60%.Aiming to evaluate the effect of air-assistance in spray deposition on bean plants (Phaseolus vulgaris with hollow nozzles (JA-0,5 and JA-1 and flat fan nozzle type (AXI-110015, and volume rates by air-assisted and non-assisted sprayers, a completely randomized experiment was carried out using copper ion as a tracer to the evaluation of the deposits. At 26 days after emergence, artificial targets were positioned on the upper and under-side of the leaflets, on the top and bottom parts of the same plants under spray boom. For the application of tracer solution it was used a fourteen meter boom sprayer with and without air-assistance at 60 and 100 L.ha-1 of volume rates. The air flow was 50% of the maximum fan rotation. After application, targets were individually washed with an

  17. Avaliação da concentração de monóxido de carbono no ar exalado em tabagistas com DPOC Evaluation of the exhaled carbon monoxide levels in smokers with COPD

    OpenAIRE

    Gustavo Chatkin; José Miguel Chatkin; Gabriel Aued; Guilherme Oliveira Petersen; Edna Thais Jeremias; Flávia Valladão Thiesen

    2010-01-01

    OBJETIVO: Medir os níveis de monóxido de carbono no ar exalado (COex) em tabagistas com e sem DPOC. MÉTODOS: Tabagistas frequentadores dos ambulatórios do Hospital São Lucas em Porto Alegre (RS) entre setembro de 2007 e março de 2009 foram convidados a participar do estudo. Os participantes responderam a um questionário com características demográficas e epidemiológicas e realizaram espirometria, medição de cotinina urinária e de COex. Os participantes foram agrupados conforme a presença de D...

  18. Avaliação da artéria etmoidal anterior pela tomografia computadorizada no plano coronal Anterior ethmoidal artery evaluation on coronal CT scans

    OpenAIRE

    Soraia Ale Souza; Marcia Maria Ale de Souza; Luís Carlos Gregório; Sergio Ajzen

    2009-01-01

    O conhecimento da localização da artéria etmoidal anterior (AEA) constitui etapa importante na cirurgia do recesso do seio frontal e do etmóide anterior. A tomografia computadorizada (TC), em especial no plano coronal pode fornecer reparos anatômicos que identificam o trajeto da AEA. OBJETIVO: Identificar os reparos anatômicos que caracterizam o trajeto da AEA na parede medial da órbita e na parede lateral da fossa olfatória. Verificar a correlação entre a presença de pneumatização supra-orbi...

  19. Avaliação do ambiente solo-semente por meio da tomografia computadorizada Evaluation of the soil-seed environment through computerized tomography

    OpenAIRE

    Alcir José Modolo; Haroldo Carlos Fernandes; João de Mendonça Naime; Carlos Ernesto G.R. Schaefer; Nerilson Terra Santos; João Cleber Modernel da Silveira

    2008-01-01

    O condicionamento físico do solo ao redor das sementes reveste-se de grande importância para o bom desenvolvimento inicial da cultura, assegurando uma população sadia de plantas. O adequado contato solo-semente é um pré-requisito para a rápida emergência e o bom estabelecimento da cultura. Neste trabalho, objetivou-se utilizar a tomografia computadorizada de resolução milimétrica para determinação do ambiente solo-semente em sistema de plantio direto, logo após o plantio da cultura da soja. U...

  20. Hemorragia intraparenquimatosa encefálica espontânea: achados à tomografia computadorizada Spontaneous intraparenchymatous hemorrhage: findings at computed tomography

    OpenAIRE

    Celso Monteiro Soares; Antonio Carlos Pires Carvalho; Andréa de Jesus Rodrigues

    2004-01-01

    Foram analisados os exames de tomografia computadorizada de crânio de 250 pacientes com hematoma intraparenquimatoso encefálico espontâneo em três diferentes hospitais na cidade do Rio de Janeiro, com o objetivo de se levantar os aspectos mais freqüentes desta doença. O hematoma intraparenquimatoso cerebral profundo foi o de maior incidência, seguido do lobar. Mais raramente foi observado sangramento cerebelar e do tronco cerebral. A faixa etária de acometimento mais freqüente foi entre 61 e ...

  1. Air-assisted boom sprayer and spray deposition on bean plants Assistência de ar em barra de pulverização e a deposição da calda em feijoeiro

    Directory of Open Access Journals (Sweden)

    Fernando Cesar Bauer

    2003-01-01

    Full Text Available The development of safe pesticide application techniques with low volume rates, frequency and spray drift, along with the need to obtain better control level of crop pest control levels, justify the air-assistance in boom sprayers. The aim of this research was to evaluate the spray deposition on bean plants with different nozzles and volume rates by air-assisted and non-assisted sprayers. A completely randomized experiment was carried out using copper oxide as a tracer (50% metalic copper for deposit evaluation. The artificial targets were fixed on the upper and under-side of the leaflets, at the top and lower third of the same plants under the spray boom. After application, targets were washed individually with an extracting solution of nitric acid (1.0 mol L-1. The tracer deposition on the artificial targets was quantified by atomic absorption spectrofotometry. The effects of air-assisted spray were not significant in relation to spray deposition 48 days after emergence of the bean plants.A possibilidade do desenvolvimento de técnicas de aplicação de produtos fitossanitários mais seguras, com menores volumes de calda, número de aplicações e deriva, aliados à necessidade de se obter melhores níveis de controle dos agentes nocivos às plantas cultivadas, justificam o uso da assistência de ar junto à barra de pulverização. Com o objetivo de avaliar a deposição da pulverização na cultura do feijoeiro (Phaseolus vulgaris, em presença e ausência da assistência de ar junto à barra de pulverização, com diferentes pontas de pulverização e volumes de calda, foi conduzido um experimento em delineamento inteiramente casualizado, utilizando-se como traçador o óxido cuproso. Alvos artificiais (papel filtro com 3 x 3 cm foram afixados nas superfícies adaxial e abaxial de folíolos posicionados nos terços superior e inferior de plantas, selecionadas ao acaso, distribuídas perpendicularmente ao deslocamento do pulverizador. Ap

  2. Daños tóxicos en tejidos vegetales, producidos por aguas contaminadas con arsénico en Zimapán, Hidalgo, México Danos tóxicos em tecidos vegetais, produzidos por águas contaminadas com arsênio em Zimapán, Hidalgo, México

    Directory of Open Access Journals (Sweden)

    Francisco Prieto García

    2006-03-01

    Full Text Available Según estudios realizados en el periodo de 1992-1998 en las aguas de los pozos, norias y manantiales, del municipio de Zimapán, Estado de Hidalgo, México, se corroboró que existía un incremento en el contenido de arsénico rebasando los límites máximos permisibles por la Norma Oficial Mexicana. La determinación de arsénico en las muestras de aguas se realizó por absorción atómica (AAS, mediante generador de hidruros (GH. En este estudio se utilizó el Vicia faba como un bioensayo para evaluar el daño genotóxico con la prueba de inducción de micronúcleos por exposición al agua de Zimapán, contaminada con As en células de raíces. Se utilizó como ensayo de control un agua de pozo de similares características del municipio de Pachuca, pero con contenidos de As por debajo de los límites de detección. Los resultados mostraron que el agua de esta región presenta altas concentraciones de arsénico y que puede provocar efectos genotóxicos que se manifiestan por la inducción de micronúcleos en las células meristemáticas de raíces de tejidos vegetales sensible.Estudos feitos no período de 1992-1998 nas águas dos poços da municipalidade de Zimapán, estado do Hidalgo, México, demostram o aumento na concentração de arsênio ultrapassando os limites máximos permissíveis pela norma oficial mexicana. A determinação de arsênio nas amostras de água foi feita por absorção atômica (AA, por meio do gerador de hidruros (GH. Neste estudo, o Vicia faba foi usado como bioensaio para avaliar os danos genotóxicos com o teste da indução dos micronúcleos pela exposição à água de Zimapán, contaminada com arsênio em células de raízes. Como controle, foi usada uma água com similares características, do município de Pachuca, mas com índices abaixo dos limites de detecção. Os resultados mostraram que a água desta região apresenta altas concentrações de arsênico e que os efeitos genotóxicos manifestam-se pela

  3. Estereoscopio com tela holografica para ver tomografias

    CERN Document Server

    Lunazzi, J J; Magalhaes, D S F

    2010-01-01

    A estereoscopia eh uma tecnica que permite a observacao de imagens tridimensionais, mas estah sempre associada com o uso de algum equipamento especial para visualizacao, como oculos bicolores ou polarizados. Para o uso em aplicacoes medicas o emprego de tais equipamentos pode inviabilizar sua utilizacao durante procedimentos cirurgicos, por exemplo. Neste trabalho apresentamos um novo tipo de estereoscopio que utiliza uma tela holografica para geracao de imagens tridimensionais sem o uso de qualquer equipamento adicional. Apresentamos a descricao do equipamento utilizado e resultados das imagens visualizadas.

  4. Hematoma intraparenquimatoso cerebral espontâneo: aspectos à tomografia computadorizada Spontaneous cerebral intraparenchymatous hematoma: computed tomography findings

    Directory of Open Access Journals (Sweden)

    Celso Monteiro Soares

    2005-02-01

    Full Text Available OBJETIVO: Identificar os aspectos mais freqüentes do hematoma intraparenquimatoso cerebral espontâneo observados na tomografia computadorizada. MATERIAIS E MÉTODOS: Foram analisados, retrospectivamente, os exames de tomografia computadorizada de 250 pacientes com hematoma intraparenquimatoso cerebral espontâneo, provenientes de três diferentes hospitais da cidade do Rio de Janeiro. RESULTADOS: O hematoma intraparenquimatoso cerebral profundo foi o de maior incidência, equivalendo a 54,4% (136 casos, seguido do lobar com 34,8% (87 casos. Mais raramente, observou-se sangramento cerebelar em 8,4% (21 casos e do tronco cerebral em 2,4% (seis casos dos pacientes. CONCLUSÃO: A cefaléia foi o sintoma mais comum e a hipertensão arterial foi o sinal mais freqüentemente apresentado. A drenagem do hematoma para o sistema ventricular ocorreu mais comumente nos hematoma profundos.OBJECTIVE: To identify the most frequent aspects of spontaneous cerebral intraparenchymatous hematoma found at computed tomography examinations. MATERIALS AND METHODS: We reviewed, retrospectively, the computed tomography studies of 250 patients with spontaneous intracerebral hemorrhage carried out in three hospitals in Rio de Janeiro, Brazil. RESULTS: Deep intracerebral hematomas showed the highest incidence and were observed in 54.4% of the cases (136 patients followed by lobar hemorrhage in 34.8% of the cases (87 patients. Cerebelar hemorrhage and brainstem bleeding were more rarely observed, occurring in 8.4% (21 patients and 2.4% (six patients of the cases, respectively. CONCLUSION: Chronic headache was the most frequent symptom whereas hypertension was observed in the majority of the cases. Blood draining into the ventricular system occurred more frequently in patients with deep hematomas.

  5. Ars Electronica

    DEFF Research Database (Denmark)

    Kristensen, Thomas Bjørnsten

    2009-01-01

    Anmeldelse af Ars Electronica festivalen 3. - 8. september, 2009 i Linz, Østrig, der fejrede 30 års jubilæum under temaet "Human Nature". Festivalen fokuserer på interaktion mellem menneske, teknologi, kunst og samfund med særlig vægt på udviklingen af computeren og det digitale. Udgivelsesdato: 15.12...

  6. Uso da tomografia por impedância elétrica torácica como ferramenta de auxílio às manobras de recrutamento alveolar na síndrome do desconforto respiratório agudo: relato de caso e breve revisão da literatura

    Directory of Open Access Journals (Sweden)

    Regis Goulart Rosa

    2015-12-01

    Full Text Available RESUMO A tomografia por impedância elétrica torácica constitui ferramenta de monitorização não invasiva, em tempo real, da distribuição regional da ventilação pulmonar. Sua utilização à beira do leito em pacientes com síndrome do desconforto respiratório agudo tem o potencial de auxiliar na condução de manobras de recrutamento alveolar, frequentemente necessárias em casos de hipoxemia refratária. Neste relato de caso, apresentamos os resultados e a interpretação da monitorização da tomografia por impedância elétrica torácica em um paciente com síndrome do desconforto respiratório agudo, durante manobras de recrutamento alveolar, com aplicação transitória de altas pressões alveolares e titulação da pressão positiva ao final da expiração ideal. Adicionalmente, apresentamos uma breve revisão da literatura a respeito do uso de manobras de recrutamento alveolar e monitorização com tomografia por impedância elétrica torácica em pacientes com síndrome do desconforto respiratório agudo.

  7. Apendicite aguda: achados na tomografia computadorizada - ensaio iconográfico Acute appendicitis: computed tomography findings - an iconographic essay

    Directory of Open Access Journals (Sweden)

    Marcelo Eustáquio Montandon Júnior

    2007-06-01

    Full Text Available A apendicite aguda é a causa mais comum de dor abdominal aguda que requer intervenção cirúrgica no mundo ocidental. O diagnóstico precoce é essencial para minimizar a morbidade da doença. O uso dos métodos de imagem significou grande avanço no diagnóstico desta entidade, até então avaliada apenas com base na história clínica, exame físico e dados laboratoriais, haja vista que 20% a 33% dos pacientes apresentam sintomas atípicos. O diagnóstico é mais difícil nas crianças, nos idosos e nas mulheres em idade fértil. Os principais métodos de imagem para sua avaliação são a ultra-sonografia e a tomografia computadorizada. Os objetivos deste trabalho são: descrever a fisiopatologia da doença, comentar os principais aspectos técnicos da tomografia computadorizada, demonstrar e ilustrar os achados tomográficos e citar os principais diagnósticos diferenciais.Acute appendicitis is the most important cause of abdominal pain requiring surgical intervention in the Western world. The early diagnosis of this disease is of paramount relevance for minimizing its morbidity. Imaging methods have represented a huge progress in the diagnosis of this entity, which used to be based essentially on clinical history, physical examination and laboratory tests results, considering that 20% to 33% of patients present with atypical symptoms. Diagnostic difficulty is higher in children, the elderly, and women in childbearing age. The main imaging methods for evaluation of acute appendicitis are ultrasound and computed tomography. The present study is aimed at describing the disease physiopathology, commenting main computed tomography technical aspects, demonstrating and illustrating tomographic findings, and describing main differential diagnoses.

  8. LINFOMAS PULMONARES: CORRELAÇÃO DA TOMOGRAFIA COMPUTADORIZADA DE ALTA RESOLUÇÃO COM A ANATOMOPATOLOGIA

    Directory of Open Access Journals (Sweden)

    Marchiori Edson

    2002-01-01

    Full Text Available Neste trabalho são descritos os aspectos tomográficos de alta resolução dos linfomas pulmonares e feita correlação com os achados anatomopatológicos. Com este objetivo, foram revisados as tomografias computadorizadas de alta resolução do tórax e os dados histopatológicos de dez pacientes com diagnóstico confirmado de linfoma não-Hodgkin ou de doença de Hodgkin. Os resultados obtidos foram confrontados com os descritos na literatura. Os achados radiológicos mais comumente vistos neste estudo foram as consolidações parenquimatosas, localizadas, com broncogramas aéreos de permeio (n = 8. Em menor freqüência, foram encontrados múltiplos nódulos parenquimatosos (n = 4, espessamento peribroncovascular (n = 3 e opacidades em vidro fosco (n = 2. Na correlação com a anatomia patológica, as consolidações corresponderam a preenchimento alveolar por células neoplásicas, o espessamento peribroncovascular se deveu a infiltração das bainhas peribroncovasculares por células linfomatosas e a atenuação em vidro fosco se associou com infiltração dos septos alveolares por tais células.

  9. A tomografia por emissão de pósitrons com 2-[18F]-fluoro-2-desoxi-D-glicose é custo-efetiva em pacientes com câncer de pulmão não pequenas células no Brasil

    Directory of Open Access Journals (Sweden)

    Juliano Julio Cerci

    2012-08-01

    Full Text Available OBJETIVO: Comparar a acurácia e a custo-efetividade do estadiamento metabólico (EM com o FDG-PET em relação ao estadiamento convencional (EC no estadiamento inicial de pacientes com câncer de pulmão não pequenas células (CPNPC. MATERIAIS E MÉTODOS: Noventa e cinco pacientes com diagnóstico inicial de CPNPC foram estadiados antes do início do tratamento. Os resultados do EC e EM foram comparados quanto a definição do tratamento e incidência de toracotomia fútil em cada estratégia. RESULTADOS: O EM com FDG-PET classificou 48,4% dos pacientes como estádio mais avançado e 5,3% como menos avançado. O resultado do EM modificaria o tratamento em 41% dos pacientes. A toracotomia foi considerada fútil em 47% dos pacientes com EC e em 19% dos casos com EM. O custo das toracotomias fúteis em oito pacientes no EM foi de R$ 79.720, enquanto em 31 pacientes no EC seria de R$ 308.915. Apenas esta economia seria mais que suficiente para cobrir os custos de todos os exames de FDG-PET nos 95 pacientes (R$ 126.350 ou de FDG-PET/CT (R$ 193.515. CONCLUSÃO: O EM com FDG-PET tem maior acurácia que o EC em pacientes com CPNPC. A FDG-PET e FDG-PET/CT são custo-efetivas e sua utilização se justifica economicamente na saúde pública no Brasil.

  10. Implicações de redes temáticas em blogs na Análise de Redes Sociais (ARS: estudo de caso de blogs sobre autismo e síndrome de Asperger

    Directory of Open Access Journals (Sweden)

    Sandra Portella Montardo

    2010-12-01

    Full Text Available Neste estudo objetiva-se apontar especificidades de redes temáticas em blogs de familiares de Pessoas com Necessidades Especiais (PNE com relação à Análise de Redes Sociais (ARS. Nosso objeto de estudo são as redes sociais em blogs de familiares de pessoas com autismo e com síndrome de Asperger. Sob o prisma da Inclusão Social (IS e da Inclusão Digital (ID, percebe-se que a especificação da temática em torno das quais essas redes se formam é condição sine qua non para o seu estabelecimento. Esse foco sugere uma problematização do conceito de laços fracos e laços fortes. A netnografia é a metodologia utilizada para análise dos blogs selecionados. Frente a isso, a análise de capital social e de laços sociais de forma interdependente - o que consiste numa adaptação a um modelo de estrutura de redes proposto - revelou-se pertinente para a identificação da IS em redes temáticas na web.

  11. Consistency of ocular coherence tomography fast macular thickness mapping in diabetic diffuse macular edema Consistência da tomografia de coerência óptica no edema macular difuso diabético

    Directory of Open Access Journals (Sweden)

    Fábio Petersen Saraiva

    2007-01-01

    Full Text Available OBJECTIVES: To investigate optical coherence tomography consistency on foveal thickness, foveal volume, and macular volume measurements in patients with and without diffuse diabetic macular edema. INTRODUCTION: Optical coherence tomography represents an objective technique that provides cross-sectional tomographs of retinal structure in vivo. However, it is expected that poor fixation ability, as seen in diabetic macular edema, could alter its results. Several authors have discussed the reproducibility of optical coherence tomography, but only a few have addressed the topic with respect to diabetic maculopathy. METHODS: The study recruited diabetic patients without clinically evident retinopathy (control group and with diffuse macular edema (case group. Only one eye of each patient was evaluated. Five consecutive fast macular scans were taken using Ocular Coherence Tomography 3; the 6 mm macular map was chosen. The consistency in measurements of foveal thickness, foveal volume, and total macular volume for both groups was evaluated using the Pearson's coefficient of variation. The T-test for independent samples was used in order to compare measurements of both groups. RESULTS: Each group consisted of 20 patients. All measurements had a coefficient of variation less than 10%. The most consistent parameter for both groups was the total macular volume. DISCUSSION: Consistency in measurement is a mainstay of any test. A test is unreliable if its measurements can not be correctly repeated. We found a good index of consistency, even considering patients with an unstable gaze. CONCLUSIONS: Optical coherence tomography is a consistent method for diabetic subjects with diffuse macular edema.OBJETIVOS: Investigar a consistência das medidas de espessura foveal, volume foveal e volume macular total feitas pela tomografia de coerência óptica em pacientes com e sem edema macular difuso diabético. INTRODUÇÃO: A tomografia de coerência óptica é uma t

  12. Avaliação da inclinação do incisivo inferior através da tomografia computadorizada Computed tomographic evaluation of inferior incisor position

    Directory of Open Access Journals (Sweden)

    Leopoldino Capelozza Filho

    2008-12-01

    Full Text Available INTRODUÇÃO: durante muito tempo, a Ortodontia baseou-se em valores normativos obtidos através das análises cefalométricas existentes, utilizando a telerradiografia em norma lateral como exame principal no diagnóstico ortodôntico, ditando o plano de tratamento. O incisivo inferior, em particular, recebeu normas cefalométricas propostas por diversos autores, dentre eles Tweed. Entretanto, os exames radiográficos possuem limitações, pois, em uma imagem bidimensional de uma estrutura tridimensional, a superposição de determinadas estruturas ósseas e dentárias é constante. O advento da tomografia computadorizada disponibilizou meios diagnósticos mais precisos e confiáveis, principalmente pela possibilidade de obtenção da imagem das estruturas em três dimensões. Nesse contexto, parece razoável questionar os dados oriundos da análise clássica da radiografia lateral da face, com intuito de criar fatores de comparação com dados que passarão a ser gerados a partir da mesma imagem obtida pela tomografia. OBJETIVOS: para isso, propusemo-nos a avaliar o ângulo formado entre o longo eixo do incisivo inferior e o plano mandibular, a grandeza IMPA da cefalometria, na telerradiografia convencional e na tomografia computadorizada. MÉTODOS: dezenove pacientes selecionados para tratamento ortodôntico constituíram a amostra deste estudo, 12 do gênero feminino e 7 do masculino, com idades entre 16 anos e 4 meses e 28 anos e 2 meses. Após a coleta de dados, feita por dois examinadores, análises estatísticas para a obtenção dos erros intra e inter-examinadores foram feitas, utilizando nível de significância de 5%. RESULTADOS E CONCLUSÕES: concluiu-se que a obtenção dos valores para o ângulo formado entre o longo eixo do incisivo inferior e o plano mandibular (IMPA na telerradiografia lateral é um método confiável para uso clínico, porque embora apresente, como regra, valores menores que os encontrados em tomografia

  13. Study of the relationship and importance of clinical semiology, axial computed tomography and electroneuromyography in lumbar radioculopathies Estudo da relação e da importância entre a semiologia clínica, tomografia axial computadorizada e eletroneuromiografia nas radiculopatias lombares

    Directory of Open Access Journals (Sweden)

    Emílio Cezar Mamede Murade

    2002-12-01

    Full Text Available The authors evaluated forty-three patients with clinical suspect of lumbar radiculopathy caused by disk hernia, concerning to clinical semiology, computed tomography and electromyography were studied and their correlations. The clinical semiology was altered in 100,0% of the patients, the computed tomography in 90,7% and the electromyography in 88,7%. The correlation among the three exams didn´t show any prevalency among any of the possible associations. The authors emphasize the importance of clinical semiology, computed tomography and electromyography for a more accurate diagnosis of lumbar radiculopathy following by disk hernia.Os autores estudaram 43 pacientes com suspeita clínica de radiculopatia lombar, causada por hérnia de disco, relacionando os achados da semiologia clínica, tomografia axial computadorizada e eletroneuromiografia, entre si. A semiologia clínica estava alterada em 100,0% dos pacientes, a tomografia axial computadorizada em 90,7% e a eletroneuromiografia em 88,7%. A correlação entre os três exames não mostrou prevalência entre nenhuma associação. Os autores enfatizam a importância da semiologia clínica, tomografia axial computadorizada e eletroneuromiografia para maior exatidão diagnóstica das radiculopatias lombares por hérnia de disco.

  14. Malária pulmonar: aspectos na tomografia computadorizada de alta resolução - relato de caso Pulmonary malaria: high-resolution computed tomography findings - a case report

    OpenAIRE

    Rosana Rodrigues; Edson Marchiori; Daniel Andrade Tinoco de Souza

    2004-01-01

    Neste trabalho é relatado o caso de paciente do sexo masculino, de 38 anos de idade, que desenvolveu quadro de malária com comprometimento pulmonar. A tomografia computadorizada de alta resolução evidenciou espessamento de septos interlobulares e de bainhas peribroncovasculares, com áreas esparsas de atenuação em vidro fosco e de consolidações, além de derrame pleural bilateral, aspectos compatíveis com edema pulmonar. O paciente recebeu tratamento específico, evoluindo bem e tendo alta 11 di...

  15. Enterografia por tomografia computadorizada: experiência inicial na avaliação das doenças do intestino delgado CT enterography: a preliminary experience in the evaluation of small bowel diseases

    OpenAIRE

    Luciana Costa-Silva; Tatiana Martins; Maria do Carmo Friche Passos

    2010-01-01

    OBJETIVO: O objetivo deste estudo é demonstrar a importância da enterografia por tomografia computadorizada (entero-TC) e como este exame pode contribuir na elucidação diagnóstica e avaliação clínica de pacientes com doenças do intestino delgado. MATERIAIS E MÉTODOS: Análise retrospectiva de 35 pacientes submetidos a entero-TC realizadas em aparelho multidetector de 16 canais, entre maio de 2008 e março de 2009. Utilizou-se meio de contraste iodado venoso e oral neutro (polietilenoglicol). As...

  16. Seguimento de portadores de coriorretinopatia serosa central por meio da tomografia de coerência óptica Evaluation of central serous chorioretinopathy with optical coherence tomography

    Directory of Open Access Journals (Sweden)

    Otacílio de Oliveira Maia Júnior

    2006-04-01

    Full Text Available OBJETIVO: Avaliar a tomografia de coerência óptica como método objetivo de diagnóstico e de seguimento da coriorretinopatia serosa central. MÉTODOS: Estudo observacional descritivo de 16 (dezesseis olhos de portadores de coriorretinopatia serosa central unilateral, em fase aguda. Estes pacientes foram submetidos à medida da acuidade visual e a exame oftalmológico completo, incluindo biomicroscopia da mácula, angiofluoresceinografia e tomografia de coerência óptica. Nenhum dos pacientes foi submetido a qualquer tipo de tratamento. RESULTADO: Dos 16 casos consecutivos de coriorretinopatia serosa central, 12 pacientes completaram o seguimento até a resolução da doença. A idade variou entre 27 e 50 anos, com média de 38,9 anos. A predominância foi do sexo masculino. Na tomografia de coerência óptica, o descolamento da retina neurossensorial foi observado em todos os casos e 33,3% dos pacientes apresentaram descolamento do epitélio pigmentado da retina. Houve diferença significativa em todas as variáveis estudadas, constatando melhora na acuidade visual, diminuição na espessura e no volume macular na resolução da doença. CONCLUSÃO: Tomografia de coerência óptica mostrou boa eficácia para detectar e quantificar alterações maculares em olhos com coriorretinopatia serosa central, podendo ser útil em avaliações clínicas na fase aguda e na resolução da doença.PURPOSE: To evaluate optical coherence tomography as an objective diagnostic and follow-up method for central serous chorioretinopathy. METHODS: Observational descriptive study of 16 (sixteen eyes of 16 patients with unilateral acute central serous chorioretinopathy. These patients had their visual acuity measured and complete ophthalmological examination was performed, including macular slit lamp examination, angiofluoresceinography and optical coherence tomography. No treatment was given to any patient. RESULTS: Of the 16 central serous chorioretinopathy eyes

  17. Efeito da velocidade do ar em barra de pulverização na deposição de produtos fitossanitários em feijoeiro Efect of the air speed in air-assisted sprayer on bean crop pesticide spray deposition

    Directory of Open Access Journals (Sweden)

    Carlos Gilberto Raetano

    2003-01-01

    Full Text Available Com o objetivo de avaliar o efeito da variação da velocidade do ar em barra de pulverização na deposição da calda na cultura do feijoeiro (Phaseolus vulgaris, realizou-se o experimento em 9 e 10 de outubro de 2000, no Centro de Pesquisas Agronômicas - Cyanamid, em Iracemápolis (SP, em delineamento inteiramente casualizado, aos 48 dias após a emergência (DAE. Para isso, convencionou-se que a rotação máxima do ventilador, medida com o auxílio de fototacômetro, possibilitou a obtenção da velocidade máxima do ar na barra de pulverização e, a partir daí, níveis de 50% e 75% da velocidade máxima do ar. Alvos artificiais foram fixados na superfície adaxial e na abaxial de folíolos posicionados, nos terços superior e inferior das plantas selecionadas, ao acaso, e distribuídas perpendicularmente ao deslocamento do pulverizador. O óxido cuproso (50% de cobre metálico foi o traçador utilizado em pulverização e a determinação quantitativa dos depósitos feita com o uso da espectrofotometria de absorção atômica. Os resultados sugerem que a variação da velocidade do ar na barra pulverizadora não influenciou sobre os níveis de depósitos no feijoeiro, aos 48 DAE, nas condições do presente trabalho.The aim of this research was to evaluate the effects of air speed in air-assisted sprayer on bean crop (Phaseolus vulgaris spray deposition. The experiment was carried out at 48 days after crop emergence and the experimental design was randomized. The maximum air speed in spray boom was obtained with the maximum of the fan rotation by a phototachometer. The middle and third air speed were obtained with lower fan rotation. The tracer used in the spray solution was copper oxid (50% of the metalic copper. It was measured by atomic spectrophotometry absorption equipment. The targets were fixed on the under and upper-side of the leaves, in the top and lower third of the same plant under the spray boom. The effects of variation

  18. Sarcoidose pulmonar: achados na tomografia computadorizada de alta resolução Pulmonary sarcoidosis: high-resolution computed tomography findings

    Directory of Open Access Journals (Sweden)

    Bruno Barcelos da Nóbrega

    2005-06-01

    Full Text Available A sarcoidose é uma doença sistêmica de causa indeterminada, caracterizada por granulomas não-caseosos. Embora possa afetar qualquer órgão, esta doença tem sua morbi-mortalidade relacionada principalmente ao acometimento pulmonar, presente em 80% a 90% dos pacientes. Este artigo ilustra as principais manifestações pulmonares da sarcoidose na tomografia computadorizada de alta resolução, incluindo as formas típicas e atípicas.Sarcoidosis is a systemic disease of unknown etiology, characterized by noncaseating granulomas. Although it may affect any organ, morbidity and mortality are most commonly related to pulmonary involvement, which is found in 80-90% of patients. This study illustrates the principal manifestations of sarcoidosis seen in high-resolution computed tomography scans, including typical as well as atypical forms.

  19. Ar-Ar_Redux: rigorous error propagation of 40Ar/39Ar data, including covariances

    Science.gov (United States)

    Vermeesch, P.

    2015-12-01

    Rigorous data reduction and error propagation algorithms are needed to realise Earthtime's objective to improve the interlaboratory accuracy of 40Ar/39Ar dating to better than 1% and thereby facilitate the comparison and combination of the K-Ar and U-Pb chronometers. Ar-Ar_Redux is a new data reduction protocol and software program for 40Ar/39Ar geochronology which takes into account two previously underappreciated aspects of the method: 1. 40Ar/39Ar measurements are compositional dataIn its simplest form, the 40Ar/39Ar age equation can be written as: t = log(1+J [40Ar/39Ar-298.5636Ar/39Ar])/λ = log(1 + JR)/λ Where λ is the 40K decay constant and J is the irradiation parameter. The age t does not depend on the absolute abundances of the three argon isotopes but only on their relative ratios. Thus, the 36Ar, 39Ar and 40Ar abundances can be normalised to unity and plotted on a ternary diagram or 'simplex'. Argon isotopic data are therefore subject to the peculiar mathematics of 'compositional data', sensu Aitchison (1986, The Statistical Analysis of Compositional Data, Chapman & Hall). 2. Correlated errors are pervasive throughout the 40Ar/39Ar methodCurrent data reduction protocols for 40Ar/39Ar geochronology propagate the age uncertainty as follows: σ2(t) = [J2 σ2(R) + R2 σ2(J)] / [λ2 (1 + R J)], which implies zero covariance between R and J. In reality, however, significant error correlations are found in every step of the 40Ar/39Ar data acquisition and processing, in both single and multi collector instruments, during blank, interference and decay corrections, age calculation etc. Ar-Ar_Redux revisits every aspect of the 40Ar/39Ar method by casting the raw mass spectrometer data into a contingency table of logratios, which automatically keeps track of all covariances in a compositional context. Application of the method to real data reveals strong correlations (r2 of up to 0.9) between age measurements within a single irradiation batch. Propertly taking

  20. Complicações pulmonares após uso de crack: achados na tomografia computadorizada de alta resolução do tórax Pulmonary complications of crack cocaine use: high-resolution computed tomography of the chest

    Directory of Open Access Journals (Sweden)

    Alexandre Mançano

    2008-05-01

    Full Text Available Relatamos os achados na tomografia computadorizada de alta resolução de um paciente que, após uso de cocaína fumada (crack, desenvolveu quadro de hemoptise, dispnéia e dor torácica súbitas. As radiografias de tórax mostravam consolidações predominando em lobos superiores. A tomografia de alta resolução evidenciava opacidades em vidro fosco, consolidações e nódulos do espaço aéreo. Nova tomografia de controle, após suspensão da droga e uso de corticóides, mostrou regressão parcial das lesões e aparecimento de escavações. A correlação entre os achados clínicos, laboratoriais e de imagem permitiu o diagnóstico de "pulmão de crack".Here, we report high-resolution computed tomography (HRCT findings in a patient who developed sudden hemoptysis, dyspnea and chest pain after smoking crack cocaine. Chest X-rays showed consolidations, primarily in the upper lobes, and HRCT scans showed ground glass attenuation opacities, consolidations and air-space nodules. A follow-up CT, after drug use discontinuation and administration of corticosteroids, showed partial resolution of pulmonary lesions and the appearance of cavitations. Clinical, imaging and laboratory findings led to a diagnosis of 'crack lung'.

  1. Avaliação da artéria etmoidal anterior pela tomografia computadorizada no plano coronal Anterior ethmoidal artery evaluation on coronal CT scans

    Directory of Open Access Journals (Sweden)

    Soraia Ale Souza

    2009-02-01

    Full Text Available O conhecimento da localização da artéria etmoidal anterior (AEA constitui etapa importante na cirurgia do recesso do seio frontal e do etmóide anterior. A tomografia computadorizada (TC, em especial no plano coronal pode fornecer reparos anatômicos que identificam o trajeto da AEA. OBJETIVO: Identificar os reparos anatômicos que caracterizam o trajeto da AEA na parede medial da órbita e na parede lateral da fossa olfatória. Verificar a correlação entre a presença de pneumatização supra-orbitária e a visualização do etmoidal anterior (canal da AEA. CASUÍSTICA E MÉTODOS: Estudo retrospectivo de 198 tomografias computadorizadas dos seios paranasais no plano coronal do período de agosto a dezembro de 2006. RESULTADOS: Pneumatização supra-orbitária foi identificada em 35% (70 exames. O canal da AEA foi caracterizado em 41% (81 exames. O sulco etmoidal anterior foi visualizado em 98% (194 dos exames e o forame etmoidal anterior foi identificado em todos os exames (100%. CONCLUSÃO: O forame etmoidal anterior e o sulco etmoidal anterior foram referências anatômicas presentes em quase 100% dos exames avaliados. Houve correlação entre a presença de pneumatização supra-orbitária e a caracterização do canal da AEA.The anterior ethmoidal artery (AEA is an important point for frontal and ethmoid sinuses surgery. CT scans can identify landmarks to help the surgeon find the AEA. AIM: To identify the landmarks of the AEA on the orbital medial wall and on the lateral wall of the olfactory fossa. and to correlate the presence of supraorbital ethmoidal cells with spotting the anterior ethmoidal artery canal. MATERIALS AND METHODS: Retrospective review of 198 direct coronal paranasal sinuses computed tomography (CT scans from August to December, 2006. RESULTS: Supraorbital pneumatization was seen in 35% (70 scans. The AEA canal was seen in 41% (81 scans. The anterior ethmoidal sulcus was seen in 98% (194 scans and the anterior

  2. Assessment of arsenic toxicity in spiked soils and water solutions by the use of bioassays Evaluación de la toxicidad del arsénico en suelos y soluciones contaminadas mediante el uso de bioensayos Avaliação da toxicidade de arsénio em solos contaminados e em soluções aquosas com recurso a bioensaioS

    Directory of Open Access Journals (Sweden)

    Francisco José Martín Peinado

    2012-11-01

    concentración efectiva de arsénico que reduce un 50% la variable respuesta (EC50 fue de 1,52 ppm para el ensayo con L. sativa y 4,98 ppm para el ensayo con V. fischeri, indicando que el bioensayo con L. sativa fue más sensible a las concentraciones de arsénico en las soluciones contaminadas.O Arsénio (As constitui um grave problema ambiental devido à sua ampla utilização e elevado potencial tóxico . Para além disso, este elemento tende a acumular-se nos solos devido à sua baixa mobilidade. Neste estudo, fez-se uma avaliação do potencial de toxicidade do As em solos e soluções aquosas de amostras laboratoriais contaminadas com este elemento, recorrendo a bioensaios com Vibrio fischeri e Lactuca sativa. Os solos contaminados com 100 ppm de arsénio registaram uma redução da solubilidade do As na solução do solo ao longo do tempo, enquanto que para os períodos de incubação mais longos (8 semanas, as respostas à toxicidade em todas as amostras neste tipo de bioensaios foi insignificante. Em soluções aquosas contaminadas com concentrações crescentes de arsénio (0, 0,1, 1, 10, 12.5, 25, 50, and100 ppm As, observaram-se reduções significativas no elongamento das raízes e na luminiscênciar espetivamente na alface e nos bioensaios com bactérias. A concentração efetiva de As (EC50 apresentou os valores de 1,52 ppm para a L. sativa e 4,98 ppm para a V. fischeri, o que indica que os bioensaios com L. sativa foram mais sensíveis às concentrações de As nas soluções contaminadas.

  3. Mediastinite aguda: aspectos de imagem pós-cirurgias cardíacas na tomografia computadorizada de multidetectores Acute mediastinitis: multidetector computed tomography findings following cardiac surgery

    Directory of Open Access Journals (Sweden)

    Clarissa Aguiar de Macedo

    2008-08-01

    Full Text Available Mediastinite pós-cirurgias torácicas é definida como a infecção dos órgãos e tecidos do espaço mediastinal, ocorrendo em 0,4% a 5% dos casos. A gravidade da infecção pós-operatória varia desde infecção de tecidos superficiais da parede torácica até mediastinite fulminante com envolvimento esternal. O critério diagnóstico da tomografia computadorizada para mediastinite aguda pós-cirúrgica é a presença de coleção mediastinal, podendo estar associada ou não a anormalidades periesternais como edema/borramento de partes moles, separação dos segmentos esternais com reabsorção óssea marginal, esclerose e osteomielite. Achados associados incluem linfonodomegalias, consolidações pulmonares e derrame pleural e pericárdico. Pequenas coleções e gás mediastinais podem ser usualmente encontradas em pós-operatório recente de cirurgias torácicas sem a presença de infecções, limitando a eficácia da tomografia computadorizada nas duas primeiras semanas. Após esse período, a tomografia alcança quase 100% de sensibilidade e especificidade. Pacientes com suspeita clínica de mediastinite devem ser submetidos a exame de tomografia para pesquisa de coleções, identificando a extensão da doença e sua natureza. A versão de multidetectores propicia recursos de reconstruções em diversos planos e janelas, contribuindo especialmente para o estudo do esterno.Postoperative mediastinitis is defined as an infection of the organs and tissues in the mediastinal space, with an incidence ranging between 0.4% and 5% of cases. This disease severity varies from infection of superficial tissues in the chest wall to fulminant mediastinitis with sternal involvement. Diagnostic criterion for postoperative detection of acute mediastinitis at computed tomography is the presence of fluid collections and gas in the mediastinal space, which might or might not be associated with peristernal abnormalities such as edema of soft tissues

  4. Temperaturas de acionamento de sistemas de climatização para perus em épocas de baixa umidade relativa do ar Activating temperatures of ventilation systems for turkeys in low humidity periods

    Directory of Open Access Journals (Sweden)

    Angélica S. Mendes

    2010-10-01

    Full Text Available Este estudo teve o objetivo de avaliar distintos programas de acionamento dos sistemas de climatização (ventiladores e nebulizadores, visando a aprimorar o ambiente interno e o bemestar das aves, evitando possíveis perdas produtivas e gastos excessivos em energia elétrica. O estudo foi conduzido em dois aviários localizados no município de Uberlândia - MG, durante a época de baixa umidade relativa do ar (junho a dezembro. Os aviários foram comparados sob os parâmetros de concentrações de CO2, temperatura e umidade relativa do ar, temperatura superficial da cama e índices produtivos. Os dados climáticos foram submetidos à análise de variância, e os dados produtivos submetidos ao teste de Qui-quadrado, utilizando-se do software MINITAB V.14. Os resultados apontados pelos tratamentos 1 e 2 mostraram que as concentrações de CO2 no ar (372,70 e 379,46 ppm, respectivamente estiveram abaixo dos limites máximos recomendados internacionalmente para ambos os sistemas. As temperaturas internas (26,23 e 26,56 ºC, respectivamente estiveram sempre acima do recomendado para as aves, e os níveis de umidade relativa do ar (69,73 e 70,42, respectivamente estiveram, em média, na faixa recomendada, para ambos os sistemas. Conclui-se que o aviário programado para acionar o sistema de climatização mais tardiamente consumiu menos energia elétrica, apresentou melhor conversão alimentar, menor incidência de artrite, porém maior percentual de mortalidade.This study aimed to evaluate different turn on systems of climatization (fans and fogging sprinklers to improve the internal environment and the birds' welfare, avoiding productive losses and expensive wastes in electrical energy. The study was conducted in a commercial property with two poultry houses, located in Uberlândia, MG, Brazil, during the phase of low relative humidity of the air (June to December. The poultry houses were compared under the parameters of concentration of CO2

  5. Qualidade do ar em ambientes internos hospitalares: estudo de caso e análise crítica dos padrões atuais Indoor air quality in hospitals: a case study and a critical review of current standards

    Directory of Open Access Journals (Sweden)

    Marina Eller Quadros

    2009-09-01

    Full Text Available O objetivo deste trabalho foi avaliar a qualidade do ar em três categorias de ambientes hospitalares: unidade de terapia intensiva (UTI adulto, UTI neonatal (UTN e centro cirúrgico de um hospital em Florianópolis, Brasil. Avaliaram-se a concentração de dióxido de carbono, a vazão e renovação de ar nas salas do centro cirúrgico. A concentração de bioaerossóis foi estimada em um dia de avaliação para cada ambiente. Não se observou relação entre a concentração de bioaerossóis e o tempo de uso das salas de cirurgia. A concentração média de bioaerossóis foi de 231 UFC.m-3 para fungos e de 187 UFC.m-3 para bactérias. Os ambientes avaliados atendiam aos valores recomendados pela legislação vigente. Os resultados permitiram avaliar criticamente essa legislação e apresentar sugestões para estabelecimento de uma resolução específica para ambientes hospitalares no Brasil.The objective of this paper was to evaluate the air quality in three indoor hospital environments: a neonatal intensive care unit (ICU, an adult ICU and a surgical ward of a hospital in Florianópolis, Brazil. Carbon dioxide concentrations, exchange air flow rates as well as fungi and bacteria concentrations were measured in these rooms. Bioaerosol concentrations were evaluated throughout one-work day for each operating room. No relationship was observed between bioaerosol concentration and the period of use in the surgical ward. Average bioaerosol concentrations were of 231 UFC.m-3 for filamentous fungi and 187 UFC.m-3 for bacteria. All environments evaluated were, overall, in compliance with current legislations. Results allowed a critical review of the present regulations and suggestions for the establishment of a specific regulation for hospital environments in Brazil.

  6. Educação ao ar livre pela aventura: o aprendizado de valores morais em expedições à natureza Education outdoors through adventure: learning moral values in nature expeditions

    Directory of Open Access Journals (Sweden)

    Flavio Theodor Kunreuther

    2012-06-01

    Full Text Available A educação ao ar livre, por meio de cursos no formato expedição, ainda acontece de forma tímida no Brasil. Entende-se por expedição uma experiência educacional contínua, de múltiplos dias, em que alunos e instrutores aventuram-se em um trajeto em área remota da natureza de forma autossuficiente. O presente estudo analisa os cursos desse tipo. Por meio de entrevistas e questionários semiestruturados, investigou-se a aprendizagem dos alunos segundo suas próprias percepções e as dos educadores da instituição, com ênfase no desenvolvimento moral do indivíduo. Como parte do estudo de caso sobre um aluno adolescente participante de um dos cursos, entrevistou-se também uma psicóloga que coordena um abrigo para menores. Os resultados encontrados indicam que os cursos de educação ao ar livre caracterizam-se por experiências que estimulam trabalhos em grupo, debates sobre justiça e solidariedade, e reflexões sobre valores e princípios como coragem, esforço pessoal, disciplina, respeito e superação de limites. Os resultados também indicam que tal proposta educacional aufere experiências sensíveis e de conexão do ser humano com a natureza. Muito embora haja potencial educacional para a educação ao ar livre, a atuação do educador perante seus alunos é fundamental para que as experiências sejam física e psicologicamente seguras, alcancem seus potenciais pedagógicos de desenvolvimento da moralidade e ajudem as pessoas a desenvolverem uma consciência ambiental, manifestada por meio de ações concretas ao retornarem dos cursos para suas comunidades.Open air education through courses organized as expeditions is still incipient in Brazil. We understand an expedition as a continued educational experience taking several days in which students and instructors venture into a remote natural area in a self-sufficient way. The present study analyzes courses of this type. Using interviews and semi-structured questionnaires, it

  7. POTENCIAL DE SECAGEM DO MILHO A GRANEL COM AR NATURAL EM BOTUCATU – SP DRYING POTENTIAL OF MAIZE GRAINS IN BULK WITH NATURAL AIR IN BOTUCATU, SP

    Directory of Open Access Journals (Sweden)

    Vicente A. Gonçalves

    2007-09-01

    Full Text Available

    A secagem de grãos com ar natural é um processo dependente das condições climáticas locais, constantemente oscilantes no tempo. Através do emprego de modelos matemáticos de simulação foi avaliada a possibilidade de realização da secagem do milho a granel com ar natural para as condições climáticas de Botucatu, com base nos registros horários de temperatura de bulbo seco e umidade relativa dos anos de 1971 a 1975 e de 1977 a 1981. O processo contínuo de secagem do milho com ar natural, nas condições analisadas, não permite a redução do teor de umidade final ao nível recomendado ao armazenamento seguro. A simulação da secagem intermitente, realizada nos períodos das 9 às 17 h, 9 às 18 h e 8 às 18 h, indica a possibilidade de redução do teor de umidade do milho, base úmida, a nível entre 12,1 e 17,3%, para o teor de unidade inicial de 22%, entre 12,4 e 15,5%, para o teor de umidade inicial de 20% e entre 13,1 e 14,7% para o de 18%, quando realizada a secagem no período máximo admissível.

    PALAVRAS-CHAVE: Secagem; Ar natural; Milho; Teor de umidade de equilíbrio.

    Grain drying using ambient was simulated under weather conditions in Botucatu. Hourly weather records, fry bulb temperature and relative humidity, from 1971 through 1975 and from 1977 through 1981, were used to calculate adiabatic drying potential of the ambient air. Historical weather records from 1971 were selected to simulate ambient air corn drying. Ambient air corn drying systems operating continuously are not feasible to reduce the moisture content of the grain to the moisture levels recommended for safe storage. Selective fan operation, from 9 a. m. to 5 a. m. , from 9 a. m. to 6 p. m. and from 8 a. m. to 6 p. m. , indicates the possibility to reduce corn moisture contents, wet

  8. Tomografia computadorizada de alta resolução na silicose: correlação com radiografia e testes de função pulmonar High-resolution computed tomography in silicosis: correlation with chest radiography and pulmonary function tests

    OpenAIRE

    Agnaldo José Lopes; Roberto Mogami; Domenico Capone; Bernardo Tessarollo; Pedro Lopes de Melo; José Manoel Jansen

    2008-01-01

    OBJETIVO: Correlacionar os parâmetros tomográficos com os de função pulmonar em portadores de silicose, bem como comparar os resultados da tomografia computadorizada de alta resolução (TCAR) com os da radiografia de tórax. MÉTODOS: Foi realizado um estudo de corte transversal, em que foram avaliados 44 pacientes não-tabagistas e sem história pregressa de tuberculose. As radiografias foram classificadas de acordo com a proposta da Organização Internacional do Trabalho. Utilizando um sistema de...

  9. A tomografia computadorizada de alta resolução na avaliação da toxicidade pulmonar por amiodarona High-resolution computed tomography of amiodarone pulmonary toxicity

    Directory of Open Access Journals (Sweden)

    Daniela Peixoto Consídera

    2006-04-01

    Full Text Available OBJETIVO: Avaliar as principais alterações identificadas na tomografia computadorizada de alta resolução do tórax em pacientes com toxicidade pulmonar pela amiodarona. MATERIAIS E MÉTODOS: Foram avaliadas dez tomografias computadorizadas de alta resolução de tórax de pacientes com pneumonite pela amiodarona, seis desses pacientes do sexo masculino e quatro do sexo feminino, com idade média de 73,5 anos. RESULTADOS: Os achados tomográficos mais relevantes foram opacidades lineares ou reticulares em seis casos (60%, pequenos nódulos com densidade elevada em seis casos (60%, consolidações densas em três casos (30% e aumento da densidade do parênquima hepático em cinco de oito casos em que havia estudo tomográfico do abdome superior (62,5%. CONCLUSÃO: A tomografia computadorizada de alta resolução é um exame importante na avaliação de pacientes com toxicidade pulmonar pela amiodarona, devendo ser realizada sempre que houver suspeita deste diagnóstico. O achado de espessamento de septos interlobulares associado a lesões com aumento de densidade é altamente sugestivo deste diagnóstico.OBJECTIVE: To evaluate the main findings of chest high-resolution computed tomography in patients with amiodarone pulmonary toxicity. MATERIALS AND METHODS: Ten patients - six male and four female, average age of 73.5 years - with amiodarone-induced pneumonitis have undergone chest high-resolution computed tomography. RESULTS: The most relevant tomographic findings were linear or reticular opacities in six cases (60%, small high density nodules in six cases (60%, dense consolidations in three cases (30% and increased density in the hepatic parenchyma in five of eight cases in which there was a superior abdomen CT scan (62.5%. CONCLUSION: The high-resolution computed tomography is a valuable non-invasive test for evaluating patients with amiodarone pulmonary toxicity and should always be performed when one suspects of the presence of this

  10. A poluição do ar em ambientes internos e a síndrome dos edifícios doentes Air pollution in internal environments and sick building syndrome

    Directory of Open Access Journals (Sweden)

    Waldir Nagel Schirmer

    2011-08-01

    Full Text Available A Qualidade do Ar Interno (QAI surgiu como ciência a partir da década de 70 com a crise energética e a consequente construção dos edifícios selados (desprovidos de ventilação natural, principalmente nos países desenvolvidos, e se destacou após a descoberta de que a diminuição das taxas de troca de ar nesses ambientes era a grande responsável pelo aumento da concentração de poluentes no ar interno. Admite-se que a ventilação seja um dos principais fatores que interferem na qualidade do ar interno e que os próprios ocupantes dos edifícios contribuem substancialmente com a poluição destes ambientes através de suas atividades. Sabe-se ainda que a má qualidade do ar interno está associada a doenças (como tosse, rinite, alergia, etc. e à Síndrome dos Edifícios Doentes (SED. Para amostragem de substâncias gasosas no ar de ambientes internos dispõe-se de diversas metodologias, sendo as principais: sistemas passivos de monitoramento, sistemas ativos e automáticos. Para a efetiva promoção de um ambiente saudável, deve-se conciliar a aplicação de legislações específicas com pesquisas e conscientização dos ocupantes dos edifícios. Essa revisão objetiva relacionar os diferentes contaminantes encontrados em ambientes internos, seus efeitos à saúde humana e suas metodologias de amostragem.Indoor Air Quality (IAQ emerged as a science from the 1970s onwards with the energy crisis and the subsequent construction of sealed buildings (without natural ventilation. This mainly occurred in developed countries and it soon came to public attention that lower levels of air exchange in these environments was the main culprit for the increase in concentration of indoor air pollutants. It is common knowledge that ventilation is one of the principal factors that interfere with air quality in indoor environments and that the occupants contribute to the pollution of these environments with their activities. Furthermore, poor indoor

  11. Hematoma intraparenquimatoso cerebral espontâneo: aspectos à tomografia computadorizada Spontaneous cerebral intraparenchymatous hematoma: computed tomography findings

    OpenAIRE

    Celso Monteiro Soares; Antonio Carlos Pires Carvalho

    2005-01-01

    OBJETIVO: Identificar os aspectos mais freqüentes do hematoma intraparenquimatoso cerebral espontâneo observados na tomografia computadorizada. MATERIAIS E MÉTODOS: Foram analisados, retrospectivamente, os exames de tomografia computadorizada de 250 pacientes com hematoma intraparenquimatoso cerebral espontâneo, provenientes de três diferentes hospitais da cidade do Rio de Janeiro. RESULTADOS: O hematoma intraparenquimatoso cerebral profundo foi o de maior incidência, equivalendo a 54,4% (136...

  12. Edema pulmonar hidrostático: aspectos na tomografia computadorizada de alta resolução Hydrostatic pulmonary edema: high-resolution computed tomography aspects

    Directory of Open Access Journals (Sweden)

    Cláudia Maria Cunha Ribeiro

    2006-12-01

    Full Text Available OBJETIVO: A proposta deste estudo foi caracterizar por meio de tomografia computadorizada de alta resolução do tórax as principais alterações pulmonares do edema pulmonar hidrostático. MÉTODOS: Foram analisadas, retrospectivamente, as tomografias de quinze pacientes com quadro clínico de edema pulmonar hidrostático, divididos em cinco principais grupos etiológicos: insuficiência cardíaca congestiva, valvulopatia mitral aguda, infarto agudo do miocárdio, miocardite e mediastinite fibrosante, tendo sido sete pacientes classificados no primeiro grupo e dois em cada um dos demais. RESULTADOS: Os principais achados do edema hidrostático foram opacidades em vidro fosco (100%, espessamento dos septos interlobulares (100%, derrame pleural (87% e espessamento do interstício peribroncovascular (80%. Outros achados menos comuns foram aumento do calibre dos vasos, consolidações e nódulos do espaço aéreo. CONCLUSÃO: O padrão predominante encontrado nos pacientes estudados foi o de opacidades em vidro fosco associadas a espessamento dos septos interlobulares (padrão de pavimentação em mosaico, com derrame pleural bilateral, predominante à direita.OBJECTIVE: This study aimed to use high-resolution computed tomography scans of the chest to characterize the principal alterations occurring in cases of hydrostatic pulmonary edema. METHODS: A retrospective analysis was made of the tomography scans of 15 patients presenting clinical profiles of hydrostatic pulmonary edema. The cases were divided into five groups by etiology: congestive heart failure (n = 7; acute mitral valve disease (n = 2; acute myocardial infarction (n = 2; myocarditis (n = 2; and fibrosing mediastinitis (n = 2. RESULTS: The principal findings in the cases of hydrostatic pulmonary edema were ground-glass opacities (in 100%, interlobular septal thickening (in 100%, pleural effusion (in 87% and peribronchovascular interstitial thickening (in 80%. Other, less common

  13. Avaliação da reprodutibilidade da tomografia computadorizada no estadiamento da pancreatite aguda Reproducibility in the assessment of acute pancreatitis with computed tomography

    OpenAIRE

    Edison de Oliveira Freire Filho; David Carlos Shigueoka; Daniel Bekhor; Renata La Rocca Vieira; André Fukunishi Yamada; Maxime Figueiredo de Oliveira Freire; Sergio Ajzen; Giuseppe D'Ippolito

    2007-01-01

    OBJETIVO: Medir a reprodutibilidade da tomografia computadorizada sem e com contraste na avaliação da gravidade da pancreatite aguda. MATERIAIS E MÉTODOS: Cinqüenta e um exames de tomografia computadorizada abdominal sem e com contraste de pacientes com pancreatite aguda foram analisados por dois radiologistas (observadores 1 e 2). Calculamos o índice morfológico pela tomografia computadorizada sem e com contraste, separadamente, e o índice de gravidade da tomografia computadorizada para panc...

  14. Preferência manual na ação de alcançar em bebês em função da localização espacial do alvo Infants' manual preference in reaching regarding spatial target location

    Directory of Open Access Journals (Sweden)

    Rosana Machado Souza

    2011-01-01

    Full Text Available Preferência manual em bebês de 5 meses de idade foi avaliada em tarefas de alcançar alvos estáticos posicionados na linha média, à direita e à esquerda com referência a coordenadas egocêntricas. A análise da frequência de uso das mãos indicou direção e magnitude de preferência manual diversificadas entre os bebês. Foi observado que os bebês realizaram predominantemente alcances ipsilaterais para alvos posicionados lateralmente. Para alcances na linha média a frequência de uso foi semelhante entre as mãos direita e esquerda. Os resultados sugerem que nessa fase do desenvolvimento a preferência manual para o alcançar é alterada pela posição dos objetos no espaço.Manual preference of 5-month-old infants was evaluated in tasks of reaching static targets positioned on the midline, at the left and right, regarding egocentric coordinates. Frequency analysis of using the hands pointed out to diversified direction and magnitude of manual preference among infants. It was observed that they predominantly made ipsilateral reaches toward targets laterally positioned. Frequency of using the right and left hands was similar for targets located at the midline. The results suggest that in this stage of development manual preference is shifted by the spatial position of the objects.

  15. Calcificações intracranianas maciças em um paciente com lúpus eritematoso sistêmico Massive intracranial calcifications in a patient with systemic lupus erythematosus

    OpenAIRE

    Gasparetto, Emerson L.; Sergio E. Ono; Arnolfo de Carvalho Neto

    2004-01-01

    O envolvimento do sistema nervoso central em pacientes com lúpus eritematoso sistêmico é freqüentemente relatado. Os exames de tomografia computadorizada e ressonância magnética demonstram achados como atrofia cerebral, infarto cerebral e/ou hemorragia intracraniana. Calcificações intracranianas maciças em pacientes com lúpus eritematoso sistêmico são raras. Os autores apresentam um paciente com lúpus eritematoso sistêmico e crises convulsivas, cuja tomografia computadorizada demonstrou exten...

  16. Pneumonia lipídica - aspectos na tomografia computadorizada: relato de caso Lipoid pneumonia: computed tomography findings - a case report

    Directory of Open Access Journals (Sweden)

    Janos Farias

    2004-02-01

    Full Text Available Os autores relatam um caso de pneumonia lipídica em um paciente de 80 anos de idade, que iniciou o quadro com dispnéia em repouso. Havia história de constipação crônica, com uso freqüente de laxativos oleosos. O paciente apresentava diminuição do nível de consciência e os familiares relatavam tosse e engasgos freqüentes, durante o uso do medicamento. As radiografias de tórax demonstravam consolidação localizada no segmento posterior do lobo superior do pulmão direito, além de opacidades mal definidas nos lobos inferiores e que não se modificavam em exames sucessivos. A tomografia computadorizada de alta resolução mostrou consolidações com medidas de densidade negativas em seu interior, variando de -29 a -83 UH, e opacidades em vidro fosco localizadas no lobo superior do pulmão direito e nos lobos inferiores, com predomínio nos segmentos posteriores. O diagnóstico foi feito através do lavado bronco-alveolar, que evidenciou a presença do material oleoso. O paciente foi orientado a interromper o uso de laxativos oleosos e não retornou para o controle ambulatorial.The authors report a case of lipoid pneumonia in an 80-year-old man with chronic constipation in regular use of mineral oil as a laxative. According to his family, he experienced coughing episodes when he took his medication. He also presented dyspnea at rest and diminished consciousness levels. Chest radiographs showed a consolidation area in the posterior segment of right upper lobe, which did not change on successive exams. High resolution computed tomography demonstrated low-density consolidation with negative Hounsfield units (-29 to -83 UH and ground-glass opacities in the right upper lobe and inferior lobes. These opacities predominated in the posterior regions of the lungs. The diagnosis was confirmed by the presence of oil material on bronchoalveolar washing. The patient was advised to discontinue the ingestion of mineral oil and did not return for

  17. AVALIAÇÃO DA QUALIDADE DO AR PELA MUDANÇA DA MATRIZ ENERGÉTICA EM USINA TERMOELÉTRICA: ÓLEO PARA MISTURA ÓLEO-GÁS NATURAL

    Directory of Open Access Journals (Sweden)

    Fernando Pêgas da Silva

    2016-08-01

    Full Text Available O petróleo ainda é a mais importante fonte de energia até o presente momento; porém, por razões ambientais as usinas térmicas a óleo diesel no Estado do Amazonas estão sendo convertidas ao gás natural, com o fortalecimento do processo marcado pela presença e intensificação das empresas na Zona Franca de Manaus e crescimento demográfico da Região Metropolitana de Manaus. A partir deste cenário que impacta diretamente a qualidade do ar, buscou-se caracterizar as mudanças dos índices dos efluentes gasosos quando da alteração da matriz energética de óleo combustível para gás natural na usina Companhia Energética Manauara (UTE Manauara – Manaus/AM. A metodologia utilizada empregou os dados (de 2007 a 2013 resultantes do monitoramento de emissões gasosas (NO2, SO2, material particulado e qualidade do ar (partículas totais em suspensão, NO2, SO2, CO, O3,fumaça. A partir destes observou-se que os parâmetros analisados apresentaram no geral um comportamento positivo à mudança de combustível, diferenciado apenas para o NO2. Havendo necessidade de adequação da legislação ambiental para o estabelecimento de limites precisos para a mistura óleo-gás natural, segundo critérios de qualidade para a região Amazônica.

  18. Conductive/convective drying of long fiber cellulose Secagem condutiva/convectiva de celulose fibra longa com ar ambiente em convecção forçada

    Directory of Open Access Journals (Sweden)

    Oswaldo Curty da Motta Lima

    2001-05-01

    Full Text Available Research deals with aspects in conductive/convective drying of long fiber cellulose sheets over heated surfaces under forced air conditions provided by an adjustable blower. Its aim is to analyze the influence of drying (heated surface temperature and air velocity in the behavior of the drying curves, drying rate curves and samples temperature profiles. Influence was analyzed through the classic proposal of two drying rate periods. The constant drying rate dependence upon surface temperature and air condition was studied from a heat transfer point of view. Heat transferred by the heated surface is used partly to evaporate water from solid and partly it is lost into ambient air. For the falling rate period, a linear (proportional reduction of the constant rate was verifiedEste trabalho teve como objetivo analisar a secagem condutiva/convectiva de folhas de celulose de fibra longa, na operação com ar ambiente em convecção forçada para diferentes condições operacionais da temperatura de secagem (superfície metálica aquecida e da velocidade do ar na superfície das amostras. Foram estudados aspectos da cinética de secagem, a partir do levantamento das curvas de secagem, taxa de secagem e perfis de temperatura, sendo seu comportamento avaliado através da abordagem clássica de dois períodos de secagem. Os valores encontrados para as taxas de secagem do período constante foram ajustados através de um balanço térmico para esta fase, ou seja, pela equivalência entre o calor transferido entre a superfície aquecida, as amostras de celulose e o ar, e o calor envolvido no processo de evaporação. Já para o período de taxa decrescente, foi verificada a possibilidade de aplicação de uma redução linear da taxa constante

  19. Round alectasis: Study with linear tomography, computed tomography and bronchography. Atelectasia redonda: Estudio con tomografia lineal, tomografia computerizada y broncografia

    Energy Technology Data Exchange (ETDEWEB)

    Garcia Aguayo, F.J.; Calpe, J.L.; Chiner, E.

    1990-01-01

    Diagnosis of round atelectasis (RA) has been carried out in five patients with simple radiography (SR) and linear tomography (LT). These procedures showed in all patients curved bronchovascular parcel towards pseudotumor, main diagnosis criterior. Computed tomography effectiveness was less than SR and LT, but revealed bilateral lesion in patient and moreover, shape, size and relations of RA with pleura. CT also showed in a patient AR development from effusion of slow resolution, corroborating pathogenic hypothesis of Hanke. In four cases bronchography was performed, confirming curvature and bronchial penetration in AR. (Author)

  20. Teores de nutrientes em cultivares de café arábica submetidos à deriva de glyphosate Nutrient content in arabica coffee cultivars subjected to glyphosate drift

    Directory of Open Access Journals (Sweden)

    A.C França

    2010-12-01

    Full Text Available Avaliaram-se, neste trabalho, os efeitos do glyphosate sobre os teores foliares de nutrientes em três cultivares de café (Coffea arabica. Utilizou-se o esquema fatorial (3 x 5 em delineamento de blocos casualizados, com quatro repetições, sendo os tratamentos compostos por três cultivares de café: Catucaí Amarelo (2 SL, Oeiras (MG-6851 e Topázio (MG-1190; e cinco doses de glyphosate (0; 57,6; 115,2; 230,4; e 460,8 g ha-1. Aos 45 e 120 DAA, coletaram-se folhas (terceiro par de ramos plagiotrópicos, contidos na parte mediana das plantas. Os sintomas de intoxicação foram caracterizados por clorose e estreitamento do limbo foliar para os três cultivares de café. Houve redução nos teores foliares de N, P, K, Cu e Zn aos 45 DAA e de N, K, Mn e Zn aos 120 DAA nas plantas de café tratadas com glyphosate, independentemente do cultivar utilizado. O cultivar Topázio apresentou as maiores reduções nos teores foliares de Fe e Mn, aos 45 DAA, e de P e Fe, aos 120 DAA.The effects of glyphosate on the foliar levels of nutrients in three coffee cultivars (Coffea arabica were evaluated in this work. A factorial (3 x 5 was used in a randomized block design with four replications, with treatments consisting of three coffee varieties: Catucaí Amarelo (2 SL, Oeiras (MG-6851 and Topázio (MG-1190 and five glyphosate doses (0, 57.6, 115.2, 230.4 and 460.8 g ha-1. At 45 and 120 DAA, leaves (third pair from plagiotrophic branches were collected from the medium part of the plants. Glyphosate intoxication symptoms were characterized by chlorosis and leaf narrowing for the three coffee varieties. There was a reduction in foliar levels of N, P, K, Cu and Zn at 45 DAA, and N, K, Mn and Zn at 120 DAA, in coffee plants treated with glyphosate, regardless of the cultivar used. Cultivar Topázio showed the greatest reductions in the foliar levels of Fe and Mn, at 45 DAA and P and Fe, at 120 DAA, when treated with glyphosate.

  1. Daños tóxicos en tejidos vegetales, producidos por aguas contaminadas con arsénico en Zimapán, Hidalgo, México Danos tóxicos em tecidos vegetais, produzidos por águas contaminadas com arsênio em Zimapán, Hidalgo, México

    OpenAIRE

    Francisco Prieto García; María de Los Ángeles Lechuga Vargas; María Aurora Méndez Marzo; Enrique Barrado Esteban; Juan Carlos Ggaytán Oyarzún

    2006-01-01

    Según estudios realizados en el periodo de 1992-1998 en las aguas de los pozos, norias y manantiales, del municipio de Zimapán, Estado de Hidalgo, México, se corroboró que existía un incremento en el contenido de arsénico rebasando los límites máximos permisibles por la Norma Oficial Mexicana. La determinación de arsénico en las muestras de aguas se realizó por absorción atómica (AAS), mediante generador de hidruros (GH). En este estudio se utilizó el Vicia faba como un bioensayo para evaluar...

  2. Tendências anuais e sazonais nos extremos de temperatura do ar e precipitação em campina grande - pb

    Directory of Open Access Journals (Sweden)

    Leydson Galvíncio Dantas

    2015-12-01

    Full Text Available RESUMO Devido à rápida expansão urbana e potencial turístico da região, o objetivo deste estudo foi a obtenção da distribuição temporal dos índices de extremos climáticos dependentes de dados diários de temperatura e precipitação, definido pela OMM, para o período de 1975 a 2011, e utilizando os testes estatísticos não paramétricos obter a magnitude das tendências dos referidos índices para a cidade de Campina Grande - PB. Os resultados mostram que as temperaturas mínimas e máxima diárias têm aumentado gradativamente ao longo das últimas décadas, apresentando tendências sazonais crescentes ao longo dos anos e que as temperaturas mínimas tiveram maior aumento. O número de dias e noites quentes por ano tem aumentado, proporcionando assim uma redução significativa dos dias e noites frias. Foi observado que as temperaturas mínimas e máximas apresentam maiores tendências de aumento nas estações do outono e primavera, respectivamente. Baseado nos índices extremos de precipitação, mesmo sem significância estatística, foi observado que as chuvas intensas tendem a aumentar, ocorrendo em um período menor de tempo.

  3. Modelo harmônico para a estimativa da temperatura do ar média mensal em diferentes locais do Estado do Rio Grande do Sul Harmonic model for estimating the average monthly air temperature in different locations of Rio Grande do Sul State, Brazil

    OpenAIRE

    Alberto Cargnelutti Filho; Ronaldo Matzenauer; Jaime Ricardo Tavares Maluf; Bernadete Radin

    2010-01-01

    O objetivo deste trabalho foi ajustar o modelo harmônico para a estimativa da temperatura do ar média mensal em 37 locais do Estado do Rio Grande do Sul, com os dados do período de 1931 a 2000. Em cada local, os dados de 1931 a 1990 (60 anos) foram utilizados para estimar os coeficientes do modelo harmônico, e os dados de 1991 a 2000 (10 anos), para a validação do modelo. Foram testadas a normalidade e homogeneidade de variâncias, estimadas tendências e incorporadas aos modelos harmônicos con...

  4. Nasoangiofibroma juvenil: concordância interobservadores no estadiamento por tomografia computadorizada Juvenile nasopharyngeal angiofibroma: interobserver agreement in cancer staging using computed tomography

    Directory of Open Access Journals (Sweden)

    Jefferson Luiz Gusso

    2001-08-01

    Full Text Available Com o advento da tomografia computadorizada, a avaliação dos locais de acometimento e extensão do nasoangiofibroma juvenil tornou-se mais precisa, o que facilitou o correto estadiamento pré-operatório. O objetivo deste trabalho é avaliar a concordância interobservadores, por meio da análise por tomografia computadorizada, de 15 casos de nasoangiofibroma juvenil em relação à extensão para locais relacionados com altos índices de recidivas. Todos os pacientes eram do sexo masculino, com idade média de 15,8 anos. A análise da concordância entre os observadores quanto à extensão e envolvimento da fossa infratemporal, seios esfenóide e cavernoso e fossa craniana média foi excelente, em relação à fissura orbitária superior foi boa e em relação à base do processo pterigóide e fossa craniana anterior foi ruim. Concluiu-se que a análise apresenta alta concordância entre os observadores para os locais estabelecidos, com exceção da base do processo pterigóide e da fossa craniana anterior.The advent of computed tomography permitted a much more precise evaluation of tumor localization, thus facilitating presurgical staging. The objective of this study was to evaluate the interobserver agreement on the analysis of computed tomography scans of 15 patients with juvenile nasopharyngeal angiofibroma, regarding assessment of tumor extension to sites of high recurrence rate. All patients were male and had a mean age of 15.8 years. The results of the interobserver agreement analysis regarding tumor invasion and extension to the infratemporal fossa, cavernous sinus, sphenoid sinus and medium cranial fossa were excellent. Identification of involvement of the superior orbital fissure was considered good. Interobserver agreement regarding tumor extension to the base of pterigoid process and anterior cranial fossa was considered poor. We concluded that there is a very good interobserver agreement on the evaluation of the established

  5. Complicações oftálmicas em pacientes com tumores malignos extra-orbitários Ophthalmic complications in patients with extraorbital malignant tumors

    OpenAIRE

    Ana Célia Baptista; Edson Marchiori; Edson Boasquevisque; Carlos Eduardo Lassance Cabral; Mário Bonfim

    2003-01-01

    OBJETIVO: Correlacionar as complicações oftálmicas, presentes em pacientes portadores de tumores malignos extra-orbitários, com o sítio de origem e diagnóstico histopatológico destas neoplasias, por meio de tomografia computadorizada. MÉTODOS: Foram estudados retrospectivamente, por tomografia computadorizada, 29 pacientes com neoplasias malignas extra-orbitárias, sem qualquer tratamento prévio do tumor, e evidência clínico-radiológica de comprometimento orbitário associado. RESULTADOS: Houve...

  6. Optimizing the width of strip weeding in arabica coffee in relation to crop age Largura da faixa de controle de plantas daninhas em café arábica em função da idade do cafeeiro

    Directory of Open Access Journals (Sweden)

    FC. Araújo

    2012-03-01

    Full Text Available The aim of this study was to determine the weed strip control (WSC required for adequate coffee growth after transplanting. A non-irrigated, field-planted (spaced 3.80 x 0.70 m crop was used. The experimental design was a randomized block, with four replicates. The treatments were arranged in a 9 x 18 split-plot design to test the WSC of 0, 15, 30, 45, 60, 90, 120, 150, and 190 cm, which involved continuously hand-weeding at each side of the coffee row, and 18 coffee growth measurements. Multiple regression analyses were carried out relating to growth-variables as a function of both WSC and growth-evaluation times. Brachiaria decumbens was the main weed accomplishing 88.5% of the total weed dry mass. The minimum width of the WSC increases as the crop ages after transplanting. Assuming reductions of 2% and 5% in the maximum coffee growth, the recommended WSC was 75 and 52 cm at 4 months after transplanting (MAT, 104 and 85 cm at 6 MAT, 123 and 105 cm at 9 MAT, 134 and 116 cm at 12 MAT, 142 and 124 cm at 15 MAT, and 148 and 131 cm at 18 MAT, respectively. It was concluded that integrated weed management in young coffee crops must focus on the weed control only in a minimum range along coffee rows, which increases with coffee plant age, keeping natural vegetation in the inter-rows.O objetivo deste estudo consistiu em determinar a faixa ideal de controle de plantas daninhas (FCPD necessária para um crescimento adequado do cafeeiro após o transplantio. Foi utilizada uma lavoura não irrigada, implantada no espaçamento de 3,80 x 0,70 m, em dezembro de 2008. O delineamento experimental foi em blocos casualizados, com quatro repetições. Os tratamentos foram dispostos em um esquema de parcelas subdivididas (9 x 18 para testar as FCPDs de 0, 15, 30, 45, 60, 90, 120, 150 e 190 cm, mantidas com capina contínua em cada lado da linha de café, bem como seus efeitos ao longo de 18 meses após o transplantio (MAT. Efetuaram-se análises de regressão m

  7. Comprometimento do espaço aéreo na silicose aguda dos jateadores de areia: aspectos na tomografia computadorizada de alta resolução Acute silicosis airspace involvement in sandblasters: high-resolution computed tomography findings

    Directory of Open Access Journals (Sweden)

    Edson Marchiori

    2002-10-01

    Full Text Available Neste trabalho são apresentados os aspectos observados nas tomografias computadorizadas de alta resolução de três pacientes, todos jateadores de areia, que desenvolveram a forma aguda da silicose. Todos apresentavam, na tomografia computadorizada de alta resolução, padrão predominante de ocupação do espaço aéreo, com áreas de consolidação com broncograma aéreo, e calcificações de permeio. Além disso, foram observados nódulos em vidro fosco, com distribuição centrolobular e com tendência à confluência. Nos três pacientes foram identificados linfonodos aumentados de volume nas regiões hilares e/ou mediastinais, e calcificações linfonodais.The authors report the high-resolution computed tomography findings of three sandblaster patients with acute silicosis. High-resolution computed tomography showed air space disease in all patients, with consolidation, air bronchogram, and parenchymal calcifications. Centrilobular ground-glass nodules, generally confluent, as well as calcified mediastinal and/or hilar nodes and enlarged lymph nodes were also seen in all patients.

  8. Resistência parcial à necrose dos frutos em genótipos de café arábica Partial resistance to fruit necrosis in arabic coffee genotypes

    Directory of Open Access Journals (Sweden)

    Gustavo Hiroshi Sera

    2009-01-01

    Full Text Available Neste trabalho, objetivou-se identificar em genótipos de café arábica (Coffea arabica L. fontes de resistência à necrose de frutos em condições de campo. As variáveis resistência à necrose de frutos ("NF", quantidade média de frutos por nó produtivo ("FN" e índice de luminosidade dentro da copa da planta ("LUM" foram avaliadas em ensaio de campo no IAPAR (Londrina, em dezembro de 2004, em cafeeiros com três anos de idade. Foi avaliada a variável "NF", atribuindo notas de 1 a 5 sendo 1 para plantas com 0 % a 5 % de frutos necrosados. "FN" foi avaliada seguindo uma escala de notas de 1 a 5, onde 1 representa plantas com 0 a 3 frutos/ nó e nota 5 com mais do que 15 frutos/ nó. A avaliação da variável "LUM" foi visual e seguiu as notas de 1 a 5, onde 1 representa plantas com pouca luminosidade dentro da copa da planta. Dos 19 genótipos avaliados, 2 apresentaram moderada resistência, 7 moderada suscetibilidade, 5 suscetíveis e 5 altamente suscetíveis. As cultivares Obatã IAC 1669-20 e Catucaí Vermelho 4-79 apresentaram o melhor nível de resistência parcial de campo, ou seja, com moderada resistência à necrose de frutos associada ao Colletotrichum spp.The aim of this research was to identify in Coffea arabica L. coffee genotypes resistance sources to fruit necrosis in field conditions. The variables fruit necrosis ("NF", fruits per productive nodes average ("FN" and luminosity index inside of the plant canopy ("LUM" were evaluated in field assay at IAPAR (Londrina, in December 2004 on three years old coffee trees. The "NF" variable were evaluated attributing scores from 1 to 5, where score 1 represented plants with 0 to 5 % of necrosed fruits. "FN" were evaluated following a score scale from 1 to 5, where score 1 represented plants with 0 to 3 fruits/ node and score 5 with more than 15 fruits/ node. The evaluation of the variable "LUM" was visual and followed the scores from 1 to 5, where score 1 represented plants with

  9. O valor da fase sem contraste na tomografia computadorizada do abdome The role of the unenhanced phase in the routine abdominal computed tomography

    Directory of Open Access Journals (Sweden)

    Ana Paula Klautau Leite

    2008-10-01

    Full Text Available OBJETIVO: Determinar o valor agregado da fase sem meio de contraste da tomografia computadorizada do abdome em pacientes sem diagnóstico determinado ou em estadiamento tumoral. MATERIAIS E MÉTODOS: Estudo prospectivo e transversal em 100 pacientes consecutivos submetidos a tomografia computadorizada abdominal sem e com meio de contraste intravenoso. Dois examinadores avaliaram todos os exames, procurando estabelecer, através da fase com meio de contraste intravenoso (primeira análise e posteriormente através da fase sem contraste (segunda análise, o diagnóstico principal e os secundários em função da indicação clínica do exame. Mediu-se a freqüência de mudança diagnóstica decorrente da análise combinada das fases pré- e pós-contraste intravenoso. Casos que tiveram mudança diagnóstica foram avaliados por especialistas clínicos para determinar se implicaria mudanças de conduta. RESULTADOS: Diagnósticos principal e secundário foram modificados em 1 e 18 casos, respectivamente (p = 1,000; p = 0,143. Os diagnósticos modificados foram: esteatose, definição de nódulo em adrenal, nefrolitíase, classificação de cistos renais e calcificação hepática. Nos casos em que a fase sem contraste modificou o diagnóstico, os especialistas mudaram sua conduta em 14/19 (73% dos pacientes (p = 0,038. CONCLUSÃO: A fase sem contraste não modificou significativamente o diagnóstico principal ou secundário. Porém, as mudanças nos diagnósticos secundários influenciaram na conduta adotada pelos especialistas.OBJECTIVE: To determine the role of the unenhanced phase of abdominal computed tomography in patients without a definite diagnosis or undergoing tumor staging. MATERIALS AND METHODS: A prospective and transversal study was developed with 100 consecutive patients submitted to unenhanced and contrast-enhanced abdominal computed tomography. Two observers evaluated all the computed tomography images in the contrast-enhanced phase

  10. Tomografia por emissão de pósitrons com 18F fluordesoxiglicose como exame não invasivo para o diagnóstico de sarcomas primários de artéria pulmonar 18F-fluorodeoxyglucose positron emission tomography as a noninvasive method for the diagnosis of primary pulmonary artery sarcoma

    OpenAIRE

    Olívia Meira Dias; Elisa Maria Siqueira Lombardi; Mauro Canzian; José Soares Júnior; Lucas de Oliveira Vieira; Mário Terra Filho

    2011-01-01

    Os sarcomas de artéria pulmonar são tumores raros e de difícil diagnóstico, simulando frequentemente o tromboembolismo pulmonar crônico. Relatamos dois casos de pacientes do sexo feminino com quadro clínico de dispneia e massas pulmonares associadas a falhas de enchimento na artéria pulmonar em angiotomografia de tórax. A tomografia por emissão de pósitrons com 18F fluordesoxiglicose mostrou hipercaptação das respectivas lesões. O sarcoma de artéria pulmonar foi confirmado posteriormente por ...

  11. Estudo da morfologia macular após a remoção da membrana epirretiniana idiopática utilizando a tomografia de coerência óptica (OCT): um estudo piloto Study on macular morphology after removal of the idiopathic epiretinal membrane using the optical coherence tomography (OCT): a pilot study

    OpenAIRE

    Janaína Jamile Ferreira Saraceno; Ismênia Machado Mateus; Tâmara Lopes Machado; Fernando Pistarini Gonçalves; Alan Diego Negretto; Yoshitaka Nakashima; André Marcelo Vieira Gomes; Suel Abujamra

    2007-01-01

    OBJETIVO: Descrever a relação entre os resultados visuais e a morfologia macular através da tomografia de coerência óptica (OCT) em pacientes submetidos à remoção da membrana epirretiniana idiopática. MÉTODOS: Dez olhos de 10 pacientes com diagnóstico de membrana epirretiniana idiopática foram incluídos neste estudo. Todos os olhos foram submetidos à vitrectomia posterior via pars plana pelo mesmo cirurgião, durante o período de fevereiro de 2002 a março de 2004. A acuidade visual corrigida u...

  12. Estado nutricional e teste do hidrogênio no ar expirado com lactose e lactulose em crianças indígenas terenas Nutritional status and breath hydrogen test with lactose and lactulose in Terena Indian children

    Directory of Open Access Journals (Sweden)

    Gildney Maria dos Santos Alves

    2002-04-01

    Full Text Available Objetivo: avaliar o estado nutricional, a absorção e a tolerância à lactose e a ocorrência de sobrecrescimento bacteriano no intestino delgado.Métodos: estudo transversal envolvendo todas as 264 crianças índias Terenas, menores de 10 anos, das aldeias Limão Verde e Córrego Seco, em Aquidauana (MS. O estado nutricional foi avaliado pelo peso e pela estatura, relacionados com a referência do NCHS. Após a ingestão de 18 gramas de lactose, foi avaliada sua absorção, pelo teste do hidrogênio no ar expirado, e a tolerância de acordo com o aparecimento de manifestações clínicas. Sobrecrescimento bacteriano no intestino delgado foi avaliado com o teste do hidrogênio no ar expirado após a administração de lactulose (5g. Resultados: a mediana dos escores Z do peso-idade, peso-estatura e estatura-idade para as crianças com idade inferior a 12 meses (n=34 foram, respectivamente: -0,66, +0,60 e -0,85. Entre 1 e 5 anos (n=111 foram, respectivamente: -0,50, +0,28 e -1,17. Entre os 5 e 10 anos (n=119, estes valores foram, respectivamente: -0,09, +0,50 e -0,60. Após os 4 anos (n=197, absorção deficiente e má absorção de lactose foi observada em 89,3% das 197 crianças avaliadas. Intolerância à lactose foi observada em 37,1% destas 197 crianças. Sobrecrescimento bacteriano no intestino delgado foi caracterizado em 11,5% das crianças índias terenas (n=252.Conclusões: a prevalência de desnutrição atual foi baixa, mas a mediana de estatura para idade foi inferior à referência do NCHS. Prevalência de deficiência ontogenética de lactase é elevada. Sobrecrescimento bacteriano sugere a existência de enteropatia ambiental assintomática nas crianças índias terenas.Objective: to evaluate the nutritional status, absorption and tolerance of lactose and the occurrence of small-bowel bacterial overgrowth. Methods: a cross-sectional study including all 264 Terena Indian children younger than 10 years from two tribes (Lim

  13. Comparação morfométrica da orelha interna entre ovinos e humanos através da tomografia computadorizada CT-Scan sheep and human inner ear morphometric comparison

    Directory of Open Access Journals (Sweden)

    Valter Ayres Seibel

    2006-06-01

    Full Text Available INTRODUÇÃO: trabalhos sobre o uso de ovelhas em cirurgias experimentais e treinamento em cirurgia otológica são raros. Este estudo pretende contribuir para ampliar o conhecimento nessa área. OBJETIVO: Estudar a orelha interna da ovelha por meio de tomografia computadorizada e cortes sucessivos com o intuito de apresentar dados morfométricos mais precisos relacionados à comparação entre a orelha de ovelhas e a de humanos. MATERIAL E MÉTODO: Foi realizado um estudo descritivo sem seguimento no qual foram comparadas as estruturas da orelha interna da ovelha com as dos humanos. As medidas foram obtidas através de tomografias computadorizadas e avaliadas por meio de um programa de análise de imagens médicas (Osíris 4.16. RESULTADOS: O estudo morfológico da orelha da ovelha, em média, e da orelha humana, em média, revelaram grande similaridade de anatomia. A maior parte das estruturas (10 de 15 preservou a relação proposta de 2/3 da dimensão humana em relação à dimensão ovina. CONCLUSÃO: Os achados contribuem para uso da orelha da ovelha como modelo em cirurgia experimental e treinamento em cirurgia otológica.INTRODUCTION: Studies about the use of sheep in surgical training and experimental otologic surgery are rare. This study intends to contribute to the knowledge on this field. AIM: To study sheep inner ear structures using computerized tomography and serial cross-sections to collect more accurate morphometric data to compare sheep and human ears. MATERIAL AND METHODS: This descriptive study compared the inner structures of sheep and human ears. Measurements were made using computerized tomography, and they were stored in a DICOM compact disc for later analysis and manipulation, with a program used for medical image analysis (Osíris 4.16. RESULTS: Mean measures for sheep and human ears were found to be similar in this morphological study. Most structures (10 out of 15 maintained the 2/3 ratio of sheep to human ear

  14. Análise de dentição mista: tomografia versus predição e medida radiográfica Mixed-dentition analysis: tomography versus radiographic prediction and measurement

    OpenAIRE

    Letícia Guilherme Felício; Antônio Carlos de Oliveira Ruellas; Ana Maria Bolognese; Eduardo Franzotti de Sant'Anna; Mônica Tirre de Souza Araújo

    2010-01-01

    OBJETIVO: o objetivo dos autores desse estudo foi comparar o método de análise de dentição mista que utiliza tomografia computadorizada de feixe cônico para avaliar os diâmetros dos dentes intraósseos com os métodos de Moyers, Tanaka-Johnston e radiografias oblíquas em 45º. MÉTODOS: foram realizadas medidas, na arcada inferior, dos diâmetros mesiodistais dos incisivos permanentes irrompidos, nos modelos de gesso com auxílio de paquímetro digital e estimativa do tamanho de pré-molares e canino...

  15. Correlação entre hipótese diagnóstica e laudo de tomografia axial computadorizada craniana Correlation between diagnostic hypothesis and result of cranial computed axial tomography

    OpenAIRE

    Edison Matos Nóvak; Fábio Terabe; André Luís Nasimoto; Paulo Henrique Migliari de Carvalho; Ariane Desirée Loper; Fabiana Schenato Büchele; Júlio César Nogara

    2001-01-01

    Para avaliar a utilização da tomografia axial computadorizada craniana (TC) em nosso meio, analisamos as solicitações de 367 exames consecutivos no período compreendido entre 07/1995 e 07/1996. Houve ampla variação da faixa etária, com média de 31,7 ± 22,9 anos. As especialidades que mais solicitaram o exame foram: Neurologia (36,2%), Pronto Atendimento (17,4%), Neuropediatria (16,9%) e Clínica Médica (5,9%). As indicações mais frequentes para o exame foram: convulsão (30%), cefaléia (26,2%),...

  16. Miocárdio viável pela tomografia computadorizada com Tc-99m (MIBI) sensibilizada por nitroglicerina endovenosa Viable myocardium scintigraphy with intravenous nitroglycerine by computed tomography with Tc-99m (MIBI)

    OpenAIRE

    José Ramos Filho; Marcos Welber Nascimento; Rafael Mariano Gislon da Silva; Thiago Negrini de Camargo; Roberto Simões de Almeida; Eloá Jacinto Lima

    2008-01-01

    FUNDAMENTO: A seleção de pacientes com doença coronariana crônica para recanalização baseia-se na detecção do miocárdio comprometido, potencialmente viável. OBJETIVO: Avaliar o miocárdio isquêmico, potencialmente viável pelo SPECT com MIBI sensibilizado por nitroglicerina em dose máxima tolerada. MÉTODOS: Investigamos de forma prospectiva, de abril de 2004 a novembro de 2005, pela tomografia computadorizada por emissão de fóton único SPECT com Tc-99m (MIBI), 40 pacientes (média etária 62 ± 8,...

  17. CARCINOMA BRONQUÍOLO-ALVEOLAR: ASPECTOS NA TOMOGRAFIA COMPUTADORIZADA DE ALTA RESOLUÇÃO

    OpenAIRE

    Moreira Luiza Beatriz Melo; Marchiori Edson; Melo Alessandro Severo Alves de; Magnago Marcelo; Muniz Maria Angélica Soares; Irion Klaus

    2002-01-01

    O carcinoma bronquíolo-alveolar é um tipo de carcinoma broncogênico de crescimento insidioso, que surge nas paredes das vias aéreas distais e se dissemina utilizando o septo alveolar como um estroma, preservando a arquitetura pulmonar. Neste trabalho foram analisadas as tomografias computadorizadas de alta resolução de 17 pacientes com carcinoma bronquíolo-alveolar. Ao contrário do relatado na literatura, foram observados predomínio no sexo masculino (71%) e maior freqüência da associação das...

  18. VAZÕES ESPECÍFICAS MÍNIMAS PARA SECAGEM DO MILHO COM AR NATURAL EM BOTUCATU-SP MINIMUM AIRFLOW RATES TO DRY CORN GRAIN WITH NATURAL AIR IN BOTUCATU-SP

    Directory of Open Access Journals (Sweden)

    V. A. Gonçalves

    2007-09-01

    Full Text Available

    Recomendam-se à secagem com ar natural vazões específicas suficientemente baixas, reduzindo a potência requerida pelo ventilador e contribuindo para o arrefecimento da sobressecagem. Através de modelos matemáticos de simulação foram determinadas as vazões específicas mínimas necessárias à secagem com ar natural do milho a granel, nas condições climáticas do município de Botucatu, no Estado de São Paulo, correspondentes aos meses de março a junho do ano de 1971, cujo potencial de secagem foi o mais drástico dentro de um período de 10 anos analisado. Foram considerados para o milho os teores de umidade inicial, base úmida, de 22%, 20% e 18%, obtendo-se os respectivos períodos de armazenamento seguro de 7, 11 e 29 dias, em função da temperatura média de 23,40C do mês de março de 1975, a mais elevada do período de 10 anos analisado. Outrossim, as médias empregadas, temperatura de bulbo seco e umidade relativa, foram obtidas a partir dos registros horários do termo-higrógrafo, localizado na Estação Meteorológica da Faculdade de Ciências Agronômicas de Botucatu, no Estado de São Paulo. Foi considerada somente a secagem seletiva dentro dos períodos diários das 9 às 17 horas, 9 às 18 horas e 8 às 18 horas, dada a impossibilidade de realização da secagem contínua, já que as condições de equilíbrio entre o ar e o grão não possibilitaram a redução do teor de umidade final ao nível recomendado ao armazenamento seguro. Constatou-se que a queda do teor de umidade de equilíbrio do grão em poucos pontos percentuais acarreta elevados decrementos nas vazões específicas mínimas requeridas. Outrossim, uma redução de poucas horas no período diário de operação do ventilador requer significativos incrementos nas vazões específicas mínimas para a realização da secagem dentro do tempo de secagem admissível.

  1. Technical competence in cardiovascular magnetic resonance and computed tomography; Competencia tecnica em ressonancia e tomografia cardiovascular

    Energy Technology Data Exchange (ETDEWEB)

    Fernandes, Juliano Lara; Shiozaki, Afonso Akio; Azevedo Filho, Clerio Francisco de; Rochitte, Carlos Eduardo; Pinto, Ibraim Marciarelli Francisco; Lopes, Marly Maria Uellendahl; Schvartzman, Paulo Roberto, E-mail: jlaraf@fcm.unicamp.br [Universidade de Campinas (UNICAMP/GERT) SP (Brazil). Grupo de Estudo em Ressonancia e Tomografia Cardiovascular

    2009-10-15

    Cardiovascular magnetic resonance and computed tomography have evolved as very practical and useful techniques applied in clinical cardiology. Due to their rapid acceptance in the cardiology community and widespread use, training of both cardiologists and radiologists on this subspecialty has not been homogeneous so far. This in part explains significant differences observed in the diverse background found in today’s practicing physicians who execute these exams. In order to guide training facilities as well as both payers, contractors and general cardiologists ordering the exam, this document provides a minimum standard that should be accomplished by all physicians who pursue education in the field and for those who already practice in it. The clinical competences listed in this statement are by no means thorough but should be required by all those involved in cardiovascular magnetic resonance and computed tomography as the customary requirements for current and future practitioners. (author)

  2. Dose assessment in pediatric computerized tomography; Avaliacao de doses em tomografia computadorizada pediatrica

    Energy Technology Data Exchange (ETDEWEB)

    Vilarinho, Luisa Maria Auredine Lima

    2004-07-01

    The objective of this work was the evaluation of radiation doses in paediatric computed tomography scans, considering the high doses usually involved and the absence of any previous evaluation in Brazil. Dose values were determined for skull and abdomen examinations, for different age ranges, by using the radiographic techniques routinely used in the clinical centers investigated. Measurements were done using pencil shape ionization chambers inserted in polymethylmethacrylate (PMMA) phantoms. These were compact phantoms of different diameters were specially designed and constructed for this work, which simulate different age ranges. Comparison of results with published values showed that doses were lower than the diagnostic reference levels established to adults exams by the European Commission. Nevertheless, doses in paediatric phantoms were higher than those obtained in adult phantoms. The paediatric dose values obtained in Hospitals A and B were lower than the reference level (DRL) adopted by SHIMPTON for different age ranges. In the range 0 - 0.5 year (neonatal), the values of DLP in Hospital B were 94 por cent superior to the DRL For the 10 years old children the values of CTDI{sub w} obtained were inferior in 89 por cent for skull and 83 por cent for abdomen examinations, compared to the values published by SHRIMPTON and WALL. Our measured CTDI{sub w} values were inferior to the values presented for SHRIMPTON and HUDA, for all the age ranges and types of examinations. It was observed that the normalized dose descriptors values in children in the neonatal range were always superior to the values of doses for the adult patient. In abdomen examinations, the difference was approximately 90% for the effective dose (E) and of 57%.for CTDI{sub w} . (author)

  3. Avaliação pulmonar em crianças portadoras de cardiopatia congênita acianótica e hiperfluxo pulmonar através de tomografia computadorizada Evaluación pulmonar en niños portadores de cardiopatía congénita acianótica e hiperflujo pulmonar a través de tomografía computadorizada Computed tomography in pulmonary evaluation of children with acyanotic congenital heart defect and pulmonary hyperflow

    Directory of Open Access Journals (Sweden)

    Solange Gimenez

    2009-10-01

    Full Text Available JUSTIFICATIVA E OBJETIVOS: Disfunção respiratória é frequente em crianças com cardiopatias congênitas acianóticas com hiperfluxo pulmonar (CCAHP, porém pouco é conhecido sobre a estrutura pulmonar destes pacientes. O objetivo deste estudo foi quantificar os volumes de gás e tecido e a distribuição da aeração pulmonar nesta população. MÉTODOS: Após aprovação do Comitê de Ética institucional e obtenção do consentimento escrito pós-informado, foram obtidas tomografias computadorizadas torácicas em sete crianças com CCAHF. As imagens pulmonares direita e esquerda foram contornadas em todas as imagens e os volumes e pesos pulmonares foram computados a partir dos dados volumétricos. As comparações entre esquerda e direita foram analisadas usando teste t de Student pareado e as correlações através de regressão exponencial. RESULTADOS: A idade mediana foi 20 meses e o peso foi de 9,9 kg. Volume pulmonar total (VPT foi de 66,7 ± 23,1 mL.kg-1, o de tecido 33,5 ± 15,7 mL.kg-1 e o de gás 33,1 ± 8,3 mL.kg-1. O pulmão direito representou 57,9% e o pulmão esquerdo 42,1% do VPT (p JUSTIFICATIVA Y OBJETIVOS: La disfunción respiratoria es frecuente en niños con cardiopatías congénitas acianóticas con hiperflujo pulmonar (CCAHP, sin embargo, se conoce muy poco sobre la estructura pulmonar de esos pacientes. El objetivo de este estudio, fue cuantificar los volúmenes de gas y tejido y la distribución de la aeración pulmonar en esa población. MÉTODOS: Después de la aprobación por parte del Comité de Ética Institucional y de la obtención del consentimiento escrito informado, se obtuvieron tomografías computadorizadas torácicas en siete niños con CCAHF. Las imágenes pulmonares derecha e izquierda fueron perfiladas en todas las imágenes, y los volúmenes y los pesos pulmonares fueron computados a partir de los datos volumétricos. Las comparaciones entre izquierda y derecha fueron analizadas usando el test t de

  4. Forma tumoral da cisticercose cerebral: diagnostico pela tomografia computadorizada

    Directory of Open Access Journals (Sweden)

    Milton K. Shibata

    1980-12-01

    Full Text Available A TC permitiu identificar a forma tumoral da cisticercose cerebral em 6 pacientes, durante investigação para esclarecimento de síndromes convulsivas. As alterações angiográficas eram mínimas. As imagens tomográficas, por sua vez, não forneceram dados que permitissem o diagnóstico diferencial com neoplasias cerebrais. O exame do LCR também não contribuiu para estabelecer o diagnóstico etiológico, que só foi firmado após a extirpação da lesão.

  5. Comparação entre fatores de calibração em termos de dose absorvida no ar para uma câmara de ionização de placas paralelas Comparison of absorbed dose to air calibration factors for a parallel plate ionization chamber

    Directory of Open Access Journals (Sweden)

    Roseli T. Bulla

    2006-06-01

    Full Text Available OBJETIVO: O objetivo deste trabalho foi realizar uma comparação entre os fatores de calibração em termos de dose absorvida no ar determinados em feixes gama (60Co e de elétrons. MATERIAIS E MÉTODOS: Foram utilizados um irradiador de 60Co e um acelerador linear Varian, modelo Clinac 2100C, com feixes de fótons e de elétrons. Foram testadas uma câmara de ionização cilíndrica e três de placas paralelas. RESULTADOS: Os sistemas de medidas foram submetidos aos testes preliminares (estabilidade de resposta e corrente de fuga, com resultados muito bons. Os fatores de calibração em termos de dose absorvida no ar foram determinados utilizando-se quatro sistemas de medidas e dois tipos de objetos simuladores, com a obtenção de resultados dentro das recomendações internacionais. CONCLUSÃO: Os resultados mostraram que os fatores de calibração em termos de dose absorvida no ar obtidos para câmaras de ionização de placas paralelas, determinados em feixes de 60Co, são no máximo 1,2% mais altos que os valores obtidos em feixes de elétrons de altas energias.OBJECTIVE: The objective of this study was to compare the absorbed dose to air calibration factors determined in gamma (60Co and electron beams. MATERIALS AND METHODS: An irradiator with a 60Co source and a Varian, Clinac 2100C linear accelerator with photon and electron beams were utilized. One thimble-type and three parallel-plate ionization chambers were tested. RESULTS: The measurement systems were submitted to preliminary tests (response stability and leakage current, with quite good results. The absorbed dose to air calibration factors were determined using four measurement systems and two types of phantoms. Results were obtained in compliance with the international recommendations. CONCLUSION: Absorbed dose to air calibration factors obtained for parallel plate ionization chambers, determined in 60Co beams, at maximum, are 1.2% higher than the values obtained in high energy

  6. Avaliação da concentração de monóxido de carbono no ar exalado em tabagistas com DPOC Evaluation of the exhaled carbon monoxide levels in smokers with COPD

    Directory of Open Access Journals (Sweden)

    Gustavo Chatkin

    2010-06-01

    Full Text Available OBJETIVO: Medir os níveis de monóxido de carbono no ar exalado (COex em tabagistas com e sem DPOC. MÉTODOS: Tabagistas frequentadores dos ambulatórios do Hospital São Lucas em Porto Alegre (RS entre setembro de 2007 e março de 2009 foram convidados a participar do estudo. Os participantes responderam a um questionário com características demográficas e epidemiológicas e realizaram espirometria, medição de cotinina urinária e de COex. Os participantes foram agrupados conforme a presença de DPOC. RESULTADOS: Foram incluídos 294 tabagistas, 174 (59,18% diagnosticados com DPOC. Todos os participantes apresentavam níveis de cotinina urinária > 50 ng/mL. Os fumantes com DPOC apresentaram medianas significativamente superiores as do grupo sem DPOC para as variáveis idade e maços-ano (p OBJECTIVE: To measure exhaled carbon monoxide (COex levels in smokers with and without COPD. METHODS: Smokers treated at outpatient clinics of São Lucas Hospital in the city of Porto Alegre, Brazil, between September of 2007 and March of 2009 were invited to participate in this study. The participants completed a questionnaire regarding demographic and epidemiologic characteristics and were submitted to spirometry, as well as to determination of COex and urinary cotinine levels. The participants were divided into two groups: those with COPD and those without COPD. RESULTS: The study involved 294 smokers, of whom 174 (59.18% had been diagnosed with COPD. All of the participants presented with urinary cotinine levels > 50 ng/mL. Smokers with COPD presented significantly higher median values for age and pack-years than did those without COPD (p < 0.001 and p = 0.026, respectively. No other statistically significant differences were found. When adjusted for gender, age at smoking onset, number of cigarettes/day and urinary cotinine level, the mean values of COex were higher, but not statistically so, in the COPD group than in the non-COPD group (17.8 ± 0

  7. Paracoccidioidomicose pulmonar: aspectos na tomografia computadorizada de alta resolução High-resolution computed tomography findings in pulmonary paracoccidioidomycosis

    Directory of Open Access Journals (Sweden)

    Maria Angélica Soares Muniz

    2002-06-01

    Full Text Available O comprometimento pulmonar na paracoccidioidomicose é muito freqüente, podendo até ser a única manifestação da doença. Neste trabalho são analisados os aspectos encontrados nas tomografias computadorizadas de alta resolução do tórax de 30 pacientes com paracoccidioidomicose confirmada. Por meio desta análise foram determinados os achados mais comuns e suas formas de apresentação e distribuição nos pulmões. Os aspectos mais freqüentemente observados foram: espessamento esparso de septos interlobulares (96,7%, opacidades em vidro fosco (66,7%, nódulos (60%, aumento irregular do espaço aéreo (enfisema paracicatricial (56,7%, espessamento de paredes brônquicas (46,7%, espessamento pleural (36,7%, cavidades (36,7%, dilatação da traquéia (33,3%, distorção arquitetural (30%, consolidação do espaço aéreo (30%, bandas parenquimatosas (23,3%, reticulado intralobular (13,3% e espessamento irregular do interstício axial peri-hilar (10%. A radiografia do tórax apresenta limitada capacidade de avaliar doenças pulmonares difusas, tornando a tomografia computadorizada de alta resolução do tórax essencial para avaliação dos pacientes com paracoccidioidomicose pulmonar.Pulmonary disease in paracoccidioidomycosis is very common and in some cases can be the sole manifestation of the disease. We studied the findings observed in 30 patients with pulmonary paracoccidioidomycosis submitted to high-resolution computed tomography in order to determine the most frequent findings, presentation patterns and distribution of paracoccidioidomycosis lesions in the lungs. The most frequent findings observed on high-resolution computed tomography were: interlobular septal thickening (96.7%, ground-glass opacities (66.7%, nodules (60%, irregular air-space enlargement (56.7%, bronchial wall thickening (46.7%, pleural thickening (36.7%, cavitation (36.7%, tracheal dilatation (33.3%, architectural distortion (30%, air-space consolidation (30

  8. Apendicite epiplóica: aspectos na ultra-sonografia e na tomografia computadorizada

    Directory of Open Access Journals (Sweden)

    Melo Alessandro Severo Alves de

    2002-01-01

    Full Text Available A apendicite epiplóica é uma condição inflamatória incomum, porém cada vez mais freqüentemente diagnosticada pelos métodos de imagem atuais (tomografia computadorizada e ultra-sonografia, os quais possibilitam a adoção de conduta terapêutica não-invasiva e eficiente. Os autores estudaram seis casos de apendicite epiplóica por meio de tomografia computadorizada, que mostraram lesões ovaladas de 1 a 2 cm de diâmetro, de localização paracólica, com atenuação de gordura e pequena lâmina hiperdensa periférica com gordura marginal peritoneal espessada. Dois desses pacientes foram submetidos a ultra-sonografia, que demonstrou formações expansivas hiperecóicas, de aspecto ovóide, não compressíveis, localizadas sob o sítio de maior sensibilidade do abdome.

  9. PREVALÊNCIA DE DOENÇAS INFECCIOSAS EM REBANHO DE SUÍNOS CRIADOS AO AR LIVRE NA REGIÃO SUDOESTE DO PARANÁ, BRASIL PREVALENCE OF INFECTIOUS DISEASES IN A PIG BREEDING HERD RAISED OUTDOORS IN THE SOUTH-WESTERN REGION OF PARANÁ, BRAZIL

    OpenAIRE

    Laerte Francisco Filippsen; Denyse Maria Galvão Leite; Aparecido da Silva; Gilberto Alexandre Vargas

    2001-01-01

    O presente trabalho objetivou determinar a prevalência de doenças infecciosas em rebanho de suínos criados ao ar livre na região sudoeste do Paraná, no período de outubro de 1996 a junho de 1999. Foram examinados um total de 969 animais. Todas as ocorrências de enfermidades observadas nos animais foram registradas. Os animais mortos no período, além de um leitão por lote, sacrificado aos 28 dias pós-desmame, foram necropsiados. Amostras de sangue foram coletadas para realização de exames soro...

  10. Qualidade de maçãs ‘Gala’ armazenadas em atmosfera controlada dinâmica e estática com renovação do ar Quality of ‘Gala’ apples stored in dynamic and static controlled atmosphere with air renovation

    OpenAIRE

    Auri Brackmann; Ricardo Fabiano Hettwer Giehl; Josuel Alfredo Vilela Pinto; Cristiano André Steffens; Ivan Sestari

    2005-01-01

    Este experimento teve como objetivo avaliar o efeito da remoção periódica da atmosfera das câmaras de atmosfera controlada com ar e nova instalação, bem como o uso da atmosfera dinâmica, sobre a manutenção da qualidade da maçã 'Gala'. Os tratamentos utilizados foram: (1) controle (sem renovação); (2) renovação da atmosfera diariamente durante o resfriamento dos frutos; (3) renovação da atmosfera diariamente durante o resfriamento e mensalmente no período de armazenamento em atmosfera controla...

  11. Aquisição e manipulação de imagens por tomografia computadorizada da região maxilofacial visando à obtenção de protótipos biomédicos Acquisition and manipulation of computed tomography images of the maxillofacial region for biomedical prototyping

    Directory of Open Access Journals (Sweden)

    Maria Inês Meurer

    2008-02-01

    Full Text Available O processo de construção de protótipos biomédicos surgiu da união das tecnologias de prototipagem rápida e do diagnóstico por imagens. No entanto, este processo é complexo, em função da necessária interação entre as ciências biomédicas e a engenharia. Para que bons resultados sejam obtidos, especial atenção deve ser dispensada à aquisição das imagens por tomografia computadorizada e à manipulação dessas imagens em softwares específicos. Este artigo apresenta a experiência multidisciplinar de um grupo de pesquisadores com a aquisição e a manipulação de imagens por tomografia computadorizada do complexo maxilofacial, visando à construção de protótipos biomédicos com finalidade cirúrgica.Biomedical prototyping has resulted from a merger of rapid prototyping and imaging diagnosis technologies. However, this process is complex, considering the necessity of interaction between biomedical sciences and engineering. Good results are highly dependent on the acquisition of computed tomography images and their subsequent manipulation by means of specific softwares. The present study describes the experience of a multidisciplinary group of researchers in the acquisition and manipulation of computed tomography images of the maxillofacial region aiming at biomedical prototyping for surgical purposes.

  12. Estimativa da produtividade de arroz irrigado em função da radiação solar global e da temperatura mínima do ar Rice yield estimates based on global solar radiation and minimum air temperature

    Directory of Open Access Journals (Sweden)

    Silvio Steinmetz

    2013-02-01

    Full Text Available Considerando-se a importância da produção do arroz irrigado no Estado do Rio Grande do Sul e que o seu desempenho é influenciado pelas condições meteorológicas, o objetivo deste trabalho foi estimar a produtividade de grãos dessa cultura em função da radiação solar global e da temperatura mínima do ar, usando procedimentos de análise de regressão linear simples e múltipla. Realizou-se um experimento de campo, em Capão do Leão, RS, durante três anos agrícolas. Empregaram-se, em cada ano agrícola, seis datas de semeadura e oito cultivares de diferentes grupos de comprimento de ciclo. Dez colmos principais de cada cultivar foram marcados, para determinarem-se os principais estádios de desenvolvimento. A variável dependente (Y foi a média da produtividade de quatro repetições, de cada época de semeadura, e as variáveis independentes foram: a média da radiação solar global (X¹, a média da temperatura mínima do ar (X² e a média da temperatura mínima do ar elevada ao quadrado (X³, computadas em quatro períodos de desenvolvimento da planta para a radiação solar global e em três períodos para a temperatura mínima do ar. A maioria das variáveis, quando testadas isoladamente, apresentou uma relação linear significativa com a produtividade, mas os coeficientes de determinação (r² foram mais elevados nas regressões lineares múltiplas envolvendo as principais variáveis. Modelos de regressão que utilizam como variáveis preditoras a radiação solar global e a temperatura mínima do ar, em diferentes períodos de desenvolvimento da planta, mostram-se adequados para a estimativa da produtividade de grãos de arroz irrigado.Considering the importance of irrigated rice production in the State of Rio Grande do Sul and that its performance is influenced by the weather conditions, the objective of this study was to estimate the grain yield of this crop as a function of global solar radiation and minimum air

  13. Superdeformation of Ar hypernuclei

    Science.gov (United States)

    Isaka, Masahiro; Kimura, Masaaki; Hiyama, Emiko; Sagawa, Hiroyuki

    2015-10-01

    We investigate the differences in the Λ separation energies (S_Λ ) of the ground and superdeformed (SD) states in {}^{37}_Λ Ar, ^{39}_Λ Ar, and ^{41}_Λ Ar within the framework of antisymmetrized molecular dynamics (AMD). In this study, we find that the calculated S_Λ values in the SD states are much smaller than those in the ground states, unlike the result using the relativistic mean-field (RMF) calculation [B.-N. Lu et al., Phys. Rev. C, 89, 044307 (2014)]. One of the reasons for this difference between the present work and the RMF calculation is the difference in the density profile of the SD states in the core nuclei. We also find that the property of the Λ N odd-parity interaction affects the S_Λ trend between the ground and SD states.

  14. Protocolo para controle de eficácia terapêutica em disfagia orofaríngea neurogênica (PROCEDON) Efficacy control protocol in oropharyngeal dysphagia

    OpenAIRE

    Roberta Gonçalves da Silva; Adriana Gomes Jorge; Fernanda Matias Peres; Paula Cristina Cola; Ana Rita Gatto; André Augusto Spadotto

    2010-01-01

    OBJETIVO: apresentar uma proposta para o controle de eficácia terapêutica em disfagia orofaríngea neurogênica. MÉTODOS: o protocolo foi proposto em concordância com a literatura atual e aplicado em um indivíduo pós-acidente vascular encefálico (AVE) isquêmico à direita, comprovado por tomografia computadorizada, com disfagia orofaríngea grave crônica, gênero masculino, 66 anos, apresentando aspiração laringotraqueal e em uso de sonda nasoentérica exclusiva pré-fonoterapia. Para controle da ef...

  15. Application of the total etching technique or self-etching primers on primary teeth after air abrasion Aplicação da técnica de condicionamento total ou de "primers" autocondicionantes em dentes decíduos após abrasão a ar

    Directory of Open Access Journals (Sweden)

    Fábio Renato Manzolli Leite

    2005-09-01

    Full Text Available Since the use of air abrasion has grown in pediatric dentistry, the aim of this study was to evaluate, by means of shear bond strength testing, the need to use the total etching technique or self-etching primers on dentin of primary teeth after air abrasion. Twenty-five exfoliated primary molars had their occlusal dentin exposed by trimming and polishing. Specimens were treated by: Air abrasion + Scotchbond MultiPurpose adhesive (G1; 37% phosphoric acid + Scotchbond MP adhesive (G2; Clearfil SE (G3; Air abrasion + 37% phosphoric acid + Scotchbond MP adhesive (G4; Air abrasion + Clearfil SE (G5. On the treated surface, a cylinder of 2 mm by 6 mm was made using a composite resin (Z100. Duncan's test showed that: (G2 = G3 = G5 > (G1 = G4. The use of a self-etching primer on air abraded dentin is recommended to obtain higher bond strengths.Como o uso da abrasão a ar tem aumentado em odontopediatria, o objetivo deste trabalho foi avaliar a resistência ao cisalhamento da resina composta Z100 sobre a superfície dentinária de dentes decíduos após abrasionamento a ar associado ou não a técnica de condicionamento total (ácido fosfórico + Scotchbond Multi Purpose ou "primer" autocondicionante (Clearfil SE Bond. A superfície oclusal de 25 molares decíduos foi removida para exposição completa da superfície dentinária. Após polimento com lixas abrasivas, foram divididos em 5 grupos (5 espécimes em cada tratados por abrasão + adesivo Scotchbond (G1; condicionamento ácido + adesivo Scotchbond (G2; adesivo Clearfil (G3; abrasão a ar + condicionamento ácido + adesivo Scotchbond (G4; abrasão a ar + adesivo Clearfil (G5. Uma matriz bipartida foi adaptada à superfície dentinária e preenchida com resina composta. Após polimerização, corpos-de-prova de 2 mm x 6 mm foram obtidos. O teste de Duncan mostrou a desigualdade (G1 = G4 < (G2 = G3 = G5. Desse modo, conclui-se que, após o abrasionamento dentinário, deve ser utilizado o sistema de

  16. Avaliação da composição química de milho seco e armazenado em silo tipo alambrado com ar natural forçado Evaluation of chemical composition of corn dried and stored with forced natural air

    Directory of Open Access Journals (Sweden)

    Luiz Carlos Gutkoski

    2009-12-01

    Full Text Available O trabalho objetivou estudar o efeito da umidade de colheita e do tempo de armazenamento em grãos de milho secos e armazenados em silos com ar natural forçado. Grãos de milho colhidos com 17,8; 18,9 e 20,5% de água foram acondicionados em silos tipo alambrado com fundo falso perfurado e com ventiladores ligados ininterruptamente até a secagem. Amostras de milho foram coletadas nos tempos zero, 4, 8, 22 e 112 dias, em seis alturas de camada de cada silo (10, 60, 110, 160, 210 e 260 cm. A composição química foi determinada pelo uso de Espectrofotômetro do Infravermelho Proximal (NIR e os resultados expressos em porcentagem e em base seca. Os dados foram analisados estatisticamente (Anova e nas interações significativas, elaborados os gráficos de regressão. Nas determinações de proteínas, lipídios, matéria seca e fibra em detergente neutro as interações foram significativas ao nível de 5% de probabilidade de erro, enquanto que em cinzas, umidade e carboidratos não foram verificadas diferenças significativas. A aeração natural forçada é capaz de reduzir a umidade do milho para 13%, sendo tecnicamente viável em propriedades familiares.The aim of this work was to study the effects of moisture at harvest and time of storage upon grains of corn dried and stored in bins with forced natural air. Grains of corn harvested with 17.8; 18.9, and 20.5% of water were stored in drying bins with false floor with fans working full-time until drying. Samples of corn were collected at zero, 4, 8, 22, and 112 days from six different heights in each bin (10, 60, 110, 160, 210 and 260 cm. The chemical composition was determined through Near-Infrared Spectrophotometer (NIR and the results were expressed in percentage at dry basis. The data were statistically analyzed (Anova and for the significant interactions graphics of regression were provided. In the process of determination of protein, fat, dry matter, and neutral detergent fiber the

  17. Dose profile in computed tomography chest scan; Perfil de dose em varredura de torax em tomografia computadorizada

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, Bruno B., E-mail: bbo@cdtn.b [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil). Pos-graduacao em Ciencias e Tecnologia das Radiacoes, Minerais e Materiais; Mourao, Arnaldo P. [Centro Federal de Educacao Tecnologica de Minas Gerais (CEFET/MG), Belo Horizonte, MG (Brazil); Alonso, Thessa C.; Silva, Teogenes A. da [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil)

    2010-07-01

    For the optimization of the patient dose in computed tomography (CT), the Brazilian legislation only established the diagnostic reference levels (DRL's) in terms of Multiple Scan Average Dose (MSAD) in a typical adult as a parameter of quality control of CT scanners. Conformity to the DRL's can be verified by measuring the dose distribution in CT scans and MSAD determination. An analysis of the quality of CT scans of the metropolitan region of Belo Horizonte is necessary by conducting pertinent tests to the study that are presented in the ANVISA (National Agency of Sanitary Vigilance) Guide. The purpose of this study is to investigate, in a chest scan, the variation of dose in CT. To measure the dose profile are used lithium fluoride thermoluminescent dosimeters (TLD-100 Rod) distributed in cylinders positioned in peripheral and central regions of a phantom of polymethylmethacrylate (PMMA). The data obtained allow us to observe the variation of the dose profile inside the phantom. The peripheral region shows higher dose values than the central region. The longitudinal variation can be observed and the maximum dose was recorded at the edges of the phantom (41,58{+-}5,10) mGy at the midpoint of the longitudinal axis. The results will contribute to disseminate the proper procedure and optimize the dosimetry and the tests of quality control in CT, as well as make a critical analysis of the DRL's. (author)

  18. ARS Biodiesel Research Initiatives

    Science.gov (United States)

    Biodiesel activities within ARS are concerned with the production, quality, and properties of this alternative fuel from agriculturally derived fats and oils. Currently, in the absence of tax incentives, biodiesel production when using refined fats and oils and conventional alkali transesterificati...

  19. ARS Culture Collection

    Science.gov (United States)

    The internationally recognized Agricultural Research Service (ARS) Culture Collection will be described to include the microorganisms maintained by the collection, preservation methods and worldwide distribution of cultures. The impact of the germplasm will be described to include discovery of the f...

  20. Tomografia computadorizada do cranio no diagnostico dos meningiomas: registro de 16 casos

    Directory of Open Access Journals (Sweden)

    James Pitagoras de Mattos

    1983-03-01

    Full Text Available Os autores se referem à importância do emprego da tomografia computadorizada do crânio para o preciso diagnóstico dos meningiomas. Constam da experiência 16 casos, comprovados cirúrgica e histologicamente. A média de idade foi de 52,1 anos, sendo 10 pacientes do sexo feminino e 6 do masculino. Quanto à localização, 5 eram da cavidade orbitrária e/ou asa do esfenóide, 3 parasagitais, 3 da foice, 2 supra-selares, 2 de convexidade e 1 do tentório. Concluem tratar-se de exame de grande positividade (95-98%, praticamente inócuo e que permite, na atualidade, o diagnóstico precoce conduzindo, consequentemente, a melhores resultados terapêuticos.

  1. BACTERIAL DETERIORANTS IN CHICKEN BREAST FILLET PACKAGED IN AIR, VACUUM AND IRRADIATED: BACTERIOLOGICAL GROWTH PARAMETERS AND SHELF-LIFE BACTÉRIAS DETERIORANTES EM FILÉS DE FRANGO EMBALADOS EM AR, VÁCUO E IRRADIADOS: PARÂMETROS BACTERIOLÓGICOS DE DESENVOLVIMENTO E PRAZO COMERCIAL

    Directory of Open Access Journals (Sweden)

    Samira Pirola Santos Mantilla

    2009-10-01

    Full Text Available

    The objective of this research was to evaluate the effect of packaging in 100% air and vacuum, combined with radiation (2 kGy and 3 kGy, on chicken breast fillet shelf-life by evaluation of bacterial deteriorants growth and pH variation parameters. The vacuum packaging increased shelf-life, when compared to commercial packaging in 100% air, both in non-irradiated and irradiated to 3 kGy fillets. The irradiation increased the shelf-life of fillet samples at both doses. The lactic acid bacteria were the organisms that most developed in irradiated samples, showing greater radioresistance, as compared to other microorganisms studied, while the enterobacteria showed greater sensitivity to treatment with ionizing radiation. The vacuum packaging, combined with irradiation, can be used to improve the safety of chicken breast fillets and to extend its shelf-life.

    KEY-WORDS: Deterioration; chicken meat; vacuum packaging; meat radiation.

    O objetivo deste experimento foi avaliar o efeito do uso de embalagens, em 100% ar e a vácuo, combinadas com a radiação gama (2 kGy e 3 kGy, no aumento do prazo de validade comercial de filé de peito de

  2. Estudo do metabolismo da glicose na tuberculose pulmonar ativa utilizando a tomografia por emissão de pósitrons (18F-FDG PET Evaluation of glucose metabolism in active lung tuberculosis by positron-emission tomography (18F-FDG PET

    Directory of Open Access Journals (Sweden)

    SIDNEY BOMBARDA

    2002-09-01

    Full Text Available Os métodos de imagem utilizados na avaliação da tuberculose pulmonar incluem a radiografia e a tomografia computadorizada do tórax. As imagens obtidas pelos métodos de medicina nuclear permitem estudos funcionais e metabólicos dos órgãos de interesse, através do uso de radiofármacos específicos. Alterações do metabolismo da glicose podem ser detectadas pela tomografia por emissão de pósitrons (PET utilizando-se o 18F-fluorodesoxiglicose (18F-FDG. Essas alterações estão presentes nas doenças neoplásicas, inflamatórias e infecciosas. A tuberculose é uma doença granulomatosa causada pelo Mycobacterium tuberculosis, que se utiliza de glicose como fonte de energia. Objetivo: O estudo do metabolismo da glicose na tuberculose pulmonar através da PET e sua comparação com a tomografia computadorizada de tórax. Material e métodos: Foram avaliados 20 pacientes portadores de tuberculose pulmonar. Todos foram submetidos à PET e à tomografia computadorizada de tórax, em até 30 dias após o início do tratamento. Resultados: Todos os pacientes apresentaram captação positiva do 18F-FDG na PET. Na tomografia computadorizada do tórax, todos os pacientes apresentaram sinais compatíveis com atividade de tuberculose. A sensibilidade dos dois métodos foi de 100%. Houve concordância entre os achados do 18F-FDG PET e da tomografia computadorizada (K = 0,27 e p Current methods to evaluate lung tuberculosis include chest radiography and computed tomography. Nuclear medicine imaging techniques are performed after administration of specific radiopharmaceuticals that accumulate in the organs of interest. Alterations of glucose metabolism can be observed by positron-emission tomography, using 18F-fluorodeoxyglucose (18F-FDG PET. These findings are present in the neoplasms, but also in inflammatory and infectious diseases. Tuberculosis is a granulomatous disease caused by Mycobacterium tuberculosis , that uses glucose as an energy source

  3. O fenômeno El Niño Oscilação Sul e a variabilidade interanual da evaporação do tanque Classe A e da umidade relativa do ar em Santa Maria, RS El Niño Southern Oscilation and the interannual variability of Pan evaporation and air relative humidity in Santa Maria, RS, Brazil

    Directory of Open Access Journals (Sweden)

    Nereu Augusto Streck

    2008-08-01

    Full Text Available O objetivo deste trabalho foi associar a variabilidade interanual da evaporação do tanque Classe A e da umidade relativa do ar com o fenômeno El Niño Oscilação Sul (ENOS em Santa Maria, RS. Foram utilizados os dados diários de evaporação do tanque Classe A (ECA, mm dia-1 e umidade relativa média diária do ar (UR, % medidos em Santa Maria, RS. A ECA foi medida de 1973 a 2006 e a UR de 1969 a 2006. Os anos foram classificados em El Niño (EN, La Niña (LN e Neutros (N, considerando o período de 01/07 de um ano até 30/06 do ano seguinte. Os resultados mostraram que a ECA é menor nos anos de EN e maior nos anos de LN. Já a UR foi maior em anos de EN e menor em anos de LN. O efeito do fenômeno ENOS sobre a ECA é maior nos meses de novembro, dezembro, janeiro e maio, enquanto que sobre a UR os meses de maior influência do ENOS são outubro, novembro, dezembro e maio.The objective of this study was to associate the interannual variability of Pan evaporation and air relative humidity with the El Niño Southern Oscilation (ENSO phenomenon in Santa Maria, RS, Brazil. Daily data records of Pan evaporation (PAN, mm day-1 and mean daily relative humidity (RH, % measured in Santa Maria, RS, were used. PAN was measured from 1973 to 2006 and RH was measured from 1969 to 2006. Years were grouped into El Niño (EN years, La Niña (LN years, and Neutral (N years, from July 1st of the year to June 30th of the following year. Results showed that PAN is lower in EN years and greater in LN years. On the other hand, RH was greater in EN years and lower in LN years. The effect of ENSO on PAN is greater in November, December, January, and May, whereas RH is affected by ENSO in October, November, December and May.

  4. Ars Electronica tulekul / Rael Artel

    Index Scriptorium Estoniae

    Artel, Rael, 1980-

    2003-01-01

    6.-11. IX toimub Austrias Linzis "Ars Electronica" festival, mille teema on "Code - The Language of Our Time". Festivali kavast, osalejatest, ava-performance'ist "Europe - A Symphonic Vision", näitusest "Cyberarts 2003. Prix Ars Electronica"

  5. Evapotranspiração máxima da cultura de pimentão em estufa plástica em função da radiação solar, da temperatura, da umidade relativa e do déficit de saturação do ar Maximum evapotranspiration of sweet pepper in plastic greenhouse as a function of solar radiation, temperature, relative humidity and water vapor pressure deficit of the air

    Directory of Open Access Journals (Sweden)

    Genei Antonio Dalmago

    2006-06-01

    Full Text Available Um experimento foi conduzido para avaliar a relação da evapotranspiração máxima (ETm da cultura de pimentão por unidade de índice de área foliar (ETmf com a radiação solar global incidente (Rg e e saldo de radiação (Rn e, externos à estufa, e com a temperatura (t am, umidade relativa (URm e déficit de saturação (D do ar no interior da estufa. A ETm foi determinada por lisimetria. Apenas a temperatura e a umidade relativa do ar foram registradas e as demais variáveis foram estimadas. O Rn e apresentou o maior efeito isolado, seguido pelo D e pela URm. A temperatura do ar às 15 horas e a temperatura máxima diária foram as variáveis pontuais de maior associação com a ETmf. A Rg e melhorou sua relação quando analisada em diferentes faixas de t am. Os resultados confirmaram o Rn e e o D como as variáveis meteorológicas de maior efeito preditivo da evapotranspiração das culturas em estufas plásticas no outono, porém com graus diferenciados de ajuste para o pimentão em relação às outras culturas.An experiment was carried out to study the relationship between sweet pepper maximum evapotranspiration (ETm per unit leaf area index (ETmf and incident solar radiation (Rg e and net radiation (Rn e outside greenhouse, and with air temperature (t am, air relative humidity (URm and water vapor pressure deficit (D inside a greenhouse. ETm was measured by lysimeters. Temperature and relative humidity were registered whereas Rg e and Rn e were estimated. The Rn e was the variable with laRg e st effect on ETmf determination, followed by D and URm. The air temperature at 15:00 and the daily maximum temperature were variables of laRg e r association with ETmf among the variables with punctual time observations. Rg e improved its relationship with ETmf when was analyzed with different t am ranges. The results confirmed Rn e and D as the meteorological variables of highest relationship with evapotranspiration in plastic greenhouse

  6. Important authorship clarification for arXiv:1010.2709

    OpenAIRE

    Yaffe, Yoav

    2010-01-01

    Version 1 of this paper (arXiv:1010.2709v1) was submitted exclusively by Noa Lavi, without prior knowledge, let alone consent, by Yoav Yaffe. Yoav Yaffe is {\\em not} an author of any version of this paper, with the exception of the present clarification.

  7. ARABIC LIGHT STEMMER (ARS

    Directory of Open Access Journals (Sweden)

    ASMA AL-OMARI

    2014-12-01

    Full Text Available Stemming is a main step used to process textual data. It is usually used in several types of applications such as: text mining, information retrieval (IR, and natural language processing (NLP. A major task in stemming is to standardize words; which can be achieved by reducing each word to its base (root or stem. Arabic stemming is not an easy task. Unlike other languages, Arabic language is a highly inflected language, since it uses many inflectional forms. Researchers are divided on the benefit of using stemming in fields of IR, NLP...etc., since in Arabic the morphological variants of a certain word are not always semantically related. The aim of this paper is to design and implement a new Arabic light stemmer (ARS which is not based on Arabic root patterns. Instead, it depends on well defined mathematical rules and several relations between letters. A series of tests were conducted on ARS stemmer to compare its effectiveness with the effectiveness of two other Arabic stemmers. Test shows clearly the effectiveness superiority of ARS compared to effectiveness of these two Arabic stemmers.

  8. Análise fluido-dinâmica do escoamento em ensaio de permeabilidade ao ar de argamassas preparadas com cimento Portland de alto-forno Fluid-dynamic analysis of the flow in air permeability measurement of mortars prepared with blast-slag furnace Portland cement

    Directory of Open Access Journals (Sweden)

    V. M. Pereira

    2008-06-01

    Full Text Available O estudo dos fenômenos fluido-dinâmicos de escoamento em meios porosos tem sido de grande interesse por diversas áreas das ciências, de forma a se avaliar não só a permeabilidade do material, mas também analisar o comportamento do fluido permeante quando no interior destes materiais. Tratando-se de compósitos à base de cimento, a mensuração da permeabilidade torna-se fundamental para que sua durabilidade possa ser estimada, pois é a permeabilidade que controla a taxa de ingresso e movimentação de agentes deletérios no interior destes materiais. Dessa forma, diversas metodologias e equacionamentos matemáticos têm sido utilizados para prever a permeabilidade de materiais à base de cimento. No entanto, várias discrepâncias e disparidades nos resultados têm sido encontradas. Dentre as metodologias empregadas para mensurar a permeabilidade de meios porosos, encontra-se a desenvolvida por Thenoz, a qual tem demonstrado bons resultados em materiais à base de cimento. Dessa forma, este trabalho visa, por meio de ensaio de permeabilidade ao ar, realizado de acordo com a metodologia de Thenoz, avaliar o comportamento fluido-dinâmico do ar durante o ensaio de permeabilidade em argamassas. Para isto, foram utilizadas argamassas preparadas com dois tipos de cimento Portland (CP II E - 32 e CP III - 32, duas relações água/cimento (0,5 e 0,6 e ensaiadas em idades de 14 e 28 dias. Por meio dos resultados obtidos foi possível observar que durante o escoamento a compressibilidade do ar pode ser ignorada e o regime de escoamento pode ser considerado como laminar, demonstrando que a metodologia proposta por Thenoz e o equacionamento matemático empregado pode resultar em coeficientes de permeabilidade ao ar confiáveis, pois fenômenos e considerações que poderiam influenciar neste tipo de escoamento podem ser negligenciados.Fluid-dynamic phenomena study in porous media flow has been of great interest for diverse areas of sciences

  9. Tomografia por emissão de pósitrons com 18F fluordesoxiglicose como exame não invasivo para o diagnóstico de sarcomas primários de artéria pulmonar 18F-fluorodeoxyglucose positron emission tomography as a noninvasive method for the diagnosis of primary pulmonary artery sarcoma

    Directory of Open Access Journals (Sweden)

    Olívia Meira Dias

    2011-12-01

    Full Text Available Os sarcomas de artéria pulmonar são tumores raros e de difícil diagnóstico, simulando frequentemente o tromboembolismo pulmonar crônico. Relatamos dois casos de pacientes do sexo feminino com quadro clínico de dispneia e massas pulmonares associadas a falhas de enchimento na artéria pulmonar em angiotomografia de tórax. A tomografia por emissão de pósitrons com 18F fluordesoxiglicose mostrou hipercaptação das respectivas lesões. O sarcoma de artéria pulmonar foi confirmado posteriormente por exame anatomopatológico. Ressaltamos a importância do uso desse tipo de tomografia como exame não invasivo no auxílio diagnóstico desses tumoresPulmonary artery sarcomas are rare, difficult-to-diagnose tumors that frequently mimic chronic pulmonary thromboembolism. We report the cases of two female patients with clinical signs of dyspnea and lung masses associated with pulmonary artery filling defects on chest CT angiography. We performed 18F-fluorodeoxyglucose positron emission tomography, which revealed increased radiotracer uptake in those lesions. Pulmonary artery sarcoma was subsequently confirmed by anatomopathological examination. We emphasize the importance of this type of tomography as a noninvasive method for the diagnosis of these tumors

  10. PREVALÊNCIA DE DOENÇAS INFECCIOSAS EM REBANHO DE SUÍNOS CRIADOS AO AR LIVRE NA REGIÃO SUDOESTE DO PARANÁ, BRASIL PREVALENCE OF INFECTIOUS DISEASES IN A PIG BREEDING HERD RAISED OUTDOORS IN THE SOUTH-WESTERN REGION OF PARANÁ, BRAZIL

    Directory of Open Access Journals (Sweden)

    Laerte Francisco Filippsen

    2001-04-01

    Full Text Available O presente trabalho objetivou determinar a prevalência de doenças infecciosas em rebanho de suínos criados ao ar livre na região sudoeste do Paraná, no período de outubro de 1996 a junho de 1999. Foram examinados um total de 969 animais. Todas as ocorrências de enfermidades observadas nos animais foram registradas. Os animais mortos no período, além de um leitão por lote, sacrificado aos 28 dias pós-desmame, foram necropsiados. Amostras de sangue foram coletadas para realização de exames sorológicos para Aujeszky, parvovirose, leptospirose e brucelose. Foram coletadas amostras de fezes dos leitões com diarréia para realização de exames bacteriológicos. A principal causa de mortalidade em leitões lactentes criados ao ar livre foi o esmagamento. A prevalência de doenças infecciosas não foi elevada. A ocorrência mais freqüente foi diarréia em leitões lactentes. O índice de pneumonia no rebanho de suínos criados ao ar livre foi baixo. Não houve ocorrência de doenças infecciosas da reprodução.The aim of this work was to determine the prevalence of infectious diseases in an outdoor pig herd in the South-western region of Paraná, Brazil, from October 1996 to June 1999. A total of 969 animals were examined. All infections observed were registered. All animals found dead within the period of study and one piglet of each litter sacrified on the 28th post weaning day were autopsied. Blood samples were collected for Aujeszky, parvovirus, leptospirosis and brucellosis serological tests. Faecal samples from piglets with diarrhoea were taken for bacteriological tests. Crushing was the main cause of outdoor suckling piglets mortality. The prevalence of infectious diseases was not high. The most frequent occurrence in suckling piglets was diarrhoea. The pneumonia index in the herd raised outdoors was low. There was no occurrence of reproductive infectious diseases.

  11. Linfangioliomiomatose pulmonar: aspectos na tomografia computadorizada de alta resolução Pulmonary lymphangioleiomyomatosis: high-resolution computed tomography findings

    Directory of Open Access Journals (Sweden)

    Eduardo Curty Castro Netto

    2003-08-01

    Full Text Available Neste trabalho foram estudados, retrospectivamente, 17 pacientes com linfangioliomiomatose pulmonar diagnosticada por biópsia pulmonar a céu aberto. Todos os pacientes eram do sexo feminino, com idade média de 39,6 anos. Duas pacientes tiveram também o diagnóstico de esclerose tuberosa. As pacientes foram submetidas a tomografia computadorizada de alta resolução, cujos achados revelaram cistos com conteúdo gasoso, de formas variadas e com diferentes tamanhos, não ultrapassando 60 mm de diâmetro. A grande maioria tinha as paredes finas. Todos os cistos apresentaram distribuição difusa pelo parênquima pulmonar. Somente duas pacientes apresentaram pneumotórax associado. Nódulos parenquimatosos e espessamento de septos interlobulares não foram observados. Dessa forma, as características tomográficas utilizadas para o diagnóstico foram a ausência de nódulos e a presença de cistos de tamanhos variados, em geral menores que 20 mm, arredondados e distribuídos difusamente pelo parênquima pulmonar.We reviewed 17 cases of pulmonary lymphangioleiomyomatosis diagnosed by open lung biopsy. All patients were women with a mean age of 39.6 years. Tuberous sclerosis was diagnosed in two cases. The patients were submitted to high-resolution computed tomography that showed diffuse thin walled cystic lesions of less than 60 mm in diameter. Associated pneumothorax was seen in two cases. The main high-resolution computed tomography findings were diffuse, rounded, cystic lesions, generally of less than 20 mm in diameter.

  12. Trauma dos ossos temporais e suas complicações: aspectos na tomografia computadorizada Temporal bone trauma and complications: computed tomography findings

    Directory of Open Access Journals (Sweden)

    Ana Maria Doffémond Costa

    2013-04-01

    Full Text Available A maioria das fraturas dos ossos temporais resulta de traumas cranianos bruscos, de alta energia, estando muitas vezes relacionadas a outras fraturas cranianas ou a politraumatismo. As fraturas e os deslocamentos da cadeia ossicular, na orelha média, representam umas das principais complicações das injúrias nos ossos temporais e, por isso, serão abordadas de maneira mais profunda neste artigo. Os outros tipos de injúrias englobam as fraturas labirínticas, fístula dural, paralisia facial e extensão da linha de fratura ao canal carotídeo. A tomografia computadorizada tem papel fundamental na avaliação inicial dos pacientes politraumatizados, pois é capaz de identificar injúrias em importantes estruturas que podem causar graves complicações, como perda auditiva de condução ou neurossensorial, tonturas e disfunções do equilíbrio, fístulas perilinfáticas, paralisia do nervo facial, lesões vasculares, entre outras.Most temporal bone fractures result from high-energy blunt head trauma, and are frequently related to other skull fractures or to polytrauma. Fractures and displacements of ossicular chain in the middle ear represent some of the main complications of temporal bone injury, and hence they will be more deeply approached in the present article. Other types of injuries include labyrinthine fractures, dural fistula, facial nerve paralysis and extension into the carotid canal. Computed tomography plays a fundamental role in the initial evaluation of polytrauma patients, as it can help to identify important structural injuries that may lead to severe complications such as sensorineural hearing loss, conductive hearing loss, dizziness and balance dysfunction, perilymphatic fistulas, facial nerve paralysis, vascular injury and others.

  13. Spectroanalytical investigations on inductively coupled N2/Ar and Ar/Ar high frequency plasmas

    International Nuclear Information System (INIS)

    In order to improve the detection limits of trace elements in corrosion products of metallic materials, the inductively coupled plasma excitation source (ICP) was applied for spectroscopic analysis. Besides optimizing the working conditions for the mentioned materials, the fundamental research clearing the excitation processes in ICP was carried out. Basicly, two plasma systems were investigated: the nitrogen cooled N2/Ar- and pure Ar/Ar-plasma. The computed detection limits for 8 chosen elements are between 0.1 and 50 μg ml-1 in both plasmas. The advantage of ion lines was clearly present; in N2/Ar-plasma it was larger than in Ar/Ar-plasma. The excitation temperatures measured with help of ArI, FeI and ZnI lines rise with increasing power and decreasing distance from the induction coil. The distribution of Zn excitation temperature in N2/Ar-plasma as well as the measured N+2 rotational and CN vibrational temperatures indicate, that the toroidal structure of Ar/Ar-plasma is not analogue to the N2/Ar-plasma. The values of the various excitation temperatures (Ar, Fe, Zn) and the differences between the excitation, vibration, rotation and ionization temperatures (Tsub(i) > Tsub(n) = Tsub(vib) > Tsub(rot)) indicate an absence of thermal equilibrium in the concerned system. (orig.)

  14. Análise de carcinomas epidermóides por meio de radiografia panorâmica e tomografia computadorizada Analysis of squamous cell carcinomas by means of panoramic radiography and computed tomography

    Directory of Open Access Journals (Sweden)

    Amanda Cáceres PEREIRA

    2001-12-01

    Full Text Available Este trabalho teve como objetivo correlacionar aspectos radiográficos como, localização e extensão do tumor, infiltração óssea e de tecidos moles e destruição das corticais, obtidos nas radiografias panorâmicas com os encontrados nas tomografias computadorizadas (TCs. Os aspectos radiográficos de 48 pacientes com diagnóstico histopatológico de carcinomas epidermóides, localizados em várias regiões do complexo buco-maxilo-facial, foram analisados por 4 radiologistas. As radiografias panorâmicas e as tomografias computadorizadas foram realizadas nos hospitais e clínicas da Universidade de Iowa (EUA, FUNDECTO - USP e Hospital Universitário da Universidade de São Paulo (SP, Brasil. Como resultados, obtivemos a grande limitação da radiografia panorâmica em determinar a localização e extensão do tumor, com delimitações bastante imprecisas da lesão. Já as TCs ofereceram resultados mais direcionados como: invasão do tumor em direção a estruturas moles adjacentes, extensão da destruição óssea, bem como a profundidade da lesão, que foram confirmados com os achados cirúrgicos. Concluímos que a tomografia computadorizada demonstrou ser uma técnica bastante sensível na detecção do comprometimento ósseo e do envolvimento de tecidos moles, proporcionando, assim, o auxílio no diagnóstico e no planejamento do tratamento. No entanto, a radiografia panorâmica foi muito pouco sensível e eficaz, por mostrar apenas margens imprecisas e pouco nítidas da lesão, não avaliando o envolvimento de tecidos moles.The purpose of this work was to compare radiographic findings, such as localization and extension of tumors toward the bone and soft tissues, in panoramic radiography and computed tomography (CT. Four radiologists assessed the radiographic findings of 48 patients with the histopathological diagnosis of squamous cell carcinoma in different sites of the maxillofacial region. Panoramic radiographs and computed

  15. Análise de dentição mista: tomografia versus predição e medida radiográfica Mixed-dentition analysis: tomography versus radiographic prediction and measurement

    Directory of Open Access Journals (Sweden)

    Letícia Guilherme Felício

    2010-10-01

    Full Text Available OBJETIVO: o objetivo dos autores desse estudo foi comparar o método de análise de dentição mista que utiliza tomografia computadorizada de feixe cônico para avaliar os diâmetros dos dentes intraósseos com os métodos de Moyers, Tanaka-Johnston e radiografias oblíquas em 45º. MÉTODOS: foram realizadas medidas, na arcada inferior, dos diâmetros mesiodistais dos incisivos permanentes irrompidos, nos modelos de gesso com auxílio de paquímetro digital e estimativa do tamanho de pré-molares e caninos permanentes ainda não irrompidos utilizando-se a tabela de Moyers e a fórmula de predição de Tanaka-Johnston. Nas radiografias oblíquas em 45º, caninos e pré-molares foram medidos utilizando-se o mesmo instrumento. Nas tomografias, as mesmas unidades dentárias foram aferidas por meio de ferramentas do programa Dolphin. RESULTADOS: a análise estatística revelou elevada concordância entre o método tomográfico e o radiográfico, e baixa concordância entre o tomográfico e os demais avaliados. CONCLUSÃO: a tomografia computadorizada de feixe cônico mostrou-se confiável para análise da dentição mista e apresenta algumas vantagens em relação aos métodos comparados: a observação e mensuração dos dentes intraósseos individualmente, com a possibilidade, contudo, de visualizá-los sob diferentes perspectivas e sem superposição de estruturas anatômicas.OBJECTIVE: The aim of this study was to evaluate the method for mixed-dentition analysis using Cone-Beam Computed Tomography for assessing the diameter of intra-osseous teeth and compare the results with those obtained by Moyers, Tanaka-Johnston, and 45-degree oblique radiographs. METHODS: Measurements of mesial-distal diameters of erupted lower permanent incisors were made on plaster cast models by using a digital calliper, whereas assessment of the size of non-erupted permanent pre-molars and canines was performed by using Moyer's table and Tanaka-Johnston's prediction

  16. Comportamento do arsênio em perfis de solos do Sítio Ilha de Terra de Caxiuanã-Pará Arsenic behavior in soil profiles on the Sítio Ilha de Terra from Caxiuanã-Pará

    OpenAIRE

    Vanda Porpino Lemos; Marcondes Lima da Costa; Robson da Silva Gurjão; Dirse Clara Kern; Cleide Samara Tavares Mescouto; Wivian Thais dos Santos Lima; Taynara Lima Valentim

    2009-01-01

    Concentrações de arsênio em perfis de solos com terra preta arqueológica (TPA) e solos de área adjacente (AD) do Sítio Ilha de Terra, Caxiuanã, no Estado do Pará, região Amazônica, podem dar informações sobre as atividades antropogênicas dos habitantes dessa região. Análises químicas e mineralógicas foram realizadas nas amostras desses perfis. Os dados obtidos mostram que as concentrações do Fe e As aumentam com a profundidade dos perfis de solos, enquanto que as concentrações de matéria orgâ...

  17. Detecção e Quantificação de Aeroalergenos Polínicos de Gramíneas e Olea spp. em Amostras de Ar Exterior e sua Correlação com as Contagens Polínicas

    OpenAIRE

    Antunes, Celia M.; Ferro, Raquel; Ribeiro, Rita; Caeiro, Elsa; Lopes, Luísa; Nunes, Carlos; Brandao, Rui; Morais-Almeida, M

    2010-01-01

    Detecção e Quantificação de Aeroalergenos Polínicos de Gramíneas e Olea spp. em Amostras de Ar Exterior e sua Correlação com as Contagens Polínicas C.M Antunes1,5 R Ferro1*, R Ribeiro1*, E Caeiro4, L. Lopes8, C. Nunes6 R Brandão2,3 & M. Morais-Almeida7 e o HIALINE working group9 1Dep. De Química, Universidade de Évora, Portugal; 2Mediterranean Inst. Crop and Environment Sciences, Univ.Evora, Portugal; 3Depto. Biologia, Universidade de Évora, Portugal; 4Soc.Portuguesa Al...

  18. Microlitíase alveolar pulmonar em gêmeos univitelinos: relato de dois casos Pulmonary alveolar microlithiasis in monozygotic twins: report of two case

    Directory of Open Access Journals (Sweden)

    Sizenildo da Silva Figueirêdo

    2002-07-01

    Full Text Available Os autores apresentam dois casos de microlitíase alveolar pulmonar em gêmeos monozigóticos. Os principais achados obtidos em exames radiográficos e de tomografia computadorizada (técnica de alta resolução são enfatizados, com base em breve revisão literária.The authors report two cases of pulmonary alveolar microlithiasis affecting monozygotic twins. The main findings observed on plain x-ray films and high-resolution computed tomography are discussed and compared with data from a brief literature review.

  19. Regional Suppression of <em>Bactrocera> Fruit Flies (Diptera: Tephritidae in the Pacific through Biological Control and Prospects for Future Introductions into Other Areas of the World

    Directory of Open Access Journals (Sweden)

    Roger I. Vargas

    2012-08-01

    Full Text Available <em>Bactrocera> fruit fly species are economically important throughout the Pacific. The USDA, ARS U.S. Pacific Basin Agricultural Research Center has been a world leader in promoting biological control of <em>Bactrocera> spp. that includes classical, augmentative, conservation and IPM approaches. In Hawaii, establishment of <em>Bactrocera> <em>cucurbitae> (Coquillett in 1895 resulted in the introduction of the most successful parasitoid, <em>Psyttalia> <em>fletcheri> (Silvestri; similarly, establishment of <em>Bactrocera> <em>dorsalis> (Hendel in 1945 resulted in the introduction of 32 natural enemies of which <em>Fopius> <em>arisanus> (Sonan, <em>Diachasmimorpha> <em>longicaudata> (Ashmead and <em>Fopius> <em>vandenboschi> (Fullaway were most successful. Hawaii has also been a source of parasitoids for fruit fly control throughout the Pacific region including Australia, Pacific Island Nations, Central and South America, not only for <em>Bactrocera> spp. but also for <em>Ceratitis> and <em>Anastrepha> spp. Most recently, in 2002, <em>F.> <em>arisanus> was introduced into French Polynesia where <em>B.> <em>dorsalis> had invaded in 1996. Establishment of <em>D.> <em>longicaudata> into the new world has been important to augmentative biological control releases against <em>Anastrepha> spp. With the rapid expansion of airline travel and global trade there has been an alarming spread of <em>Bactrocera> spp. into new areas of the world (<em>i.e.>, South America and Africa. Results of studies in Hawaii and French Polynesia, support parasitoid introductions into South America and Africa, where <em>B.> <em>carambolae> and <em>B.> <em>invadens>, respectively, have become established. In addition, <em>P.> <em>fletcheri> is a candidate for biological control of <em>B.> <em>cucurbitae> in Africa. We review past and more

  20. Nutrição do cafeeiro arábica em função da densidade de plantas e da fertilização com NPK Coffee nutrition as a function of plant density and NPK fertilization

    Directory of Open Access Journals (Sweden)

    Luiz Carlos Prezotti

    2004-01-01

    Full Text Available Embora aumente a produtividade por área, o adensamento reduz a produção por planta, eleva sua eficiência de recuperação de nutrientes, o que contribui para a redução da quantidade de fertilizantes a ser aplicada por planta. O objetivo deste trabalho foi avaliar a resposta do cafeeiro arábica à aplicação de N (100, 300, 500 e 700 kg.ha-1 de N, P (0, 60, 120 e 180 kg.ha-1 de P2O5 e K (100, 300, 500 e 700 kg.ha-1 de K2O, cultivados em diferentes densidades de plantio (3.333, 5.000, 10.000 e 20.000 plantas por hectare. Com base em informações obtidas em cinco produções, não foram observadas diferenças significativas de produtividade em função da densidade de plantas. A resposta em produtividade do café arábica às doses de N, P e K foi variável nos diversos espaçamentos, com maior freqüência de resultados positivos a N e P e menos expressivos para K. Os teores foliares de N e P foram pouco influenciados pelas doses de N e P2O5. Os teores foliares de K foram fortemente influenciados pelas doses de K2O. Cafeeiros submetidos ao sistema de cultivo adensado apresentaram maiores teores foliares de P e K, quando comparados àqueles cultivados em espaçamento mais largo. Os solos sob cultivo adensado, quando comparados a solos sob cultivos mais largos, apresentaram variações em suas características químicas, sendo mais evidente a redução do teor de H + Al.Although increasing in productivity, high-density tree planting provides reduction of the production per plant, increases the efficiency of recovery of nutrients by plants, and can contributes to the reduction of the amount of fertilizers to be applied per plant. Due to evaluate the answer of coffee tree plants (Coffea arabica L. to N (100, 300, 500 e 700 kg.ha-1 of N; P (0, 60, 120 and 180 kg.ha-1 of P2O5 and K (100, 300, 500 and 700 kg.ha-1 of K2O application, on work was carried out in a coffee cultivated at four densities (3,333; 5,000; 10,000 and 20,000 plants

  1. Modelagem de um condicionador de ar de alta precisão para uso em processamento agrícola Modeling of a high precision air conditioner for use in agricultural processing

    Directory of Open Access Journals (Sweden)

    Mauri Fortes

    2006-08-01

    Full Text Available Apresenta-se neste trabalho, estudo detalhado sobre a modelagem de um condicionador de ar com controle acurado de temperatura e umidade relativa. Desenvolveu-se um programa de computador que permite predizer o comportamento do sistema sob diferentes condições psicrométricas e de vazão do ar de entrada. O modelo global físico-matemático inclui equações de balanço de massa e de energia para três diferentes volumes de controle que compõem o condicionador. Modelaram-se os processos de mistura, evaporação (ou condensação simultânea de uma superfície d'água e de uma gota e o aquecimento de corrente de ar, separadamente. Propõem-se expressões semi-empíricas simples para os coeficientes de transferência de calor e massa inerentes ao processo de evaporação sobre uma superfície d'água e um modelo simplificado para o sistema de spray. Construiu-se um condicionador de ar no qual foram feitos testes experimentais para o ajuste das constantes que aparecem nas expressões para os coeficientes de transferência. Os dados obtidos validaram o modelo global, com precisão aceitável para projetos de engenharia.In this work, a detailed procedure for the analysis of an accurately controlled air conditioner is presented. A computer program, that allows predicting the behavior of the system under different psychrometric conditions and different input air mass flow rates, was developed. The global physical-mathematical model includes mass and energy conservation equations for three different control volumes that compose the conditioner. Thus, the processes of mixture of air, simultaneous evaporation (or condensation from a water surface and from a drop, and the air-stream heating are modeled separately. Simple semi-empiric expressions for heat and mass coefficients inherent to the evaporation process on a water surface are proposed as well a simplified model for the spray system. Experimental tests made on an air-conditioner allowed to obtain

  2. Geochronology and thermochronology by the 40Ar/39Ar method

    International Nuclear Information System (INIS)

    This work is a response to the authors' belief that there is a need for a monograph on 40Ar/39Ar dating to provide concise knowledge concerning the application of this method to geological studies. They aim to provide a reasonably comprehensive but by no means exhaustive coverage of the principles and practices of 40Ar/39Ar dating, with emphasis on interpretation of results. In attempting to provide an overview of the current state of knowledge, they commonly cite examples from the available literature. They draw rather heavily upon their own work, because they feel comfortable with their own examples. (author)

  3. Tomografia computadorizada sem contraste intravenoso no abdome agudo: quando e por que usar When and why use unenhanced computed tomography in patients with acute abdomen

    OpenAIRE

    Edison de Oliveira Freire Filho; Paulo Eduardo Marinho de Jesus; Giuseppe D'Ippolito; Jacob Szejnfeld

    2006-01-01

    A tomografia computadorizada sem contraste intravenoso tem sido freqüentemente proposta na avaliação inicial de pacientes com suspeita de abdome agudo, ocupando o espaço de outros métodos diagnósticos. Os autores apresentam uma revisão bibliográfica dos principais aspectos e eficácia da tomografia computadorizada sem contraste intravenoso no diagnóstico de apendicite aguda, cólica nefrética, diverticulite, pancreatite aguda, apendicite epiplóica, pneumoperitônio e obstrução intestinal. Discut...

  4. Behavior of Eucalyptus grandis and E. cloeziana seedlings grown in arsenic-contaminated soil Comportamento de mudas de E. grandis E. eucalyptus cloeziana cultivadas em solo contaminado por arsênio

    Directory of Open Access Journals (Sweden)

    Roseli Freire Melo

    2010-06-01

    Full Text Available Arsenic has been considered the most poisonous inorganic soil pollutant to living creatures. For this reason, the interest in phytoremediation species has been increasing in the last years. Particularly for the State of Minas Gerais, where areas of former mining activities are prone to the occurrence of acid drainage, the demand is great for suitable species to be used in the revegetation and "cleaning" of As-polluted areas. This study was carried out to evaluate the potential of seedlings of Eucalyptus grandis (Hill Maiden and E. cloeziana F. Muell, for phytoremediation of As-polluted soils. Soil samples were incubated for a period of 15 days with different As (Na2HAsO4 doses (0, 50, 100, 200, and 400 mg dm-3. After 30 days of exposure the basal leaves of E. cloeziana plants exhibited purple spots with interveinal chlorosis, followed by necrosis and death of the apical bud at the 400 mg dm-3 dose. Increasing As doses in the soil reduced root and shoot dry matter, plant height and diameter in both species, although the reduction was more pronounced in E. cloeziana plants. In both species, As concentrations were highest in the root system; the highest root concentration was found in E. cloeziana plants (305.7 mg kg-1 resulting from a dose of 400 mg dm-3. The highest As accumulation was observed in E. grandis plants, which was confirmed as a species with potential for As phytoextraction, tending to accumulate As in the root system and stem.O arsênio (As tem sido considerado o poluente inorgânico de solo mais tóxico para os seres vivos, razão pela qual o interesse por espécies indicadoras e fitorremediadoras tem aumentado nos últimos anos. Particularmente para o Estado de Minas Gerais, que apresenta áreas remanescentes de atividade mineradora sujeitas à ocorrência de drenagem ácida, existe grande demanda por espécies com potencial para serem utilizadas na revegetação e "limpeza" de substratos contaminados por esse metaloide. Este

  5. Geological Dating by 40 Ar - 39 Ar method

    International Nuclear Information System (INIS)

    The isotope 40 K is radioactive, it decays to 40 Ar stable. The number of 40 Ar atoms produced from 40 K, permits to calculate the date of rocks and minerals. This dating technique is named 'Conventional K-Ar Dating Method'. The 40 Ar - 39 Ar dating method permits to calculate the age of rocks and minerals eliminating the limitation of the K-Ar method by calculating potassium and argon concentrations in a single measurement of the ratio of argon isotopes. In this work, the irradiation of the sample with fast neutrons in the nuclear reactor was established. 39 Ar is obtained from the induced reaction 39 K (n,p) 39 Ar. Thus the ration of 40 Ar -39 Ar allows to obtain the date of rocks and minerals. This ratio was measured in a mass spectrometer. If the measurement of argon concentration in the sample is carried out at different increasing temperature values, it is possible to get information of paleotemperatures. The number of atoms 39 Ar is a function of the number 39 K atoms, irradiation time, neutrons flux, its energy E and the capture cross section σ of 39 K. These parameters are calculate indirectly by obtaining the so called 'J value ' by using a standard mineral with known age (HD-BI y Biot-133), this mineral is irradiated together with the unknown age sample. The values of 'J' obtained are in the interval of 2.85 a 3.03 (x 10-3)J/h. Rocks from 'Tres Virgenes' were dated by the method described in this work, showing an agreement with previous values of different authors. The age of this rocks are from Cenozoico era, mainly in the miocene period. (Author)

  6. Dessecação da aveia-preta (Avena strigosa Schreb com herbicida de contato, em presença ou não de assistência de ar junto à barra do pulverizador, em diferentes volumes de calda Black-oats (Avena strigosa Schreb control with contact burndown herbicide applied at different carrier volumes, with and without air assistance at sleeve boom sprayer

    Directory of Open Access Journals (Sweden)

    Luiz C. Garcia

    2004-12-01

    Full Text Available A tecnologia de aplicação dos produtos fitossanitários na agricultura pode ser aprimorada mediante a redução dos desperdícios. Com o objetivo de contribuir com tal avanço tecnológico, avaliou-se a eficácia de um herbicida com ação de contato, aplicado em pós-emergência com pulverizadores sem e com assistência de ar junto à barra, em diferentes volumes de calda. O experimento foi instalado no município de Ponta Grossa - PR, com a dessecação de aveia-preta (Avena strigosa Schreb implantada em sistema de plantio direto sob a palha. Empregou-se a mistura herbicida formulada (SC de dicloreto de paraquate (400 g ha-1 + diuron (200 g ha-1. O delineamento experimental utilizado foi o de blocos casualizados (DBC, em esquema fatorial 2 (pulverizador sem e com assistência de ar x 5 (volumes de calda: 0; 100; 200; 300 e 400 L ha-1, com quatro repetições. A avaliação do efeito da dessecação se deu por meio da escala proposta pela Asociación Latinoamericana de Malezas (ALAM. A interação entre os fatores foi significativa, obtendo-se suficiência na dessecação a partir de 200 e 100 L ha-1, sem e com assistência de ar na barra, respectivamente.Agricultural pesticide application technology is largely improved by reduction of waste and losses. With such objective, an experiment was conducted in order to evaluate the efficacy of a post-emergence contact herbicide applied with and without air-assisted sleeve boom in different spray volumes. The experiment was carried out in Ponta Grossa county, in a no-till black oats cover crop (Avena strigosa Schreb. The formulated mixture (SC of paraquat and diuron at 400 + 200 g a.i ha-1 was applied with a sleeve boom sprayer, with and without air-assistance and five spray volumes: 0; 100; 200; 300 and 400 L ha-1. Treatments were placed in a 2 x 5 factorial arrangement in a randomized complete block design with four replications. Herbicide efficacy was evaluated by the ALAM rating system. Efficacy

  7. Efeito dos incêndios florestais na qualidade do ar

    OpenAIRE

    Miranda, Ana Isabel

    1998-01-01

    Os incêndios florestais podem ser considerados como um processo de combustão natural em grande escala, que consome diversas espécies vegetais numa área geográfica específica Consequentemente, consistem numa fonte potencial de elevadas quantidades de poluentes para a atmosfera, sendo indispensável conhecer o seu impacto na qualidade do ar. O objectivo principal deste trabalho consiste no estudo do efeito das emissões dos incêndios florestais na qualidade do ar. Para tal, foram d...

  8. Estudos quimiométricos em amostras de arroz nacional: caracterização do perfil de aminoácidos e sua correlação com o teor de arsénio

    OpenAIRE

    Lopes, Joel Nuno Rodrigues

    2014-01-01

    O arroz é um dos alimentos básicos mais importantes para a população mundial, sendo um dos cereais mais consumidos em todo o mundo. Possui um alto teor em hidratos de carbono devido à alta concentração de amido, contém ainda proteínas, vitaminas, minerais e poucas gorduras. A quantidade de proteína a ingerir é requisito para uma dieta adequada (0,75g/kg/dia), devido ao desempenho vital que esta tem na saúde humana. O arroz pelo seu papel determinante na alimentação mundial faz com que os ami...

  9. Estudo comparativo do diagnóstico de câncer pulmonar entre tomografia computadorizada e broncoscopia Comparative study between computed tomography and bronchoscopy in the diagnosis of lung cancer

    Directory of Open Access Journals (Sweden)

    Christopher Oliveira

    2010-08-01

    Full Text Available OBJETIVO: Analisar a tomografia computadorizada e a broncoscopia no diagnóstico do câncer pulmonar e verificar a eficácia destas técnicas perante a presença desta doença. Os parâmetros idade, gênero, hábitos tabágicos, tipos histológicos, estadiamento e terapêutica foram, igualmente, analisados. MATERIAIS E MÉTODOS: Foram analisados 70 pacientes do Serviço de Pneumologia do Hospital Distrital da Figueira da Foz, Coimbra, Portugal, que realizaram ambas as técnicas em estudo, tendo-se confirmado ou não a presença de câncer pulmonar. RESULTADOS: Diagnosticaram-se 37 tumores pulmonares, 23 casos no gênero masculino e 14 no feminino. Histologicamente, 40,54% eram adenocarcinomas, seguido do carcinoma escamoso (32,43% dos casos e do carcinoma de pequenas células (18,92%. O estadiamento mostrou 6,70% no estádio IB, 23,30% no estádio IIIA comparativamente ao IIIB com 36,70%, encontrando-se 33,30% dos doentes no estádio IV. A quimioterapia isolada foi efetuada em 75,7% dos doentes. A sensibilidade da broncoscopia foi de 83,8%, a especificidade, de 81,8%, e a precisão, de 82,8%. A sensibilidade da tomografia computadorizada foi de 81,1%, a especificidade, de 63,6%, e a precisão, de 72,8%. CONCLUSÃO: Os resultados da broncoscopia confirmaram a sua importância no diagnóstico do câncer pulmonar, pela dependência deste no exame anatomopatológico do tecido ou células, obtido por várias técnicas de biópsia. A tomografia computadorizada apresentou boa sensibilidade, de 81,1%, contudo, a sua especificidade, de apenas 63,6%, resulta do número de falso-positivos (36,4%.OBJECTIVE: To analyze the role of computed tomography and bronchoscopy in the diagnosis of lung cancer, evaluating the effectiveness of these techniques in the presence of this disease. Parameters such as age, gender, smoking habits, histological types, staging and treatment were also analyzed. MATERIALS AND METHODS: The sample of the present study included 70

  10. Determinação espectrofotométrica do arsênio em solo da cidade de Santana-AP usando o método do dietilditiocarbamato de prata (SDDC modificado Arsenic spectrophotometric determination in soil of the Santana-AP city using the silver diethyldithiocarbamate (SDDC modified method

    Directory of Open Access Journals (Sweden)

    Simone de Fátima Pinheiro Pereira

    2009-01-01

    Full Text Available Várias toneladas de rejeito de manganês contendo arsênio, gerado por uma empresa de mineração, foram utilizadas como aterro de ruas da cidade de Santana-AP. A possibilidade de exposição das pessoas residentes nessas localidades levou ao estudo de quantificação de arsênio total nos solos. Após a digestão, os teores de arsênio foram quantificados por espectrofotometria de absorção molecular usando um sistema automático de geração de hidretos (HG-MAS, diciclohexilamina/CHCl3 como solvente do dietilditiocarbamato de prata (SDDC e KBH4 como redutor. O método apresentou bons resultados com sensibilidade (ε de 1,10 10(4 L.mol-1.cm-1, estabilidade de 2,96% e outras vantagens em relação ao método oficial. O método foi aplicado em amostras de referência de solo com recuperação de 98,82 % (N=10. As análises de solos mostraram que do total de amostras analisadas 94,74 % apresentaram concentração de arsênio acima do valor editado pela CETESB para solo residencial (50 mg.kg-1 com valor médio de 682,96 mg.kg-1, variando de 48,08 mg.kg-1 a 1.713,00 mg.kg-1 que comprova a contaminação do solo pelo arsênio.Several tons of manganese residues containing arsenic, generated by a mining company, were used as streets landfill in Santana-Ap city. The possibility of exposure of people living in these villages has led to the study of quantification of total arsenic in the soil. After digestion, the levels of arsenic were quantified by molecular absorption spectrophotometry using a hydrides generation automatic system (HG-MAS, dicyclohexilamine/CHCl3 as silver diethyldithiocarbamate (SDDC solvent and KBH4 as reducer. The method presented good results with sensitivity (ε of 1.10 10(4 l.mol-1.cm-1, stability of 2.96 % and other advantages in relation to the official method. The method was applied to the soil standard samples with recoveries of the 98.82 % (n=10. The soil analysis showed that 94.74 % samples showed arsenic concentrations

  11. Análise por tomografia computadorizada do enxerto autógeno na cirurgia de "sinus lift" Computed tomography evaluation of autogenous graft in sinus lift surgery

    Directory of Open Access Journals (Sweden)

    Sérgio Aron Ajzen

    2005-02-01

    Full Text Available OBJETIVO: Quantificar a formação óssea nos enxertos com e sem plasma rico em plaquetas, obtido pelos métodos de centrifugação e aférese, comparando os três tipos de enxertos realizados por meio de análise tomográfica. MATERIAIS E MÉTODOS: Este estudo prospectivo, duplo cego, utilizou uma amostra composta de 34 pacientes adultos, de ambos os sexos, com idade média de 48 anos e 8 meses, portadores de pneumatização unilateral ou bilateral dos seios maxilares, que necessitavam de enxertos ósseos, com a finalidade de melhorar as condições locais para a colocação dos implantes dentários. Todos os pacientes realizaram tomografia computadorizada antes da cirurgia. Foram operados 53 seios maxilares, divididos em três grupos: enxerto de plasma rico em plaquetas obtido pelos métodos de aférese, centrifugação e enxerto apenas de osso autógeno. Após seis meses do procedimento cirúrgico foram realizados novos exames de imagem. RESULTADOS: Pela avaliação tomográfica, houve crescimento em altura e em largura nos três grupos quando foram comparados os momentos inicial e final, entretanto, não houve diferença estatística para a altura e para a largura. CONCLUSÃO: Evidências clínicas demonstram a eficácia dos enxertos autógenos, principalmente os associados a fatores indutores de crescimento ósseo, como o plasma rico em plaquetas, recuperando o arcabouço maxilofacial, necessário para a reconstrução protética e funcional por meio de implantes dentários.OBJECTIVE: To quantify bone formation within autogenous bone grafts and autogenous bone grafts in combination with platelet-rich plasma obtained either from aphaeresis or centrifugation using computed tomography. MATERIALS AND METHODS: This prospective, double-blind study was conducted in 34 male and female adult patients (mean age of 28 years and 8 months, with either unilateral or bilateral pneumatization of the maxillary sinuses, requiring bone graft for dental

  12. Achados tomográficos das alterações abdominais pós-operatórias dos pacientes submetidos ao derivação gastrojejunal em Y-de-Roux sem anel

    OpenAIRE

    Fernanda Marcondes Ribas; Paulo Afonso Nunes Nassif; Carmen Paredes Marcondes Ribas; Ulrich Andreas Dietz; Felipe Tuon; Eduardo Wendler; Marcelo Seiki Enokawa; Kellen Regina Ferri

    2012-01-01

    OBJETIVO: Avaliar por exame de tomografia computadorizada de pacientes submetidos à derivação gastrojejunal em Y-de-Roux, sem anel, para tratamento de obesidade mórbida. MÉTODOS: Estudaram-se 40 pacientes, encaminhados ao serviço de tomografia do Hospital Universitário Evangélico de Curitiba para avaliação diagnóstica. Encontravam-se em pós-operatório de cirurgia bariátrica tendo sido operados no mesmo hospital. Foram incluídos pacientes submetidos à operação laparoscópica com sintomas que ne...

  13. 40Ar/39Ar age calibration against counted annuallayers

    DEFF Research Database (Denmark)

    Storey, Michael; Stecher, Ole

    2008-01-01

    The 40Ar/39Ar method, based on the decay of the naturally occurring radioactive isotope 40K, is capable of producing ages with precision better than ± 0.1 %. However, accuracy is limited to no better than 1 % mainly due to the relatively large uncertainty in the 40K decay constants. One approach...

  14. Hemorragia intraparenquimatosa encefálica espontânea: achados à tomografia computadorizada Spontaneous intraparenchymatous hemorrhage: findings at computed tomography

    Directory of Open Access Journals (Sweden)

    Celso Monteiro Soares

    2004-09-01

    Full Text Available Foram analisados os exames de tomografia computadorizada de crânio de 250 pacientes com hematoma intraparenquimatoso encefálico espontâneo em três diferentes hospitais na cidade do Rio de Janeiro, com o objetivo de se levantar os aspectos mais freqüentes desta doença. O hematoma intraparenquimatoso cerebral profundo foi o de maior incidência, seguido do lobar. Mais raramente foi observado sangramento cerebelar e do tronco cerebral. A faixa etária de acometimento mais freqüente foi entre 61 e 70 anos de idade. Não houve diferença expressiva quanto ao sexo predominante ou ao lado mais acometido, porém verificou-se que os homens são mais acometidos em uma faixa etária mais precoce do que as mulheres. A cefaléia foi o sintoma de maior freqüência e a hipertensão arterial esteve presente na maioria dos casos. A drenagem da hemorragia para o sistema ventricular ocorreu mais comumente nos hematomas profundos.Computed tomography studies of 250 patients with spontaneous hemorrhage were examined in three hospitals in the city of Rio de Janeiro. The goal of this study was to identify the aspects of this disease that appear most frequently in this type of exam. Deep intracerebral hematomas have had the highest incidence followed by lobar hemorrhage, with thalamus being more frequently affected. Cerebelar hemorrhage was much rarer, with brainstem bleeding observed in few patients. The age group with a peak incidence was at 61 to 70 years. Headache was the most frequently related symptom and elevated levels of blood pressure were found in most of the cases. There was no pronounced difference as to predominance in either sex or side most affected but it was observed that the onset of this disease occurs at an earlier age in men than in women. Blood draining into the ventricular system occurred more frequently in deep hematomas.

  15. Modelação da distribuição espacial da qualidade do ar em Lisboa usando sistemas de informação geográficas

    OpenAIRE

    Mesquita, Sandra Maria Pereira

    2010-01-01

    Com a presente dissertação pretendeu-se demonstrar a importância e potencialidade dos Sistemas de Informação Geográfica (SIG) na avaliação da poluição atmosférica. Usando ferramentas SIG, foram aplicadas e comparadas várias metodologias para modelar a distribuição espacial anual do poluente atmosférico dióxido de azoto (NO2) na cidade de Lisboa. Foram usados dados de NO2 da rede fixa de estações de monitorização de qualidade do ar e de duas campanhas com cerca de 100 tubos de d...

  16. Acurácia da mensuração do enfisema pulmonar na tomografia computadorizada: pontos importantes Accuracy of measurement of pulmonary emphysema with computed tomography: relevant points

    OpenAIRE

    Bruno Hochhegger; Edson Marchiori; Klaus L. Irion; Hugo Oliveira

    2010-01-01

    Para garantir a confiabilidade dos dados de quantificação computadorizada do enfisema pulmonar (densitovolumetria pulmonar) na tomografia computadorizada, alguns aspectos técnicos devem ser considerados. A alteração das densidades na tomografia computadorizada com as mudanças no nível de inspiração e expiração do pulmão, com a espessura de corte da tomografia computadorizada, com o algoritmo de reconstrução e com o tipo de tomógrafo dificulta as comparações tomográficas nos estudos de acompan...

  17. Teor e capacidade máxima de adsorção de arsênio em Latossolos brasileiros Content and maximum capacity of arsenic adsorption in Brazilian Oxisols

    Directory of Open Access Journals (Sweden)

    Mari Lucia Campos

    2007-12-01

    Full Text Available A alta toxicidade do As aos animais e humanos e a possibilidade de existência de grande número de áreas contaminadas tornam imprescindível o conhecimento do teor semitotal em solos ditos não-contaminados e dos processos de adsorção do As em solos de carga variável. O objetivo deste trabalho foi determinar o teor e a capacidade máxima de adsorção de As (CMADS AS em Latossolos. O teor total foi determinado pelo método USEPA 3051A, e a CMADS As, com auxílio de isotermas de Langmuir com base nos valores de adsorção obtidos em dose de As (0, 90, 190, 380, 760 e 1.150 µmol L-1 (relação solo:solução final = 1:100, a pH 5,5 e força iônica de 15 mmol L-1. Os 17 Latossolos apresentaram teor médio total de As de 5,92 mg kg-1 e CMADS As média de 2.013 mg kg-1. O teor de argila e os óxidos de Fe e Al apresentaram influência positiva na CMADS As.In view of the toxicity of As for man and animals and the possibility of existence of a great number of contaminated areas it is imperative to know the total As content in soils considered uncontaminated and about As sorption processes in soils of variable charge. The objective of this work was to determine the total content and maximum capacity of As adsorption (CMADS As in Oxisols. The total content was determined by the USEPA 3051A method. The cmADS As was determined by the Langmuir Isotherms using six solution concentrations (0, 0.09, 0.19, 0.38, 0.76, 1.15 mmol L-1 (1:100 soil: solution ratio, pH values 5.5 and ionic strength 15 mmol L-1. In the 17 Oxisols the average total As content was 5.92 mg kg-1 and mean cmADS As was 2.013 mg kg-1. Clay, and Fe and Al oxides content influenced cmADSs positively.

  18. Influência da temperatura do ar de secagem e da concentração de agente carreador sobre as propriedades físico-químicas do suco de açaí em pó Influence of drying air temperature and carrier agent concentration on the physicochemical properties of açai juice powder

    Directory of Open Access Journals (Sweden)

    Renata Valeriano Tonon

    2009-06-01

    Full Text Available A influência da temperatura do ar de secagem e da concentração de agente carreador sobre as propriedades físico-químicas do suco de açaí em pó produzido por spray drying foi avaliada. O processo foi realizado em um mini spray dryer de bancada e maltodextrina 10DE foi utilizada como agente carreador. A temperatura do ar de secagem variou de 138 a 202 °C e a concentração de maltodextrina variou de 10 a 30%. As características analisadas foram: umidade, higroscopicidade, retenção de antocianinas, cor, distribuição do tamanho de partículas e morfologia. O aumento da temperatura resultou em partículas maiores, menos úmidas, mais higroscópicas e com menor retenção de antocianinas, além de provocar uma diminuição do parâmetro de cor L* e do ângulo de tom H*. O aumento na concentração de maltodextrina resultou em partículas maiores e menos higroscópicas, com maior luminosidade (L*, menores valores de C* e maiores valores de H*. Em relação à morfologia, o aumento da temperatura levou à formação de uma maior quantidade de partículas com superfície lisa, fato atribuído à maior transferência de calor e, consequentemente, à formação mais rápida de uma membrana ao redor da gota atomizada.The objective of this work was to study the influence of inlet air temperature and maltodextrin concentration on the physicochemical properties of açai juice powder produced by spray drying. The process was carried out in a mini spray dryer and the maltodextrin 10DE was used as carrier agent. Inlet air temperature varied from 138 to 202 °C and maltodextrin concentration varied from 10 to 30%. The characteristics analyzed were: moisture content, hygroscopicity, anthocyanin retention, color, particle size distribution, and morphology. The increase in the temperature resulted in particles with larger size, less moisture content, more hygroscopy and with lower anthocyanin retention, besides promoting a reduction in the color

  19. The 38Ar(p,d)37Ar reaction

    International Nuclear Information System (INIS)

    The 38Ar(p,d)37Ar reaction has been used to study the properties of the high-lying positive parity states in 37Ar. Angular distributions in the region thetasub(c.m.)=160-1320 have been analyzed using the DWBA code DWUCK to determine the spectroscopic properties of these states. The two lowest T=3/2 states have been identified at 4.98MeV (3/2+) and 6.65MeV (1/2+). The results are compared to recent shell-model calculations; their significance for the solar neutrino experiment is also discussed. (Auth.)

  20. Tumores neuroendócrinos do pulmão: principais achados radiológicos em uma série de 22 casos com confirmação anatomopatológica

    OpenAIRE

    Marcel Koenigkam Santos; André Rodrigues Façanha Barreto; Francisco Abaeté Chagas Neto; Valdair Francisco Muglia; Jorge Elias Júnior

    2012-01-01

    OBJETIVO: Descrever os principais achados de imagem em uma série de casos de tumores neuroendócrinos primários do pulmão (TNPs), destacando as alterações na tomografia computadorizada. MATERIAIS E MÉTODOS: Exames de 22 pacientes (12 homens, idade média de 60 anos) avaliados nos últimos cinco anos em nosso serviço, com confirmação histopatológica, foram retrospectivamente revistos por dois médicos radiologistas e os achados foram descritos em consenso, focando as alterações tomográficas. RESUL...

  1. Avaliação da reprodutibilidade da tomografia computadorizada no estadiamento da pancreatite aguda Reproducibility in the assessment of acute pancreatitis with computed tomography

    Directory of Open Access Journals (Sweden)

    Edison de Oliveira Freire Filho

    2007-12-01

    Full Text Available OBJETIVO: Medir a reprodutibilidade da tomografia computadorizada sem e com contraste na avaliação da gravidade da pancreatite aguda. MATERIAIS E MÉTODOS: Cinqüenta e um exames de tomografia computadorizada abdominal sem e com contraste de pacientes com pancreatite aguda foram analisados por dois radiologistas (observadores 1 e 2. Calculamos o índice morfológico pela tomografia computadorizada sem e com contraste, separadamente, e o índice de gravidade da tomografia computadorizada para pancreatite aguda. Medimos a reprodutibilidade intra- e interobservador da tomografia computadorizada através do índice kappa (kapa. RESULTADOS: Para a concordância interobservador obtivemos kapa de 0,666, 0,705, 0,648, 0,547 e 0,631 para índice morfológico sem e com contraste, presença de necrose pancreática, extensão da necrose pancreática e índice de gravidade da tomografia computadorizada, respectivamente. Para a concordância intra-observador dos observadores 1 e 2 obtivemos, respectivamente, kapa de 0,796 e 0,732 para o índice morfológico sem contraste; 0,725 e 0,802 para o índice morfológico com contraste; 0,674 e 0,849 para a presença de necrose pancreática; 0,606 e 0,770 para a extensão da necrose pancreática; e 0,801 e 0,687 para o índice de gravidade da tomografia computadorizada. CONCLUSÃO: O estadiamento da pancreatite aguda pela tomografia computadorizada por meio do índice morfológico e do índice de gravidade da tomografia computadorizada é um método bastante reprodutível. O não-uso do contraste não afeta a reprodutibilidade da tomografia computadorizada para o cálculo do índice morfológico.OBJECTIVE: To evaluate the reproducibility of unenhanced and contrast-enhanced computed tomography in the assessment of patients with acute pancreatitis. MATERIALS AND METHODS: Fifty-one unenhanced and contrast-enhanced abdominal computed tomography studies of patients with acute pancreatitis were blindly reviewed by two

  2. Quando a fase de equilíbrio pode ser suprimida nos exames de tomografia computadorizada de abdome? What is the real role of the equilibrium phase in abdominal computed tomography?

    Directory of Open Access Journals (Sweden)

    Priscila Silveira Salvadori

    2013-04-01

    Full Text Available OBJETIVO: Avaliar a necessidade de realização da fase de equilíbrio nos exames de tomografia computadorizada de abdome. MATERIAIS E MÉTODOS: Realizou-se estudo retrospectivo, transversal e observacional, avaliando 219 exames consecutivos de tomografia computadorizada de abdome com contraste intravenoso, realizados num período de três meses, com diversas indicações clínicas. Para cada exame foram emitidos dois pareceres, um avaliando o exame sem a fase de equilíbrio (primeira análise e o outro avaliando todas as fases em conjunto (segunda análise. Ao final de cada avaliação, foi estabelecido se houve mudança nos diagnósticos principais e secundários, entre a primeira e a segunda análise. Foi utilizada a extensão do teste exato de Fisher para avaliar a modificação dos diagnósticos principais (p 0,999. Com relação aos diagnósticos secundários, cinco exames (2,3% foram modificados. CONCLUSÃO: Para indicações clínicas como estadiamento tumoral, abdome agudo e pesquisa de coleção abdominal, a fase de equilíbrio não acrescenta contribuição diagnóstica expressiva, podendo ser suprimida dos protocolos de exame.OBJECTIVE: To evaluate the role of the equilibrium phase in abdominal computed tomography. MATERIALS AND METHODS: A retrospective, cross-sectional, observational study reviewed 219 consecutive contrast-enhanced abdominal computed tomography images acquired in a three-month period, for different clinical indications. For each study, two reports were issued - one based on the initial analysis of non-contrast-enhanced, arterial and portal phases only (first analysis, and a second reading of these phases added to the equilibrium phase (second analysis. At the end of both readings, differences between primary and secondary diagnoses were pointed out and recorded, in order to measure the impact of suppressing the equilibrium phase on the clinical outcome for each of the patients. The extension of the exact Fisher

  3. Fixação do nitrogênio do ar pelas bactérias que vivem em simbiose com as raízes da centrosema Fixation of the atmospheric nitrogen by bacteria which live symbiotically on centrosema

    Directory of Open Access Journals (Sweden)

    J. Casado Montojos

    1963-01-01

    Full Text Available Continuando a série de trabalhos sôbre a quantidade de nitrogênio atmosférico fixada por bactérias que vivem em simbiose com raízes de leguminosas, são relatados os resultados encontrados em centrosema (Centrosema pubescens Benth. Foram utilizados vasos de Mitscherlich, com terra-roxa-misturada. A colheita das plantas foi efetuada por ocasião do florescimento. A parte aérea foi pesada para cálculo da quantidade de massa verde produzida, e, em seguida, juntamente com as raízes, sêca a 60°C até pêso constante. Determinaram-se os teores de nitrogênio na parte aérea e subterrânea das plantas, assim como da terra dos vasos. Os resultados mostraram elevada capacidade de fixação simbiótica de nitrogênio pela centrosema correspondente a cêrca de 204 quilogramas de nitrogênio por hectare.Following a series of research work with the purpose of verifying the amount of atmospheric nitrogen fixed by symbiotic bacteria, the authors report in this paper the results on their research with the leguminous plant Centrosema pubescens Benth. This experiment was conducted in Mitscherlich pots containing terra-roxa-misturada obtained from a 20 cm deep layer of soil taken from the Central Experiment Station "Theodureto de Camargo", in Campinas. The plants were cut in the blooming period, as this is the proper season for turning over green manure crops. The aerial portion of the plants was weighed so as to determine the total production of green matter and then it was dried together with the roots at 60°C. Thus, nitrogen of the total plant was determined and the same analysis was done at the end of the experiment for the soil removed from the pots. According to the results of this experiment, it was found that 204 kilograms of nitrogen per hectare were fixed, showing therefore that centrosema has a high capacity of symbiotic nitrogen fixation.

  4. Evaluation of two semi-analytical techniques in air quality applications Avaliação de duas técnicas semi-analíticas em aplicações na qualidade do ar

    Directory of Open Access Journals (Sweden)

    Jonas C. Carvalho

    2007-04-01

    Full Text Available In this article an evaluation of two semi-analytical techniques is carried out, considering the quality and accuracy of these techniques in reproducing the ground-level concentration values of passive pollutant released from low and high sources. The first technique is an Eulerian model based on the solution of the advection-diffusion equation by the Laplace transform technique. The second is a Lagrangian model based on solution of the Langevin equation through the Picard Iterative Method. Turbulence parameters are calculated according to a parameterization capable of generating continuous values in all stability conditions and in all heights of the planetary boundary layer. Numerical simulations and comparisons show a good agreement between predicted and observed concentrations values. Comparisons between the two proposed techniques reveal that Lagrangian model generated more accurate results, but Eulerian model demands a lesser computational time.Neste artigo é realizada uma avaliação de duas técnicas semi-analíticas, considerando a qualidade e a exatidão destas técnicas em reproduzir valores de concentração ao nível da superfície de poluentes passivos emitidos a partir de fontes baixas e altas. A primeira técnica é um modelo Euleriano baseado na solução da equação advecção-difusão através da técnica de transformada de Laplace. A segunda é um modelo Lagrangiano baseado na solução da equação de Langevin através do Método Iterativo de Picard. Parâmetros da turbulência são calculados de acordo com uma parametrização capaz de gerar valores contínuos em todas as condições de estabilidade e em todas as alturas na camada limite planetária. Simulações numéricas e comparações mostram uma boa concordância entre valores de concentração previstos e observados. Comparações entre as duas técnicas revelam que o modelo Lagrangiano gera resultados mais precisos, mas o modelo Euleriano exige um menor tempo

  5. Influência da adição da goma arábica em filmes isolados de polímero acrílico: estudo das propriedades de intumescimento e de permeabilidade Influence of arabic gum in acrylic polymer isolated films: study of swelling properties and permeability

    Directory of Open Access Journals (Sweden)

    Victor Gustavo Santos Gabas

    2003-12-01

    Full Text Available Goma arábica associada ao polímero acrílico Eudragit RS30D® na formação de filmes isolados foram obtidos e investigados como material potencialmente adequado à liberação modificada de fármacos. Foram preparadas dispersões aquosas de 4% (p/v e o citrato de trietila (20% massa polímero acrílico foi usado como plastificante. Dispersões foram vertidas em placa de Nylon revestida com Teflon® e colocadas em estufa a 60 ºC. A determinação do índice de intumescimento (Ii% em fluidos de simulação gástrica (FSG e intestinal (FSI, além da permeabilidade ao vapor d'água (TVA foram avaliadas. As dispersões propostas apresentaram habilidades filmogênicas. O polissacarídeo favoreceu, proporcionalmente à sua concentração, o grau de hidratação e a permeabilidade ao vapor d'água dos filmes formados. Estas particularidades observadas sugerem que os filmes constituídos por estas associações garantem acessibilidade com maior intensidade, quando comparado ao polimetacrilato individualmente, condição essa indispensável para uma biodegradação efetiva, em especial às regiões distais do trato gastrintestinal.Arabic gum combined with polymeric acrylic Eudragit RS30D® in isolated films for film coating, were obtained and investigated as potential material adapted for drug delivery systems. They were prepared aqueous dispersions of 4% (p/v, the triethyl citrate (20% w/w of the methacrylate polymer it was used with plasticizer. Sample of dispersions were poured over plate of Nylon covered with Teflon and placed in an air circulated oven at 60 ºC. Determination of the swelling index (Is% in fluids of gastric (SGF or intestinal simulation or intestinal (SIF, and the permeability to the water vapour (TVA were investigated. An increase in the amount of added polysaccharide favored the degree of hydration/swelling and permeability of the formed films. These observed particularities suggest that the films constituted by these

  6. 40Ar-39Ar geochronology and thermochronology: principles and potential

    International Nuclear Information System (INIS)

    Geochronology based on radiogenic isotopes has become an invaluable tool in earth sciences. Several radioactive parent-daughter systems of varying half-lives such as Rb-Sr, Sm-Nd, K-Ar have been traditionally used by researchers for determining the timing of geological and planetary processes. 40Ar-39Ar dating, a variant of the K-Ar system, is a well-established and versatile method of determining the eruptive ages of volcanic rocks and the ∼150-500 deg C thermal histories of a variety of more slowly cooled igneous and metamorphic rocks. This technique has been the most popular tool for dating felsic and intermediate volcanic rocks. Recently several new areas of research have been explored, including total-fusion dating of mineral grains from volcanic and sedimentary samples, mapping of argon isotopic gradients in crystals, and selective dating of fabric-defining minerals in poly deformed specimens

  7. Retinal thickness assessed by optical coherence tomography (OCT in pseudophakic macular edema Espessura retiniana medida pela tomografia de coerência óptica (OCT no edema macular do pseudofácico

    Directory of Open Access Journals (Sweden)

    Maria Teresa Brizzi Chizzoti Bonanomi

    2006-08-01

    com 22 olhos pseudofácicos com visão igual a 20/20 e no mínimo 6 meses de pós-operatório, submetidos apenas ao mapa macular com o tomografia de coerência óptica 2. Os critérios de exclusão foram diabetes e maculopatias e exames de qualidade insuficiente para análise. Os angiogramas foram divididos em 3 grupos segundo a intensidade do edema: Grupo I: nível 0 (ausência de edema macular angiográfico do pseudofácico; grupo II: níveis 1 e 2 (edema macular angiográfico do pseudofácico perifoveal incompleto e completo e grupo III: níveis 3 e 4 (edema macular angiográfico do pseudofácico até um e maior que um diâmetro papilar de área. As nove zonas do mapa macular da tomografia de coerência óptica foram comparadas entre o controle os três subgrupos do grupo de estudo e, entre o grupo I e os grupos II e III. RESULTADOS: Dos 36 olhos do grupo de estudo, 23 (64% foram classificados como grupo I, 10 (28% como grupo II e 3 (8% como grupo III. A espessura para a zona fóvea foi de 185±15 µm no grupo controle, de 189±24 µm no grupo I, de 213±33 µm no grupo II e de 455± 38 µm no grupo III. Diferenças significativas para esta região foram observadas entre o grupo controle ou grupo I e o grupo III para todas as zonas (p<0,01 e, entre o grupo I e o grupo II para a zona fóvea e a temporal interna (p<0,05. CONCLUSÃO: O programa de mapa macular da tomografia de coerência óptica 2 é útil para o diagnóstico de edema macular angiográfico do pseudofácico.

  8. Evaluation of small intestine bacterial overgrowth in patients with functional dyspepsia through H2 breath test Avaliação de supercrescimento bacteriano no intestino delgado em pacientes com dispepsia funcional, utilizando o teste de H2 no ar expirado

    Directory of Open Access Journals (Sweden)

    Michelle Bafutto Gomes Costa

    2012-12-01

    ção cujos sintomas não estão relacionados à doença de base orgânica; sua etiopatogenia não é bem definida. O supercrescimento bacteriano no intestino delgado (SBID é caracterizado pelo aumento do número e/ou tipo de bactérias colônicas no trato gastrointestinal superior. A hipótese de SBID associado à dispepsia funcional deve ser considerada, uma vez que o distúrbio de motilidade do trato gastrointestinal é um dos principais fatores etiológicos envolvidos nas duas patologias. OBJETIVO: Determinar se há presença de SBID em pacientes com dispepsia funcional. MÉTODO: Estudo caso-controle, avaliando 34 pacientes: 23 dispépticos funcionais e 11 não dispépticos (grupo controle. Questionário baseado nos critérios de Roma III foi aplicado. Os pacientes se submeteram ao teste de H2 no ar expirado com lactulose, considerado positivo: pico de H2 superior a 20 ppm, em relação ao jejum ou dois picos superiores a 10 ppm sustentados até 60 minutos. RESULTADOS: Dos 23 pacientes dispépticos, 13 (56.5% obtiveram resultado positivo para SBID através do teste de H2 no ar expirado. No grupo controle, não foi evidenciado SBID. A associação entre o grupo dispéptico e o grupo controle em relação ao SBID, mostrou-se estatisticamente significante, com P = 0.0052. Do grupo dispéptico, 12 (52.2% pacientes faziam uso de inibidor de bomba de prótons; destes, 9 (75% apresentaram resultado positivo para SBID. No grupo controle, os 11 pacientes não usavam inibidor de bomba de prótons e não foi evidenciado SBID. Mostrou-se estatisticamente significante a associação do grupo de dispépticos em uso de inibidor de bomba de prótons que tiveram SBID e grupo controle, com P = 0.0011. CONCLUSÃO: Concluiu-se que, pacientes com dispepsia funcional apresentaram SBID, quando submetidos ao teste de H2 no ar expirado, em relação aos não-dispépticos. Além disso, observou-se maior prevalência de SBID em pacientes dispépticos que faziam uso de inibidor de bomba de pr

  9. Exposição ao mercúrio e ao arsênio em Estados da Amazônia: síntese dos estudos do Instituto Evandro Chagas/FUNASA Exposure to mercury and arsenic in Amazon States: a summary of studies by the Evandro Chagas Institute/FUNASA

    Directory of Open Access Journals (Sweden)

    Elisabeth C. de Oliveira Santos

    2003-06-01

    Full Text Available Este artigo é uma revisão das pesquisas da Seção de Meio Ambiente do Instituto Evandro Chagas/FUNASA sobre exposição ao mercúrio (Hg no vale do rio Tapajós e Estado do Acre, e exposição ao arsênio (As através de resíduos da exploração de manganês (Mn realizada pela ICOMI deixados no Porto de Santana-AP. Em relação ao mercúrio, têm sido pesquisadas populações sob risco através da via respiratória ou alimentar. No primeiro caso, os trabalhadores de casas de compra e venda de ouro têm apresentado teores mais elevados de Hg em urina do que os garimpeiros estudados. No segundo caso, as populações ribeirinhas têm mostrado níveis diferenciados de exposição (Hg em cabelo. Comunidades ribeirinhas situadas em áreas não afetadas pelo mercúrio da garimpagem e com hábitos alimentares semelhantes às de área de risco têm sido avaliadas, visando a construção de parâmetros de normalidade regional. São também pesquisados os teores de Hg em materiais ambientais e na biota aquática. Os estudos de saúde humana e ambiente na cidade de Santana-AP objetivaram avaliar as fontes e possíveis vias de exposição da população da comunidade do Elesbão ao arsênio. Verificou-se a existência de fonte de risco através dos rejeitos de Mn, porém os níveis de As na água consumida pela população mostraram-se dentro dos parâmetros de normalidade. As médias encontradas em sangue e cabelo coincidem com médias de normalidade referidas na literatura, em populações não expostas, e as associações entre variáveis epidemiológicas, avaliação clínico-laboratorial e os teores de arsênio não mostraram significância estatística.This article is a review of the studies carried out by Environmental Section of the Evandro Chagas Institute/FUNASA on mercury (Hg exposure in the Tapajós river basin, and arsenic exposure (As due to residues of the manganese (Mn exploration, performed by ICOMI and left at the port of Santana

  10. Correlação entre os achados do teste de emissão de ar nasal e da nasofaringoscopia em pacientes com fissura labiopalatina operada Correlation between the findings on the nasal air emission test and nasopharyngoscopy in patients with operated cleft lip and palate

    Directory of Open Access Journals (Sweden)

    Fabiana Andrade Penido

    2007-06-01

    Full Text Available OBJETIVO: Verificar se as informações colhidas no teste de emissão de ar nasal apresentam compatibilidade com os achados da nasofaringoscopia, podendo auxiliar no julgamento da funcionalidade do mecanismo velofaríngeo. MÉTODOS: Foram analisados os achados do teste de emissão de ar nasal e nasofaringoscopia em 21 indivíduos operados de fissura pós-forame e transforame incisivo, de ambos os gêneros, com idade superior a oito anos. A correlação foi feita observando se, diante de um gap velofaríngeo (espaço entre as estruturas da região velofaríngea visualizado na nasofaringoscopia, notava-se embaçamento do espelho de Glatzel no teste de emissão de ar nasal. Os dados foram analisados estatisticamente pelo índice de Kappa. RESULTADOS: Notou-se concordância entre os testes (pOBJECTIVE: To verify whether the information collected in the nasal air emission test are compatible to the nasopharyngoscopy findings, helping the assessment of the velopharyngeal mechanism functionality. METHODS: The findings of nasal air emission test and nasopharyngoscopy were analyzed in 21 individuals of both genders, over the age of 8 years, operated for post-foramen and transincisive foramen fissure. The correlation was carried out observing whether or not, in the face of a velopharyngeal gap visualized in the nasopharyngoscopy, misting of the Glatzel mirror was noted in the nasal air emission test. Data were statistically analyzed using the Kappa index. RESULTS: An agreement was observed between the tests (p<0,05, and it was considered higher during blowing, emission of isolated stops and fricatives in words and phrases (Kappa: 0,897; 0,887; 0,774 and 0,774, respectively, than for emission of stops in words, isolated fricatives and stops in phrases (Kappa: 0,691; 0,640 and 0,488, respectively. Incompatibility occurred in a few cases, in the presence of a small gap, complete closing and complete closing with bubbling. Regarding the tendency of

  11. Processamento por ajuste de campo em acústica submarina e aplicações

    OpenAIRE

    C. Soares; Jesus, S.M.

    2004-01-01

    A acústica submarina encontra aplicação em variados problemas tais como detecçãao activa ou passiva e localização de navios e submarinos, comunicações acústicas, tomografia acústica, procura de objectos enterrados e monitorização remota de fenomenos naturais, entre outros. Parte destas aplicações tornaram-se possíveis graças aos avanços tecnológicos da última década, que trouxeram um aumento significativo da capacidade computacional disponível.

  12. Relação entre área e volume da mastoide em adultos brasileiros

    OpenAIRE

    Marco Antônio Rios Lima; Luciano Farage; Maria Cristina Lancia Cury; Fayez Bahmad Júnior

    2013-01-01

    As medidas de área e volume da mastoide por tomografia computadorizada não foram previamente descritas em adultos brasileiros. O conhecimento dessas medidas é muito importante para o entendimento da fisiologia da orelha média e seus estados patológicos, refletindo diretamente na pneumatização mastoídea. OBJETIVO: Verificar a existência de relação entre a área e o volume da mastoide. MÉTODO: Estudo de coorte contemporânea com corte transversal, no qual 28 pacientes foram submetidos à tomografi...

  13. Electron scattering from 36Ar and 40Ar

    International Nuclear Information System (INIS)

    The argon isotopes, 36Ar and 40Ar, have been investigated using electron scattering at the high-resolution Linac facilities of the National Bureau of Standards. Both elastic scattering and scattering to low-lying states have been observed. A high-pressure, low-volume gas target cell was designed and developed for this experiment. The cell features a transmission geometry and has resolution comparable to solid targets. Spectra were obtained at incident beam energies ranging from 65 to 115 MeV at scattering angles of 92.50 and 1100. Values obtained for the rms charge radii are 3.327 +- 0.015 and 3.393 +- 0.015 fm for 36Ar and 40Ar respectively. A sensitive measurement was made of the difference in the two radii yielding a value of Δ r = 0.079 +- 0.006 fm. The inelastic levels observed are the 1.97 (2+) and 4.18 MeV (3-) levels in 36Ar, and the 1.46 (2+), 2.52 (2+), 3.21 (2+), and 3.68 MeV (3-) levels in 40Ar. A Tassie model analysis was made of the inelastic transitions in the DWBA approximation and transition strengths of these levels were extracted

  14. Radiodensidade hepática de cães hígidos por tomografia computadorizada helicoidal Hepatic radiodensity in healthy dogs by helical computed tomography

    Directory of Open Access Journals (Sweden)

    Lorena Adão Vescovi Séllos Costa

    2010-04-01

    Full Text Available Os objetivos do presente estudo são obter valores médios de radiodensidade do parênquima hepático de cães normais e descrever a adaptação na espécie canina de uma técnica de mensuração da densidade tomográfica já utilizada em humanos. Para a realização do estudo, foram adquiridos exames tomográficos do fígado de oito cães hígidos adultos jovens, sem distinção de sexo ou raça. Após a realização do exame, foram obtidos valores médios de radiodensidade de três regiões de interesse (ROIs do parênquima hepático em três diferentes níveis de corte. Além disso, foi realizada a análise de uma região de interesse do parênquima esplênico em três diferentes níveis de corte para uma avaliação comparativa entre os órgãos. Observou-se, no grupo avaliado, um valor médio de atenuação HU de 59,58±3,34 unidades Hounsfield (HU. A diferença de densidade entre o parênquima hepático e o esplênico foi, em média, de 4,69±7,77HU. No presente estudo, o exame de tomografia computadorizada demonstrou ser uma técnica com alta sensibilidade para estimar a radiodensidade do parênquima hepático. O estabelecimento de valores de normalidade e a padronização de uma metodologia de avaliação permitem melhor caracterização de alterações na radiodensidade pelo exame tomográfico, auxiliando no estabelecimento de um diagnóstico e minimizando a necessidade de exames invasivos.The objectives of the study reported here were to obtain medium values of hepatic parenchyma radiodensity in healthy dogs, and also describe the adaptation in canine specie of a tomographic density measurement technique, which has already been used in humans. For the accomplishment of this study tomographic exams were realized in eight young dogs without sex or breed definition. After the exams, the liver's degree of HU attenuation was determined through a mean value of three selected regions of interest (ROI in hepatic parenchyma obtained in three

  15. Nocardiose pulmonar em paciente com síndrome da imunodeficiência adquirida: relato de caso Pulmonary nocardiosis in a patient with acquired immunodeficiency syndrome: case report

    OpenAIRE

    Ana Carina Gamboa da Silva; Erick Malheiro Leôncio Martins; Edson Marchiori; Gilberto Torres Neto

    2002-01-01

    Os autores descrevem um caso de nocardiose pulmonar em um homem de 37 anos de idade com a síndrome da imunodeficiência adquirida, em tratamento com anti-retrovirais, cujos sintomas de apresentação foram tosse com expectoração, hemoptóicos e emagrecimento progressivo. Foi realizada radiografia do tórax, que demonstrou consolidação no lobo superior do pulmão direito, e tomografia computadorizada do tórax, que evidenciou consolidação pulmonar com áreas escavadas. Diante dos achados radiológicos ...

  16. Fibrose pulmonar idiopática simultânea a enfisema em pacientes tabagistas Idiopathic pulmonary fibrosis and emphysema in smokers

    OpenAIRE

    Denise Rossato Silva; Marcelo Basso Gazzana; Sérgio Saldanha Menna Barreto; Marli Maria Knorst

    2008-01-01

    OBJETIVO: Descrever os achados clínicos e funcionais de pacientes com enfisema em lobos superiores e fibrose pulmonar idiopática (FPI) em lobos inferiores, recentemente descrita na literatura. MÉTODOS: Um grupo de 11 pacientes com a presença simultânea de enfisema e FPI foi identificado retrospectivamente. Todos os pacientes realizaram tomografia computadorizada de tórax com alta resolução e provas de função pulmonar. RESULTADOS: Entre os 11 pacientes identificados, havia 8 homens e 3 mulhere...

  17. Ars Poetica : [luuletused] / Mats Traat

    Index Scriptorium Estoniae

    Traat, Mats, 1936-

    2008-01-01

    Sisu: Ars poetica ; Veepeegel ; Kontrollõed ; Mandariiniriik ; Nikolai Siamashvili (1888-1911) ; Kolmekümne kolmas aasta ; Kiri linast 1966 ; Italmaz Nuriyev ; Rudolf Rimmelile mõeldes ; Gennadi Aigi

  18. O uso de FDG-PET/TC scan no planejamento da radioterapia em câncer do pulmão não de pequenas células Use of FDG-PET/CT scan in the planning of radiation therapy for non-small cell lung cancer

    OpenAIRE

    Faria, Sergio L; Robert Lisbona; Jerry Stern; Slobodan Devic; Luis Souhami; Freeman, Carolyn R.

    2007-01-01

    Radioterapia é uma importante alternativa de tratamento curativo em pacientes com câncer do pulmão não de pequenas células. Entretanto, pulmões são muito sensíveis à radiação e isto aumenta a importância em se delimitar o volume a ser irradiado com precisão. Ultimamente, a tomografia por emissão de pósitron (PET) e a tomografia computadorizada (TC) são feitas de forma combinada, e a literatura sugere que seu impacto no planejamento da radioterapia é significativo. Ao se utilizar exames de PET...

  19. Produção do girassol e teor de óleo nos aquênios em função da temperatura do ar, precipitação pluvial e radiação solar Yield of sunflower and oil seed content as a function of air temperature, rainfall and solar radiation

    Directory of Open Access Journals (Sweden)

    Giovani Luiz Thomaz

    2012-08-01

    Full Text Available O presente estudo teve o objetivo de avaliar o efeito da temperatura do ar, precipitação pluvial e radiação solar, ocorridos em cada fase fenológica da cultura do girassol, na produção de aquênios, no teor de óleo dos aquênios e na produção de óleo do girassol. Foram conduzidos dez experimentos em intervalos de 20 dias, com início em 30/07/2007 e término em 28/01/2008. Cada experimento constituiu uma época de semeadura. Para verificar a normalidade dos erros e homogeneidade das variâncias, inicialmente, realizou-se uma análise individual por experimento para, em seguida, realizar análise conjunta. O delineamento experimental utilizado foi o de blocos ao acaso com quatro tratamentos (cultivares e quatro repetições, em cada época de semeadura. Houve interação entre épocas de semeadura e cultivares para todas as variáveis estudadas. Foram feitas análises de correlação entre as variáveis meteorológicas e as de produção do girassol. A produção de aquênios, teor de óleo e produção de óleo nas cultivares de girassol foram mais elevados quando ocorreram temperaturas mais baixas na fase vegetativa, maiores precipitações pluviais na floração e maiores índices de radiação solar na fase vegetativa e de enchimento de aquênios.The objective of this research was to evaluate the effect of air temperature, rainfall and solar radiation occurring during each phonological phase of the sunflower crop, on yield of achenes, on oil content of achenes and on oil yield in sunflower. Ten experiments were carried out at Ponta Grossa, PR, Brazil, with intervals of 20 days, beginning on July 30, 2007 and finishing on January 28, 2008. Each sowing time constituted an experiment. The experiments were arranged in a randomized complete block design, with four treatments (cultivars and four replicates. It was performed the analysis of variance of each experiment separately and, after that, the joint analysis of all experiments

  20. İran bal arıları (Apis mellifera meda)’nın varroa paraziti (Varroa destructor)’ne karşı korunma yeteneğinin değerlendirilmesi

    OpenAIRE

    NAJI KHOEI, Amir

    2012-01-01

    <em>Varroa destructor, em>bal arılarının (<em>Apis melliferaem> L.) en önemli parazitlerinden biridir. Bu araştırmada İran bal arılarının (<em>Apis melliferaem> <em>meda>) <em>Varroa destructorem>'e karşı direnç özelliklerini araştırmak amacıyla, İran'ın Doğu Azerbaycan ilinin 5 farklı ilçesinden materyal olarak 60 bal arısı kolonisi ile Tebriz Üniversitesi Ziraat Fakültesi’nde deneme kurulmuştur. Çalışmada; tıma...

  1. Carbono orgânico e elementar em partículas em suspensão em habitações

    OpenAIRE

    Pinho, Isabel Cristina Correia de

    2011-01-01

    As concentrações de partículas em suspensão na atmosfera (PM10) e o seu conteúdo em carbono foram determinadas em amostras recolhidas em quatro locais distintos do concelho de Aveiro. Na recolha das amostras foram utilizados dois amostradores, de baixo caudal um para o ar interior e outro para o ar exterior, em simultâneo, com tempos de amostragem de 48 horas. As concentrações de PM10 foram determinadas por gravimetria, enquanto que o material carbonoso foi determinado ...

  2. Ar-39-Ar-40 Ages of Two Nakhlites, MIL03346 and Y000593: A Detailed Analysis

    Science.gov (United States)

    Park, Jisun; Garrison, Daniel; Bogard, Donald

    2007-01-01

    Radiometric dating of martian nakhlites by several techniques have given similar ages of approx.1.2-1.4 Ga [e.g. 1, 2]. Unlike the case with shergottites, where the presence of martian atmosphere and inherited radiogenic Ar-40 produce apparent Ar-39-Ar-40 ages older than other radiometric ages, Ar-Ar ages of nakhlites are similar to ages derived by other techniques. However, even in some nakhlites the presence of trapped martian Ar produces some uncertainty in the Ar-Ar age. We present here an analysis of such Ar-Ar ages from the MIL03346 and Y000593 nakhlites.

  3. Aspectos da tomografia computadorizada craniana na neurocisticercose na infância

    Directory of Open Access Journals (Sweden)

    Marilisa M. Guerreiro

    1989-06-01

    Full Text Available Os autores relatam aspectos tomográficos da neurocisticercose na infância a propósito da análise de 27 exames em 18 pacientes, que foram distribuídos em três grupos segundo o quadru clínico e os achados tomográficos. O grupo 1 foi caracterizado basicamente por epilepsias e calcificações. O grupo 2 caracterizou-se por hipertensão intracraniana e diversos aspectos tomográficos: edema, cistos e nódulos em três pacientes; hidrocefalia e calcificações em dois pacientes e normal em um paciente. O grupo 3 consistiu clinicamente de epilepsia e cefaléia, com vários padrões tomográficos. Os resultados são discutidos à luz da literatura disponível.

  4. Doença cística medular do rim: relato de um caso diagnosticado por ultra-sonografia e tomografia computadorizada Medullary cystic disease of the kidney: report of a case diagnosed by ultrasonography and computed tomography examinations

    Directory of Open Access Journals (Sweden)

    Tarcísio Nunes Carvalho

    2003-12-01

    Full Text Available Doença cística medular, nefronofitíase juvenil familiar ou complexo de doença cística medular referem-se a um grupo de doenças similares cuja lesão básica é uma progressiva atrofia tubular renal com esclerose glomerular e formação cística medular. É importante causa de insuficiência renal em pacientes adolescentes. Estudos de imagem têm papel principal no diagnóstico desta enfermidade, com cistos caracteristicamente individualizados na medula renal e junção córtico-medular e tamanho renal normal ou reduzido. Neste artigo demonstramos os achados de imagem da doença cística medular renal em uma adolescente com quadro clínico característico, por meio de ultra-sonografia e tomografia computadorizada.The terms medullary cystic disease, juvenile nephronophthisis or medullary cystic disease complex refer to a group of similar diseases in which the basic pathological abnormality is progressive renal tubular atrophy with secondary glomerular sclerosis and medullary cystic formation. Medullary cystic disease is an important cause of renal failure in adolescent patients. Imaging methods play a primary role in the diagnosis of these diseases. Cysts are characteristically seen in the renal medulla and corticomedullary junction whereas kidneys may be of normal to small size. In this article we present the ultrasonography and computed tomography findings of a female adolescent patient with characteristic clinical picture of medullary cystic disease.

  5. Estudo de Adequações em um Aeroporto Regional para Alcançar a Eficiência Energética de Forma Renovável

    Directory of Open Access Journals (Sweden)

    Artur Rech da Rosa

    2016-04-01

    Full Text Available A sustentabilidade ambiental trata da utilização do meio ambiente, dando oportunidade a ele de se regenerar, ou encontrando meios de substituir a ocupação ambiental por meios renováveis. Nesse contexto, o Aeroporto Regional de Caxias do Sul, que é um empreendimento prestador de serviços de transporte à região da Serra Gaúcha, pode atuar conforme o conceito de desenvolvimento sustentável, desde que ocorra a integração dos critérios ambientais na prática econômica. Nesse contexto, a fotogeração se mostra como uma alternativa para suprir sua demanda energética tornando-o sustentável do ponto de vista deste recurso. Neste trabalho, são determinados a demanda do aeroporto para este tipo de energia, o dimensionamento do sistema fotovoltaico e uma análise da viabilidade econômica do mesmo. A implementação deste sistema pode economizar ao aeroporto 420.248,73 R$/ano e pode gerar o equivalente a R$ 235.653,74/ano em créditos de energia, sendo viável economicamente. Este empreendimento, além de sustentar uma imagem de green airport, pode gerar empregos para especialistas na área e incentivar e propagar a ideia de utilização de energias renováveis

  6. Avaliação do ambiente solo-semente por meio da tomografia computadorizada Evaluation of the soil-seed environment through computerized tomography

    Directory of Open Access Journals (Sweden)

    Alcir José Modolo

    2008-04-01

    Full Text Available O condicionamento físico do solo ao redor das sementes reveste-se de grande importância para o bom desenvolvimento inicial da cultura, assegurando uma população sadia de plantas. O adequado contato solo-semente é um pré-requisito para a rápida emergência e o bom estabelecimento da cultura. Neste trabalho, objetivou-se utilizar a tomografia computadorizada de resolução milimétrica para determinação do ambiente solo-semente em sistema de plantio direto, logo após o plantio da cultura da soja. Utilizou-se o esquema de parcelas subdivididas, em que as parcelas constituíram-se de três teores de água do solo, correspondentes a 0,27; 0,31; e 0,36 kg kg-1, e as subparcelas de quatro níveis de carga, aplicadas pela roda compactadora, correspondentes a 0, 50, 90 e 140 N, no delineamento em blocos ao acaso, com quatro repetições. Foram avaliados a densidade média do solo na região da semente e o perfil de densidade média na linha de semeadura. De acordo com os resultados obtidos, pode-se concluir que as cargas aplicadas pela roda compactadora elevaram a densidade do solo no plano vertical da linha de semeadura abaixo da profundidade de semeadura, quando comparadas com as obtidas antes do plantio; a combinação entre cargas aplicadas pela roda compactadora e os teores de água no solo não influenciou a densidade média do solo na região da semente.The physical conditioning of the soil around seeds is of great importance for an adequate initial development of a crop, ensuring a healthy plant population. A suitable soil-seed contact is a prerequisite for a fast crop germination and good establishment. In this study, computerized tomography of millimeter resolution was used to determine the soil-seed environment in a no tillage system, immediately after soybean planting. A split plot design was used, in which the plots consisted of three contents of soil water, corresponding to 0.27; 0,31 and 0.36 kg kg-1, respectively, and the split

  7. Tomografia computadorizada de abdome normal: estudo retrospectivo das angulações dos hilos renais Normal abdominal computed tomography: a retrospective study of renal hila angles

    Directory of Open Access Journals (Sweden)

    Makoto Sakate

    2009-02-01

    Full Text Available OBJETIVO: Obter valores da angulação média dos hilos renais em relação ao plano horizontal, traçado sobre músculos eretores da espinha direito e esquerdo, considerando como parâmetro de referência para as medidas das angulações o centro da coluna vertebral lombar. MATERIAIS E MÉTODOS: Foram analisados 250 exames de tomografia computadorizada de abdomes considerados normais de indivíduos de ambos os sexos, sendo 128 masculinos (idade média de 52,45 ± 17,42 anos e 122 femininos (idade média de 54,39 ± 18,27 anos, totalizando 500 hilos renais estudados. A angulação média de cada hilo renal em relação ao plano horizontal foi obtida, sendo considerados sempre os ângulos agudos. RESULTADOS: O estudo comparativo entre os sexos mostrou que não houve diferença estatisticamente significante em relação aos ângulos agudos dos hilos renais. A análise estatística mostrou, com intervalo de confiança de 95%, para média do ângulo direito os limites de 40,40° e 44,54° e para o hilo renal esquerdo os limites de 39,91° e 43,23°. CONCLUSÃO: Os hilos renais, independentemente do sexo, apresentam angulações semelhantes. Valores angulares maiores terão anomalia de hiper-rotação ou hiper-rotação exagerada e valores menores terão anomalia de rotação incompleta ou rotação invertida.OBJECTIVE: To obtain mean angulation values for renal hila in relation to the horizontal plane traced over the right and left spinal erector muscles, considering the center of the lumbar vertebral spine as a parameter for measuring the renal hila angles. MATERIALS AND METHODS: The authors have analyzed 250 abdominal computed tomography studies of both male and female healthy individuals (128 men with mean age 52.45 ± 17.42 years, and 122 women with mean age 54.39 ± 18.27 years, corresponding to 500 renal hila evaluated. The mean angulation of each hilum in relation to the horizontal plane was obtained taking acute angles into consideration

  8. Comprometimento órbito-craniano por tumores malignos sinonasais: estudo por tomografia computadorizada Sinonasal malignant tumors involvement of the orbit and skull: a computed tomography study

    Directory of Open Access Journals (Sweden)

    Ana Célia Baptista

    2002-10-01

    Full Text Available Tumores malignos das cavidades sinonasais são raros e freqüentemente diagnosticados em estágio avançado da doença. A extensão destes tumores para locais críticos como a órbita e o crânio gera dificuldades no tratamento destas lesões. Dez pacientes com neoplasia maligna sinonasal, sem qualquer tratamento prévio e com evidência radiológica de extensão órbito-craniana, foram estudados por tomografia computadorizada. Dos dez tumores, cinco (50% foram neoplasias epiteliais, tendo sido a mais comum o carcinoma epidermóide (três casos. O sítio de origem tumoral mais comum foi o seio etmoidal, em quatro pacientes (40%, seguido pelo seio maxilar (30% e pela fossa nasal (30%. Dezesseis órbitas foram comprometidas, já que seis pacientes (60% apresentaram acometimento orbitário tumoral bilateral. Os tumores se estenderam mais freqüentemente para as órbitas através de erosão da parede medial e do soalho orbitários. A maioria das órbitas teve todos os compartimentos acometidos. Extensão dos tumores para a cavidade craniana foi mais comum através do teto etmoidal (70% e teto orbitário (30%. A fossa craniana anterior foi acometida em oito casos (80%, seguida pela fossa craniana média (40% e pelo lobo frontal (excluindo-se a fossa anterior (30%. Trinta e sete regiões da face foram acometidas pelos dez tumores, excluindo-se o sítio de origem da neoplasia e a região órbito-craniana, corroborando a grande extensão loco-regional do tumor no momento do diagnóstico.Malignant tumors of the sinonasal cavities are rare and often diagnosed late in the course of the disease. These tumors can extend into regions such as the orbit and brain, where treatment is difficult. Ten patients with nontreated sinonasal malignant neoplasms and radiological evidence of tumor extension into the orbit and brain were studied with computed tomography. Five (50% tumors were epithelial neoplasms whereas squamous cell carcinoma was the most common type (3

  9. Bone densitometry in healthy cats by quantitative computed tomography; Densitometria ossea em gatos higidos por tomografia computadorizada quantitativa

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, D.C. [Universidade Federal do Parana - Curitiba, PR (Brazil); Costa, L.A.V.S.; Teixeira, M.W.; Costa, F.S. [Universidade Federal Rural de Pernambuco - Recife, PE (Brazil); Cardoso, M.J.L. [Universidade Estadual do Norte do Parana - Campus Luiz Meneghel - Bandeirantes, PR (Brazil)

    2012-06-15

    The radiodensity of the trabecular bone of the lumbar vertebrae in 16 healthy adult cats was studied using quantitative computed tomography (QCT). The average radiodensity of the trabecular bone of the second lumbar vertebra was 436.1 +- 42.1 Hounsfield units. However, there was a nonhomogeneous radiodensity distribution of the vertebral body. (author)

  10. Cholesteatoma: computed tomography and radiography in a dog; Colesteatoma: tomografia computadorizada e radiografia em cao com otite cronica

    Energy Technology Data Exchange (ETDEWEB)

    Belotta, Alexandra Frey; Babicsak, Viviam Rocco; Mamprim, Maria Jaqueline; Vulcano, Luiz Carlos, E-mail: a_fbelotta@yahoo.com.br [Universidade Estadual Paulista Julio de Mesquita Filho (FMVZ/UNESP), Botucatu, SP (Brazil). Faculdade de Medicina Veterinaria e Zootecnia . Dept. de Reproducao Animal e Radiologia Veterinaria; Arruda, Vanesa Kutz de; Amorim, Rogerio Martins [Universidade Estadual Paulista Julio de Mesquita Filho (FMVZ/UNESP), Botucatu, SP (Brazil). Faculdade de Medicina Veterinaria e Zootecnia. Dept. de Clinica Veterinaria

    2012-07-01

    Cholesteatoma, a rare and/or misdiagnosed disease, results of a serious complication in dogs with chronic otitis. This article describes a case of a dachshund sent to the veterinary hospital presenting signs of cognitive dysfunction associated to peripheral neuropathy of the facial nerve on the right side. At radiography, an enlargement and thickness of the contours associated with loss of anatomical definition of the right tympanic bulla compared to the left was seen. At tomography, this enlargement and thickness were seen with better definition, besides the fulfilling by hyperdense calcified content, bullae osteolysis and temporal bone sclerosis at the same side. (author)

  11. Computed tomography of the thorax in children with cystic fibrosis; Tomografia computadorizada do torax em criancas com fibrose cistica

    Energy Technology Data Exchange (ETDEWEB)

    Parente Filho, Livio William Sales [Universidade Federal, Rio de Janeiro, RJ (Brazil); Marchiori, Edson [Universidade Federal Fluminense, Niteroi, RJ (Brazil); Daltro, Pedro; Santos, Eloa Nunes [Instituto Fernandes Figueiras, Rio de Janeiro, RJ (Brazil)

    1998-04-01

    We studied retrospectively the value of computed tomography of the thorax in patients suffering from cystic fibrosis. Twenty-six patients were studied, which showed as the most frequency pulmonary findings bronchial wall thickening in 22 patients (84.6), followed by bronchiectasis in 16 patients (61.5%). Less frequent finding were ill-defined patch consolidation, mucoid impaction, bullaes and atelectasis. We found a predominant distribution of bronchial wall thickening and bronchiectasis in the upper lobes of the lungs. Computed tomography is the more sensitive technique for early visualization and location of the manifestations of cystic fibrosis bronchopathy. (author) 14 refs., 9 figs.

  12. Evaluation of the absorbed dose in odontological computerized tomography; Avaliacao da dose absorvida em tomografia computadorizada odontologica

    Energy Technology Data Exchange (ETDEWEB)

    Legnani, Adriano; Schelin, Hugo R.; Rocha, Anna Silvia P.S. da, E-mail: schelin@utfpr.edu.b, E-mail: anna@utfpr.edu.b [Universidade Tecnologica Federal do Parana (UTFPR), Curitiba, PR (Brazil); Khoury, Helen J., E-mail: khoury@ufpe.b [Universidade Federal de Pernambuco (UFPE), Recife, PE (Brazil)

    2011-10-26

    This paper evaluated the absorbed dose at the surface entry known as 'cone beam computed tomography' (CBCT) in odontological computerized tomography. Examination were simulated with CBCT for measurements of dose. A phantom were filled with water, becoming scatter object of radiation. Thermoluminescent dosemeters were positioned on points correspondent to eyes and salivary glands

  13. REGISTRATION OF BIRDSFOOT TREFOIL GERMPLASM ARS-2622

    Science.gov (United States)

    ARS-2622 broadleafed birdsfoot trefoil (Lotus corniculatus L.) germplasm was released by the USDA-ARS in cooperation with the Missouri Agricultural Experiment Station in August 2002. The merit of ARS-2622 is that it is a rhizome producing population with a broad genetic base. ARS-2622 was developed ...

  14. Reconstrução do seio maxilar atrófico com enxerto autólogo de crista ilíaca: avaliação por tomografia computadorizada e radiografia panorâmica Autologus crest iliac graft in the reconstruction of resorbed maxillary sinus: evaluation through computed tomography and panoramic radiography

    Directory of Open Access Journals (Sweden)

    André Luíz Zétola

    2002-02-01

    Full Text Available OBJETIVOS: As dificuldades para a utilização de implantes dentários osteointegrados em pacientes portadores de atrofia do seio maxilar justificaram o emprego de enxerto autólogo não vascularizado de crista ilíaca isolado ou associado à hidroxiapatita (HA em 14 pacientes submetidos a 25 procedimentos no Hospital das Nações, Curitiba, Paraná, portadores de atrofia do sinus maxilar. O objetivo foi avaliar comparativamente a precisão da tomografia computadorizada e da radiografia panorâmica, através da quantificação da neoformação óssea nesta estrutura. MÉTODOS: Foram selecionadas pacientes edentados, com altura óssea residual do rebordo gengival ao soalho do seio maxilar menor que 5mm. O enxerto medular de crista ilíaca fragmentada isolado ou misturado com HA foi colocado através da parede lateral no soalho atrófico da cuba maxilar por via submucosa. A avaliação quantitativa e qualitativa foi feita através da radiografia panorâmica e tomografia computadorizada, sendo utilizado na análise estatística a distribuição t de Student (prevalência de 0,05 para análise das variâncias, considerado que a leitura dos laudos radiológicos foi feita por dois especialistas, medindo a distância entre os pontos inferiores e superiores do enxerto no soalho do seio maxilar. RESULTADOS: Tivemos um ganho médio de 14,8mm em todos os procedimentos, com um erro maior que 3mm em 16 procedimentos (64% e incorporação satisfatória do enxerto ósseo suficiente para futuro implante dentário. CONCLUSÕES: A tomografia computadorizada foi o método de escolha na avaliação qualitativa e quantitativa da incorporação de enxerto autólogo não vascularizado em seio maxilar atrófico.BACKGROUND:There are different methods to evaluate bone grafts in the maxillary sinus. Panoramic radiography is the most common one, even though assessment could be difficult. Occasionaly computerized tomography (CTis another option but cost and radiation in

  15. Analysis list: AR [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available AR Blood,Breast,Prostate + hg19 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/target/AR.1.tsv http://dbar...chive.biosciencedbc.jp/kyushu-u/hg19/target/AR.5.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/tar...get/AR.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/colo/AR.Blood.tsv,http://dbar...chive.biosciencedbc.jp/kyushu-u/hg19/colo/AR.Breast.tsv,http://dbarchive.biosc...iencedbc.jp/kyushu-u/hg19/colo/AR.Prostate.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/colo/Blood.gml,http://dbar

  16. Analysis list: Ar [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Ar Gonad,Kidney,Prostate + mm9 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/targe...t/Ar.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Ar.5.tsv http://dbarchive.biosciencedbc.jp/...kyushu-u/mm9/target/Ar.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Ar.Gonad.tsv,http://dbarchive.bioscience...dbc.jp/kyushu-u/mm9/colo/Ar.Kidney.tsv,http://dbarchive.bioscienced...bc.jp/kyushu-u/mm9/colo/Ar.Prostate.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Gonad.gml,http://dbarchive.bioscience

  17. Genética de Coffea: XIV - Hereditariedade do cálice petalóide em Coffea arábica L. Var. calycanthema K.M.C.

    Directory of Open Access Journals (Sweden)

    A. Carvalho

    1952-06-01

    Full Text Available As espécies de Coffea, no geral, apresentam um cálice constituído de cinco sépalas muito rudimentares. Em Coffea arabica L. foi encontrado um único cafeeiro, possuindo o cálice bem desenvolvido e de natureza petalóide. A análise genética dêsse característico é discutida no presente trabalho. Verificou-se que se trata de um fator que afeta, aparentemente, apenas algumas partes da flor, sendo o cálice de natureza petalóide, o estilo e o estigma de forma e tamanho variáveis e o estigma desprovido de superfície estigmática. O ovário e o pedicelo da flor são de cor branca e se desprendem com a flor, alguns dias após a sua abertura, determinando esterilidade quase total das plantas portadoras do fator calicântema. O pólen é normal. Pelo cruzamento de plantas normais com o cafeeiro calicântema, obtiveram-se 50% de plantas normais e 50% de plantas calicântema. Êstes dados da análise genética indicam, pois, que a calicantemia é controlada por um par de fatôres genéticos, tendo as plantas com cálice normal a constituição cc e, sendo heterozigotas para êsse par de alelos - Cc, as plantas calicântema estudadas. Não se conhecem plantas de constituição CC, pois todos os cafeeiros portadores do alelo C apresentam esterilidade das partes femininas da flor. As plantas calicântema têm tôdas as flores com o cálice petalóide, e não se notaram casos de instabilidade somática do alelo C. A julgar pelos dados de cruzamento com a var. murta, o cafeeiro mostrando o característico calicântema deve ter-se originado por mutação da var. typica. Essa mutação deve ser muito rara, pois apenas uma planta foi observada entre centenas de milhares de cafeeiros que têm sido examinados, tanto em viveiros como nas plantações de café.Coffea arabica varieties usually develop a rudimentary calyx formed by five reduced denticles. Two exceptions however have already been found which have large sepals. In one of them the development

  18. Aspectos tomográficos da tuberculose pulmonar em pacientes adultos com AIDS

    Directory of Open Access Journals (Sweden)

    Lanamar Aparecida de Almeida

    2011-02-01

    Full Text Available OBJETIVO: Este trabalho tem como finalidade descrever os achados tomográficos da tuberculose pulmonar em pacientes adultos com AIDS atendidos no serviço de radiologia de um hospital de referência em doenças infecciosas, procurar associações desses achados e a contagem de CD4. MATERIAIS E MÉTODOS: Foram estudados 45 pacientes por meio de tomografia computadorizada de tórax durante quatro anos. RESULTADOS: Foram encontrados linfonodomegalia mediastinal e/ou hilar em 31 (68,8% dos casos, derrame pleural em 29 (64,4%, nódulos centrolobulares de distribuição segmentar em 26 (57,7%, consolidação em 24 (53,3%, confluência de micronódulos em 17 (37,7%, nódulos mal definidos com distribuição centrolobular em 16 (35,5%, padrão de "árvore em brotamento" em 13 (28,9%, espessamento de parede brônquica em 12 (26,6%, cavidade de parede espessa em 10 (22,2%, nódulos miliares em 9 (20% e bronquiectasias cilíndricas em 6 (13,3%. Dos 45 pacientes, 35 (77,8% apresentaram CD4 200 cel/mm³. CONCLUSÃO: Concluímos que neste estudo, diversamente do descrito na literatura, linfonodomegalia mediastinal e/ou hilar e consolidação foram significativamente mais frequentes em pacientes com CD4 > 200 cel/mm³. No entanto, linfonodos com centro hipodenso foram mais frequentemente observados em pacientes com severa imunodepressão, ou seja, CD4 < 200 cel/mm³.

  19. 40Ar/39Ar geochronology at the Instituto de Geociências, USP: instrumentation, analytical procedures, and calibration

    Directory of Open Access Journals (Sweden)

    PAULO M. VASCONCELOS

    2002-06-01

    Full Text Available Laser heating 40Ar/39Ar geochronology provides high analytical precision and accuracy, mum-scale spatial resolution, and statistically significant data sets for the study of geological and planetary processes. A newly commissioned 40Ar/39Ar laboratory at CPGeo/USP, São Paulo, Brazil, equips the Brazilian scientific community with a new powerful tool applicable to the study of geological and cosmochemical processes. Detailed information about laboratory layout, environmental conditions, and instrumentation provides the necessary parameters for the evaluation of the CPGeo/USP 40Ar/39Ar suitability to a diverse range of applications. Details about analytical procedures, including mineral separation, irradiation at the IPEN/CNEN reactor at USP, and mass spectrometric analysis enable potential researchers to design the necessary sampling and sample preparation program suitable to the objectives of their study. Finally, the results of calibration tests using Ca and K salts and glasses, international mineral standards, and in-house mineral standards show that the accuracy and precision obtained at the 40Ar/39Ar laboratory at CPGeo/USP are comparable to results obtained in the most respected laboratories internationally. The extensive calibration and standardization procedures undertaken ensure that the results of analytical studies carried out in our laboratories will gain immediate international credibility, enabling Brazilian students and scientists to conduct forefront research in earth and planetary sciences.A geocronologia de 40Ar/39Ar por aquecimento a laser permite alta precisão e acurácia analítica, tem resolução espacial em escala micrométrica, e fornece um número de dados estatisticamente significantes para o estudo de processos geológicos e planetários. Um recém construído laboratório de 40Ar/39Ar no CPGeo/USP, São Paulo, Brazil, mune a sociedade científica brasileira com uma técnica eficaz aplicável aos estudos geol

  20. Contribuição da tomografia de coerência óptica de 820 nm na distrofia granular corneana: relato de caso Contribution of 820 nm optical coherence tomography in granular corneal dystrophy: case report

    Directory of Open Access Journals (Sweden)

    Beatriz de Abreu Fiuza Gomes

    2008-10-01

    Full Text Available O objetivo deste trabalho é correlacionar os dados clínicos de um caso de distrofia granular com o exame de tomografia de coerência óptica (OCT de 820 nm de modo a determinar o nível intra-estromal dos depósitos corneanos. É relatado um caso de distrofia granular em paciente de 38 anos do sexo masculino. Foi realizado exame oftalmológico completo e OCT para documentação do caso. O aparelho utilizado foi o Stratus OCT III, originalmente desenvolvido para avaliação do segmento posterior. A acuidade visual corrigida foi de 20/50 em ambos os olhos. À biomicroscopia, foram observadas opacidades em "floco de neve" em diferentes níveis do estroma corneano bilateral e de forma simétrica. A avaliação pelo OCT revelou múltiplos pontos hiperreflectivos nas camadas superficiais e profundas do estroma. Foi possível acessar a anatomia morfológica da córnea através de cortes seriados realizados pelo Stratus OCT III e confirmar a profundidade dos depósitos corneanos.The purpose of this case report is to correlate clinical features of granular dystrophy using 820 nm optical coherence tomography (OCT in order to determine the depth of intrastromal corneal deposits. We report a case of a 38-year-old man with granular dystrophy. After complete ophthalmologic examination the patient was submitted to OCT, using the Stratus OCT III, originally proposed for studying disorders of the posterior segment. Best-corrected visual acuity was 20/50 in both eyes. Biomicroscopy revealed bilateral "snowflake"opacities in different levels of the stromal layer. OCT disclosed multiple hiperreflective dots in anterior and deeper stromal layers. It was possible to assess the morphology of the cornea and to determine the depth of the corneal deposits with serial cross-sectional OCT scans using the Stratus OCT III.

  1. "Ars Electronica 2009" / Raivo Kelomees

    Index Scriptorium Estoniae

    Kelomees, Raivo, 1960-

    2009-01-01

    30. "Ars Electronica" festival "Human Nature" ("Inimese loomus") Linzis. Osaka ülikooli professori Hiroshi Ishiguro mehaanilis-digitaalsest nukust. Hübriidkunsti kategoorias peapreemia saanud Eduardo Kaci inimtaimest. Konverentsidest. Näitusest "See this Sound", mis oli pühendatud helile kujutavas kunstis

  2. Estudo da morfologia macular após a remoção da membrana epirretiniana idiopática utilizando a tomografia de coerência óptica (OCT: um estudo piloto Study on macular morphology after removal of the idiopathic epiretinal membrane using the optical coherence tomography (OCT: a pilot study

    Directory of Open Access Journals (Sweden)

    Janaína Jamile Ferreira Saraceno

    2007-12-01

    Full Text Available OBJETIVO: Descrever a relação entre os resultados visuais e a morfologia macular através da tomografia de coerência óptica (OCT em pacientes submetidos à remoção da membrana epirretiniana idiopática. MÉTODOS: Dez olhos de 10 pacientes com diagnóstico de membrana epirretiniana idiopática foram incluídos neste estudo. Todos os olhos foram submetidos à vitrectomia posterior via pars plana pelo mesmo cirurgião, durante o período de fevereiro de 2002 a março de 2004. A acuidade visual corrigida usando a tabela de Snellen, bem como a retinografia, a angiofluoresceinografia, a biomicroscopia de fundo e a tomografia de coerência óptica pré e pós-operatórios foram obtidos de todos os pacientes em todas as visitas. No estudo da tomografia de coerência óptica foram avaliadas três características em cada imagem: presença de depressão foveal, presença de edema macular cistóide e média da espessura central macular. RESULTADOS: A idade média dos pacientes foi de 63,3 anos (57 a 78. Cinco pacientes eram do sexo masculino e 5, do sexo feminino. A acuidade visual pré-operatória variou de 20/80 a conta dedos a 1 metro. A acuidade visual melhorou pelo menos duas linhas de visão em 8 olhos (80% e a metamorfopsia melhorou também na mesma proporção (80%. Quatro pacientes não apresentavam metamorfopsia com a tabela de Amsler, e os demais apresentavam melhora parcial. À tomografia de coerência óptica todos os olhos mantiveram o aumento da espessura central, variando de 232 a 605 µ (média= 351,9 µ. Três olhos mantiveram o edema macular cistóide. Quatro olhos apresentaram acuidade visual final melhor ou igual a 20/30. Neste grupo a média de espessura central foi de 277 µ (265 a 285 µ. A recuperação do contorno foveal foi observada em dois destes olhos. Nos quatro pacientes não havia edema macular cistóide residual. CONCLUSÃO: A tomografia de coerência óptica é uma ferramenta capaz de avaliar as altera

  3. Exigências nutricionais da grápia em Argissolo Vermelho distrófico arênico: efeito da adubação NPK no teor de nutrientes nos tecidos Nutritional demand of grápia in Paleaudalf soil: effect of NPK fertilization on content of nutrients in the tissues

    Directory of Open Access Journals (Sweden)

    Fernando Teixeira Nicoloso

    2007-04-01

    Full Text Available A grápia (Apuleia leiocarpa (Vog. Macbride é uma espécie florestal nativa de ampla utilidade na indústria madeireira, motivo pelo qual, atualmente, encontra-se em processo de extinção. Em trabalho prévio, utilizando-se um Argissolo Vermelho distrófico arênico, foi demonstrado que o crescimento de plantas jovens de grápia respondeu à adubação de N, P e K com dose de máxima eficiência técnica estimada em, respectivamente, 70, 80 e 80mg kg-1. No presente trabalho, objetivou-se caracterizar o efeito da adubação NPK nos teores de macronutrientes e micronutrientes dos tecidos de plantas de grápia. Em condições de casa de vegetação, foram realizados 27 tratamentos de adubação em esquema trifatorial completo (3x3x3, representados por três níveis (0, 40 e 80mg kg-1 de N, de P e de K. A parcela experimental foi constituída de um vaso com 3,5kg de Argissolo Vermelho distrófico arênico e duas plantas. Aos 140 dias após a emergência das plantas, avaliou-se o crescimento e os teores de N, P, K, Ca, Mg, Cu, Zn, Fe e Mn nas folhas, no caule e nas raízes da grápia. Os resultados sugerem que os teores adequados de nutrientes nas folhas de plantas jovens de grápia, para se obter de 80 a 100% da produção de biomassa, sejam: N=2,5 a 3,0%; P=0,1 a 0,18%, K=1,6 a 2,1%, Ca=0,60 a 0,75%, Mg=0,2 a 0,3%; Cu=1,5 a 2,5mg kg-1, Zn=50 a 85mg kg-1, Fe=100 a 150mg kg-1 e Mn=250 a 400mg kg-1.Grápia (Apuleia leiocarpa (Vog. Macbride is a Brazilian forest species with great interest for timber-trade, and nowadays due to deforestation, it has been considered in extinction process. In the previous paper, it was shown that the NPK fertilization, respectively at 70, 80 and 80mg kg-1 of a Paleudalf soil, significantly increased the growth of young plants of grápia. The present work is aimed at characterizing the effects of the NPK fertilization on macronutrient and micronutrient contents in the tissues of grápia. At glasshouse conditions, 27

  4. Qualidade de maçãs ‘Gala’ armazenadas em atmosfera controlada dinâmica e estática com renovação do ar Quality of ‘Gala’ apples stored in dynamic and static controlled atmosphere with air renovation

    Directory of Open Access Journals (Sweden)

    Auri Brackmann

    2005-04-01

    Full Text Available Este experimento teve como objetivo avaliar o efeito da remoção periódica da atmosfera das câmaras de atmosfera controlada com ar e nova instalação, bem como o uso da atmosfera dinâmica, sobre a manutenção da qualidade da maçã 'Gala'. Os tratamentos utilizados foram: (1 controle (sem renovação; (2 renovação da atmosfera diariamente durante o resfriamento dos frutos; (3 renovação da atmosfera diariamente durante o resfriamento e mensalmente no período de armazenamento em atmosfera controlada; (4 renovação da atmosfera mensalmente; (5 50µL L-1 de etileno no interior da câmara; e (6 atmosfera dinâmica (injeção diária de N2 para remoção do CO2. Após oito meses de armazenamento, o tratamento com renovação da atmosfera diariamente durante o resfriamento e mensalmente no período de armazenamento em atmosfera controlada proporcionou frutos com maior firmeza de polpa. Nenhuma das técnicas avaliadas permitiu manter os níveis de etileno nas câmaras de armazenamento abaixo de 5µL L-1. Provavelmente, a absorção do etileno proporciona um benefício igual ou maior com um menor custo, pois a renovação da atmosfera implica altos custos na aquisição de nitrogênio.This experiment was carried out aiming to evaluate the effect of periodical removal of the atmosphere of controlled atmosphere chambers with fresh air and the use of dynamic atmosphere on quality of 'Gala' apples. Evaluated treatments were: (1 control (without air renovation; (2 daily atmosphere renovation during fruit cooling; (3 daily atmosphere renovation during cooling and monthly during controlled atmosphere storage of fruits; (4 monthly atmosphere renovation; (5 50µL L-1 ethylene inside chamber; and (6 dynamic atmosphere (N2 injection to remove CO2. After eight months of storage, daily atmosphere renovation during cooling and monthly during controlled atmosphere storage maintained fruit firmness. None of the evaluated techniques allowed ethylene levels

  5. Comportamento do arsênio em perfis de solos do Sítio Ilha de Terra de Caxiuanã-Pará Arsenic behavior in soil profiles on the Sítio Ilha de Terra from Caxiuanã-Pará

    Directory of Open Access Journals (Sweden)

    Vanda Porpino Lemos

    2009-06-01

    Full Text Available Concentrações de arsênio em perfis de solos com terra preta arqueológica (TPA e solos de área adjacente (AD do Sítio Ilha de Terra, Caxiuanã, no Estado do Pará, região Amazônica, podem dar informações sobre as atividades antropogênicas dos habitantes dessa região. Análises químicas e mineralógicas foram realizadas nas amostras desses perfis. Os dados obtidos mostram que as concentrações do Fe e As aumentam com a profundidade dos perfis de solos, enquanto que as concentrações de matéria orgânica (MO decrescem; as concentrações mais elevadas de Fe e As são observadas no perfil AD. Esses resultados indicam interações entre Fe e As e sugerem que a MO nos solos promove a dissolução da goethita e lixiviação do Fe e As no perfil TPA.Arsenic concentrations in soil profiles with archaeological black earth (ABE and surroundings (SA from the Sítio Ilha de Terra, Caxiuanã, in the State of Pará, Amazon region, may provide information on anthropogenic activity in the Amazonian habitat. The samples of ABE and SA soil profiles were submitted to chemical and mineralogical analysis. The obtained data show that Fe and As concentrations increase with depth while organic matter (OM decreases. The highest concentrations of Fe and As are observed in the SA profile. These results indicate interactions between Fe and As and suggest that OM promotes the dissolution of goethite and leaching of Fe and As in the ABE profile.

  6. Tomografia por emissão de pósitrons (PET no tórax: resultados preliminares de uma experiência brasileira Thoracic positron emission tomography: preliminary results of a Brazilian experiment

    Directory of Open Access Journals (Sweden)

    MÁRIO TERRA FILHO

    2000-08-01

    Full Text Available Novos métodos não invasivos estão sendo desenvolvidos para a detecção de neoplasias malignas pulmonares. Dentre estes destaca-se a tomografia por emissão de pósitrons (PET, que utiliza como radiotraçador a deoxi-2-D glicose marcada com fluor-18 (FDG. Objetivo: Avaliar os resultados do FDG-PET, realizado em câmara híbrida com circuito de coincidência em pacientes portadores de doenças pleuropulmonares infecciosas ou tumorais. Material e Métodos: Foram avaliados 15 pacientes divididos em: grupo I – 5 portadores de tuberculose pulmonar, e grupo II – 10 pacientes com possíveis neoplasias pleuropulmonares. Após a administração endovenosa de 185MBq de FDG as aquisições foram feitas em câmara de cintilação ADAC Vertex Plus de duas cabeças. Resultados: No grupo I todos os exames foram positivos. No grupo II, após o estabelecimento diagnóstico por toracotomia em nove e mediastinoscopia em um, observaram-se: dois adenocarcinomas, dois granulomas, um hamartoma, um mesotelioma, uma atelectasia redonda, um carcinoma indiferenciado de pequenas células, um carcinoma indiferenciado de grandes células, uma antracose. Os exames foram positivos em seis pacientes (cinco neoplasias malignas e em um caso de granuloma e negativos nos outros quatro. Conclusão: O FDG-PET realizado através de câmara híbrida produz imagens de boa qualidade que permitem a identificação de processos infecciosos em atividade. O FDG-PET associado ao quadro clínico/radiológico pode diferenciar as neoplasias pulmonares malignas das benignas.New non-invasive methods have been developed to detect lung malignancies. One of them is positron emission tomography (PET using 18F 2-deoxy-D-glucose (FDG as a radiotracer. Objective: Evaluate the FDG-PET results performed through a hybrid coincidence–gamma camera in patients with pleuropulmonary infectious diseases or lung tumors. Material and methods: Fifteen patients were evaluated, and divided into: group I – five

  7. Avaliação da concordância interobservadores na análise da polipose nasossinusal por meio da tomografia computadorizada Evaluation of the concordance between observers in sinunasal polyposis through computed tomographic analysis

    Directory of Open Access Journals (Sweden)

    Elaine A. Mendes

    2004-08-01

    Full Text Available Polipose nasossinusal (PNS é uma entidade de etiologia controversa, caracterizada por uma condição inflamatória da superfície mucosa das fossas nasais e seios paranasais, bilateralmente. A queixa principal do paciente consiste na obstrução nasal e, ao exame físico, observam-se freqüentemente massas polipóides ocupando as cavidades nasais em extensões variáveis. Além da rinoscopia anterior e da endoscopia nasal, o uso da tomografia computadorizada (TC torna-se necessário para avaliação das fossas nasais e da presença ou não do acometimento dos seios paranasais por essas massas, bem como a sua extensão. Este trabalho tem como objetivo avaliar a concordância interobservadores, por meio da análise da tomografia computadorizada, de 32 casos de PNS. FORMA DE ESTUDO: Clínico prospectivo. CASUÍSTICA E MÉTODOS: Foram avaliadas 32 TC de pacientes portadores PNS por dois observadores experientes, separadamente, em relação à presença ou não de 3 sinais tomográficos sugestivos dessa doença: (1 alargamento infundibular do complexo ostiomeatal, (2 abaulamento lateral da lâmina papirácea e (3 apagamento do trabeculado ósseo etmoidal. RESULTADOS: Observou-se Qui-quadrado não significante para o primeiro e segundo sinais (p=0,7055 e p=0,2057 e significante para o terceiro (p=0,0040. Contudo, o coeficiente de correlação de Kendall entre os dois observadores foi significante para os três sinais tomográficos acima citados (pSinonasal polyposis (SNP is a condition with a controversial aethiology, known by bilaterally inflammatory mucous membranes of nasal and paranasal sinuses. The major patient's complaint is nasal obstruction, and polypoid masses in different sizes can be found during nasal cavity examination. Beyond anterior rhinoscophy and nasal endoscopy, screening sinus computed tomography (SSCT is necessary to measure the size and the extent of the polyps into nasal cavities and paranasal sinuses. The purpose of this

  8. Oldest human footprints dated by Ar/Ar

    Science.gov (United States)

    Scaillet, Stéphane; Vita-Scaillet, Grazia; Guillou, Hervé

    2008-11-01

    Fossilized human trackways are extremely rare in the geologic record. These bear indirect but invaluable testimony of human/hominid locomotion in open air settings and can provide critical information on biomechanical changes relating to bipedalism evolution throughout the primitive human lineage. Among these, the "Devil's footsteps" represent one of the best preserved human footprints suite recovered so far in a Pleistocene volcanic ash of the Roccamonfina volcano (southern Italy). Until recently, the age of these footprints remained speculative and indirectly correlated with a loosely dated caldera-forming eruption that produced the Brown Leucitic Tuff. Despite extensive hydrothermal alteration of the pyroclastic deposit and variable contamination with excess 40Ar, detailed and selective 40Ar/ 39Ar laser probe analysis of single leucite crystals recovered from the ash deposit shows that the pyroclastic layer and the footprints are 345 ± 6 kyr old (1 σ), confirming for the first time that these are the oldest human trackways ever dated, and that they were presumably left by the modern human predecessor, Homo heidelbergensis, close to Climatic Termination IV.

  9. Densidade de um planossolo sob sistemas de cultivo avaliada por meio da tomografia computadorizada de raios gama Bulk density of an alfisol under cultivation systems in a long-term experiment evaluated with gamma ray computed tomography

    Directory of Open Access Journals (Sweden)

    Adilson Luís Bamberg

    2009-10-01

    Full Text Available A sustentabilidade do arroz (Oryza sativa L. irrigado em solos de várzea está alicerçada na utilização da rotação e sucessão de culturas, fundamentais para o controle do arroz-vermelho e preto. Os reflexos sobre os atributos dos solos de várzea merecem estudos em especial sobre a compactação do solo. O objetivo deste trabalho foi identificar camadas compactadas em Planossolo submetido a diferentes sistemas de cultivo e preparo, avaliando-se a densidade do solo (Ds pela Tomografia Computadorizada de Raios Gama (TC. A análise foi realizada em um experimento de longa duração, conduzido de 1985 a 2004, na Estação Experimental da Embrapa Clima Temperado, Capão do Leão, RS, num delineamento experimental em blocos ao acaso, com sete tratamentos, cada um com quatro repetições (T1 - um ano de arroz com preparo convencional do solo seguido de dois anos de pousio; T2 - cultivo contínuo de arroz com preparo convencional do solo; T4 - rotação de arroz e soja (Glycine max L. com preparo convencional do solo; T5 - rotação de arroz, soja e milho (Zea maiz L. em preparo convencional do solo; T6 - plantio direto de arroz no verão em sucessão do azevém (Lolium multiflorum L. no inverno; T7 - rotação de arroz sob plantio direto e soja sob preparo convencional do solo; T8 - testemunha: solo sem cultivo. A Tomografia Computadorizada de Raios Gama permitiu detectar que o plantio direto de arroz no verão em sucessão do azevém no inverno não resultou na formação de camadas compactadas; a utilização de dois anos de pousio, no sistema de produção de arroz irrigado, não foi suficiente para evitar a formação de uma camada superficial compactada; e a rotação de arroz, soja e milho com preparo convencional do solo apresentou duas camadas compactadas (0,0 a 1,5 cm e 11 a 14 cm, indicando que essas podem limitar a produção agrícola nesse sistema de produção em Planossolos.The sustainability of irrigated rice (Oryza sativa L. in

  10. Avaliação da reprodutibilidade das medidas da camada de fibras nervosas retiniana e da cabeça do nervo óptico pela tomografia de coerência óptica

    Directory of Open Access Journals (Sweden)

    Ricardo Rau

    2012-10-01

    Full Text Available OBJETIVO: Determinar a reprodutibilidade da espessura da camada de fibras nervosas da retina peripapilar e dos parâmetros da cabeça do nervo óptico em olhos normais, utilizando a tomografia de coerência óptica de domínio espectral (SD-OCT. MÉTODOS: Trinta e quatro olhos de 34 indivíduos saudáveis foram incluídos no estudo. O protocolo do cubo do disco óptico 200x200 do OCT Cirrus foi utilizado para gerar 3 imagens de cada olho para avaliar a reprodutibilidade. O coeficiente de correlação intraclasse (ICC foi calculado para as medidas da espessura da camada de fibras nervosas da retina e da cabeça do nervo óptico. RESULTADOS: A correlação foi excelente para todas as medidas da espessura da camada de fibras nervosas da retina (ICC entre 0,87 e 0,98. O mesmo ocorreu com os parâmetros da cabeça do nervo óptico que, com exceção da razão E/D vertical (ICC 0,56, apresentou ICC entre 0,83 e 0,99. CONCLUSÃO: As medidas de espessura da camada de fibras nervosas da retina peripapilar e os parâmetros da cabeça no nervo óptico demonstraram uma excelente reprodutibilidade com o OCT Cirrus, indicando que este aparelho poderá ser uma ferramenta útil no estudo do glaucoma. Este estudo apresenta algumas limitações, como o pequeno número de casos avaliados, sendo necessários maiores estudos para corroborar nossos achados.

  11. Achados tomográficos das alterações abdominais pós-operatórias dos pacientes submetidos ao derivação gastrojejunal em Y-de-Roux sem anel

    Directory of Open Access Journals (Sweden)

    Fernanda Marcondes Ribas

    2012-06-01

    Full Text Available OBJETIVO: Avaliar por exame de tomografia computadorizada de pacientes submetidos à derivação gastrojejunal em Y-de-Roux, sem anel, para tratamento de obesidade mórbida. MÉTODOS: Estudaram-se 40 pacientes, encaminhados ao serviço de tomografia do Hospital Universitário Evangélico de Curitiba para avaliação diagnóstica. Encontravam-se em pós-operatório de cirurgia bariátrica tendo sido operados no mesmo hospital. Foram incluídos pacientes submetidos à operação laparoscópica com sintomas que necessitavam de avaliação tomográfica diagnóstica. Excluíram-se pacientes que tinham sido submetidos à cirurgia bariátrica por outras técnicas cirúrgicas; que tinham sido operados por outra equipe; que não concordassem com a administração de contraste iodado por via oral ou endovenosa; e que excediam o limite de peso da mesa de exame. Para análise estatística utilizou-se a média das variáveis. RESULTADOS: Os pacientes apresentaram-se com idade entre 23 a 70 anos e eram 11 homens e 29 mulheres. Não houve alterações extra-abdominais detectáveis pela tomografia de abdômen total; dos 40 pacientes avaliados, 30 apresentavam achados tomográficos dentro do limite da normalidade. A presença de estenose na anastomose gastrojejunal foi encontrada em um paciente; hérnia interna ocorreu em cinco; fístula anastomótica em um e abcesso em três dos pacientes estudados. CONCLUSÃO: A tomografia de abdome total não conseguiu informar a causa dos sintomas dos pacientes operados em 87,5% dos pacientes que procuraram re-avaliação médica por sintomas pós-operatórios da cirurgia bariátrica.

  12. Exigências nutricionais da grápia ao fósforo e enxofre em Argissolo Vermelho distrófico arênico: efeito da adubação no crescimento Nutritional demand of grápia to phophorus and sulfur in paleaudalf soil: fertilization effects on growth

    Directory of Open Access Journals (Sweden)

    Evandro Luiz Missio

    2004-08-01

    Full Text Available A grápia (Apuleia leiocarpa Vog. Macbride é uma espécie de grande interesse madeireiro, encontrando-se, atualmente, bastante dizimada devido à exploração extrativista, sem haver reposição através de reflorestamento. O objetivo deste trabalho foi determinar os níveis ótimos de adubação de fósforo e enxofre no crescimento de plantas jovens de grápia. As plantas foram cultivadas em vasos contendo 3,5kg de solo Argissolo Vermelho distrófico arênico, sob condições de casa de vegetação não climatizada. O delineamento experimental foi o inteiramente casualizado com seis repetições. Foram avaliados 16 tratamentos em esquema bifatorial completo (4x4, representados pela combinação de quatro doses de P (0, 60, 120 e 180mg kg-1 e quatro de enxofre (0, 10, 20 e 30mg kg-1. A análise do crescimento das plantas foi realizada mensalmente através da altura da planta, diâmetro do caule e número de folhas remanescentes. Aos 130 dias após a emergência das plantas, avaliaram-se ainda o número de folhas caídas, matéria seca das folhas, caule, raízes e total da planta e a relação entre a matéria seca das raízes e da parte aérea. A produção de matéria seca total das plantas jovens de grápia respondeu positivamente à adubação conjunta de P e S, com dose de máxima eficiência técnica estimada de, respectivamente, 204 e 16mg kg-1 de solo. A adubação fosfatada na dose igual ou acima de 120mg kg-1 de solo induziu o aparecimento de clorose foliar típica da deficiência de Fe. A alta disponibilidade de P no solo favoreceu o crescimento da parte aérea em detrimento das raízes.Grápia (Apuleia leiocarpa Vog. Macbride is an important native forest species that has been in extinction process. The aim of this study was to determine the optimum levels of phosphorus and sulfur fertilization on the initial growth of grápia. Grápia plants were cultivated in pots containing 3.5kg of a Paleudalf soil, under unclimatized glasshouse

  13. AR DOC: Augmented reality documentaries

    DEFF Research Database (Denmark)

    Vistisen, Peter

    2014-01-01

    Augmented Reality Documentaries (AR DOC) er et ’lille’ Shareplay projekt (ansøgte midler <= 125.000 DKK), der af haft som sit formål at afprøve et unikt samarbejde omkring udforskningen af nye teknikker til augmented reality cross media løsninger, til at skabe engagerende publikumsformidling...... indenfor oplevelsesindustrien. Projektet har genereret ny viden omkring, hvordan fysisk og digital formidling kan understøttes via Augmented Reality som formidlingsformat....

  14. ARS - Helsinki - 2006 / Galina Balashova

    Index Scriptorium Estoniae

    Balashova, Galina

    2006-01-01

    Steven Holli projekteeritud Kiasma muuseumihoonest Helsingis. Kontseptuaalkunsti näitusest ARS 06 "Reaalsustunne" Kiasmas. Eestlastest esineb Mark Raidpere. Vene kunstnikegrupi AEC+F ja vene kunstnike Juri Vassiljevi ning Aleksandr Ponomarjovi töödest näitusel. Ka Gerda Steineri & Jörg Lenzlingeri (Šveits), Martin & Munoz'i (USA, Hispaania), arvutigraafik Charles Sandisoni (SB), videokunstnik Bill Viola (USA) jt. töödest

  15. Ars Industrialis, arsindustrialis.org

    Directory of Open Access Journals (Sweden)

    Frédérique Mingant

    2012-03-01

    Full Text Available The arsindustrialis.org website was created in 2005, when the association Ars Industrialis came into being. The association was founded by a group of philosophers and jurists, on the initiative of philosopher Bernard Stiegler, the former director of the IRCAM (Institut de Recherche et Coordination Acoustique/Musique–Institute of Research and Coordination on Acoustic/Music and the current director of the Department of cultural development at the Centre Georges Pompidou (French National Arts C...

  16. arXiv.org and Physics Education

    Science.gov (United States)

    Ramlo, Susan

    2007-01-01

    The website arXiv.org (pronounced "archive") is a free online resource for full-text articles in the fields of physics, mathematics, computer science, nonlinear science, and quantitative biology that has existed for about 15 years. Available directly at http://www.arXiv.org, this e-print archive is searchable. As of Jan. 3, 2007, arXiv had open…

  17. Avaliação tomográfica do posicionamento de parafusos pediculares em deformidades na coluna torácica e lombar introduzidos com base na técnica "free hand" Evaluación tomográfica de la colocación de tornillos pediculares en deformidades de la columna torácica y lumbar, introducidos con base en la técnica "free hand" Tomographic evaluation of the placement of pedicle screws used in deformities of the thoracic and lumbar spine based on the "free hand" technique

    OpenAIRE

    Dante Bernardes Giubilei; Paulo Tadeu Maia Cavali; Maurício Antonelli Lehoczki; Alexander Junqueira Rossato; Marcelo Italo Risso-Neto; Guilherme Rebechi Zuiani; Ivan Guidolin Veiga; Wagner Pasqualini; Élcio Landim

    2011-01-01

    OBJETIVO: Avaliar o posicionamento de parafusos pediculares aplicados em vértebras da coluna torácica e lombar em pacientes portadores de escolioses, introduzidos pela técnica "free hand". MÉTODOS: Avaliação de quinze tomografias computadorizadas de 284 parafusos pediculares em 15 pacientes (sete homens e oito mulheres), com idade entre 12 e 39 anos (média de 16,7 anos) com escoliose. Os parafusos foram inseridos de T2 a S1 para as seguintes afecções: duas escolioses congênitas e 13 escoliose...

  18. Degeneração hepatolenticular: avaliação crítica dos critérios diagnósticos em 95 casos

    Directory of Open Access Journals (Sweden)

    Egberto Reis Barbosa

    1985-09-01

    Full Text Available O presente estudo teve como objetivo a análise crítica dos critérios diagnósticos na degeneração hepatolenticular (DHL. Foram estudados 95 casos de DHL, com enfoque na caracterização clínica e laboratorial da doença. No aspecto clínico foram analisadas a variabilidade quanto ao modo de instalação da moléstia e a freqüência do anel de Kayser-Fleischer (K-F. Em relação aos exames complementares foram analisados os níveis de ceruloplasmina, cobre sérico, cobre urinário e aminoacidúria, o estudo radiológico e cintilográfico do esqueleto, a tomografia computadorizada de crânio e a biópsia hepática. Em 54,4% dos casos o quadro clínico inicial foi neurológico, em 31,1% hepático, em 14,4% psiquiátrico, em 7,8% ostearticular, em 2,2% oftalmológico (anel de K-F, em 1,1% hematológico (anemia hemolítica e em 1,1% cardíaco. O anel de K-F estava presente em 84 dos 92 casos em que foi pesquisado (91,3%. Quanto aos resultados laboratoriais, hipoceruloplasminemia foi assinalada em 98,8% dos casos avaliados, hiperaminoacidúria em 94,7%, hipocupremia em 87,0%, hipercuprúria em 78,2%, osteoporose em 79,4%, alterações cintilográficas das articulações em 65,2%, e a tomografia de crânio, realizada em 11 casos, mostrava, em 2, áreas hipoatenuantes nos gânglios da base. Discute-se a importância dos exames complementares acima citados e do anel de K-F como elementos para a caracterização da DHL.

  19. Disgenesia do corpo caloso e más-formações associadas: achados de tomografia computadorizada e ressonância magnética Dysgenesis of the corpus callosum and associated malformations: computed tomography and magnetic resonance imaging findings

    Directory of Open Access Journals (Sweden)

    Cristiano Montandon

    2003-10-01

    Full Text Available O termo disgenesia do corpo caloso refere-se a uma má-formação deste com origem na embriogênese do telencéfalo. O relato analisa os achados de tomografia computadorizada e ressonância magnética em 11 pacientes com disgenesia calosa e em um caso de corpo caloso normal com lipoma associado. Esta pode ser distinguida em três grupos: agenesia total (três casos, agenesia parcial (seis casos e hipoplasia (dois casos. Anomalias associadas foram observadas em nove casos, incluindo má-formação de Chiari tipo II (um caso, esquizencefalia (um caso, cisto inter-hemisférico (dois casos, heterotopia nodular (um caso, cisto de Dandy-Walker (um caso e lipoma do corpo caloso (quatro casos. Este artigo demonstra um espectro destes distúrbios, auxiliando na sua interpretação diagnóstica.Callosal dysgenesis is a malformation of the corpus callosum with origins in the embryogenesis of the telencephalon. We reviewed the computed tomography and magnetic resonance imaging findings of 11 patients with callosal dysgenesis and one patient with normal corpus callosum associated with a lipoma. The patients were divided into three distinct groups: total agenesis (three patients, partial agenesis (six patients and hypoplasia (two patients. Associated abnormalities were observed in nine patients, including Chiari II malformation (one patient, schizencephaly (one patient, interhemispheric cyst (two patients, Dandy-Walker cyst (one patient, nodular heterotopy (one patient and lipoma of the corpus callosum (four patients. This paper presents a review that may contribute to the diagnosis of these disorders.

  20. Prevalência de achados pulmonares em 55 pacientes com neoplasias esofagianas Prevalence of lung abnormalities in 55 patients with esophageal cancer

    OpenAIRE

    Tiago Alves de Brito Zan; Fabrício Corrêa de França; Marcos Pontes Muniz; José Antônio Cordeiro; Aldenis Albenese Borim; Patrícia Maluf Cury

    2005-01-01

    OBJETIVO: Identificar alterações pulmonares em pacientes com neoplasia esofágica. Comparar os dados obtidos, além de mostrar sua relação com o tabagismo. MATERIAIS E MÉTODOS: Estudo transversal tipo série de casos. Foram analisados prontuários e exames de imagem (tomografias computadorizadas e radiografias) de 55 pacientes com câncer de esôfago, diagnosticados entre 1998 e 2001, no Hospital de Base de São José do Rio Preto. Comparou-se a freqüência dos tumores encontrados e outras alterações ...

  1. Ars Memorativa, Ars Oblivionis in Middle English Religious Plays

    Directory of Open Access Journals (Sweden)

    Ciobanu Estella Antoaneta

    2015-12-01

    Full Text Available This paper investigates the multi-layered violence of religious representation in the late medieval York biblical plays, with a focus on the Supper at Emmaus. I read Emmaus (Y40, a play which commemorates the Crucifixion and openly encourages strong anti-Judaism, alongside scenes in an early predecessor pageant, The Crucifixion (Y35, within their contemporary devotional and mnemonic practices, i.e. the confessional Book of Margery Kempe and Thomas Bradwardine’s tract on ars memorativa. Emmaus in particular demonstrates how a fundamentally violent ars memorativa, the legacy of ancient rhetoric to the Middle Ages, also underpins the instruction of the laity in the basics of Christian faith, here with the aid of highly musical prosody and repetition, and thereby hones a biased, intolerant and violence-inured Christian collective memory. To study the York play’s position relative to late medieval mnemonic practices, I frame my analysis within memory studies, enriched with the more specific insights offered by social-psychological, neurobiological and cognitivist studies of memory.

  2. Proposta para padronização do relatório de tomografia computadorizada nos aneurismas da aorta abdominal A proposal for standardizing computed tomography reports on abdominal aortic aneurysms

    OpenAIRE

    Fabiola Goda Torlai; Gustavo S. Portes Meirelles; Fausto Miranda Jr; José Honório A.P. da Fonseca; Sérgio Ajzen; Giuseppe D'Ippolito

    2006-01-01

    OBJETIVO: Propor um modelo de padronização de relatório para aneurisma da aorta abdominal na tomografia computadorizada. MATERIAIS E MÉTODOS: Foram realizadas, no período de abril a outubro de 2004, entrevistas com integrantes da Disciplina de Cirurgia Vascular da nossa instituição, para elaboração de um modelo de padronização de relatório de tomografia computadorizada para o estudo do aneurisma da aorta abdominal. A partir deste modelo foi elaborado um questionário, enviado a nove outros cir...

  3. Dependence of the measured 38Ar/36Ar ratio on the total Ar amount and its implications

    International Nuclear Information System (INIS)

    The sensitivity of a mass spectrometer for different isotopes of an element usually is not the same and causes a systematic difference between measured and actual isotopic ratios and is defined as mass discrimination. In noble gas mass spectrometry, the correction factor for mass discrimination can be calculated using a reference gas (air in most cases) with known isotopic composition. The mass discrimination factor (mdf) is defined as the ratio of true isotopic ratio to the measured isotopic ratio. Usually, mdf values, determined using argon in air as standard, are nearly constant for a given element over long periods of time. Both mass discrimination and sensitivity remain the same over a certain range of total pressure in the mass spectrometer, during the measurement of a given gas. For the case of Xe, Kr and Ne, in general, the total gas pressure in the mass spectrometer during the analysis of a sample gas falls within this range and consequently, a fixed value of sensitivity and mdf are used. But in the case of argon and particularly in certain cases (like in ureilites), this may not be true as we deal with samples having a wide range of 40Ar/36Ar ratios (10-3 to 104). It was noticed that the values for 38Ar/36Ar in ureilites (having 40Ar/36Ar 40Ar/36Ar = 295.5. This was the motivation for investigating the pressure effect on the measured ratio of 38Ar/36Ar

  4. Beta decay of 31Ar

    International Nuclear Information System (INIS)

    A complete study of 31Ar beta decay has been made by high-resolution charged-particle and gamma-ray spectroscopy. Beta-delayed radiation was detected by an array of three charged-particle detectors and a large-volume germanium detector. Fifteen new energy levels were discovered in 31Cl. The beta-strength distribution, measured to 14.5 MeV, is compared with a shell-model calculation in the full sd space. The quenching of the Gamow-Teller strength and the isospin impurity of the IAS in 31Cl are discussed. (orig.)

  5. Complicações respiratórias em pacientes com paralisia cerebral submetidos à anestesia geral Complicaciones respiratorias en pacientes con parálisis cerebral sometidos a la anestesia general Respiratory complications in patients with cerebral palsy undergoing general anesthesia

    OpenAIRE

    Sérgio Silva de Mello; Ronaldo Soares Marques; Renato Ângelo Saraiva

    2007-01-01

    JUSTIFICATIVA E OBJETIVOS: Anestesia em pacientes com paralisia cerebral (PC) pode representar um desafio para o anestesiologista. Este estudo prospectivo teve como objetivo determinar a prevalência e o risco de complicações respiratórias em crianças com PC submetidas à anestesia geral inalatória (AGI) para tomografia computadorizada (TC). MÉTODO: Participaram do estudo pacientes com idades entre 1 e 17 anos, estado físico ASA I a III, submetidos a AGI com sevoflurano e máscara laríngea para ...

  6. Preliminary tests in skull pediatric phantom for dosimetry in computerized tomography; Testes preliminares em um simulador pediatrico de cranio para dosimetria em tomografia computadorizada

    Energy Technology Data Exchange (ETDEWEB)

    Martins, Elaine Wirney; Potiens, Maria da Penha de A., E-mail: elainewirney@uso.br, E-mail: mppalbu@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2014-07-01

    Computed tomography (CT) is one of the techniques in the field of radiology with striking technological advance in recent years. One reason for this was the increased number of channels associated with the increased power of the X-ray tube. These conditions allowed the equipment high speed in the acquisition of the cuts, reducing the patient exposure time essential characteristic for the increase of its use in pediatric patients. In this context, were developed a new pediatric skull simulator to analyze the results of measurements performed in laboratory and clinic beams with the objective of creation and use of diagnostic reference levels observing risks stochastic effects and assessing the reduction of absorbed doses in patients undergoing growing. Preliminary tests performed in clinical beams showed C{sub w} values: 2.525 ± 0.212 mGy for the developed simulator quoted and 3.362 ± 0.282 mGy for a simulator developed by IPEN called standard, both being between uncertainty values of 8.4% and 14.4% suggested by TRS number 457.

  7. Dose optimization in adult patients exams in a computerized tomography service; Otimizacao de dose em exames de pacientes adultos em um servico de tomografia computadorizada

    Energy Technology Data Exchange (ETDEWEB)

    Pimentel, Juliana; Finatto, Jerusa D.; Silva, Ana Maria Marques da, E-mail: ana.marques@pucrs.br [Pontificia Universidade Catolica do Rio Grande do Sul (PUCRS), Porto Alegre, RS (Brazil); Froner, Ana Paula P. [CDI Tomografia e Ressonancia Magnetica, Porto Alegre, RS (Brazil)

    2013-08-15

    This paper presents a study of dose optimization in computed tomography X-ray of skull, chest and abdomen of adult patients, performed in a diagnostic imaging service in a large hospital. Images of a simulated dose phantom were acquired and the kVp, mAs, pitch, thickness and CTDI{sub vol} were collected directly from the equipment. Using the PACS system, regions of interest were delineated, where the mean and standard deviation of CT numbers for each protocol were been calculated. The optimization took into account the maintenance of the CT number and noise from images acquired with clinical protocols. It was observed that the protocols used in the service, in general, exhibit a low dose, despite the great variability among the different professional shifts. In examinations of the chest, skull and abdomen, changes in the values of mAs and pitch were suggested, allowing dose reductions (60%, 17% and 19%, respectively), without compromising the image diagnostic quality. (author)

  8. Miocárdio viável pela tomografia computadorizada com Tc-99m (MIBI sensibilizada por nitroglicerina endovenosa Viable myocardium scintigraphy with intravenous nitroglycerine by computed tomography with Tc-99m (MIBI

    Directory of Open Access Journals (Sweden)

    José Ramos Filho

    2008-09-01

    Full Text Available FUNDAMENTO: A seleção de pacientes com doença coronariana crônica para recanalização baseia-se na detecção do miocárdio comprometido, potencialmente viável. OBJETIVO: Avaliar o miocárdio isquêmico, potencialmente viável pelo SPECT com MIBI sensibilizado por nitroglicerina em dose máxima tolerada. MÉTODOS: Investigamos de forma prospectiva, de abril de 2004 a novembro de 2005, pela tomografia computadorizada por emissão de fóton único SPECT com Tc-99m (MIBI, 40 pacientes (média etária 62 ± 8,9 anos, 30 homens com obstrtução coronariana demonstrada angiograficamente, e a cintilografia miocárdica foi realizada em repouso e com nitroglicerina endovenosa (EV, iniciando com a dose (1 µg/kg/min e incremento a cada minuto, até a queda da pressão arterial sistólica em 20 mmHg. A redução da perfusão dos segmentos foi classificada em moderada e severa, e comparada depois da nitroglicerina. Analisamos as variáveis angiográficas, hemodinâmicas e de perfusão miocárdica. RESULTADOS: Analisamos 680 segmentos miocárdicos em repouso: 538 com distribuição homogênea e 142 com hipoperfusão (54 com redução moderada e 88 severa. Depois da nitroglicerina, ocorreu aumento da perfusão em 19 (47,5% de 40 pacientes. Tornaram-se viáveis 55 de 142 segmentos: 33 (61,1% com redução moderada e 22 (25% com redução severa, ambos apresentaram aumento significativo da distribuição do radiofármaco (p BACKGROUND: The selection of patients with chronic coronary disease for recanalization is based on the detection of the affected myocardium that is potentially viable. OBJECTIVE: To evaluate the potentially viable ischemic myocardium through single photon emission computed tomography (SPECT with MIBI after a maximum tolerated dose of I.V. nitroglycerin. METHODS: We prospectively investigated by SPECT with Tc-99m (MIBI, from April 2004 to November 2005, 40 patients (mean age: 62 ± 8.9 yrs, 30 men with coronary obstruction demonstrated

  9. Biópsia percutânea de lesões ósseas guiada por tomografia computadorizada: taxas de definição diagnóstica e complicações

    Directory of Open Access Journals (Sweden)

    Macello Jose Sampaio Maciel

    2014-10-01

    Full Text Available Objetivo: Determinar taxas de definição diagnóstica e complicações da biópsia percutânea guiada por tomografia computadorizada (TC de lesões ósseas suspeitas de malignidade. Materiais e Métodos: Estudo retrospectivo que incluiu 186 casos de biópsia percutânea guiada por TC de lesões ósseas no período de janeiro de 2010 a dezembro de 2012. Todas as amostras foram obtidas usando agulhas de 8 a 10 gauge. Foram coletados dados demográficos, história de neoplasia maligna prévia, dados relacionados à lesão, ao procedimento e ao resultado histológico. Resultados: A maioria dos pacientes era do sexo feminino (57% e a idade média foi 53,0 ± 16,4 anos. Em 139 casos (74,6% a suspeita diagnóstica era metástase e os tumores primários mais comuns foram de mama (32,1% e próstata (11,8%. Os ossos mais envolvidos foram coluna vertebral (36,0%, bacia (32,8% e ossos longos (18,3%. Houve complicações em apenas três pacientes (1,6%, incluindo uma fratura, um caso de parestesia com comprometimento funcional e uma quebra da agulha necessitando remoção cirúrgica. Amostras de 183 lesões (98,4% foram consideradas adequadas para diagnóstico. Resultados malignos foram mais frequentes nos pacientes com suspeita de lesão secundária e história de neoplasia maligna conhecida (p < 0,001 e nos procedimentos orientados pela PET/CT (p = 0,011. Conclusão: A biópsia percutânea guiada por TC é segura e eficaz no diagnóstico de lesões ósseas suspeitas.

  10. Ars discendi, ars docendi : programme Pascal

    OpenAIRE

    Goyet, Thérèse

    2016-01-01

    Le latin de l’intitulé, c’est pour le plaisir, mais on peut lui donner quelques autres justifications. Ars évoque tout à la fois le savoir‑faire, le talent, la compétence professionnelle, le goût de la solution élégante. La parataxe permet le va-et-vient entre le thème et le prédicat (sujet et attribut). On interprétera au choix : savoir étudier, c’est savoir enseigner. Ou : pour apprendre, il faut enseigner ; ou : l’enseignement consiste en étude ; et d’autres variations communes sur une vér...

  11. 40Ar/39Ar dating of the Late Cretaceous

    International Nuclear Information System (INIS)

    As part of the wider European GTS Next project, I propose new constraints on the ages of the Late Cretaceous, derived from a multitude of geochronological techniques, and successful stratigraphic interpretations from Canada and Japan. In the Western Canada Sedimentary Basin, we propose a new constraint on the age of the K/Pg boundary in the Red Deer River section (Alberta, Canada). We were able to cyclo-stratigraphically tune sediments in a non-marine, fluvial environment utilising high-resolution proxy records suggesting a 11-12 precession related cyclicity. Assuming the 40Ar/39Ar method is inter-calibrated with the cyclo-stratigraphy, the apparent age for C29r suggests that the K/Pg boundary falls between eccentricity maxima and minima, yielding an age of the C29r between 65.89 ± 0.08 and 66.30 ± 0.08 Ma. Assuming that the bundle containing the coal horizon represents a precession cycle, the K/Pg boundary is within the analytical uncertainty of the youngest zircon population achieving a revised age for the K/Pg boundary as 65.75 ± 0.06 Ma. The Campanian - Maastrichtian boundary is preserved in the sedimentary succession of the Horseshoe Canyon Formation and has been placed 8 m below Coal nr. 10. Cyclo-stratigraphic studies show that the formation of these depositional sequences (alternations) of all scales are influenced directly by sea-level changes due to precession but more dominated by eccentricity cycles proved in the cyclo-stratigraphic framework and is mainly controlled by sand horizons, which have been related by auto-cyclicity in a dynamic sedimentary setting. Our work shows that the Campanian - Maastrichtian boundary in the Western Canada Sedimentary Basin coincides with 2.5 eccentricity cycles above the youngest zircon age population at the bottom of the section and 4.9 Myr before the Cretaceous - Palaeogene boundary (K/Pg), and thus corresponds to an absolute age of 70.65 ± 0.09 Ma producing an 1.4 Myr younger age than recent published ages

  12. Osteoporose vs. doença de Alzheimer e Parkinson usando a tomografia computorizada quantitativa

    OpenAIRE

    Rodrigues, José Artur Oliveira

    2013-01-01

    Dissertação de mestrado integrado em Engenharia Biomédica A osteoporose é reconhecida como um dos maiores problemas de saúde pública devido à elevada taxa de morbilidade e mortalidade e aos custos associados com a descalcificação dos ossos, originando fraturas ósseas. É uma doença caracterizada por uma densidade mineral óssea diminuída e por uma microdeterioração do tecido ósseo que conduzem a um aumento da fragilidade óssea e a um consequente aumento do risco de fraturas. A...

  13. Evaluation of dosimetric techniques in positrons emission tomography and computerized tomography (PET/CT); Avaliacao de tecnicas dosimetricas em tomografia por emissao de positrons e tomografia computadorizada (PET/CT)

    Energy Technology Data Exchange (ETDEWEB)

    Pinto, Gabriella Montezano

    2014-09-01

    Among diagnostic techniques PET/CT is one of those with the highest dose delivery to the patient as a cause of external exposure to X-rays, and the use of a radiopharmaceutical that results in a high energy gamma emission. The dosimetry of these two components becomes important in order to optimize and justify the technique. Various dosimetric techniques are found in literature without a consensus of the best to use. With the advances in technological and consequent equipment configuration changes, upgrades and variation in methodologies, particularly in computed tomography, a standardization of these techniques is required. Previous studies show that CT is responsible for 70 % of the dose delivered to the patient in PET/CT examinations. Thus, many researchers have been focused on CT dose optimization protocols studies. This work analyzes the doses involved in a PET/CT oncology protocol by using an Alderson female anthropomorphic phantom in a public hospital of Rio de Janeiro city. The dose estimate for PET examination resulting from the use of {sup 18}F - FDG radiopharmaceutical was conducted through dose factors published in ICRP 106; the dose for CT was estimated and compared by calculation of the absorbed doses to patients according to four methods: thermoluminescent dosimetry (TL0100) distributed in critical organs of the Alderson phantom; measurements of CTOI according to AAPM number 96; correction factor for effective diameter SSOE (AAPM Number 204); and simulation by ImPACT program For CT, the results in terms of effective dose presented (TLO, CTOI and ImPACT) ± 5 % maximum variations between methodologies. Considering medium absorbed dose (TLO, SSOE and ImPACT) the results differed in ± 7 % from each other. These findings demonstrate that parameters provided by the manufacturer on the console can be used to have a primary approach of both, absorbed and effective doses to the patient since that a quality assurance program of these parameters are adopted in clinical routine. The organs receiving the highest equivalent doses in PET/CT examinations were bladder (64 mSv) and heart (41 mSv). The eye lens received equivalent dose of 17 mSv, and other radiosensitive organs such as uterus and breast received 17 and 13 mSv, respectively. The effective doses also showed a little variation among methodologies with doses around 20 mSv, demonstrating that this parameter not address the worst case and that the dose analysis for critical organs in a PET/CT examination is necessary. (author)

  14. CARCINOMA BRONQUÍOLO-ALVEOLAR: ASPECTOS NA TOMOGRAFIA COMPUTADORIZADA DE ALTA RESOLUÇÃO Bronchioloalveolar carcinoma: aspects in high-resolution computed tomography

    OpenAIRE

    Luiza Beatriz Melo Moreira; Edson Marchiori; Alessandro Severo Alves de Melo; Marcelo Magnago; Maria Angélica Soares Muniz; Klaus Irion

    2002-01-01

    O carcinoma bronquíolo-alveolar é um tipo de carcinoma broncogênico de crescimento insidioso, que surge nas paredes das vias aéreas distais e se dissemina utilizando o septo alveolar como um estroma, preservando a arquitetura pulmonar. Neste trabalho foram analisadas as tomografias computadorizadas de alta resolução de 17 pacientes com carcinoma bronquíolo-alveolar. Ao contrário do relatado na literatura, foram observados predomínio no sexo masculino (71%) e maior freqüência da associação das...

  15. Paracoccidioidomicose pulmonar: aspectos na tomografia computadorizada de alta resolução High-resolution computed tomography findings in pulmonary paracoccidioidomycosis

    OpenAIRE

    Maria Angélica Soares Muniz; Edson Marchiori; Marcelo Magnago; Luiza Beatriz Melo Moreira; José Guiomar de Almeida Junior

    2002-01-01

    O comprometimento pulmonar na paracoccidioidomicose é muito freqüente, podendo até ser a única manifestação da doença. Neste trabalho são analisados os aspectos encontrados nas tomografias computadorizadas de alta resolução do tórax de 30 pacientes com paracoccidioidomicose confirmada. Por meio desta análise foram determinados os achados mais comuns e suas formas de apresentação e distribuição nos pulmões. Os aspectos mais freqüentemente observados foram: espessamento esparso de septos interl...

  16. Dating blueschist metamorphism: a combined 40Ar/39Ar and electron microprobe approach

    International Nuclear Information System (INIS)

    40Ar/39Ar and electron microprobe examination of blueschist samples from the Iceberg Lake schist, southern Alaska suggest that phengite inclusions are the source of 40Ar in crossite. Because such fine-grained inclusions may be susceptible to argon loss, caution should be exercised in interpreting K-Ar ages from this phase, and possibly other low-K amphiboles from blueschist suites. The estimated blocking temperature for phengite in the matrix (3140 to 4500C), however, is close to the estimated peak metamorphic temperatures (3250 +- 500C), suggesting that phengite 40Ar/39Ar plateau dates may coincide closely with the time of blueschist metamorphism. (author)

  17. Triaxial superdeformation in $^{40}$Ar

    CERN Document Server

    Taniguchi, Yasutaka; Kimura, Masaaki; Ikeda, Kiyomi; Horiuchi, Hisashi; Ideguchi, Eiji

    2010-01-01

    Superdeformed (SD) states in $^{40}$Ar have been studied using the deformed-basis antisymmetrized molecular dynamics. Low energy states were calculated by the parity and angular momentum projection (AMP) and the generator coordinate method (GCM). Basis wave functions were obtained by the energy variation with a constraint on the quadrupole deformation parameter $\\beta$, while other quantities such as triaxiality $\\gamma$ were optimized by the energy variation. By the GCM calculation, an SD band is obtained just above the ground state band. The SD band involves a $K^\\pi = 2^+$ side band due to the triaxiality. The calculated quadrupole electric transition strengths of the SD band reproduce well the experimental values. Triaxiality is significantly important to understand low-lying states.

  18. Ars grammatica de Dionisio Tracio

    Directory of Open Access Journals (Sweden)

    Beltrán Jorge Enrique

    2003-06-01

    Full Text Available

    Ars Grammatica de Dionisio Tracio (170-90 a. C fue la primera gramática griega que se escribió. Su contenido y método fueron modelos que siguieron las gramáticas escolares posteriores. La versión española que se presenta ahora responde a la necesidad que se tenía en nuestro medio de una traducción completa de este texto. Finalmente, se acompaña la traducción de una introducción y de abundantes notas, en un intento por hacerla comprensible para el hablante del español, no necesariamente conocedor de la lengua griega.

  19. Effects of Si Addition and Heating Ar on the Electromigration Performance of Al-Alloy Interconnects

    Science.gov (United States)

    Lee, Dok Won; Lee, Byung-Zu; Jeong, Jong Yeul; Park, Hyun; Shim, Kyu Cheol; Kim, Jong Seok; Park, Young Bae; Woo, Sun-Woong; Lee, Jeong-gun

    2002-02-01

    The electromigration (EM) performance of Ti/Al-alloy multilayered metallization with one-step sputtered Al-alloy has been studied. The Al-alloys investigated included Al-1.0%Si-0.5%Cu and Al-0.5%Cu, and the Al-alloy films were prepared with and without heating Ar. The package-level EM test results indicate that the EM resistance of the Al-Si-Cu stack is nearly identical to that of the Al-Cu stack. Si addition was found to degrade the microstructure of the Al-alloy film, while it had the retarding effect on the Ti/Al reaction, which suggests that there exists a trade-off between the film microstructure and the formation of TiAl3 intermetallic compound. The EM performance of the one-step sputtered Al-alloy stack was enhanced by the use of heating Ar during the deposition of Al-alloy film, which has been attributed to the improved microstructure of the Al-alloy film by the use of heating Ar.

  20. Efeito da rega com injecção de ar na humidade do solo, dis­ponibilidade de azoto nítrico, condutividade eléctrica e pro­dutividade da alface cultivada em estufa plástica Effects of irrigation with injection of air in soil moisture, nitrate avail­ability, electrical conductivity and lettuce productivity grown in plastic greenhouse

    Directory of Open Access Journals (Sweden)

    C.R. Pivetta

    2010-01-01

    Full Text Available Este trabalho teve como objectivo veri­ficar se a injecção de ar junto a água de rega gota-a-gota enterrada, afecta a humi­dade do solo, a disponibilidade de azoto nítrico, a condutividade eléctrica e o cres­cimento e produtividade da alface. Para tal realizou-se um ensaio com a alface variedade “Mention” cultivada em estufa plástica e localizada na Herdade Experi­mental da Mitra-ICAAM, da Universida­de de Évora -Portugal. Utilizou-se o deli­neamento experimental blocos ao acaso com quatro repetições, com os tratamen­tos: rega com injecção de ar (CAR, e rega sem injecção de ar (SAR. O ar foi introdu­zido na água de rega por meio de um injector “Mazzei”. O teor de humidade na camada superficial (0-0,05 m foi seme­lhante para os dois tratamentos, alcançan­do valores em torno de zero. Em termos de concentração de azoto nítrico (NO 3- os valores observados na camada 0,10­0,20 m, aos 35 e 47 dias após a transplan­tação, foram mais elevados no tratamento CAR. Aos 47 dias após a transplantação, os níveis médios de NO3-foram de 95,33 e 67,94 ppm nos tratamentos CAR e SAR, respectivamente. A densidade radical no tratamento CAR na camada de 0-0,10 m do solo foi 34 % superior em relação ao SAR. A produção comercial não foi afectada pelo tratamento. A falta de resposta da cultura ao acréscimo de azoto nítrico e da densidade radical pode estar relacionada com o curto ciclo da cultura e/ou com o elevado teor de azoto presente no solo, ou ainda com a profundidade que os goteja­dores foram instalados e não com a fun­cionalidade do injector de ar.The objective of the present study was to evaluate the effect of the air injection through subsurface drip irrigation (oxyga­tion in soil moisture, availability of nitro­gen oxide, and electrical conductivity, plant growth and yield of lettuce, variety "Men­tion", cultivated in plastic greenhouse. The experiment was carried out at the Mitra-ICAM, an Experimental

  1. CT-guided plexus and splanchnic nerve neurolytic block. Experience in 150 cases and techniques optimization; Il blocco neurolitico del plesso celiaco e dei nervi splancnici con tomografia computerizzata

    Energy Technology Data Exchange (ETDEWEB)

    Marra, V.; Frigerio, A.; Menna, S.; Di Virgilio, M.R. [Ospedale San Giovanni, Turin (Italy). Serv. di Radiologia; Debernardi, F.; Musso, L. [Ospedale San Giovanni, Turin (Italy). Serv. di Anestesia, Rianimazione e Terapia Antalgica

    1999-09-01

    The paper reports the personal experience in computerized tomography guided celiac plexus and splanchnic nerve neurolytic block blocks. [Italian] Scopo del lavoro e' illustrare l'esperienza personale nell'uso della tomografia computerizzata nel trattamento del dolore da neoplasie addominali superiori, rivoluzionando le tecniche di esecuzione, aumentandone la precisione e riducendone notevolmente il rischio di complicanze.

  2. Retinal thickness measurement and evaluation of natural history of the diabetic macular edema through optical coherence tomography Medida da espessura retiniana e avaliação da história natural do edema macular diabético pela tomografia de coerência óptica

    Directory of Open Access Journals (Sweden)

    Rosana Zacarias Hannouche

    2009-08-01

    influence on the center point thickness data, whereas values of visual acuity were significantly correlated with it. CONCLUSION: This study presents the optical coherence tomography applicability in the detection and semiologic evaluation of diabetic macular edema in patients with visual acuity 20/40 or greater, during one year, showing the retinal thickening in the early stages of diabetic retinopathy. Further, it evidenciated the correlation between the increase in foveal thickness and the reduction in visual acuity. Levels of hemoglobin A1c did not influence the center point thickness data. An early detection of clinically significant macular edema leads us to a redefinition of the real meaning of incipient retinopathy and can prevent further significant reduction of vision.OBJETIVOS: 1 Diagnosticar a presença de edema macular diabético em pacientes com retinopatia diabética e acuidade visual igual ou melhor que 20/40, pela realização do exame de tomografia de coerência óptica, medindo a espessura foveal central, ao longo de um ano. 2 Avaliar a história natural do edema, ao longo de um ano, associando a espessura foveal central com a hemoglobina glicosilada (HbA1c e alterações na acuidade visual. 3 Correlacionar os resultados obtidos com o grupo controle. MÉTODOS: Estudo prospectivo de uma amostra de 30 pacientes, com edema macular diabético e acuidade visual melhor ou igual a 20/40. O estudo contou com 30 olhos como grupo controle. Foram feitas medidas da melhor acuidade visual corrigida, dosagem de hemoglobina glicosilada, biomicroscopia com lente de 78 dioptrias, angiofluoresceinografia e tomografia de coerência óptica. Determinou-se, pelo propósito do estudo, a espessura foveal central como principal variável. Além da estatística descritiva, utilizaram-se testes para análise dos resultados: foi testada a homogeneidade de cada variável pelos testes t-Student, Qui-Quadrado e teste de Tukey; para correlacionar variáveis utilizou-se a análise de

  3. Tomografia computadorizada como método auxiliar no diagnóstico e tratamento de lesões intra-ósseas: caso clínico de odontoma composto = Computed tomography as auxiliary method in the diagnostic and treatment of intra-osseos lesions: a case of compound odontoma

    Directory of Open Access Journals (Sweden)

    Paiano, Grasiela Antunes

    2006-01-01

    Full Text Available O advento da tomografia computadorizada (TC possibilita de visualização tridimensional, favorece o diagnóstico e proporcionando um tratamento mais preciso em virtude da localização exata da lesão e análise da proximidade com as estruturas anatômicas vitais relacionadas. Contudo o tratamento de lesões ósseas se torna mais segura, reduzindo o risco de lesão a dentes adjacentes e nervos. O Odontoma é considerado o tumor odontogênico que mais comumente acomete os ossos maxilares. A variante composta deste tumor apresenta a característica de muitas estruturas semelhantes a dentes envolvidas por um halo radiolúcido e grande freqüência na região anterior da maxila, porém o diagnóstico deste tumor nas demais localizações dos maxilares é pouco freqüente. Apresenta normalmente crescimento limitado e expande as corticais ósseas, porém sem tendência à recidiva. O tratamento do odontoma consiste na sua excisão cirúrgica. Os autores pretendem relatar a utilização da TC como método auxiliar no diagnóstico e tratamento de um caso de exérese de um odontoma composto na região anterior da mandíbula.

  4. Trabalho em equipa

    OpenAIRE

    Antunes, Andreia Sofia Duarte

    2016-01-01

    O presente relatório de estágio tem como tema principal o trabalho em equipa. Aborda com mais pormenor o subtema dos momentos de reflexão na equipa pedagógica. Ao longo do estudo são vários os conceitos abordados e a interligação entre os mesmos. Pretendo dar a conhecer a temática em questão e conceções que lhe estão naturalmente associadas. Sendo um estudo investigativo são abordados os métodos utilizados ao longo de toda a investigação. Com este relatório pretende-se alcançar qual ...

  5. Remoção dos compostos odoríferos geosmina e 2-metilisoborneol de águas de abastecimento através de processos de aeração em cascata, dessorção por ar e nanofiltração Removal of the odoriferous compounds geosmin and 2-methylisoborneol from drinking water by the processes of cascade aeration, air strippingand nanofiltration

    Directory of Open Access Journals (Sweden)

    Michely Zat

    2011-12-01

    Full Text Available Atividades humanas aceleram o processo natural de eutrofização das águas, favorecendo a floração de algas e cianobactérias. Estes organismos emitem os compostos 2-metilisoborneol (MIB e geosmina, que conferem gosto e odor de mofo e terra à água. A presença destes compostos se estende à água potável uma vez que os processos convencionais de tratamento são insuficientes para removê-los. Esta pesquisa foi realizada com o objetivo de avaliar alternativas de processos de tratamento para a remoção de MIB e geosmina da água. Os processos estudados foram aeração em cascata, dessorção por ar e nanofiltração. Os resultados sugerem a possibilidade de remoção quase total de MIB e geosmina da água através do sistema de nanofiltração, enquanto que os processos baseados em aeração e dessorção foram relativamente ineficientes.Human activities accelerate the natural process of eutrophication, favouring the occurrence of algae and cyanobacterial blooms. These organisms emit the compounds 2-methylisoborneol (MIB and geosmin, which confer earthy and moldy taste and odor to water. The presence of MIB and geosmin is extended to drinking water inasmuch they are not completely removed by the processes used in conventional treatment. This research was conducted to evaluate the capability of alternative treatment processes to remove MIB and geosmin from water. The processes studied were cascade aeration, air stripping, and nanofiltration. The results suggested that MIB and geosmin can be almost completely removed by nanofiltration, while the processes based on aeration and stripping were relatively inefficient.

  6. Modification of stearic acid in Ar and Ar-O2 pulsed DC discharge

    Directory of Open Access Journals (Sweden)

    Euclides Alexandre Bernardelli

    2011-12-01

    Full Text Available Stearic acid (CH3(CH216COOH was treated with Ar and Ar-O2 (10% pulsed DC discharges created by a cathode-anode confined system to elucidate the role of oxygen in plasma cleaning. The treatment time (5 to 120 minutes and plasma gas mixture (Ar and Ar-O2 were varied, and the results showed that the mass variation of stearic acid after Ar-O2 plasma exposure was greater than that of pure Ar plasma treatment. Thus, compared to Ar*, active oxygen species (O and O2, in all states enhance the etching process, regardless of their concentration. During the treatments, a liquid phase developed at the melting temperature of stearic acid, and differential thermal analyses showed that the formation of a liquid phase was associated with the breakage of bonds due to treatment with an Ar or Ar-O2 plasma. After treatment with Ar and Ar-O2 plasmas, the sample surface was significantly modified, especially when Ar-O2 was utilized. The role of oxygen in the treatment process is to break carbonaceous chains by forming oxidized products and/or to act as a barrier again ramification, which accelerates the etching of stearic acid.

  7. Tomografia computadorizada sem contraste intravenoso no abdome agudo: quando e por que usar When and why use unenhanced computed tomography in patients with acute abdomen

    Directory of Open Access Journals (Sweden)

    Edison de Oliveira Freire Filho

    2006-02-01

    Full Text Available A tomografia computadorizada sem contraste intravenoso tem sido freqüentemente proposta na avaliação inicial de pacientes com suspeita de abdome agudo, ocupando o espaço de outros métodos diagnósticos. Os autores apresentam uma revisão bibliográfica dos principais aspectos e eficácia da tomografia computadorizada sem contraste intravenoso no diagnóstico de apendicite aguda, cólica nefrética, diverticulite, pancreatite aguda, apendicite epiplóica, pneumoperitônio e obstrução intestinal. Discutem quais as vantagens e limitações desta técnica de exame, bem como seus aspectos práticos.The use of unenhanced computed tomography has been frequently recommended for the initial assessment of patients with clinical suspicion of acute abdomen instead of other diagnostic methods. The authors present a review of the literature on the main aspects, advantages, limitations and efficacy of unenhanced computed tomography for the diagnosis of acute appendicitis, renal colic, diverticulitis, acute pancreatitis, primary epiploic appendicitis, pneumoperitoneum and small bowel obstruction. The advantages and limitations of this technique are also discussed.

  8. 244-AR Vault Interim Stabilization Project Plan

    International Nuclear Information System (INIS)

    The 244-AR Vault Facility, constructed between 1966 and 1968, was designed to provide lag storage and treatment for the Plutonium-Uranium Extraction Facility (PUREX) tank farm sludges. Tank farm personnel transferred the waste from the 244-AR Vault Facility to B Plant for recovery of cesium and strontium. B Plant personnel then transferred the treatment residuals back to the tank farms for storage of the sludge and liquids. The last process operations, which transferred waste supporting the cesium/strontium recovery mission, occurred in April 1978. After the final transfer in 1978, the 244-AR facility underwent a cleanout. However, 2,271 L (600 gal) of sludge were left in Tank 004AR from an earlier transfer from Tank 241-AX-104. When the cleanout was completed, the facility was placed in a standby status. The sludge had been transferred to Tank 004AR to support Pacific Northwest National Laboratory [PNNL] vitrification work. Documentation of waste transfers suggests that a portion of the sludge may have been moved from Tank 004AR to Tank 002AR in preparation for transfer back to the AX Tank Farm; however, quantities of the sludge that were moved to Tank 002AR from that transfer must be estimated

  9. Efeito da adição de polpa, carboximetilcelulose e goma arábica nas características sensoriais e aceitação de preparados em pó para refresco sabor laranja Effect of adding pulp, carboxymethyl cellulose and arabic gum to sensory characteristics and acceptance of powdered orange-flavored refreshments

    Directory of Open Access Journals (Sweden)

    Valentina de Fátima Caleguer

    2007-06-01

    Full Text Available O trabalho teve como objetivo avaliar o efeito sensorial da adição de polpa, carboximetilcelulose (CMC e goma arábica (fibra nos atributos e aceitação de refrescos de laranja. Utilizou-se uma amostra padrão e outras formuladas com polpa, CMC, fibra e todos os ingredientes. Foram realizadas análises físico-químicas (pH, acidez titulável, sólidos solúveis, vitamina C, cor e turbidez, e as amostras também foram caracterizadas pela técnica de Perfil Livre. Na análise descritiva utilizou-se 14 provadores e, para a avaliação dos resultados foi empregada a Análise Procrustes Generalizada. As amostras caracterizadas como diferentes (padrão, CMC, fibra foram submetidas a teste de aceitação. Os refrescos foram caracterizados e separados com base em atributos de aparência (cor laranja e turbidez, aroma (adocicado e laranja, sabor (doce, laranja e ácido e textura (viscosidade. O padrão e a amostra com polpa, que não foram diferenciadas sensorialmente, apresentaram menor intensidade de cor laranja e turbidez, e foram consideradas menos encorpadas e mais ácidas. As amostras com CMC e fibra se diferenciaram do padrão e apresentaram comportamento intermediário. A formulação com todos os ingredientes apresentou características opostas: maior intensidade de cor e turbidez, mais encorpada e menos ácida. As amostras com CMC e fibra foram mais aceitas que o padrão.The aim of this work was to evaluate the sensory effect of adding pulp, carboxymethyl cellulose (CMC and arabic gum (fiber to characteristics and acceptance of powdered orange flavored soft drinks. A standard sample and another formulated with pulp, CMC, fiber with all the ingredients were used. Physicochemical analyses (pH, titratable acidity, soluble solids, vitamin C, color and turbidity were applied and samples were characterized by Free-Choice Profiling. Fourteen panelists were used in the descriptive analysis and the Generalized Procrustes Analysis was applied to

  10. Ruptura traumática de via aérea em criança: um desafio diagnóstico Traumatic airway disruption in a child: a diagnostic challenge

    OpenAIRE

    Andréa Maria Cordeiro Ventura; Patrícia Freitas Góes; José Pinhata Otoch; José Carlos Fernandes

    2005-01-01

    OBJETIVO: Relatar um caso de ruptura da via aérea em criança vítima de trauma torácico decorrente de queda do tanque de lavar roupas. DESCRIÇÃO: Relato de caso descritivo. O paciente pré-escolar de 34 meses, do sexo masculino foi atendido na unidade de terapia intensiva pediátrica de Hospital Universitário. Foram realizados os seguintes procedimentos: radiografia simples e tomografia de tórax, endoscopia respiratória, toracotomia, antibioticoterapia, ventilação mecânica. A radiografia simples...

  11. Determinação espectrofotométrica do arsênio em solo da cidade de Santana-AP usando o método do dietilditiocarbamato de prata (SDDC) modificado Arsenic spectrophotometric determination in soil of the Santana-AP city using the silver diethyldithiocarbamate (SDDC) modified method

    OpenAIRE

    Simone de Fátima Pinheiro Pereira; Geiso Rafael Fonseca Oliveira; Johny da Silva Oliveira; Juliane da Silva e Silva; Pedro Moreira de Sousa Junior

    2009-01-01

    Várias toneladas de rejeito de manganês contendo arsênio, gerado por uma empresa de mineração, foram utilizadas como aterro de ruas da cidade de Santana-AP. A possibilidade de exposição das pessoas residentes nessas localidades levou ao estudo de quantificação de arsênio total nos solos. Após a digestão, os teores de arsênio foram quantificados por espectrofotometria de absorção molecular usando um sistema automático de geração de hidretos (HG-MAS), diciclohexilamina/CHCl3 como solvente do di...

  12. The Coronae of AR Lac

    CERN Document Server

    Huenemoerder, D P; Drake, J J; Sanz-Forcada, J; Canizares, Claude R.; Drake, Jeremy J.; Huenemoerder, David P.; Sanz-Forcada, Jorge

    2003-01-01

    We observed the coronally active eclipsing binary, AR Lac, with the High Energy Transmission Grating on Chandra for a total of 97 ks, spaced over five orbits, at quadratures and conjunctions. Contemporaneous and simultaneous EUV spectra and photometry were also obtained with the Extreme Ultraviolet Explorer. Significant variability in both X-ray and EUV fluxes were observed, dominated by at least one X-ray flare and one EUV flare. We saw no evidence of primary or secondary eclipses. X-ray flux modulation was largest at high temperature, indicative of flare heating of coronal plasma. Line widths interpreted in terms of Doppler broadening suggest that both binary stellar components are active. From line fluxes obtained from total integrated spectra, we have modeled the emission measure and abundance distributions. A strong maximum was found in the differential emission measure, characterized by peaks at log T = 6.9 and 7.4, together with a weak but significant cooler maximum near log T=6.2, and a moderately str...

  13. 40Ar/39Ar ages of lunar impact glasses: Relationships among Ar diffusivity, chemical composition, shape, and size

    CERN Document Server

    Zellner, N E B

    2015-01-01

    Lunar impact glasses, quenched melts produced during cratering events on the Moon, have the potential to provide not only compositional information about both the local and regional geology of the Moon but also information about the impact flux over time. We present in this paper the results of 73 new 40Ar/39Ar analyses of well-characterized, inclusion-free lunar impact glasses and demonstrate that size, shape, chemical composition, fraction of radiogenic 40Ar retained, and cosmic ray exposure (CRE) ages are important for 40Ar/39Ar investigations of these samples. Specifically, analyses of lunar impact glasses from the Apollo 14, 16, and 17 landing sites indicate that retention of radiogenic 40Ar is a strong function of post-formation thermal history in the lunar regolith, size, and chemical composition. Based on the relationships presented in this paper, lunar impact glasses with compositions and sizes sufficient to have retained 90% of their radiogenic Ar during 750 Ma of cosmic ray exposure at time-integra...

  14. Effects of shock pressure on 40Ar-39Ar radiometric age determinations

    International Nuclear Information System (INIS)

    The relation of shock to the drop in the 40*Ar/39*Ar ratio seen at high release temperatures in some neutron-irradiated lunar samples is investigated through measurements of the 40*Ar/39*Ar ratio in gas samples released by stepwise heating of rock samples previously subjected to shock, either in the laboratory or in nature. Explosives were used to shock solid pieces and powder of a basalt from a diabase dike in Liberia to calculated pressures of 65, 150 and 270 kbar. These, an unshocked sample of the powder, two naturally shocked samples from the Brent impact crater in Canada, one unshocked sample from near the crater, and appropriate monitors were irradiated. Ar from stepwise heating was analyzed. The unshocked basalt shows a good 40*Ar/39*Ar plateau at age 198 +-9 m.y. in agreement with a previous result of 186 +- 2 m.y. The shocked samples contain varying amounts of implanted atmospheric Ar, the isotopes of which have experienced mass fractionation. This effect is small enough in four samples so that the linearity of their graphs of 39*Ar/40Ar vs 36Ar/40Ar is evidence of a plateau. The ages of these samples are then 201 +- 10, 205 +- 12 and 201 +-9 m.y. It appears that the shock has had little effect on the 40Ar-39Ar age spectrum, although the release patterns of the 39*Ar are shifted downward by the order of 2000C. Shock implantation of Ar was at lower shock pressure, in the presence of less Ar, and into a less porous material than previously demonstrated. The Brent Crater samples do not all show good plateaus, but do indicate an age of 420 m.y. for the crater event and 795 +- 24 m.y. for the rock formation, in agreement with previous results. None of the 40*Ar/39*Ar profiles shows a drop at high temperature, but a possible role of shock implantation of Ar is indicated in the production of this effect. Further experiments are suggested. (author)

  15. Características estruturais maculares de olhos de pré-escolares nascidos prematuros: análise por tomografia de coerência óptica e oftalmoscopia binocular indireta

    Directory of Open Access Journals (Sweden)

    Lígia Beatriz Bonotto

    2013-04-01

    Full Text Available OBJETIVO: Comparar a estrutura retiniana da mácula e fóvea entre prematuros com retinopatia da prematuridade (ROP estágios II e III pós-tratamento, com ROP estágios II e III regredida espontaneamente e sem ROP, através de exames de tomografia de coerência óptica (OCT e da oftalmoscopia binocular indireta (OBI. MÉTODOS: Estudo do tipo transversal, observacional e não cego. Foram incluídas crianças prematuras nascidas entre 06/1992 e 06/2006 e examinadas entre 06/2009 e 12/2010; idade gestacional menor ou igual a 32 semanas e peso ao nascer menor ou igual a 1.599 g; com mínimo de três consultas durante o período de seleção; sem retinopatia da prematuridade ou com diagnóstico de ROP estágios II ou III em pelo menos um dos olhos com regressão espontânea ou após tratamento; máximo de seis meses de idade cronológica para o primeiro exame no serviço; idade cronológica mínima de quatro anos no período da reavaliação. Foram excluídas crianças prematuras que não compareceram ou que não tinham condições clínicas para a realização dos exames de reavaliação. Os prematuros foram divididos em três grupos: G1- com ROP pós-tratamento; G2- com ROP pós-regressão espontânea; e G3- sem ROP. Os exames realizados foram OBI e OCT. RESULTADOS: Vinte e quatro prematuros (48 olhos apresentaram os critérios exigidos para a pesquisa, com idade média cronológica entre 5 e 6 anos. À OBI, houve diferença estatística significativa para a presença de alterações na retina dos prematuros do grupo G1. No entanto estas alterações corresponderam às lesões cicatriciais deixadas pelo tratamento da ROP, sem comprometimento visível da região macular. À OCT houve diferença estatística significativa para a maior espessura foveal para os prematuros do grupo G1. Considerando-se o olho esquerdo, não houve diferença estatística significativa relacionada à espessura da fóvea entre G1 e G3. Não houve diferença entre os tr

  16. 40Ar/39Ar laser-probe dating of diamond inclusions from the Premier kimberlite

    International Nuclear Information System (INIS)

    Inclusions encapsulated by diamonds at the time of their formation provide a means for determining diamond crystallization ages and the chemistry of the surrounding upper mantle at that time. Sm-Nd studies of peridotitic inclusions, from Cretaceous-age kimberlites in southern Africa, suggest that the diamonds formed 3.3 Gyr ago. By contrast, eclogite-suite inclusions generally yield younger ages, sometimes approaching the time of kimberlite eruption. Here we report the results of 40Ar/39Ar laser-probe analyses of individual eclogitic clinopyroxene inclusions from Premier diamonds, which yield a mean age of 1,198±14 Myr. This age agrees well with Sm-Nd and 40Ar/39Ar analyses on similar Premier inclusions, and is indistinguishable from the inferred time of emplacement of the host kimberlite (1,150-1,230 Myr), which implies that diamond formation was essentially synchronous with kimberlite generation. The extrapolated non-radiogenic 40Ar/36Ar ratio of 334±102 is similar to the present-day atmospheric composition. This value is inconsistent with Sr and Nd isotopic signatures from Premier eclogite inclusions, which suggest a depleted mantle source (40Ar/36Ar>20,000). Pre-entrapment equilibration of the inclusions with an 36Ar-rich fluid is the most probable explanation for the low non-radiogenic (40Ar/36Ar) composition. (author)

  17. 40Ar/39Ar ages of lunar impact glasses: Relationships among Ar diffusivity, chemical composition, shape, and size

    Science.gov (United States)

    Zellner, N. E. B.; Delano, J. W.

    2015-07-01

    Lunar impact glasses, which are quenched melts produced during cratering events on the Moon, have the potential to provide not only compositional information about both the local and regional geology of the Moon but also information about the impact flux over time. We present in this paper the results of 73 new 40Ar/39Ar analyses of well-characterized, inclusion-free lunar impact glasses and demonstrate that size, shape, chemical composition, fraction of radiogenic 40Ar retained, and cosmic ray exposure (CRE) ages are important for 40Ar/39Ar investigations of these samples. Specifically, analyses of lunar impact glasses from the Apollo 14, 16, and 17 landing sites indicate that retention of radiogenic 40Ar is a strong function of post-formation thermal history in the lunar regolith, size, and chemical composition. This is because the Ar diffusion coefficient (at a constant temperature) is estimated to decrease by ∼3-4 orders of magnitude with an increasing fraction of non-bridging oxygens, X(NBO), over the compositional range of most lunar impact glasses with compositions from feldspathic to basaltic. Based on these relationships, lunar impact glasses with compositions and sizes sufficient to have retained ∼90% of their radiogenic Ar during 750 Ma of cosmic ray exposure at time-integrated temperatures of up to 290 K have been identified and are likely to have yielded reliable 40Ar/39Ar ages of formation. Additionally, ∼50% of the identified impact glass spheres have formation ages of ⩽500 Ma, while ∼75% of the identified lunar impact glass shards and spheres have ages of formation ⩽2000 Ma. Higher thermal stresses in lunar impact glasses quenched from hyperliquidus temperatures are considered the likely cause of poor survival of impact glass spheres, as well as the decreasing frequency of lunar impact glasses in general with increasing age. The observed age-frequency distribution of lunar impact glasses may reflect two processes: (i) diminished

  18. Ar-40/Ar-39 laser-probe dating of diamond inclusions from the Premier kimberlite

    Science.gov (United States)

    Phillips, D.; Onstott, T. C.; Harris, J. W.

    1989-01-01

    The results of Ar-40/Ar-39 laser-probe analyses of individual eclogitic clinopyroxene inclusions from Premier diamonds are reported which yield a mean age of 1198 + or - 14 Myr. This age agrees well with Sm-Nd and Ar-40/Ar-39 analyses on similar Premier inclusions and is indistinguishable from the inferred time of emplacement of the host kimberlite, which implies that diamond formation was essentially synchronous with kimberlite generation. The extrapolated nonradiogenic Ar-40/Ar-36 ratio of 334 + or - 102 is similar to the present-day atmospheric composition. This value is inconsistent with Sr and Nd isotopic signatures from Premier eclogite inclusions, which suggest a depleted mantle source. Preentrapment equilibration of the inclusions with an Ar-36-rich fluid is the most probable explanation for the low nonradiogenic composition.

  19. 39Ar-40Ar systematics of two millimeter-sized rock fragments from Mare Crisium

    International Nuclear Information System (INIS)

    Two small fragments, L24B, a glass-rich agglutinate (1.9mg) and L24A, a fine-grained lithic fragment (9.4mg), from the Luna 24 landing site have been neutron irradiated for the purpose of 39Ar-40Ar dating. A fairly well-defined 39Ar-40Ar plateau age of 3.65+-0.12 AE was found for the larger fragment. After appropriate corrections the composition of the trapped and spallogenic Ar could be deciphered. The evolution of 38Arsub(sp)/37Ar showed that 660 m.y. and 500 m.y. were the most reliable exposure ages for L24A and L24B, respectively. The Ti contents of <=0.6% determined by gamma-counting prior to the Ar analysis indicate both fragments being associated with the group of low-Ti or even very low-Ti basalts. (Auth.)

  20. 39Ar/Ar measurements using ultra-low background proportional counters

    Energy Technology Data Exchange (ETDEWEB)

    Hall, Jeter C.; Aalseth, Craig E.; Bonicalzi, Ricco; Brandenberger, Jill M.; Day, Anthony R.; Humble, Paul H.; Mace, Emily K.; Panisko, Mark E.; Seifert, Allen

    2016-01-08

    Age dating groundwater and seawater using 39Ar/Ar ratios is an important tool to understand water mass flow rates and mean residence time. For modern or contemporary argon, the 39Ar activity is 1.8 mBq per liter of argon. Radiation measurements at these activity levels require ultra low-background detectors. Low-background proportional counters have been developed at Pacific Northwest National Laboratory. These detectors use traditional mixtures of argon and methane as counting gas, and the residual 39Ar from commercial argon has become a predominant source of background activity in these detectors. We demonstrated sensitivity to 39Ar by using geological or ancient argon from gas wells in place of commercial argon. The low level counting performance of these proportional counters is then demonstrated for sensitivities to 39Ar/Ar ratios sufficient to date water masses as old as 1000 years.

  1. Multiparametric multidetector computed tomography scanning on suspicion of hyperacute ischemic stroke: validating a standardized protocol Avaliação multiparamétrica por tomografia computadorizada multidetectores na suspeita de isquemia cerebral hiperaguda: validando um protocolo padronizado

    Directory of Open Access Journals (Sweden)

    Felipe Torres Pacheco

    2013-06-01

    Full Text Available Multidetector computed tomography (MDCT scanning has enabled the early diagnosis of hyperacute brain ischemia. We aimed at validating a standardized protocol to read and report MDCT techniques in a series of adult patients. The inter-observer agreement among the trained examiners was tested, and their results were compared with a standard reading. No false positives were observed, and an almost perfect agreement (Kappa>0.81 was documented when the CT angiography (CTA and cerebral perfusion CT (CPCT map data were added to the noncontrast CT (NCCT analysis. The inter-observer agreement was higher for highly trained readers, corroborating the need for specific training to interpret these modern techniques. The authors recommend adding CTA and CPCT to the NCCT analysis in order to clarify the global analysis of structural and hemodynamic brain abnormalities. Our structured report is suitable as a script for the reproducible analysis of the MDCT of patients on suspicion of ischemic stroke.A tomografia computadorizada multidetectores (TCMD permitiu o diagnóstico precoce de isquemia cerebral hiperaguda. O presente estudo objetivou validar a interpretação e a descrição padronizada de um protocolo de TCMD multiparamétrica em uma série de pacientes adultos. A concordância entre os examinadores foi testada, e seus resultados confrontados com uma leitura padrão. Não foram observados resultados falso-positivos, e foi documentado um elevado grau de concordância (Kappa>0,81 quando os dados da angiotomografia (ATC e dos mapas de perfusão cerebral por TC (PCTC foram adicionados à análise da TC sem contraste (TCSC. A concordância interobservador foi superior para os leitores melhor treinados, corroborando a necessidade de formação específica para a interpretação dos exames. Os autores recomendam acrescer a interpretação da ATC e da PCTC à análise da TCSC, visando à análise global das anormalidades cerebrais estruturais e hemodin

  2. Linfoma renal: espectro de imagens na tomografia computadorizada Renal lymphoma: spectrum of computed tomography findings

    Directory of Open Access Journals (Sweden)

    Carol Pontes de Miranda Maranhão

    2005-04-01

    Full Text Available O acometimento renal no linfoma é raro, uma vez que o rim não possui tecido linfóide. O envolvimento secundário é mais freqüente, ocorrendo em até um terço das autópsias dos portadores de linfoma. Alguns autores acreditam que esta seja a única forma de acometimento renal, questionando a existência do linfoma primário. O linfoma renal representaria metástases hematogênicas ou invasão direta do tumor ocorrendo no espaço perirrenal. A partir destes tipos de envolvimento decorrem as formas de apresentação do linfoma renal: múltiplos nódulos, massa solitária, invasão renal por doença retroperitoneal contígua, doença perirrenal e infiltração difusa. Neste trabalho são discutidas e apresentadas imagens destas diferentes formas de acometimento.Isolated renal lymphoma is rare due to the absence of lymphoid tissue in kidneys. Secondary involvement occurs more frequently and is reported in up to 1/3 of the autopsies of patients who died from lymphoma. Some authors believe this is actually the only existing form of renal lymphoma. The involvement of the kidney by lymphoma would occur through hematogenic metastasis or direct tumor invasion of the perirenal space. These different types of involvement determine the several forms of renal lymphoma presentation: multiple nodules, solitary mass, renal invasion from contiguous retroperitoneal disease, perirenal disease and diffuse infiltration. In this study the imaging findings features of the different forms of involvement are presented and discussed.

  3. arXiv.org and Physics Education

    Science.gov (United States)

    Ramlo, Susan

    2007-09-01

    The website arXiv.org (pronounced archive) is a free online resource for full-text articles in the fields of physics, mathematics, computer science, nonlinear science, and quantitative biology that has existed for about 15 years. Available directly at http://www.arXiv.org, this e-print archive is searchable. As of Jan. 3, 2007, arXiv had open access to 401,226 e-prints in the topic areas. Those who sign up for an ID and password can also sign up for daily submission abstract emails for specific subject classes of arXiv, including physics education, physics and society, and history of physics. Founded and developed by Paul Ginsparg when he was at Los Alamos National Laboratory, arXiv's original name was the LANL preprint archive or xxx.lanl.gov. The location and name changed after Ginsparg moved to the physics department at Cornell University. Today, arXiv is hosted and operated by Cornell University library. Mirror sites for arXiv exist worldwide.2

  4. On mechanism of Ar(3p54p) states excitation in low-energy Ar-Ar collisions

    International Nuclear Information System (INIS)

    The present work is devoted to study of Ar(3p54p) states excitation in binary low-energy Ar-Ar collisions. The results of the experimental investigation of excitation cross sections of Ar I 4p'[l/2]1, 4p'[3/2]1, 4p'[3/2]2 and 4p[3/2]2 levels in the collision energy range from threshold up to 500 eV (cm) and degree of polarization for 4s[3/2]20-4p'[l/2]1 and 4s[3/2]20-4p[3/2]2 transitions in this energy range are represented.

  5. Ars Baltica-verkoston puheenjohtajuus Suomeen Risto Ruohoselle

    Index Scriptorium Estoniae

    1999-01-01

    1990. a. loodud võrgustiku Ars Baltica sekretariaat (Ars Baltica Contact Point & Communication Center) tuleb Kielist Tallinnasse Eesti kultuuriministeeriumi kuni aastani 2002 (Suur-Karja 23). Ars Baltica (ühendus)

  6. Instrumentation development for planetary in situ 40Ar/39Ar geochronology

    Science.gov (United States)

    Davidheiser-Kroll, B.; Morgan, L. E.; Munk, M.; Warner, N. H.; Gupta, S.; Slaybaugh, R.; Harkness, P.; Mark, D. F.

    2015-12-01

    The chronology of the Solar System, particularly the timing of formation of extraterrestrial bodies and their features, is a major outstanding problem in planetary science. Although various chronological methods for in situ geochronology have been proposed (e.g. Rb-Sr, K-Ar), and even applied (K-Ar, Farley et al., 2014), the reliability, accuracy, and applicability of the 40Ar/39Ar method makes it by far the most desirable chronometer for dating extraterrestrial bodies. The method however relies on the neutron irradiation of samples, and thus a neutron source. We will discuss the challenges and feasibility of deploying a passive neutron source to planetary surfaces for the in situ application of the 40Ar/39Ar chronometer. Requirements in generating and shielding neutrons, as well as analyzing samples are discussed, along with an exploration of limitations such as mass, power, and cost. Two potential solutions for the in situ extraterrestrial deployment of the 40Ar/39Ar method will be presented. Although this represents a challenging task, developing the technology to apply the 40Ar/39Ar method on planetary surfaces would represent a major advance towards constraining the timescale of solar system formation and evolution.

  7. Modelo de interpretação da tomografia computadorizada de alta resolução do diagnóstico diferencial das doenças intersticiais crônicas High-resolution computed tomography interpretation model for differential diagnosis of chronic interstitial lung diseases

    Directory of Open Access Journals (Sweden)

    C. Isabela S. Silva

    2005-04-01

    Full Text Available O reconhecimento e o diagnóstico diferencial dos diversos padrões da tomografia computadorizada de alta resolução (TCAR são de fundamental importância na avaliação das doenças pulmonares difusas. Existem vários padrões de TCAR descritos na literatura, sendo alguns deles superponíveis. A interpretação desses padrões pode ser uma tarefa difícil, particularmente para residentes e radiologistas não especializados em tórax. Os autores ilustram os achados característicos da TCAR nas doenças pulmonares intersticiais crônicas e propõem um modelo simplificado de interpretação desses achados, baseado no padrão e na distribuição da doença. O algoritmo inclui os seis principais padrões de anormalidade identificados na TCAR: septal, reticular, cístico, nodular, de atenuação em vidro fosco e consolidação parenquimatosa.The recognition and differential diagnosis of the various patterns of abnormality seen on high-resolution computed tomography (HRCT are important in the evaluation of patients with chronic insterstitial lung diseases. Various patterns of abnormality have been described in the literature, which sometimes are overlapped. Distinction between the various patterns can be difficult particularly for residents and radiologists who are not familiarized with these images. The authors illustrate the characteristic patterns of abnormality seen in chronic interstitial lung diseases and propose a simple interpretation algorithm based on the pattern and distribution of the findings. The algorithm includes the six main patterns of abnormality seen on HRCT: septal lines, reticular pattern, cystic pattern, nodular pattern, ground-glass opacities and consolidation.

  8. Ars ornata / Kadri Mälk

    Index Scriptorium Estoniae

    Mälk, Kadri, 1958-

    1998-01-01

    V rahvusvaheline ehtekunsti konverents 'Ars ornata Europeana' juuni lõpus Stockholmis. New Yorgis elava kuraatori Charon Kranseni ja prantsuse ehtekunstniku Christophe Burger' juhitud vestlusringidest. 1997. a. Pariisis loodud International Craft Design Association'ist (ICDA).

  9. "Ars Ornata" Mediterrania / Kadri Mälk

    Index Scriptorium Estoniae

    Mälk, Kadri, 1958-

    1999-01-01

    VI rahvusvaheline ehtekunstinäitus "Ars Ornata" juuni lõpus Barcelonas. Konverentsist, peanäitusest (osalejad Eestist), ehtekunstiõpetust andvast kõrgkoolist Escola Massana'st Barcelonas, õppejõude. Eesti ehtekunsti tulevikust.

  10. ARS 01 Helsingi Kiasmas / Tarmo Virki

    Index Scriptorium Estoniae

    Virki, Tarmo

    2001-01-01

    Helsingis Kiasmas avatud rahvusvahelisest kunstinäitusest ARS 01 alapealkirjaga "Avanevaid perspektiive", kus esines oma töödega ka Marko Mäetamm. Näituse raames toimuvast Santiago Sierra kunstiprojektist kodututega

  11. Evapotranspiração máxima da cultura de pimentão em estufa plástica em função da radiação solar, da temperatura, da umidade relativa e do déficit de saturação do ar Maximum evapotranspiration of sweet pepper in plastic greenhouse as a function of solar radiation, temperature, relative humidity and water vapor pressure deficit of the air

    OpenAIRE

    Genei Antonio Dalmago; Arno Bernardo Heldwein; Astor Henrique Nied; Edenir Luis Grimm; Carina Rejane Pivetta

    2006-01-01

    Um experimento foi conduzido para avaliar a relação da evapotranspiração máxima (ETm) da cultura de pimentão por unidade de índice de área foliar (ETmf) com a radiação solar global incidente (Rg e) e saldo de radiação (Rn e), externos à estufa, e com a temperatura (t am), umidade relativa (URm) e déficit de saturação (D) do ar no interior da estufa. A ETm foi determinada por lisimetria. Apenas a temperatura e a umidade relativa do ar foram registradas e as demais variáveis foram estimadas. O ...

  12. Enterografia por tomografia computadorizada: experiência inicial na avaliação das doenças do intestino delgado CT enterography: a preliminary experience in the evaluation of small bowel diseases

    Directory of Open Access Journals (Sweden)

    Luciana Costa-Silva

    2010-10-01

    Full Text Available OBJETIVO: O objetivo deste estudo é demonstrar a importância da enterografia por tomografia computadorizada (entero-TC e como este exame pode contribuir na elucidação diagnóstica e avaliação clínica de pacientes com doenças do intestino delgado. MATERIAIS E MÉTODOS: Análise retrospectiva de 35 pacientes submetidos a entero-TC realizadas em aparelho multidetector de 16 canais, entre maio de 2008 e março de 2009. Utilizou-se meio de contraste iodado venoso e oral neutro (polietilenoglicol. As principais indicações foram avaliação de doença de Crohn, diarreia de origem indeterminada e suspeita de neoplasias. RESULTADOS: Houve boa correlação dos achados à entero-TC relacionados à atividade da doença em pacientes com doença de Crohn, quando comparados com dados clínicos, laboratoriais e endoscópicos. Em 15 casos identificaram-se alterações compatíveis com doença de Crohn, 9 deles sugerindo atividade. Dos pacientes com diarreia, o exame elucidou a maioria dos casos. Identificaram-se dois casos de tumor carcinoide. CONCLUSÃO: A entero-TC é método simples e eficaz para estudo das doenças inflamatórias/neoplásicas do intestino delgado, sobretudo na avaliação da doença de Crohn, indicando atividade da doença. Uma de suas principais vantagens é a possibilidade de avaliação de alterações mesentéricas e extraintestinais associadas.OBJECTIVE: The present study was aimed at demonstrating the value of computed tomography enterography (CT enterography and how this imaging method can be useful in the diagnostic elucidation and assessment of patients with small bowel diseases. MATERIALS AND METHODS: Retrospective evaluation of 35 patients submitted to CT enterography in a 16-row multidetector CT equipment from May/2008 to March/2009. All the patients received intravenous and neutral oral iodinated contrast agents (polyethylene glycol. Main indications were: Crohn's disease, diarrhea of undetermined origin and suspicion

  13. The mass of 32Ar and 33Ar for fundamental tests

    International Nuclear Information System (INIS)

    Masses of the short-lived radionuclides 32Ar (T1/2 = 98 ms) 33Ar (T1/2 = 173 ms) have been determined with the Penning trap mass spectrometer ISOLTRAP. Relative uncertainties of 6.0 x 10-8 (δm = 1.8 keV) and 1.4 x 10-8 (δm = 0.44 keV), respectively, have been achieved. At present, these new mass data serve as the most stringent test of the quadratic form of the isobaricmultiplet mass equation IMME. Furthermore, the improved accuracy for the mass of 32Ar yields a better constraint on scalar contributions to the weak interaction. New mass values have also been measured for 44Ar and 45Ar, and a 20σ deviation for 44Ar from the literature value was found and interpreted. (orig.)

  14. Dating blueschist metamorphism: a combined /sup 40/Ar//sup 39/Ar and electron microprobe approach

    Energy Technology Data Exchange (ETDEWEB)

    Sisson, V.B.; Onstott, T.C.

    1986-09-01

    /sup 40/Ar//sup 39/Ar and electron microprobe examination of blueschist samples from the Iceberg Lake schist, southern Alaska suggest that phengite inclusions are the source of /sup 40/Ar in crossite. Because such fine-grained inclusions may be susceptible to argon loss, caution should be exercised in interpreting K-Ar ages from this phase, and possibly other low-K amphiboles from blueschist suites. The estimated blocking temperature for phengite in the matrix (314/sup 0/ to 450/sup 0/C), however, is close to the estimated peak metamorphic temperatures (325/sup 0/ +- 50/sup 0/C), suggesting that phengite /sup 40/Ar//sup 39/Ar plateau dates may coincide closely with the time of blueschist metamorphism.

  15. The effects of retrograde reactions and of diffusion on 39Ar-40Ar ages of micas

    DEFF Research Database (Denmark)

    Allaz, Julien; Engi, Martin; Berger, Alfons;

    2011-01-01

    Effects of metamorphic reactions occurring during decompression were explored to understand their influence on 39Ar-40Ar ages of micas. Monometamorphic metasediments from the Lepontine Alps (Switzerland) were studied. Collected samples reached lower amphibolite facies during the Barrovian...... retrograde chlorite formation. We conclude that even very minor chloritisation of biotite is apparently a more effective parameter than temperature in resetting the Ar clock, as is the formation of plagioclase from paragonite decomposition. Multi-equilibrium thermobarometry is necessary to ensure that...

  16. Computed tomography image of the mediastinal and axillary lymph nodes in clinically sound Rottweilers Imagem por tomografia computadorizada dos linfonodos axilares e mediastinais de cães rottweilers clinicamente saudáveis

    Directory of Open Access Journals (Sweden)

    Ana Carolina B. Fonseca Pinto

    2013-03-01

    smallest diameter of the axillary and mediastinal lymph nodes not surpassed 7mm and 8mm respectively. Their attenuations were equal or smaller than that of musculature in the post contrast scan.A tomografia computadorizada é uma modalidade diagnóstica que possibilita a avaliação detalhada dos linfonodos e que é capaz de detectar mais precocemente alterações envolvendo estas estruturas, que modalidades de imagem como a radiografia e a ultrassonografia. Tendo em vista a escassez de informações na literatura veterinária esta pesquisa objetivou fornecer informações sobre os aspectos tomográficos normais dos linfonodos axilares e mediastinais em cães. Realizou-se o exame tomográfico de 15 cães adultos, machos e fêmeas, da raça Rottweiler, selecionados como clinicamente normais por meio de anamnese, exame físico, hemograma, perfil bioquímico renal e hepático, eletrocardiograma e exame radiográfico do tórax. Após a injeção intravenosa do contraste iodado hidrossolúvel iônico, realizaram-se cortes tomográficos transversais do tórax com 10mm de espessura e 10mm de incremento em um tomógrafo axial. Os exames tomográficos foram avaliados buscando-se identificar os linfonodos axilares e mediastinais. Quando visibilizados, os linfonodos foram mensurados em seu menor eixo e sua atenuação foi comparada com a da musculatura. Foram calculados a média e desvio padrão da idade, do peso, do comprimento dos animais e do menor eixo dos linfonodos axilares e mediastinais. A média de idade dos animais e o desvio padrão foram de 3,87 anos ±2,03, do peso foi de 41,13kg ± 5,12 e do comprimento dos animais foi de 89,61cm ±2,63. Os linfonodos axilares foram visibilizados em 60% dos animais, a média das mensurações dos menores diâmetros e o desvio padrão foi de 3,58mm ±2,02 com valor mínimo de 1mm e máximo de 7mm. Dos 13 linfonodos observados 61,53% apresentaram-se hipoatenuantes comparativamente a musculatura e 30,77% isoatenuantes. Os linfonodos

  17. 40Ar/39Ar age and thermal history of the Kirin chondrite

    International Nuclear Information System (INIS)

    The Kirin meteorite, a large (> 2800 kg) H5 chondrite, fell in Kirin Province, China in 1976. A sample from each of the two largest fragments (K-1. K-2) yield 40Ar/39Ar total fusion ages of 3.63 +- 0.02 b.y. and 2.78 +- 0.02 b.y. respectively. 40Ar/40Ar age spectra show typical diffusional argon loss profiles. Maximum apparent ages of 4.36 b.y. (K-1) and approx. 4.0 b.y. (K-2) are interpreted as possible minimum estimates for the age of crystallization of the parent body. (orig./ME)

  18. Ar-39-Ar-40 Evidence for Early Impact Events on the LL Parent Body

    Science.gov (United States)

    Dixon, E. T.; Bogard, D. D.; Garrison, D. H.; Rubin, A. E.

    2006-01-01

    We determined Ar-39-Ar-40 ages of eight LL chondrites, and one igneous inclusion from an LL chondrite, with the object of understanding the thermal history of the LL-chondrite parent body. The meteorites in this study have a range of petrographic types from LL3.3 to LL6, and shock stages from S1 to S4. These meteorites reveal a range of K-Ar ages from 23.66 to 24.50 Ga, and peak ages from 23.74 to 24.55 Ga. Significantly, three of the eight chondrites (LL4, 5, 6) have K-Ar ages of -4.27 Ga. One of these (MIL99301) preserves an Ar-39-Ar-40 age of 4.23 +/- 0.03 Ga from low-temperature extractions, and an older age of 4.52 +/- 0.08 Ga from the highest temperature extractions. In addition, an igneous-textured impact melt DOM85505,22 has a peak Ar-39-Ar-40 age of >= 4.27 Ga. We interpret these results as evidence for impact events that occurred at about 4.27 Ga on the LL parent body that produced local impact melts, reset the Ar-39-Ar-40 ages of some meteorites, and exhumed (or interred) others, resulting in a range of cooling ages. The somewhat younger peak age of 3.74 Ga from GR095658 (LL3.3) suggests an additional impact event close to timing of impact-reset ages of some other ordinary chondrites between 3.6-3.8 Ga. The results from MIL99301 suggest that some apparently unshocked (Sl) chondrites may have substantially reset Ar-39-Ar-40 ages. A previous petrographic investigation of MIL99301 suggested that reheating to temperatures less than or equal to type 4 petrographic conditions (600C) caused fractures in olivine to anneal, resulting in a low apparent shock stage of S1 (unshocked). The Ar-39-Ar-40 age spectrum of MIL99301 is consistent with this interpretation. Older ages from high-T extractions may date an earlier impact event at 4.52 +/- 0.08 Ga, whereas younger ages from lower-T extractions date a later impact event at 4.23 Ar-39-Ar-40 0.03 Ga that may have caused annealing of feldspar and olivine

  19. 40Ar - 39Ar dating of meteorites and the history of chondrite parent bodies

    International Nuclear Information System (INIS)

    The 40Ar-39Ar analyses of eleven ordinary chondrites and the unique meteorite Pontylyfni are presented. Results of previous 40Ar-39Ar age analyses have shown that the uncertainty in the calculated ages arises principally from the difficulties of interpretation of release patterns obtained from stepped heating experiments. For this reason considerable attention is paid to identifying the causes of complicating features in the age spectra. The ages obtained range from 4.52Ga to a lower limit of 4.38Ga and it is inferred that these date the time of cooling of the chondrites after formation and metamorphism. (author)

  20. Efeitos da temperatura e da movimentação do ar sobre o isolamento térmico do velo de ovinos em câmara climática Effect of temperature and air velocity on the thermal insulation of the fleece of sheep in climatic chamber

    OpenAIRE

    Alex Sandro Campos Maia; Roberto Gomes da Silva; Patrícia de Cássia Andrade

    2009-01-01

    Foram utilizados dez ovinos da raça Corriedale - cinco machos e cinco fêmeas com pesos entre 52,2 e 87,6 kg - com o objetivo de avaliar o efeito da combinação da movimentação do ar (0 e 5,0 m/s) com a temperatura do ar (25, 30 e 40ºC) sobre a temperatura retal (T R, ºC), da epiderme (T E, ºC), da superfície do velo (T V, ºC) e do interior do velo (T I, ºC) e a espessura do velo (E V, cm) e suas relações com o isolamento térmico do velo. A presença de vento não teve efeito sobre as variáveis e...

  1. Phytochemical and Biological Studies of <em>Agave em>attenuata>

    OpenAIRE

    Vincenzo De Feo; Muhammad Riaz; Nasir Rasool; Muhammad Zubair; Komal Rizwan; Muhammad Zia-Ul-Haq

    2012-01-01

    The present study was conducted to examine various biological activities of a methanol extract of <em>Agave attenuataem> leaves. GC-MS analysis of the <em>n>-hexane fraction from the extract revealed the presence of 31 compounds, with mono-2-ethylhexyl phthalate (11.37%), 1,2-benzenedicarboxylic acid (6.33%), <em>n>-docosane (6.30%) and eicosane (6.02%) as the major components. The leaves contained appreciable levels of total phenolic contents (10...

  2. 40Ar/39Ar ages in deformed potassium feldspar: evidence of microstructural control on Ar isotope systematics

    Science.gov (United States)

    Reddy, Steven M.; Potts, Graham J.; Kelley, Simon P.

    2001-05-01

    Detailed field and microstructural studies have been combined with high spatial resolution ultraviolet laser 40Ar/39Ar dating of naturally deformed K-feldspar to investigate the direct relationship between deformation-related microstructure and Ar isotope systematics. The sample studied is a ~1,000 Ma Torridonian arkose from Skye, Scotland, that contains detrital feldspars previously metamorphosed at amphibolite-facies conditions ~1,700 Ma. The sample was subsequently deformed ~430 Ma ago during Caledonian orogenesis. The form and distribution of deformation-induced microstructures within three different feldspar clasts has been mapped using atomic number contrast and orientation contrast imaging, at a range of scales, to identify intragrain variations in composition and lattice orientation. These variations have been related to thin section and regional structural data to provide a well-constrained deformation history for the feldspar clasts. One hundred and forty-three in-situ 40Ar/39Ar analyses measured using ultraviolet laser ablation record a range of apparent ages (317-1030 Ma). The K-feldspar showing the least strain records the greatest range of apparent ages from 420-1,030 Ma, with the oldest apparent ages being found close to the centre of the feldspar away from fractures and the detrital grain boundary. The most deformed K-feldspar yields the youngest apparent ages (317-453 Ma) but there is no spatial relationship between apparent age and the detrital grain boundary. Within this feldspar, the oldest apparent ages are recorded from orientation domain boundaries and fracture surfaces where an excess or trapped 40Ar component resides. Orientation contrast images at a similar scale to the Ar analyses illustrate a significant deformation-related microstructural difference between the feldspars and we conclude that deformation plays a significant role in controlling Ar systematics of feldspars at both the inter- and intragrain scales even at relatively low

  3. Acute pleuropulmonary complications detected by computed tomography following myocardial revascularization Cirurgia de revascularização do miocárdio: complicações pleuro-pulmonares agudas caracterizadas por tomografia computadorizada de tórax

    Directory of Open Access Journals (Sweden)

    Francisco S. Vargas

    2002-08-01

    Full Text Available INTRODUCTION: Pleuropulmonary changes are common following coronary artery bypass grafting surgery performed with a saphenous vein graft, with or without an internal mammary artery. The presence of atelectasis or pleural effusions reflects the thoracic trauma. PURPOSE: To define the postoperative incidence of changes in the lung and in the pleural space and to evaluate the influence of the trauma. METHODS: Thirty patients underwent elective coronary artery bypass grafting surgery (8 saphenous vein grafts and 22 saphenous vein grafts and internal mammary artery grafts with pleurotomy. Chest tubes in the left pleural space were used in all internal mammary artery patients. On the second (day 2 and seventh (day 7 postoperative day, patients underwent a computed tomography, and pleural effusions were rated as follows: grade 0 = no fluid to grade 4 = fluid in more than 75% of the hemithorax. Atelectasis was rated as follows: laminar = 1, segmental = 3, and lobar = 10 points. RESULTS: All patients had pleural effusion or atelectasis. Between day 2 and day 7, the number of patients with effusions or atelectasis on the right side decreased (P INTRODUÇÃO: O comprometimento pleuro-pulmonar é freqüente após cirurgia de revascularização do miocárdio independente do uso de veia safena ou de artéria mamária interna. A presença de atelectasias e derrame pleural tem sido atribuída ao trauma torácico. OBJETIVOS: Definir a incidência do comprometimento pleuro-pulmonar observado através de tomografia computadorizada, analisando a influência do trauma no desenvolvimento destas complicações. MÉTODOS: Trinta pacientes foram submetidos a cirurgia eletiva de revascularização do miocárdio (8 safena e 22 também mamária com pleurotomia. Foi drenada a cavidade pleural esquerda de todos os pacientes do grupo mamária. Realizada Tomografia Computadorizada do tórax no 2º e 7º dias pós-op, avaliando-se o derrame pleural (0: sem líquido e 4: derrame

  4. The thermal significance of potassium feldspar K-Ar ages inferred from 40Ar/39Ar age spectrum results

    International Nuclear Information System (INIS)

    40Ar/39Ar age spectrum analyses of three microcline separates from the Separation Point Batholith, northwest Nelson, New Zealand, which cooled slowly through the temperature zone of partial radiogenic 40Ar accumulation are characterized by a linear age increase over the first 65 percent of gas release with the lowest ages corresponding to the time that the samples cooled below about 1000C. The last 35 percent of 39Ar released from the microclines yields plateau ages which reflect the different bulk mineral ages, and correspond to cooling temperatures between about 130 to 1600C. Theoretical calculations confirm the likelihood of diffusion gradients in feldspars cooling at rates =0C-Ma-1. Diffusion parameters calculated from the 39Ar release yield an activation energy, E = 28.8 +- 1.9 kcal-mol-1, and a frequency factor/grain size parameter, D0/l2 = 5.6sub(-3.9)sup(+14) sec-1. This Arrhenius relationship corresponds to a closure temperature of 132 +- 130C which is very similar to the independently estimated temperature. From the observed diffusion compensation correlation, this D0/l2 implies an average diffusion half-width of about 3 μm, similar to the half-width of the perthite lamellae in the feldspars. The results are discussed. (author)

  5. Polineuropatia periférica arsenical: tratamento com penicilamina. Dosagem de arsênico inorgânico em nervo periférico, sangue e urina Arsenical peripheral polyneuropathy: treatment with penicillamine and determination of the concentrations of inorganic arsenic in peripheral nerve, blood, and urine. A case report

    Directory of Open Access Journals (Sweden)

    Abrão Anghinah

    1974-09-01

    Full Text Available Os autores registram caso de paciente na qual, após intoxicação aguda por arsênico inorgânico, instalou-se quadro de polineuropatia periférica. Foram verificadas altas concentrações de arsênico no nervo periférico estudado (1,48 mg/100 g peso seco, e 0,49 mg/100 g peso fresco e na urina. Antes do tratamento com penicilamina a quantidade de arsênico excretada na urina era de 80,0 micro/100 ml; após 7 dias de tratamento a excreção passou a ser de 150,2 micrograma/100 ml. Estes resultados bioquímicos foram acompanhados de progressiva melhora clínica.Report of a case of acute intoxication by inorganic arsenic with a picture of peripheral polyneuropathy. High concentrations of arsenic were found in the peripheral nerve studied (1.48 mg/100 g fresh tissue; 0,40 mg/100 g dry tissue blood and urine. Before the treatment with penicillamine the urinary concentration of arsenic was 80,0 micrograms/100 ml; 7 days after the onset of treatment the excretion increased to 150.2 micrograms/100 ml. Improvement of the clinical conditions was parallel to these biochemical results.

  6. Imagem em tuberculose pulmonar Pulmonary tuberculosis imaging

    Directory of Open Access Journals (Sweden)

    SIDNEY BOMBARDA

    2001-11-01

    Full Text Available A tuberculose é uma doença de alta incidência e prevalência no Brasil. Sinais sugestivos de atividade ou seqüela da tuberculose podem ser obtidos através dos métodos de imagem. Na radiografia de tórax, a tuberculose pulmonar ativa pode manifestar-se sob a forma de consolidações, cavitações, padrões intersticiais (reticulares/retículo-nodulares, linfonodomegalias hilares ou mediastinais e derrame pleural. Imagens compatíveis com doença ativa, como nódulos centrolobulares de distribuição segmentar, cavidades de paredes espessas, espessamento de parede brônquica ou bronquiolar, bronquiectasias e linfonodomegalias, podem ser observadas pela tomografia computadorizada do tórax; cavidades de paredes finas, bronquiectasias de tração e estrias são imagens sugestivas de seqüela da doença, assim como o enfisema e o aspecto em mosaico do parênquima pulmonar. A cintilografia com o citrato de gálio-67 é um método complementar útil na detecção de processos infecciosos, incluindo a tuberculose, especialmente em pacientes imunossuprimidos. Estudos de inalação e perfusão pulmonar são utilizados na avaliação pré-operatória de pacientes com seqüelas de tuberculose ou tuberculose multirresistente. A tomografia por emissão de pósitrons utilizando a deoxiglicose marcada com o flúor-18 permite a detecção do processo inflamatório que ocorre na fase ativa da tuberculose e que pode persistir, em menor intensidade, após o término do tratamento. Métodos de imagem constituem importantes recursos para o diagnóstico e acompanhamento da tuberculose pulmonar.Tuberculosis is a disease of high incidence and prevalence in Brazil. Imaging methods can reveal signs suggestive of tuberculosis activity or sequelae. Chest radiographs can reveal active lung tuberculosis through consolidations, cavitations, interstitial patterns (nodular and reticulo-nodular, mediastinal or hilar lymphadenopathy and pleural effusions. Images compatible

  7. Distrofia em forma-de-borboleta: relato de caso Butterfly-shaped pattern dystrophy: case report

    Directory of Open Access Journals (Sweden)

    David Leonardo Cruvinel Isaac

    2007-02-01

    Full Text Available Os autores apresentam um caso de distrofia macular em forma-de-borboleta, diagnosticado em paciente do sexo masculino, apresentando concomitante atrofia do epitélio pigmentado da retina e perda visual central em um dos olhos. Os achados relatados contrariam conceitos inicialmente disponíveis de curso sempre benigno da doença. A lesão característica e bem delimitada no pólo posterior e a angiofluoresceinografia, permitiram estabelecer o diagnóstico. Descreve-se ainda, pela primeira vez, os achados da distrofia em forma-de-borboleta à tomografia de coerência óptica.The authors present a case of butterfly-shaped pattern dystrophy diagnosed in a male patient, with retinal pigmented epithelium atrophy and central visual acuity decrease in one of the eyes. The evolution of this case was not benign as described in previous reports. A well-defined lesion located in the posterior pole of both eyes associated with fluorescein angiography allowed the diagnosis of this pattern dystrophy. Optical coherence tomography was performed, showing the aspects of the pathology, for the first time.

  8. Sinais de uretelolitíase na tomografia computadorizada helicoidal sem contraste: ensaio iconográfico e revisão de literatura Ureterolithiasis signs on unenhanced helical computed tomography: iconographic essay and literature review

    OpenAIRE

    Renata La Rocca Vieira; Salomão Faintuch; Suzan Menasce Goldman; Sérgio Aron Ajzen; Jacob Szejnfeld

    2004-01-01

    O principal sinal diagnóstico de ureterolitíase na tomografia computadorizada é a visualização direta do cálculo no interior do ureter. Todavia, a sua caracterização pode ser prejudicada devido a suas pequenas dimensões, variação da respiração entre a aquisição dos cortes tomográficos, escassez de gordura retroperitoneal ou eliminação recente do cálculo. Neste contexto, foram descritos diversos sinais secundários de obstrução ureteral, observados na tomografia computadorizada, que podem auxil...

  9. Tomografia computadorizada de alta resolução nas complicações pulmonares pós-transplante de medula óssea: ensaio iconográfico High-resolution computed tomography findings in pulmonary complications after bone marrow transplantation: iconographic essay

    Directory of Open Access Journals (Sweden)

    Emerson L. Gasparetto

    2005-12-01

    Full Text Available O transplante de medula óssea (TMO tem sido utilizado como tratamento de escolha para diversas doenças hematológicas. Entretanto, as complicações pulmonares, que podem ocorrer em até 60% dos pacientes, são o principal motivo de falha no tratamento. As complicações pulmonares pós-TMO podem ser divididas em três fases, de acordo com a imunidade do paciente. Na primeira fase, até 30 dias após o procedimento, predominam as complicações não infecciosas e as pneumonias fúngicas. Na fase precoce, que vai até o 100º dia pós-TMO, as infecções virais, principalmente por citomegalovírus, são mais comuns. Finalmente, na fase tardia pós-TMO, complicações não infecciosas como bronquiolite obliterante com pneumonia em organização e doença do enxerto contra o hospedeiro são mais comumente observadas. Os autores apresentam um ensaio iconográfico, enfatizando os aspectos de tomografia de alta resolução em pacientes com complicações pulmonares pós-TMO.Bone marrow transplantation has been the treatment of choice for many hematologic diseases. However, pulmonary complications, which may occur in up to 60% of the patients, are the main cause of treatment failure and may be divided in three phases according to the patient's immunity. In the first phase, up to 30 days after the procedure, there is a predominance of non-infectious complications and fungal pneumonia. Viral infections, mainly by cytomegalovirus, are common in the second phase (up to 100 days after bone marrow transplantation. Finally, in the late phase after bone marrow transplantation, non-infectious complications as bronchiolitis obliterans organizing pneumonia and graft-versus-host disease are most commonly seen. The authors present a pictorial essay of the high-resolution computed tomography findings in patients with pulmonary complications after bone marrow transplantation.

  10. Acurácia da mensuração do enfisema pulmonar na tomografia computadorizada: pontos importantes Accuracy of measurement of pulmonary emphysema with computed tomography: relevant points

    Directory of Open Access Journals (Sweden)

    Bruno Hochhegger

    2010-08-01

    Full Text Available Para garantir a confiabilidade dos dados de quantificação computadorizada do enfisema pulmonar (densitovolumetria pulmonar na tomografia computadorizada, alguns aspectos técnicos devem ser considerados. A alteração das densidades na tomografia computadorizada com as mudanças no nível de inspiração e expiração do pulmão, com a espessura de corte da tomografia computadorizada, com o algoritmo de reconstrução e com o tipo de tomógrafo dificulta as comparações tomográficas nos estudos de acompanhamento do enfisema pulmonar. No entanto, a densitovolumetria pulmonar substituiu a avaliação visual e compete com as provas de função pulmonar como método para medir o enfisema pulmonar. Esta revisão discute as variáveis técnicas que alteram a aferição do enfisema na tomografia computadorizada e sua influência nas medições de enfisema.Some technical aspects should be taken into consideration in order to guarantee the reliability of the assessment of pulmonary emphysema with lung computed tomography densitometry. Changes in lung density associated with variations in lungs inspiratory and expiratory levels, computed tomography slice thickness, reconstruction algorithm and type of computed tomography apparatus make tomographic comparisons more difficult in follow up studies of pulmonary emphysema. Nevertheless, quantitative computed tomography has replaced the visual assessment competing with pulmonary function tests as a sensitive method to measure pulmonary emphysema. The present review discusses technical variables of lung computed tomography and their influence on measurements of pulmonary emphysema.

  11. ArDroneXT - Ar.Drone 2 eXTension for swarming and service hosting

    OpenAIRE

    Autefage, Vincent; Chaumette, Serge

    2013-01-01

    This report explains how to upgrade an Ar.Drone 2 for swarming and services hosting. In other words, it gives the technical information required to easily create a swarm of Ar.Drone 2 sharing a Wi-Fi network. Moreover, it describes the process to install new services and applications on the drone.

  12. A Refined Astronomically Calibrated 40Ar/39Ar Age for Fish Canyon Sanidine

    DEFF Research Database (Denmark)

    Rivera, Tiffany; Storey, Michael; Zeeden, Christian; Hilgen, Frederik; Kuiper, Klaudia

    sanidine age of 0.7674±0.0022 Ma (2σ, external errors) is indistinguishable from the ID-TIMS U/Pb zircon age (0.7671±0.0019 Ma). The consistency between the astronomically calibrated 40Ar/39Ar sanidine age and U/Pb zircon age for this Quaternary unit suggests that agreement between these two radio...

  13. 39Ar-40Ar dating of mesosiderites: Evidence for major parent body disruption < 4 Ga ago

    International Nuclear Information System (INIS)

    39Ar-40Ar ages were measured on 17 samples of 14 different mesosiderites and indicate major degassing of Ar by one or more thermal events less than 4.0 Ga ago. Three samples gave release patterns of constant age, whereas the other samples typically showed 200-400 Ma increases in 39Ar-40Ar age with increasing gas extraction temperature. These stepwise releases indicate ages of ∼3.4-3.8 Ga; averaged ages for individual meteorites are 3.45-3.82 Ga. No substantial evidence exists in the temperature releases for 39Ar-40Ar ages older than 4.0 Ga, and the Ar ages appear to be in contradiction to 244Pu fission track ages previously reported for a few mesosiderites. We suggest that metal-silicate mixing occurred ∼4.4 Ga ago, but that a major collisional event disrupted the mesosiderite parent planet 500 degree C, and left them deeply buried to undergo slow cooling

  14. K/Ar ages from basal gneiss region

    International Nuclear Information System (INIS)

    K/Ar and 40Ar/39Ar geochronology of minerals from the Stadlandet region, Norway, is complicated by the presence of excess 40Ar in many samples. There is a correlation between excess 40Ar concentration and textural occurrence of samples. Amphiboles and micas closely accociated with eclogite pods are likely to contain significant concentrations of excess 40Ar, while samples from the country rocks are not. K/Ar and 40Ar/39Ar ages for hornblende from the country rocks suggest that post-metamorphic cooling through 5000C occured about 410 Ma ago, shortly after eclogite formation. Biotites containing no excess 40Ar cooled through 3000C about 370 Ma ago. A post-metamorphic cooling rate of about 50C/Ma can be inferred

  15. Correlação entre hipótese diagnóstica e laudo de tomografia axial computadorizada craniana Correlation between diagnostic hypothesis and result of cranial computed axial tomography

    Directory of Open Access Journals (Sweden)

    Edison Matos Nóvak

    2001-09-01

    Full Text Available Para avaliar a utilização da tomografia axial computadorizada craniana (TC em nosso meio, analisamos as solicitações de 367 exames consecutivos no período compreendido entre 07/1995 e 07/1996. Houve ampla variação da faixa etária, com média de 31,7 ± 22,9 anos. As especialidades que mais solicitaram o exame foram: Neurologia (36,2%, Pronto Atendimento (17,4%, Neuropediatria (16,9% e Clínica Médica (5,9%. As indicações mais frequentes para o exame foram: convulsão (30%, cefaléia (26,2%, déficit motor (20,2% e redução do nível de consciência (16,9%. As "hipóteses" aventadas com maior frequência foram: afastar lesão estrutural (9,0%, acidente vascular não discriminado (8,2% e neurocisticercose (8,2%. O laudo da TC foi normal em 50,4% dos exames. Os laudos anormais mais frequentes foram: hidrocefalia (5,4%, acidente vascular isquêmico (5,4% e neoplasia (3,5%. As maiores taxas de achados normais foram encontradas nas "hipóteses" de cefaléia (94,4%, convulsão (71,4% e afastar lesão estrutural (66,7%. Os maiores índices de acerto entre hipótese e laudo foram encontrados nas situações de "afastar lesões estruturais" (66,7%, hidrocefalia (50%, acidente vascular cerebral isquêmico (50% e hematoma (50%. Concluimos que a utilização de um recurso auxiliar de diagnóstico como a TC cumpre melhor ainda a sua função se o requisitante do exame preencher com clareza e detalhamento o pedido do exame.The use of computed axial tomography (CT in the investigation of neurologic disorders is attractive for his disponibility in the health services. However, the indications of the exam and the correlation with the clinical features has not been frequently studied. We study correlation between the requests of CT and the findings reported by the radiologist, in 367 exams performed from 07/1995 to 07/ 1996. The mean age was 31.7 ± 22.9 years. The CT were requested in decrescent order of frequency by the Services of Neurology (36

  16. Ar-41 measurements and nuclear emergency preparedness

    International Nuclear Information System (INIS)

    During the early phase of an emergency is necessary to confirm the release of radioactivity predictions made by the operator of the nuclear plant. In this context, it has begun measuring Ar-41 in the vicinity of a research reactor. Since the Ar-41 is produced in the reactor, it has been studied as a good way to validate the air dispersion model used in nuclear emergencies and to develop a method to improve the characterization of the release. For this latter purpose a pilot experiment was conducted to determine computational and experimental methods, the flux of 1.29 MeV of Ar-41 and compared to evaluate the accuracy of the assessments made. This paper describes meteorological forecasting systems used in the experiment, the estimate of the stability class and the concentration of nuclides using a calculation code developed by the ARN, as well as the methodology and equipment used for measurement in the field. (authors)

  17. Análise do diâmetro transverso do processo odontoide com uso da tomografia computadorizada Análisis del diámetro transverso del proceso odontoides con uso de la tomografía computarizada Analysis of the transverse diameter in the odontoid process by computerized tomography

    Directory of Open Access Journals (Sweden)

    Fábio Kazuo Soejima

    2010-12-01

    Full Text Available INTRODUÇÃO: o diâmetro reduzido do odontoide é um desafio para o cirurgião no planejamento pré-operatório e escolha na fixação da fratura com um ou dois parafusos. OBJETIVO: analisar a medida do diâmetro transverso (DT do processo odontoide por meio da tomografia computadorizada para o planejamento pré-operatório da osteossíntese com um ou dois parafusos. MÉTODOS: foram analisadas 79 tomografias computadorizadas cervicais de pacientes adultos, sem deformidades congênitas ou queixas de dor em coluna cervical alta, atendidos em uma clínica privada de Blumenau - Santa Catarina. RESULTADOS: as médias de idade não revelaram diferença estatisticamente significante entre os sexos, mas observou-se diferença estatisticamente significante entre as médias do DT do odontoide de homens e mulheres. A média do diâmetro transverso nos homens foi de 10,29 mm, e nas mulheres de 9,39 mm. CONCLUSÃO: a tomografia computadorizada mostrou-se útil para a medição do diâmetro transverso do processo odontoide. A fixação com um parafuso cortical de 3,5 mm seria possível em todos os casos analisados e a fixação com dois parafusos seria possível em 83,9% dos homens e 62,5% das mulheres.INTRODUCCIÓN: el diámetro reducido de la odontoides es un desafío para el cirujano en la planificación pre-operatoria y de la elección en la fijación de la fractura con uno o dos tornillos. OBJETIVO: analizar la medida del diámetro transverso (DT del proceso odontoides, por medio de la tomografía computarizada para el planeamiento pre-operatorio de la osteosíntesis con uno o dos tornillos. MÉTODOS: fueron analizadas 79 tomografías computarizadas cervicales de pacientes adultos, sin deformidades congénitas o reclamos de dolor en la columna cervical alta, atendidos en una clínica privada de Blumenau - Santa Catarina, Brasil. RESULTADOS: los promedios de edad no revelaron diferencia estadísticamente significante entre los sexos, pero se observ

  18. Efeitos da temperatura e da movimentação do ar sobre o isolamento térmico do velo de ovinos em câmara climática Effect of temperature and air velocity on the thermal insulation of the fleece of sheep in climatic chamber

    Directory of Open Access Journals (Sweden)

    Alex Sandro Campos Maia

    2009-01-01

    Full Text Available Foram utilizados dez ovinos da raça Corriedale - cinco machos e cinco fêmeas com pesos entre 52,2 e 87,6 kg - com o objetivo de avaliar o efeito da combinação da movimentação do ar (0 e 5,0 m/s com a temperatura do ar (25, 30 e 40ºC sobre a temperatura retal (T R, ºC, da epiderme (T E, ºC, da superfície do velo (T V, ºC e do interior do velo (T I, ºC e a espessura do velo (E V, cm e suas relações com o isolamento térmico do velo. A presença de vento não teve efeito sobre as variáveis estudadas, o que sugere que fluxo de ar (40ºC o fluxo de calor sensível não foi significativa.Ten Corriedale sheep were evaluated, five males and five females with 52.2 to 87.6 kg of body weight, to evaluate the effect of air velocity (0 and 5 m/s and temperature (25, 30 and 40ºC on rectal temperature (T R, ºC, skin temperature (T E, ºC, fleece surface temperature (T V, ºC, temperature inside the fleece (T I, ºC, and fleece thickness (E V, cm and their relationship with fleece thermal insulation. The results showed that air velocity did not affect the studied traits, suggesting that airflow 40°C, the sensible heat flow was not significant.

  19. Improved Ar(II) transition probabilities

    OpenAIRE

    Danzmann, K.; de Kock, M

    1986-01-01

    Precise Ar(II) branching ratios have been measured on a high current hollow cathode with a 1-m Fourier transform spectrometer. Absolute transition probabilities for 11 Ar(II) lines were calculated from these branching ratios and lifetime measurements published by Mohamed et al. For the prominent 4806 Å line, the present result is Aik = 7.12×107s-1 ±2.8%, which is in excellent agreement with recent literature data derived from pure argon diagnostics, two-wavelength-interferometry, and Hβ-diagn...

  20. Online Scene Modeling for Interactive AR Applications

    OpenAIRE

    Yoo, Jaesang; Cho, Kyusung; Jung, Jinki; Yang, Hyun S.

    2010-01-01

    Augmented reality applications require 3D model of environment to provide even more realistic experience. Unfortunately, however, most of researches on 3D modeling have been restricted to an offline process up to now, which conflicts with characteristics of AR such as realtime and online experience. In addition, it is barely possible not only to generate 3D model of whole world in advance but also trasfer the burden of 3D model generation to a user, which limits the usability of AR. Thus, it ...

  1. AR-扩增实境

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    1、什么是AR-扩增实境?AR-扩增实境(Augmented Reality,简称AR),简单地说,就是把虚拟的物体和现实的场景进行嫁接。这是一种实时地计算摄影机影像的位置及角度并加上相应图像的技术,这种技术的目标是在屏幕上把虚拟世界套在现实世界并进行互动。

  2. Penning ionization : In benzene · Ar and fluorobenzene · Ar van der waals molecules and in collisions of benzene with metastable Ar atoms

    Science.gov (United States)

    Rühl, E.; Bisling, P.; Brutschy, B.; Beckmann, K.; Leisen, O.; Morgner, H.

    1986-08-01

    The photoion efficiency curves of the van der Waals complexes benzene ·Ar (Bz·Ar) and fluorobenzene·Ar (Fb·Ar) exhibit sharp resonances, which correspond to excitation to the Ar 2P 3/24s and 2P 1/24s resonance states. The peaks are redshifted relative to their asymptotic values (Bz·Ar, Δ E = -70 ± 10 meV; Fb·Ar, Δ E = -40 ± 10 meV). These findings are supported by electron spectroscopy studies of the Penning ionization of benzene by state-selected metastable Ar ( 3p 2, 3p 0) atoms. Strong evidence is presented that Penning ionization is the process observed in both cases.

  3. Comparative 40Ar/39Ar and K-Ar dating of illite-type clay minerals: A tentative explanation for age identities and differences

    Science.gov (United States)

    Clauer, Norbert; Zwingmann, Horst; Liewig, Nicole; Wendling, Raymond

    2012-10-01

    The 40K/40Ar (K-Ar) and 40Ar/39Ar dating methods are applied here to the same, very small, micrometric illite-type particles that crystallized under low-temperature (samples with a total of fifteen size fractions from advantages, such as the plateaus obtained by incremental step heating of the various size fractions, even if not translatable straight as ages of the illite populations; they allow identification of two generations of authigenic illite that formed at about 200 and 175 Ma, and one detrital generation. However, 40Ar/39Ar dating of clay minerals remains challenging as technical factors, such as the non-standardized encapsulation, may have potential unexpected effects. Both dating methods have their limitations: (1) K-Ar dating requires relatively large samples (ca. 10-20 mg) incurring potential sample homogeneity problems, with two aliquots required for K and Ar analysis for an age determination, also inducing a higher analytical uncertainty; (2) an identified drawback of 40Ar/39Ar dating is Ar recoil and therefore potential loss that occurs during neutronic creation of 39Ar from 39K, mostly in the finer mineral particles. If all the recoiled 39Ar is redistributed into adjacent grains/minerals, the final 40Ar/39Ar age of the analyzed size fraction remains theoretically identical, but it is not systematic in clay-type material. The finest grain sizes (e.g., convenient and straightforward use supported by a standardized and well-controlled technical approach. The present comparison of the two Ar-dating methods as applied to clay material shows that neither method is presently outdated, and that they are even of reciprocal use. Both methods have distinct application fields in clay geochronology and complementary application fields in clay crystallography.

  4. Padronização de um método para mensuração das tábuas ósseas vestibular e lingual dos maxilares na Tomografia Computadorizada de Feixe Cônico (Cone Beam Methodology standardization for measuring buccal and lingual alveolar bone plates using Cone Beam Computed Tomography

    Directory of Open Access Journals (Sweden)

    Marcos Cezar Ferreira

    2010-02-01

    Full Text Available INTRODUÇÃO: a espessura das tábuas ósseas que recobrem os dentes por vestibular e lingual constitui um dos fatores limitantes da movimentação dentária. O avanço tecnológico em Imaginologia permitiu avaliar detalhadamente essas regiões anatômicas por meio da utilização da tomografia computadorizada de feixe cônico (TCFC. OBJETIVO: descrever e padronizar, pormenorizadamente, um método para mensuração das tábuas ósseas vestibular e lingual dos maxilares nas imagens de tomografia computadorizada de feixe cônico. METODOLOGIA: a padronização digital da posição da imagem da face deve constituir o primeiro passo antes da seleção dos cortes de TCFC. Dois cortes axiais de cada maxilar foram empregados para a mensuração da espessura do osso alveolar vestibular e lingual. Utilizou-se como referência a junção cemento-esmalte dos primeiros molares permanentes, tanto na arcada superior quanto na inferior. RESULTADOS: cortes axiais paralelos ao plano palatino foram indicados para avaliação quantitativa do osso alveolar na maxila. Na arcada inferior, os cortes axiais devem ser paralelos ao plano oclusal funcional. CONCLUSÃO: o método descrito apresenta reprodutibilidade para utilização em pesquisas, assim como para a avaliação clínica das repercussões periodontais da movimentação dentária, ao permitir a comparação de imagens pré e pós-tratamento.INTRODUCTION: The thickness of the buccal and lingual bone plates constitutes one of the limiting factors of the orthodontic movement. The imaging technology has permitted the evaluation of this anatomical region, by means of cone beam computed tomography. PURPOSE: To describe and standardize, in details, a method for measuring the buccal and lingual bone plate thickness in CBCT images. METHODOLOGY: Digital standardization of face image should constitute the first step before the selection of CBCT slices. Two axial sections of each jaw were used for measuring the thickness

  5. Collective dipole response of proton-rich nuclei 32Ar and 34Ar

    International Nuclear Information System (INIS)

    The earlier observation of low-lying dipole strength in neutron rich nuclei and its interpretation with respect to basic nuclear properties (symmetry energy, skin thickness) initiated the investigation of this phenomenon in proton-rich nuclei. Macroscopically this strength could be explained with the resonant dipole oscillation of a proton skin against the isospin-symmetric core. For nuclei like 32Ar the occurrence of pronounced dipole strength is predicted in the low-energy region between 8-10 MeV excitation energy. For the 34Ar the pygmy strength is expected to drop sharply and vanish entirely for the N=Z nucleus 36Ar. The experiment S327 has been performed in August 2008 at the GSI Darmstadt in Cave C using the LAND reaction setup. Fragmentation of a 800 A MeV primary 36Ar beam on a Be target was used to produce the radioactive isotopes 34Ar and 32Ar. After passing the FRS (Fragment Separator) the ions impinged on a Pb target. The dipole response is observed using the Coulomb excitation method in inverse kinematics. The concept and the experimental method will be shown in the context of the underlying physics case in 32,34Ar.

  6. Modification of stearic acid in Ar and Ar-O2 pulsed DC discharges

    International Nuclear Information System (INIS)

    Stearic acid (C18H36O2) was treated into Ar and Ar-O2(10%) pulsed DC discharge created by a cathode-anode confined system. The samples were placed at the floating potential. The results show that the mass variation of the stearic acid samples after Ar-O2 plasma exposure is more important than the pure Ar plasma treatments. This comportment demonstrate that the oxygen actives species (O and O2 in all states) strongly enhance the etching process with regards to A* species, regardless of their concentration. After treatment by Ar and Ar-O2 plasma, analyses by X-ray diffraction show a significant structural modification of the samples surface, utilizing Ar-O2 plasma the modification was more pronounced. The chemical composition evolution shows that the acid function is etched preferentially in the beginning of the treatment (about 5 min) and that after 10 min the carbonic chains seems to be functionalized by oxygen. (author)

  7. Study of Ar and Ar-CO2 microwave surfaguide discharges by optical spectroscopy

    Science.gov (United States)

    Silva, Tiago; Britun, Nikolay; Godfroid, Thomas; van der Mullen, Joost; Snyders, Rony

    2016-05-01

    A surfaguide microwave discharge operating at 2.45 GHz in Ar and Ar-CO2 mixtures is studied using diagnostics methods based on optical emission spectroscopy. The population densities of Ar metastable and resonant states of the lowest group of excited levels ( 1 s x ) are investigated for several experimental conditions using the self-absorption technique. It is found that the densities of these levels, ranging from 1017 to 1016 m-3 for the pure Ar case, are dependent on the discharge pressure and applied power. The electron temperature and electron density are calculated via the balances of creation/loss mechanisms of radiative and metastable levels. In the range of the studied experimental conditions (50-300 W of applied power and 0.5-6 Torr of gas pressure), the results have shown that lower values of electron temperature correspond to higher values of power and pressure in the discharge. Adding CO2 to the argon plasma results in a considerable decrease (about 3 orders of magnitude) of the Ar metastable atom density. The feasibility of using the ratio of two Ar emission line intensities to measure the electron temperature in CO2 discharges with small Ar admixtures is studied.

  8. Potassium Isotopic Compositions of NIST Potassium Standards and 40Ar/39Ar Mineral Standards

    Science.gov (United States)

    Morgan, Leah; Tappa, Mike; Ellam, Rob; Mark, Darren; Higgins, John; Simon, Justin I.

    2013-01-01

    Knowledge of the isotopic ratios of standards, spikes, and reference materials is fundamental to the accuracy of many geochronological methods. For example, the 238U/235U ratio relevant to U-Pb geochronology was recently re-determined [1] and shown to differ significantly from the previously accepted value employed during age determinations. These underlying values are fundamental to accurate age calculations in many isotopic systems, and uncertainty in these values can represent a significant (and often unrecognized) portion of the uncertainty budget for determined ages. The potassium isotopic composition of mineral standards, or neutron flux monitors, is a critical, but often overlooked component in the calculation of K-Ar and 40Ar/39Ar ages. It is currently assumed that all terrestrial materials have abundances indistinguishable from that of NIST SRM 985 [2]; this is apparently a reasonable assumption at the 0.25per mille level (1s) [3]. The 40Ar/39Ar method further relies on the assumption that standards and samples (including primary and secondary standards) have indistinguishable 40K/39K values. We will present data establishing the potassium isotopic compositions of NIST isotopic K SRM 985, elemental K SRM 999b, and 40Ar/39Ar biotite mineral standard GA1550 (sample MD-2). Stable isotopic compositions (41K/39K) were measured by the peak shoulder method with high resolution MC-ICP-MS (Thermo Scientific NEPTUNE Plus), using the accepted value of NIST isotopic SRM 985 [2] for fractionation [4] corrections [5]. 40K abundances were measured by TIMS (Thermo Scientific TRITON), using 41K/39K values from ICP-MS measurements (or, for SRM 985, values from [2]) for internal fractionation corrections. Collectively these data represent an important step towards a metrologically traceable calibration of 40K concentrations in primary 40Ar/39Ar mineral standards and improve uncertainties by ca. an order of magnitude in the potassium isotopic compositions of standards.

  9. Hazard evaluation for 244-AR vault facility

    International Nuclear Information System (INIS)

    This document presents the results of a hazard identification and evaluation performed on the 244-AR Vault Facility to close a USQ (USQ No. TF-98-0785, Potential Inadequacy in Authorization Basis (PIAB): To Evaluate Miscellaneous Facilities Listed in HNF-2503 And Not Addressed In The TWRS Authorization Basis) that was generated as part of an evaluation of inactive TWRS facilities

  10. "ARS 01", perspektiivide avamine / Helen Kivisoo

    Index Scriptorium Estoniae

    Kivisoo, Helen

    2001-01-01

    30. IX 2001-20. I 2002 Kiasmas kuuendat korda toimuvast rahvusvahelisest näitusest "ARS", kus Eestist osaleb Marko Mäetamm. Kuraatorid Tuula Arkio, Maaretta Jaukkuri, Patrik Nyberg, Jari-Pekka Vanhala. Teemaks "kolmas ruum". Näituse kajastamisest.

  11. Lignocellulosic Biofuels: Bioenergy Research at ARS

    Science.gov (United States)

    The growth and long-term viability of bioenergy production in the Nation are impeded by a number of technical and commercial barriers. Agricultural Research Service (ARS) addresses technical barriers and does so by leveraging its strengths and unique capabilities to (1) pursue technical barriers th...

  12. Ionization of Argon n=2 (Ar+9 to Ar+16) by a 'relativistic' laser field

    International Nuclear Information System (INIS)

    The high field photoionization cross sections for the (n=2) shell of argon were measured with pulsed 800 nm radiation (27±5 fs duration) at an intensity of 1.5x1019 W/cm2±1x1019 W/cm2. The pondermotive energy for an electron at these field intensities is approximately 1 MeV. The best agreement with a calculated AC tunneling model was at an intensity of 0.6x1019 W/cm2. The difference between experimental and calculated relative charge state yields is less than an order of magnitude for Ar+9 to Ar+14 and Ar+16

  13. A compilation of 40Ar-39 and K-Ar ages: report 25

    International Nuclear Information System (INIS)

    Twenty-three 40Ar-39Ar age determinations (including two potassium-argon analyses) carried out by the Geological Survey of Canada are reported. Each age determination is accompanied by a description of the rock and mineral concentrate used; brief interpretative comments regarding the geological significance of each age are also provided where possible. The experimental procedures employed are described in outline. An index of all Geological Survey of Canada K-Ar age determinations published in this format has been prepared using NTS quadrangles as the primary reference. (author). 6 refs., 2 tabs., 1 fig

  14. The ChArMEx database

    Science.gov (United States)

    Ferré, Hélène; Belmahfoud, Nizar; Boichard, Jean-Luc; Brissebrat, Guillaume; Cloché, Sophie; Descloitres, Jacques; Fleury, Laurence; Focsa, Loredana; Henriot, Nicolas; Mière, Arnaud; Ramage, Karim; Vermeulen, Anne; Boulanger, Damien

    2015-04-01

    The Chemistry-Aerosol Mediterranean Experiment (ChArMEx, http://charmex.lsce.ipsl.fr/) aims at a scientific assessment of the present and future state of the atmospheric environment in the Mediterranean Basin, and of its impacts on the regional climate, air quality, and marine biogeochemistry. The project includes long term monitoring of environmental parameters , intensive field campaigns, use of satellite data and modelling studies. Therefore ChARMEx scientists produce and need to access a wide diversity of data. In this context, the objective of the database task is to organize data management, distribution system and services, such as facilitating the exchange of information and stimulating the collaboration between researchers within the ChArMEx community, and beyond. The database relies on a strong collaboration between ICARE, IPSL and OMP data centers and has been set up in the framework of the Mediterranean Integrated Studies at Regional And Locals Scales (MISTRALS) program data portal. ChArMEx data, either produced or used by the project, are documented and accessible through the database website: http://mistrals.sedoo.fr/ChArMEx. The website offers the usual but user-friendly functionalities: data catalog, user registration procedure, search tool to select and access data... The metadata (data description) are standardized, and comply with international standards (ISO 19115-19139; INSPIRE European Directive; Global Change Master Directory Thesaurus). A Digital Object Identifier (DOI) assignement procedure allows to automatically register the datasets, in order to make them easier to access, cite, reuse and verify. At present, the ChArMEx database contains about 120 datasets, including more than 80 in situ datasets (2012, 2013 and 2014 summer campaigns, background monitoring station of Ersa...), 25 model output sets (dust model intercomparison, MEDCORDEX scenarios...), a high resolution emission inventory over the Mediterranean... Many in situ datasets

  15. Effects of Sorafenib on <em>C>-Terminally Truncated Androgen Receptor Variants in Human Prostate Cancer Cells

    Directory of Open Access Journals (Sweden)

    Mark Schrader

    2012-09-01

    Full Text Available Recent evidence suggests that the development of castration resistant prostate cancer (CRPCa is commonly associated with an aberrant, ligand-independent activation of the androgen receptor (AR. A putative mechanism allowing prostate cancer (PCa cells to grow under low levels of androgens, is the expression of constitutively active, <em>C>-terminally truncated AR lacking the AR-ligand binding domain (LBD. Due to the absence of a LBD, these receptors, termed ARΔLBD, are unable to respond to any form of anti-hormonal therapies. In this study we demonstrate that the multikinase inhibitor sorafenib inhibits AR as well as ARΔLBD-signalling in CRPCa cells. This inhibition was paralleled by proteasomal degradation of the AR- and ARΔLBD-molecules. In line with these observations, maximal antiproliferative effects of sorafenib were achieved in AR and ARΔLBD-positive PCa cells. The present findings warrant further investigations on sorafenib as an option for the treatment of advanced AR-positive PCa.

  16. Influence of secondary packing on the freezing time of chiken meat in air blast freezing tunnels Influência da embalagem secundária sobre o tempo de congelamento de carne de frango em túneis de circulação de ar forçada

    Directory of Open Access Journals (Sweden)

    Clarice de Ávila Santos

    2008-12-01

    Full Text Available Freezing of poultry cuts in continuous convective air blast tunnels is normally performed with the products protected by Low Density Polyethylene (LDPE as a primary packaging and using Corrugated Cardboard Boxes (CCB as secondary packaging. The objective of this work was to investigate the influence of these secondary packaging on the freezing of poultry cuts in continuous convective air blast tunnels. The study was performed by replacing CCB with Perforated Metal Boxes (PMB in order to remove the packaging thermal resistance. The assays, performed in a industrial plant, demonstrated that CCB used commercially for meat freezing have a high heat transfer resistance. Their replacement with PMB can lead to shorter freezing times and spatially homogeneous freezing. Reductions of up to 45% in the freezing times were observed using PMB. The plateau of the temperature curve, related to the freezing time of free water, was significantly reduced using PMB, which is accepted to lead to better product quality after thawing. As the products were protected by the LDPE films as primary packaging, their appearance were not affected. The results presented in this work indicate that replacing CBB with PMB can be an excellent alternative to reduce freezing time and improve freezing homogeneity in industrial air blast tunnels, which could also be applied to other products.O congelamento de cortes de frango em túneis convectivos é normalmente realizado com o produto envolto por filmes de polietileno de baixa densidade (PEBD, embalagem primária e acondicionado em caixas de papelão (CP, embalagem secundária. O objetivo deste trabalho foi avaliar o efeito da embalagem secundária no congelamento dos cortes de frango. Para isso, compararam-se as curvas de congelamento do produto processado acondicionado em caixas metálicas perfuradas (CMP, que praticamente eliminam a resistência térmica da embalagem secundária, com as curvas de congelamento do produto nas CP

  17. Influência das condições de operação em spray dryer piloto sobre a umidade e a atividade de água do leite em pó integral

    OpenAIRE

    Ítalo Tuler Perrone; Moisés Simeão; Paulo Henrique Rodrigues Júnior; Rodrigo Stephani; Antonio Fernandes de Carvalho

    2013-01-01

    O objetivo desse trabalho foi determinar a influência das condições de operação em spray dryer piloto sobre a umidade e a atividade de água do leite em pó integral. Foram empregados seis tratamentos nos quais se variou a temperatura do ar de entrada, a vazão de ar na câmara e a vazão de produto. O tratamento com menor temperatura do ar de entrada, menor vazão de ar e menor temperatura do ar de saída neste experimento possibilitaram que o leite em pó integral tivesse atividade de água média su...

  18. Wavelets in quantification of liver tumors in contrasted computed tomography images; Wavelets na quantificacao de tumores de figado em exames contrastados de tomografia computadorizada

    Energy Technology Data Exchange (ETDEWEB)

    Rodrigues, Bruna T.; Alvarez, Matheus; Souza, Rafael T.F.; Miranda, Jose R.A., E-mail: matheus@ibb.unesp.br [Universidade Estadual Paulista Julio de Mesquita Filho (UNESP), Botucatu, SP (Brazil). Instituto de Biociencias. Departamento de Fisica e Biofisica; Romeiro, Fernando G. [Universidade Estadual Paulista Julio de Mesquita Filho (UNESP), Botucatu, SP (Brazil). Fac de Mediciana. Departamento de Clinica Medica; Pina, Diana R. de; Trindade, Andre Petean [Universidade Estadual Paulista Julio de Mesquita Filho (UNESP), Botucatu, SP (Brazil). Fac. de Medicina. Departamento de Doencas Tropicais e Diagnostico por Imagem

    2012-12-15

    This paper presents an original methodology of liver tumors segmentation, based on wavelet transform. A virtual phantom was constructed with the same mean and standard deviation of the intensity of gray presented by the measured liver tissue. The optimized algorithm had a sensitivity ranging from 0.81 to 0.83, with a specificity of 0.95 for differentiation of hepatic tumors from normal tissues. We obtained a 96% agreement between the pixels segmented by an experienced radiologist and the algorithm presented here. According to the results shown in this work, the algorithm is optimal for the beginning of the tests for quantification of liver tumors in retrospective surveys. (author)

  19. Adaptation of a real time `microfocus` X-ray system for computerized tomography; Adaptacao de um sistema de raios-X `microfocus` em tempo real para tomografia computarizada

    Energy Technology Data Exchange (ETDEWEB)

    Rodrigues, Julio L.; Lopes, Joana R.; Lopes, Ricardo T.; Oliveira, Luis F. de [Universidade Federal, Rio de Janeiro, RJ (Brazil). Coordenacao dos Programas de Pos-graduacao de Engenharia

    1997-10-01

    A tomographic system has been settled up by adapting a real time microfocus radiographic system through an image digitization schedule. This system aimed to obtain CT of small samples in an acceptable data acquisition time, which was hardly reduced compared to traditional X-ray micro tomographic system that employs conventional X-ray sources and detectors. Several CTs ware made using small samples with holes, milk tooth and fruits, in order to verify the performance of the system (spatial resolution, density resolution and image quality). (author). 7 refs., 10 figs.

  20. Method of evaluation of diagnostics reference levels in computerized tomography; Metodo de avaliacao de niveis de referencia de radiodiagnostico em tomografia computadorizada

    Energy Technology Data Exchange (ETDEWEB)

    Vega, Walter Flores

    1999-04-01

    Computerized tomography is a complex technique with several selectable exposition parameters delivering high doses to the patient. In this work it was developed a simple methodology to evaluate diagnostic reference levels in computerized tomography, using the concept of Multiple Scan Average Dose (MSAD), recently adopted by the Health Ministry. For evaluation of the MSAD, a dose distribution was obtained through a measured dose profile on the axial axis of a water phantom with thermoluminescence dosemeters, TLD-100, for different exam technique. The MSAD was evaluated hrough two distinct methods. First, it was evaluated by the integration of the dose profile of a single slice and, second, obtained by the integration on central slice of the profile of several slices. The latter is in of accordance with the ionization chamber method, suggesting to be the most practical method of dose evaluation to be applied in the diagnostic reference level assessment routine for CT, using TLDs. (author)

  1. Determination of the initial energy in computerized tomography with proton beams; Determinacao da energia inicial em tomografia computadorizada com feixe de protons

    Energy Technology Data Exchange (ETDEWEB)

    Rocha, Rodrigo Luis da

    2007-07-01

    In earliest works devoted to proton computed tomography it was shown that the advantage of pCT image reconstruction appears when the energy is close to the Bragg peak region, since the proton passes the object. This effect provided by the Bragg peak makes the computerized tomography with protons possible. However, when decreasing the initial proton energy, with the increase of the irradiation dose, there are two effects that work simultaneously in opposite ways. First, the energy loss of a proton in an object becomes bigger at small initial energy. At the same time decreasing of the proton energy results in the increase of the energy straggling, requiring a larger number of protons. In this work the radiation dose dependence on the proton initial energy was studied using analytical formulas and computer simulations. The investigation determined that the radiation dose practically does not depend on the initial energy, except in the energy region very close to the minimum energy necessary to pass the object. (author)

  2. Study of radiation conditions for obtaining standard beam computed tomography; Estudo das condicoes de radiacao para obtencao do feixe padrao em tomografia computadorizada

    Energy Technology Data Exchange (ETDEWEB)

    Andrade, Lucio das Chagas de; Peixoto, Jose Guilherme Pereira, E-mail: lucio-andrade@hotmail.com [Instituto de Radioprotecao e Dosimetria (IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil)

    2015-07-01

    In Brazil there is a need to expand the traceability for the calibration of cameras used in dosimetry in CT. Thus, in order to promote the expansion of the radiation conditions RQT, LNMRI disseminate this greatness. These radiation conditions may be characterized in terms of tension in the X-ray tube (PPV), the first half-value layer (1{sup st} HVL) and homogeneity coefficient (CH). The LNMRI achieved satisfactory results within the international specifications suggested by IEC 61267 and TRS 457. (author)

  3. The TMS34010 graphic processor - an architecture for image visualization in NMR tomography; O processador grafico TMS34010 - uma arquitetura para visualizacao de imagem em tomografia por RMN

    Energy Technology Data Exchange (ETDEWEB)

    Slaets, Jan Frans Willem; Paiva, Maria Stela Veludo de; Almeida, Lirio O.B

    1989-12-31

    This abstract presents a description of the minimum system implemented with the graphic processor TMS34010, which will be used in the reconstruction, treatment and interpretation f images obtained by NMR tomography. The project is being developed in the LIE (Electronic Instrumentation Laboratory), of the Sao Carlos Chemistry and Physical Institute, S P, Brazil and is already in operation 4 refs., 7 figs.

  4. Attainment of dosimetric pediatrics grandeur to computed tomography examinations of the abdomen; Obtencao das grandezas dosimetricas em exames de tomografia computadorizada pediatricas do abdomen

    Energy Technology Data Exchange (ETDEWEB)

    Jormada, Tiago S., E-mail: tsj@cdtn.br [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil). Curso de pos-graduacao em Ciencias e Tecnologia das Radiacoes, Minerais e Materiais; Silva, Teogenes A., E-mail: silvata@cdtn.br [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil)

    2013-10-01

    Currently, 10% of all computerized tomography exams (CT) are made in pediatric patients. In developed countries, the practice of obtaining the dosimetric quantities (weighted index dose C{sub w}, index air kerma volumetric C{sub vol} product kerma-length P{sub KL},{sub CT}) and effective dose (E) in pediatric CT scans is common. In Brazil, data like these are practically nonexistent. The goal of this work is to obtain the dosimetric quantities and the dose effective in pediatric CT scans, and study its application in the optimization process. The study took place in a thermographs' Toshiba Asteion Single-Slice and a GE Brightsped's multi-slice where measurements were made with type pencil ionization chamber and a trunk's phantom of PMMA with diameter of 16 cm. In single-slice CT scanner, the results obtained for the C{sub vol}, P{sub KL},{sub CT} and E were 18.73 mGy, 15.61 mGy and 6.87 mSv mGy.cm 343.51, respectively, whereas in multi-slice CT scanner the results were 18.81 mGy, 20.07 mGy, 441.64 mGy.cm and 8,83 mSv. There was no significant difference between the values of C{sub w} obtained already in the values of the Cvol, P{sub KL},{sub CT} and E dose the differences between the results were quite significant. Comparing the C{sub w} and P{sub KL},{sub CT} and with the values recommended by UCRP 87 (25 mGy for C{sub vol} and 360 mGy.cm for P{sub KL},{sub CT} in pediatric CT scans of the abdomen), the two scanners were below reference levels for C{sub w} and not require an start on process of optimization. (author)

  5. Crazy-paving: correlation between high resolution computed tomography and anatomopathological findings; Pavimentacao em mosaico: correlacao da tomografia computadorizada de alta resolucao com a anatomopatologia

    Energy Technology Data Exchange (ETDEWEB)

    Marchiori, Edson; Vabo, Karen Amaral do; Damato, Simone Duarte [Universidade Federal Fluminense, Niteroi, RJ (Brazil). Dept. de Radiologia; Kavakama, Jorge [Hospital das Clinicas, Sao Paulo, SP (Brazil). Instituto do Coracao. Servico de Radiologia; Capelozzi, Vera Lucia [Sao Paulo Univ., SP (Brazil). Dept. de Patologia

    2000-06-01

    In this paper we present the high resolution computed tomography findings of various diseases which show a 'crazy-paving' pattern on CT. Cases of alveolar proteinosis, bronchoalveolar carcinoma, lipoid pneumonia and pneumocistosis are illustrated and correlated with the anatomopathological findings. (author)

  6. Computed tomography findings in patients less than 20 years old with lymphoma; Aspectos da tomografia computadorizada no linfoma em pacientes abaixo de 20 anos de idade

    Energy Technology Data Exchange (ETDEWEB)

    Borba, Adriana Moreira Viana [Pontificia Universidade Catolica do Rio de Janeiro (PUC-RJ), Rio de Janeiro, RJ (Brazil). Escola de Medicina; Monteiro, Alexandra Maria Vieira; Lucena, Stella Beatriz Goncalves de [Universidade do Estado do Rio de Janeiro (UERJ), RJ (Brazil). Faculdade de Ciencias Medicas; Lima, Claudio Marcio Amaral de Oliveira; Ribeiro, Erica Barreiros [Hospital Naval Marcilio Dias, Rio de Janeiro, RJ (Brazil)]. E-mail: cmaol@br.inter.net; Skinner, Luis Flavio [Universidade do Estado do Rio de Janeiro (UERJ), RJ (Brazil). Faculdade de Ciencias Medicas. Hospital Universitario Pedro Ernesto (HUPE)

    2007-03-15

    Objective: To describe the general findings of lymphoma and their histological patterns in patients less than 20 years old. Materials And Methods: Twenty-two cases (16 male and 6 female, mean age 11.5 years) from the digital archive of computed tomography at the Cancer Control Center of Hospital Universitario Pedro Ernesto - Universidade do Estado do Rio de Janeiro, Rio de Janeiro, RJ, Brazil, were retrospectively analyzed in the period between March 2003 and July 2005. Of these 22 cases, 12 were Hodgkin's and 10 were non-Hodgkin's. Results: Overall, mediastinal lymphadenomegaly was the most frequent finding (59%), with predominance in the Hodgkin's subgroup (75%), followed by hepatosplenomegaly (50%) and cervical and retroperitoneal lymphadenomegaly (27.3%). The Hodgkin's subgroup presented a prevalence of lymphadenopathy, in many lymph node chains, followed by hepatosplenomegaly (50%). One case was found with unilateral tonsillar mass, pulmonary ground-glass opacities, and renal nodules. In the non-Hodgkin's subgroup, the disease was predominantly extranodal, characterized by hepatosplenomegaly (50%), thickening of the intestinal wall (40%), pleural effusion (30%), pulmonary nodule (20%), ascites (10%), pericardial effusion (10%) and mixed bone lesions (10%). Conclusion: Computed tomography is an extremely useful method for detection, staging and follow-up of lymphomas, with alert findings like mediastinal lymphadenopathy, hepatosplenomegaly, unilateral tonsillar mass and thickening of intestinal wall. (author)

  7. Stratus optical coherence tomography findings in patients with retinopathy of prematurity Tomografia de coerência óptica em pacientes com retinopatia da prematuridade

    OpenAIRE

    Aline do Lago; Lícia Matieli; Michele Gomes; Natalia Tamie Baba; Michel Eid Farah; Rubens Belfort Junior; Nilva Simeren Bueno Moraes

    2007-01-01

    PURPOSE: To describe morphological features of the macula in patients with retinopathy of prematurity. METHODS: Twelve premature babies with retinopathy of prematurity grades I, II and III underwent dilated fundus examination and optical coherence tomography evaluation. RESULTS: In all thirteen eyes of the twelve premature patients optical coherence tomography revealed a condensed retinal pigmented epithelial layer in the macular-foveal area shown by increased reflectivity. In these eyes the ...

  8. Automatic 2D segmentation of airways in thorax computed tomography images; Segmentacao automatica 2D de vias aereas em imagens de tomografia computadorizada do torax

    Energy Technology Data Exchange (ETDEWEB)

    Cavalcante, Tarique da Silveira; Cortez, Paulo Cesar; Almeida, Thomaz Maia de, E-mail: tarique@lesc.ufc.br [Universidade Federal do Ceara (UFC), Fortaleza, CE (Brazil). Dept. de Engenharia de Teleinformatica; Felix, John Hebert da Silva [Universidade da Integracao Internacional da Lusofonia Afro-Brasileira (UNILAB), Redencao, CE (Brazil). Departamento de Energias; Holanda, Marcelo Alcantara [Universidade Federal do Ceara (UFC), Fortaleza, CE (Brazil). Fac. de Medicina

    2013-07-01

    Introduction: much of the world population is affected by pulmonary diseases, such as the bronchial asthma, bronchitis and bronchiectasis. The bronchial diagnosis is based on the airways state. In this sense, the automatic segmentation of the airways in Computed Tomography (CT) scans is a critical step in the aid to diagnosis of these diseases. Methods: this paper evaluates algorithms for airway automatic segmentation, using Neural Network Multilayer Perceptron (MLP) and Lung Densities Analysis (LDA) for detecting airways, along with Region Growing (RG), Active Contour Method (ACM) Balloon and Topology Adaptive to segment them. Results: we obtained results in three stages: comparative analysis of the detection algorithms MLP and LDA, with a gold standard acquired by three physicians with expertise in CT imaging of the chest; comparative analysis of segmentation algorithms ACM Balloon, ACM Topology Adaptive, MLP and RG; and evaluation of possible combinations between segmentation and detection algorithms, resulting in the complete method for automatic segmentation of the airways in 2D. Conclusion: the low incidence of false negative and the significant reduction of false positive, results in similarity coefficient and sensitivity exceeding 91% and 87% respectively, for a combination of algorithms with satisfactory segmentation quality. (author)

  9. Dose estimation in CT exams of the abdomen based on values of DLP; Estimativa da dose em exames de tomografia de abdome com base nos valores de DLP

    Energy Technology Data Exchange (ETDEWEB)

    Kikuti, C.F.; Medeiros, R.B.; Salvadori, P.S.; Costa, D.M.C; D' lppolito, G., E-mail: kikuticf@gmail.com, E-mail: rbitelli2011@gmail.com [Universidade Federal de Sao Paulo (UNIFESP), SP (Brazil). Coordenadoria de Fisica e Higiene das Radiacoes. Departamento de Diagnostico por Imagem

    2013-10-01

    One of the challenges of multidetector computerized tomography is to minimize the risk of ionizing radiation using optimized protocols since higher doses are necessary to obtain high image quality. It was also noted that, due to the geometry in image acquisition using MDCT becomes necessary to estimate dose values consistent with the hypothesis clinically and with the specificities of the tomographic equipment. The aim of this study was to estimate the doses in abdomen exams from the data recorded on the MDCT console and dimensions obtained from DICOM images of patients undergoing different clinical protocols. Were collected, from the image DICOM of 101 exams, values of the dose length product (DLP) provided by Philips Health Care - Brilliance 64 equipment console, in order to relate them with the dose values obtained by means of thermoluminescent dosimeters ( TLD ) of CasSo{sub 4}:Mn placed on the surface of a cylindrical simulator abdomen acrylic manufactured under the technical - operational conditions for a typical abdomen exam. From the data obtained, it was possible to find a factor of 1.16 ( 5 % ) indicating that the DLP values Brilliance 64 console underestimate the doses and this should be used with correction factor to estimate the total dose of the patient. (author)

  10. Computed tomography of mast cell tumors in dogs: assessment before and after chemotherapy; Tomografia computadorizada de mastocitomas em caes: avaliacao pre e pos-tratamento quimioterapico

    Energy Technology Data Exchange (ETDEWEB)

    Lorigados, Carla A.B.; Matera, Julia Maria; Pinto, Ana Carolina B.C.F.; Macedo, Thais R., E-mail: clorigados@usp.br [Universidade de Sao Paulo (FMVZ/USP), SP (Brazil). Fac. de Medicina Veterinaria e Zootecnia. Dept. de Cirurgia; Coppi, Antonio A.; Ladd, Fernando V.L. [Universidade de Sao Paulo (LSSCA/USP), SP (Brazil). Fac. de Medicina Veterinaria e Zootecnia. Lab. de Estereologia Estocastica e Anatomia Quimica; Souza, Vanessa A.F. de [Faculdades Metropolitanas Unidas (FMU), Sao Paulo, SP (Brazil). Curso de Medicina Veterinaria

    2013-11-15

    Nineteen dogs with mast cell tumors treated with chemotherapy were evaluated by computed tomography (CT). Were evaluated aspects related to contours, attenuation, postcontrast enhancement and presence of cleavage with adjacent structures. The RECIST criteria and volumetric measurement of lesions were performed to assess the response to treatment. The mast cell tumors presented a homogeneous or heterogeneous attenuation, presented more frequently a well delineated and regular contours and moderate enhancement after intravenous administration of the iodinated contrast media. The methods RECIST and volumetric measurements showed an excellent agreement to the classification of therapeutic response, providing a good parameter of the response to treatment. The CT examination proved to be useful in the delimitation of the tumor and an important tool for planning of surgical margins. (author)

  11. Bronchial asthma: correlation of high resolution computerized tomography findings with clinical data; Asma bronquica: correlacao de achados em tomografia computadorizada de alta resolucao com dados clinicos

    Energy Technology Data Exchange (ETDEWEB)

    Mogami, Roberto [Universidade do Estado, Rio de Janeiro, RJ (Brazil). Servico de Radiologia; Marchiori, Edson [Universidade Federal Fluminense, Niteroi, RJ (Brazil). Dept. de Radiologia; Kirk, Kennedy; Capone, Domenico [Universidade do Estado, Rio de Janeiro, RJ (Brazil). Servico de Pneumologia; Daltro, Pedro [Instituto Fernandes Figueira, Rio de Janeiro, RJ (Brazil). Servico de Radiologia

    1999-04-01

    In this work we did a sectional study of 31 asthmatic patients with several levels of disease severity, which were submitted to high resolution computed tomography of the thorax and spirometry, between the months of July, 1995 and August, 1997. The tomographic findings were correlated with the clinical classification of the patients and the most frequent tomographic findings were bronchial wall thickening, bronchial dilatation, air trapping, centrilobular opacities, cicatricial linear shadows, mucoid impaction, emphysema and atelectasis. In asthmatic patients of long duration we observed small airway disease and irreversible lesions as the predominant findings. In smoking patients there was no high frequency of emphysema. (author)

  12. Computed tomography of the adrenals in patients with tuberculosis; Emprego da tomografia computadorizada na deteccao de alteracoes das adrenais em doentes com tuberculose

    Energy Technology Data Exchange (ETDEWEB)

    Yamashita, Seizo; Machado, Jussara Marcondes; Morceli, Jose [UNESP, Botucatu, SP (Brazil). Faculdade de Medicina. Dept. de Doencas Tropicais e Diagnostico por Imagem]. E-mail: seizo_eid@uol.com.br

    2004-06-01

    We evaluated the adrenals of individuals without tuberculosis (group 1 - G1) and with tuberculosis (group 2 - G2) using computed tomography. The antero-posterior length, the thickness, and the longitudinal length of the adrenals were compared in G1 and G2. The duration of the disease, the occurrence of morphologic abnormalities in G2, the distribution according to sex, age and skin color were also studied. There was difference in the antero-posterior length and thickness of right adrenal between G1 and G2. A higher prevalence of white skin male individuals was observed in G2. There was no association between duration of the disease and the occurrence of morphologic abnormalities in G2. A higher occurrence of adrenal enlargement was observed in G2. The main computed tomography findings in patients with tuberculosis were enlargement of the adrenal without calcification, enlargement of the adrenal with punctiform calcifications, and residual calcification of the adrenal. (author)

  13. Evaluation of apical deviation in root canals instrumented with K3 and ProTaper systems Avaliação do desvio apical em canais instrumentados pelos sistemas K3 e ProTaper

    Directory of Open Access Journals (Sweden)

    Mariana Diniz Bisi dos Santos

    2006-12-01

    Full Text Available OBJECTIVES: this study evaluated the apical deviation of curved root canals instrumented with K3 and ProTaper systems. MATERIAL AND METHODS: twenty root canals of human maxillary and mandibular first molars were employed, which were divided into 2 groups: group A (10 teeth was instrumented with the K3 system, and group B (10 teeth with the ProTaper system. Evaluation of deviation was performed by double radiographic exposure. Radiographs were achieved before and after instrumentation, with 0.3-second, thus allowing superimposition of images. Three-dimensional computerized tomograph was performed in 3 specimens in each group, as an additional means to evaluate the apical deviation. RESULTS: were evaluated by the parametric test Student-Newman-Keuls at 5%, which did not reveal significance between groups concerning the apical deviation. The results of computerized tomograph images demonstrated that the larger deviation of the root canal occurred at the distolingual area for both systems. CONCLUSIONS: both techniques produced a mild apical deviation. Computerized microtomography was shown to be accurate for experimental endodontics studies.OBJETIVOS: avaliar o desvio apical de canais radiculares curvos instrumentados pelos sistemas K3 e ProTaper. MATERIAIS E MÉTODOS: foram utilizados 20 canais radiculares de primeiros molares superiores e inferiores humanos, os quais foram divididos em 2 grupos, o grupo A (10 dentes foi instrumentado pelo sistema K3 e o grupo B (10 dentes com o sistema ProTaper, a forma de avaliação do desvio foi a dupla exposição radiográfica. As tomadas radiográficas foram feitas antes e após a instrumentação, com um tempo de 0,3 segundos em cada exposição, ocorrendo assim, sobreposição das imagens. Em 3 espécimes, de cada grupo, foi realizada a tomografia computadorizada tridimensional, como forma adicional de avaliar o desvio apical . Os resultados obtidos foram avaliados pelo teste paramétrico Student

  14. Criação intensiva de suínos em confinamento ou ao ar livre: estudo meta-analítico do desempenho zootécnico nas fases de crescimento e terminação e avaliação de carcaça e carne no Longissimus dorsi Intensive pig production in confinement or outdoor systems: a meta-analytical study of the production performance in the growing and finishing phases and carcass and meat evaluation from the Longissimus dorsi

    Directory of Open Access Journals (Sweden)

    Alice Bogoni Demori

    2012-07-01

    Full Text Available Uma meta-análise foi realizada para avaliar o desempenho e a qualidade de carcaça e carne de suínos em função do sistema de alojamento nas fases de crescimento/terminação. Foram selecionadas publicações indexadas com resultados de experimentos comparando variáveis de desempenho e de pós-abate de suínos alojados em sistemas intensivos convencionais ou ao ar livre. A base de dados contemplou 27 artigos publicados entre 1997 e 2009. Ao total, foram considerados 2.985 animais e 701 médias na análise de dados. A meta-análise foi realizada através de duas análises sequenciais: gráfica e de variância-covariância. O sistema de criação de suínos ao ar livre aumentou em 9% (P0,05 pelo sistema de alojamento dos suínos. Concluiu-se que o sistema de criação influencia no desempenho dos suínos, mas não interfere nas características de carcaça e carne estudadas.A meta-analysis was carried out to study performance and characteristics of carcass and meat in pigs in function of housing system during the growing/finishing period. Indexed publications with results of experiments comparing performance and post-slaughter variables of pigs housed in outdoor or conventional intensive systems were selected. In total, 2.985 animals and 701 averages were considered in the data analysis. Meta-analysis followed two sequential analyses: graphic and variance. The outdoor productive system increased in 9% (P0.05 by the housing system. It is concluded that the housing system influences the pig performance, but does not interfere in characteristics of carcass and meat.

  15. New Approach to Estimate 40Ar/36Ar Ratio in Shocked Meteorites

    Science.gov (United States)

    Fujimoto, H.; Hyodo, H.; Ninagawa, K.

    2008-12-01

    Measurement of a 40Ar/39Ar age in a meteorite requires proper estimation of a 40Ar/36Ar "initial" ratio. For a primordial one, it is reported to be an order of 10-4, suggesting that one can ignore it in age calculation. However, there is no basis for applying this value as individual meteorites have different histories. In terms of 40Ar/39Ar studies on various meteorites, very few studies discuss how the ratios were estimated. Using terrestrial value of 295.5 is invalid. The only case in which the ratio does not affect on the results is when an age of a meteorite is in an order of billion years, resulting in a large raw 40Ar/36Ar ratio. A proper approach to estimate the ratio is application of isochron analyses. When a small amount of sample (a few micrograms) is studied in laserprobe analysis, this often becomes difficult. A shocked meteorite Y-75097 has developed maskelynite veins, which were identified in optical microscope, electron microprobe and thermoluminescence studies. We have applied 40Ar/39Ar dating method using both stepwise heating by a continuous laser and pinpoint dating by a pulsed laser. Stepwise heating results of several fragments (about 50 micrograms) of the meteorite yielded various old and young ages. Most pinpoint analyses gave the raw 40Ar/36Ar ratio less than the terrestrial value with sporadically and anomalously old ages. Among the data, three points isochron from a maskelynite vein yielded about 300 Ma with "initial" ratio of 180. To confirm this result, plagioclase and olivine data near the vein were plotted in a correlation diagram, but an isochron is not well defined due to relatively large analytical errors. A new method to analyze these data is proposed. Once 40Ar/39Ar ratio is determined from an experiment, the only factor which determines the age is the "initial" ratio in the 40Ar/39Ar age equation. Instead of using a known fixed ratio, we set the ratio (y-axis) and the age (x-axis) as variables. In this diagram, a single data

  16. Planar defects as Ar traps in trioctahedral micas: A mechanism for increased Ar retentivity in phlogopite

    Science.gov (United States)

    Camacho, A.; Lee, J. K. W.; Fitz Gerald, J. D.; Zhao, J.; Abdu, Y. A.; Jenkins, D. M.; Hawthorne, F. C.; Kyser, T. K.; Creaser, R. A.; Armstrong, R.; Heaman, L. W.

    2012-08-01

    The effects of planar defects and composition on Ar mobility in trioctahedral micas have been investigated in samples from a small marble outcrop (∼500 m2) in the Frontenac Terrane, Grenville Province, Ontario. These micas crystallized during amphibolite-facies metamorphism at ∼1170 Ma and experienced a thermal pulse ∼100 Ma later at shallow crustal levels associated with the emplacement of plutons. 87Rb/86Sr ages of the phlogopites range from ∼950 to ∼1050 Ma, consistent with resetting during the later thermal event. The same phlogopites however, give 40Ar/39Ar ages between ∼950 and 1160 Ma, spanning the age range of the two thermal events. This result is intriguing because these micas have undergone the same thermal history and were not deformed after peak metamorphic conditions. In order to understand this phenomenon, the chemical, crystallographical, and microstructural nature of four mica samples has been characterized in detail using a wide range of analytical techniques. The scanning electron microscope (SEM), electron microprobe (EMP), and laser ablation inductively coupled plasma mass spectrometry (LA-ICP-MS) data show that the micas are chemically homogeneous (with the exception of Ba) and similar in composition. The Fourier transform infrared spectroscopy and Mossbauer results show that the M sites for three of the micas are dominated by divalent cations and the Fe3+/(Fe2++Fe3+) ratio for all four phlogopites ranges from 0.10 to 0.25. The stable-isotopic data for calcite indicate that this outcrop was not affected by hydrothermal fluids after peak metamorphism. No correlation between chemical composition and 87Rb/86Sr and 40Ar/39Ar age or between crystal size and 40Ar/39Ar age is observed. The only major difference among all of the micas was revealed through transmitted electron microscope (TEM), which shows that the older 1M micas contain significantly more layer stacking defects, associated with crystallization, than the younger micas. We

  17. O uso de politetrafluoroetileno expandido em tireoplastia tipo I

    Directory of Open Access Journals (Sweden)

    Mello-Filho Francisco Veríssimo de

    2003-01-01

    Full Text Available A paralisia unilateral de prega vocal (PUPV em abdução é uma alteração que produz grande desconforto ao paciente, principalmente pelos distúrbios fonatórios causados. Atualmente dispomos de uma variedade de métodos para seu tratamento. OBJETIVO: Verificar a eficiência, vantagens e desvantagens do uso da fita de politetrafluoretileno expandido (PTFE-e, na medialização de prega vocal (PV paralisada, em abdução. FORMA DE ESTUDO: Coorte Longitudinal. MATERIAL E MÉTODOS: Foram estudados quatro pacientes com diagnóstico clínico-laringoscópico de disfonia por PPVU, em abdução há pelo menos um ano. Os pacientes foram submetidos a avaliação fonoaudiológica e a tireoplastia tipo I para medialização da PV com fita de PTFE-e. Durante o seguimento pós-operatório procedeu-se videolaringoscopia, tomografia computadorizada e fonoterapia. RESULTADOS: Todos os pacientes estão satisfeitos com a qualidade vocal, apresentam medialização estável da PV com a fonocirurgia e bons resultados à avaliação fonoaudiológica. Um paciente apresentou extrusão intra-operatória da fita de PTFE-e, sendo feito um segundo procedimento, sem complicações, seis meses depois. CONCLUSÃO: Na opinião dos autores a fita de PTFE-e se presta com eficiência ao tratamento da PUPV, sem apresentar riscos importantes.

  18. Ar-Ar Dating of Martian Meteorite, Dhofar 378: An Early Shock Event?

    Science.gov (United States)

    Park, J.; Bogard, D. D.

    2006-01-01

    Martian meteorite, Dhofar 378 (Dho378) is a basaltic shergottite from Oman, weighing 15 g, and possessing a black fusion crust. Chemical similarities between Dho378 and the Los Angeles 001 shergottite suggests that they might have derived from the same Mars locale. The plagioclase in other shergottites has been converted to maskelenite by shock, but Dho378 apparently experienced even more intense shock heating, estimated at 55-75 GPa. Dho378 feldspar (approximately 43 modal %) melted, partially flowed and vesiculated, and then partially recrystallized. Areas of feldspathic glass are appreciably enriched in K, whereas individual plagioclases show a range in the Or/An ratio of approximately 0.18-0.017. Radiometric dating of martian shergottites indicate variable formation times of 160-475 Myr, whereas cosmic ray exposure (CRE) ages of shergottites indicate most were ejected from Mars within the past few Myr. Most determined Ar-39-Ar-40 ages of shergottites appear older than other radiometric ages because of the presence of large amounts of martian atmosphere or interior Ar-40. Among all types of meteorites and returned lunar rocks, the impact event that initiated the CRE age very rarely reset the Ar-Ar age. This is because a minimum time and temperature is required to facilitate Ar diffusion loss. It is generally assumed that the shock-texture characteristics in martian meteorites were produced by the impact events that ejected the rocks from Mars, although the time of these shock events (as opposed to CRE ages) are not directly dated. Here we report Ar-39-Ar-40 dating of Dho378 plagioclase. We suggest that the determined age dates the intense shock heating event this meteorite experienced, but that it was not the impact that initiated the CRE age.

  19. An 40 Ar- 39 Ar study of the Cape Verde hot spot

    DEFF Research Database (Denmark)

    Holm, Paul Martin; Grandvuinet, Tanja; Wilson, James Richard;

    2008-01-01

    The 40Ar-39Ar analyses of 28 groundmass separates from volcanic rocks from the islands of Santiago, Sal, and São Vicente, Cape Verde archipelago, are presented. The new age data record the volcanic evolution for Santiago from 4.6 to 0.7 Ma, for Sal from around 15 to 1.1 Ma, and for São Vicente fr...

  20. Variscan polyphase tectonothermal record in the West Sudetes (Bohemian Massif) - deduced from Ar-Ar ages

    Czech Academy of Sciences Publication Activity Database

    Marheine, D.; Kachlík, V.; Patočka, František; Maluski, H.; Zelazniewicz, A.

    La Coruňa : International Basement Tectonics Association, 2000, s. 254-257. [International Conference on Basement Tectonics /15./, Galicia 2000.. La Coruňa (ES), 04.07.2000-08.07.2000] R&D Projects: GA AV ČR BARRANDE97008; GA AV ČR KSK1012601 Institutional research plan: CEZ:AV0Z3013912 Keywords : HP-LT-; HT- metamorphic rocks * tectonothermal events * Ar-Ar geochronology Subject RIV: DB - Geology ; Mineralogy

  1. Ar-Ar Isotopic age of lamproite dikes of the Chuisky complex, Gorny Altai

    International Nuclear Information System (INIS)

    The age of lamproite dikes of the Chuisky complex of the Gorny Altai was identified by the method of Ar-Ar isotope dating. The previously established Early-Middle Triassic age (236.5 ± 3.8 mln. years) of the dikes permits relating their formation and activities of the superplume, which dictated the development of the Permian-Triassic magmatism within vast territories in the Northern and Central Asia

  2. Ar/39Ar age spectrum analysis of detrital microclines from the southern San Joaquin Basin, California

    International Nuclear Information System (INIS)

    Detrital microcline grains from sedimentary strata preserve a record of thermal evolution in the temperature range approx.= 1000 to 2000C which can be revealed by 40Ar/39Ar age spectrum analysis. Microcline separates from deep drill hole intersections with Eocene to Miocene sediments in the Basin and Tejon Blocks of the southern San Joaquin Valley, California, analysed by the age spectrum approach show radiogenic 40Ar (40Ar*) gradients that record both the slow cooling of the uplifting sediment source approx.= 65 Ma ago, and a recent thermal event. This information, in conjunction with the observation of fission track annealing in the coexisting apatites, allows estimation of the temperature-time conditions of this thermal event at about 1400C for approx.= 200 ka. Present and paleotemperature data is in accord with heating related to several kilometers of Pleistocene sediment deposition. Heat flow calculations suggest that this recent subsidence has depressed the thermal gradient from about 300C km-1 to the present apparent gradient of 240C km-1. 40Ar/39Ar analysis of detrital microcline crystals yields thermochronological information in the temperature-time range of petroleum maturation and provides this technique with potential as both a useful exploration tool and as a means of probing the fundamental geodynamic processes of basin evolution. (orig.)

  3. Plasma etching of III-nitrides in ICl/Ar and IBr/Ar plasmas

    International Nuclear Information System (INIS)

    Two new plasma chemistries, ICl/Ar and IBr/Ar, were investigated for dry etching of III-nitrides. Under electron cyclotron resonance conditions, we examined the effect of plasma composition, and source and chuck power on etch rates and surface morphology. The etch rate of InN proved to be the most sensitive of the materials investigated to the plasma composition and ion density in ICl plasmas. The GaN, InN, and InGaN etch rates reached ∼13000, 11500, and 7000 Angstrom/min, respectively, at 250 W rf chuck power and 1000 W microwave source power for ICl discharges. The etch rates in IBr plasmas were somewhat slower than in ICl. The etched surface of GaN was found to be smooth, with no significant preferential loss of N from the surface at low rf powers in either chemistry. There was no significant residue on the GaN surfaces after etching in IBr/Ar, and only slight chlorine contamination on the surfaces etched in ICl/Ar. Selectivities of 5 endash 10 for GaN over InN, AlN, or InAlN were achieved in ICl/Ar, but were <4 under all conditions with IBr/Ar. copyright 1997 American Vacuum Society

  4. Ar-Ar Dating on the Metallogenesis of the Dongchuang Gold Deposit in the Xiaoqinling Area

    Institute of Scientific and Technical Information of China (English)

    李强之; 陈衍景; 钟增球; 李文良; 李绍如; 郭晓东; 金宝义

    2002-01-01

    The Dongchuang gold deposit in the Xiaoqinling area is an orogenic-type lode gold deposit. It is one ofthe few superlarge (>100 t Au) deposits in China. Although it has been argued that it was formed in the Mesozoic,related isotopic age data have not been reported in previous studies. Based on detailed geological study, the authors havecarried out isotopic dating on various metallogenic generations. The ore-forming process of the Dongchuang golddeposit consists of four stages: coarse-grained pyrite-bearing quartz veins (stageⅠ), fine-grained pyrite-quartz veinlets(stage Ⅱ), multi-sulfides (stage Ⅲ) and carbonate-quartz veinlets (stage Ⅳ). Ar-Ar dating on mineral separates of stagesⅠ, Ⅱ and Ⅲ yields plateau ages of 142.9±2.9 Ma, 132.2±2.6 Ma and 128.3±6.2 Ma, respectively. Sericite separates fromstage Ⅱ assemblage also yield an Ar-Ar isochron age of 132.6±2.7 Ma, similar to the Ar-Ar plateau age. These resultssuggest that the Dongchuang gold deposit was mainly formed during 143-128 Ma, coinciding with the authors'geological observations and previous hypothesis. This ore formation is coeval with the regional-tectonic transition fromcollisional compression to extension, strongly showing that the decompression-geothermal increase regime duringcompression-to-extension transition is the most conducive geodynamic environment to orogenic-type goldmineralization.

  5. Estudo da transferência das cloraminas da água para o ar duma piscina coberta

    OpenAIRE

    Barbosa, Albino António da Silva

    2009-01-01

    Mestrado em Engenharia Química A qualidade do ar em ambientes de piscinas cobertas, bem como seus efeitos no sistema respiratório humano, tem vindo a ser estudada por diversos autores. Estes concluíram, por exemplo, que a exposição prolongada à tricloramina é causa de asma ocupacional entre funcionários de piscinas, e muito provavelmente causa de asma entre frequentadores assíduos. O cloro combinado ou as cloraminas assim como outros subprodutos da desinfecção resultam da reacção entre ...

  6. Insuficiência respiratória aguda causada por pneumonia em organização secundária à terapia antineoplásica para linfoma não Hodgkin

    OpenAIRE

    Adriell Ramalho Santana; Fábio Ferreira Amorim; Paulo Henrique Alves Soares; Edmilson Bastos de Moura; Marcelo de Oliveira Maia

    2012-01-01

    Doenças difusas do parênquima pulmonar pertencem a um grupo de doenças de evolução geralmente subaguda ou crônica, mas que podem determinar insuficiência respiratória aguda. Paciente masculino, 37 anos, em terapia para linfoma não Hodgkin, admitido com tosse seca, febre, dispneia e insuficiência respiratória aguda hipoxêmica. Iniciadas ventilação mecânica e antibioticoterapia, porém houve evolução desfavorável. Tomografia computadorizada de tórax mostrava opacidades pulmonares em "vidro fosco...

  7. CT interpretation of craniofacial anomalies: a comparative analysis by undergraduate dental students Interpretação de anomalias craniofaciais em TC: análise comparativa por alunos de graduação em Odontologia

    Directory of Open Access Journals (Sweden)

    Bruno Felipe Gaia

    2005-03-01

    Full Text Available The aim of this study was to evaluate the accuracy and reproducibility of computed tomography (CT image interpretation made in axial slices (2D-CT and 3D reconstructed images (3D-CT of patients with craniofacial anomalies. The analyses were made by undergraduate dental students, and compared with the diagnoses considered upon surgical intervention. Computed tomography of 43 patients were analyzed independently by three calibrated examiners (undergraduate students with, respectively, one, two, and three semesters of experience in craniofacial CT training and interpretation. The analysis of 2D-CT and 3D-CT images were performed at distinct times using an independent workstation associated with a specific computer graphics software for volumetric images. The analysis of inter-examiner agreement and of the agreement between observers and the gold standard was performed using the Kappa test. The accuracy evaluation presented a progressively higher value for examiners with progressively broader experience in 2D-CT and 3D-CT image interpretation. 3D-CT analyses allowed a higher inter-examiner agreement (1 - 0.896 than 2D-CT analyses (1 - 0.614. 3D-CT was considered more precise and accurate than 2D-CT for all students' evaluations. The reproducibility and accuracy varied according to the experience in CT interpretation, and the most experienced student achieved results closer to the gold standard.O propósito desta pesquisa foi avaliar a habilidade de alunos de graduação na análise de pacientes portadores de anomalias craniofaciais usando imagens de tomografia computadorizada (TC em cortes axiais (2D-TC e em terceira dimensão (3D-TC. A análise foi realizada por alunos de graduação em Odontologia, em comparação com o diagnóstico efetuado no ato operatório. Tomografias computadorizadas de 43 pacientes foram analisadas, independentemente, por três alunos de graduação previamente calibrados, com respectivamente um, dois e três semestres de

  8. K/Ar dating of diagenetic illite

    International Nuclear Information System (INIS)

    Ascertaining the potassium/argon (K/Ar) age of diagenetic illite yields important information for hydrocarbon exploration since the growth of this mineral in the pores of sandstone reservoir and oil migration are inter linked events in the diagenetic evolution of rocks. Illite was mechanically separated by repeating a series of ultrasonic baths and ultrasonic probes followed by high-speed centrifuging. Resultant fractions were analyzed by X-ray diffractometry to measure the illite content of each sample. The separated illite material was found to be composed of illite and ordered mixed layer illite-smectite with 80% illite layers. Separated fractions were dated radiometrically by the K/Ar method. Preliminary results indicate an average age of some 200 m.y., which marks the end of the diagenetic development of the illite of this area. (author)

  9. Length determination of zygomatic implants using tridimensional computed tomography Determinação do comprimento de fixações zigomáticas a partir de tomografia computadorizada tridimensional

    Directory of Open Access Journals (Sweden)

    Luciana Ribeiro Koser

    2006-12-01

    Full Text Available Considering the potential of tridimensional computed tomography (3D-CT as a predictor of real bone dimensions, nine dried human skulls with maxillary edentulism were evaluated using images obtained by 3D-CT, prior to the installation of zygomatic implants, in order to obtain the measurements of the implants. In the analysis of correlation between the two 3D-CT examiners, a 75% agreement was found, and no correlation was found between them and the surgical measurement. The worst result was the surgical one, possibly because an inaccurate probe was used. Based on the obtained data, we concluded that the probe used is inaccurate, suggesting that the surgical probe be changed in its measurement scale. Agreement between surgeon and radiologist could possibly be obtained by using insertion guides, since what might have possibly caused the discrepancy in the results is the fact that the 3D-CT examiners and the surgeon used different implant insertion points. It is also possible that a larger sample might produce a more accurate evaluation, thus improving the results.Considerando-se o potencial da tomografia computadorizada tridimensional (TC-3D como preditor de dimensões ósseas reais e avaliando-se nove crânios humanos secos com edentulismo maxilar, foi feito um estudo utilizando-se o recurso das imagens obtidas por TC-3D, previamente à execução da técnica de fixação zigomática, para mensurar o comprimento de tais fixações. Na avaliação da concordância interexaminador da TC-3D, houve uma boa correlação entre o primeiro e segundo (75%, e ausência de correlação entre estes e a medida cirúrgica. Contextualizando, o pior resultado foi o cirúrgico, possivelmente pelo fato de utilizar uma sonda imprecisa. Diante dos dados obtidos, concluiu-se que a sonda utilizada é imprecisa, sugerindo uma mudança na mesma quanto ao seu escalonamento e que medidas para aproximar as linguagens do cirurgião e do radiologista talvez fossem conseguidas

  10. Cartografar é traçar um plano comum

    Directory of Open Access Journals (Sweden)

    Virgínia Kastrup

    2013-08-01

    Full Text Available A pesquisa de campo sobre produção da subjetividade enfrenta o problema de construir conhecimento envolvendo pesquisadores e pesquisados, com territórios e semióticas singulares. Surgem questões relativas ao protagonismo dos participantes e a como traçar com eles um plano comum, garantindo o caráter participativo da pesquisa. No contexto do método da cartografia, o artigo tem como objetivo tratar do tema do comum num duplo aspecto. Num primeiro, discute o acesso ao plano comum. Com base em Gilles Deleuze e Felix Guattari, tal plano não é dito homogêneo nem reúne atores que manteriam entre si relações de identidade, mas opera comunicação entre singularidades, sendo pré-individual e coletivo. Num segundo aspecto, aponta que, enquanto pesquisa-intervenção, a cartografia se compromete com a criação de um mundo comum e heterogêneo. O artigo mostra que o traçado do comum tem como diretriz metodológica a tranversalidade e examina os procedimentos de participação, inclusão e tradução.

  11. Pneumonia lipídica - aspectos na tomografia computadorizada: relato de caso Lipoid pneumonia: computed tomography findings - a case report

    OpenAIRE

    Janos Farias; Erick Malheiro Leoncio Martins; Aline Serfaty Pozes; Suzane Mansur Fialho; Edson Marchiori

    2004-01-01

    Os autores relatam um caso de pneumonia lipídica em um paciente de 80 anos de idade, que iniciou o quadro com dispnéia em repouso. Havia história de constipação crônica, com uso freqüente de laxativos oleosos. O paciente apresentava diminuição do nível de consciência e os familiares relatavam tosse e engasgos freqüentes, durante o uso do medicamento. As radiografias de tórax demonstravam consolidação localizada no segmento posterior do lobo superior do pulmão direito, além de opacidades mal d...

  12. A natural laboratory for 40Ar/39Ar geochronology: ICDP cores from Lake Van, Turkey

    Science.gov (United States)

    Engelhardt, Jonathan; Sudo, Masafumi; Oberhänsli, Roland

    2015-04-01

    Pore water samples from ICDP Paleovan cores indicate a limited pore water exchange within Quaternary lake sediments. The core's volcaniclastic sections bear unaltered K-rich ternary feldspar and fresh to altered glass shards of predominantly rhyolitic composition. Whereas applying the 40Ar/39Ar method on feldspars resulted in ages timing a late-stage crystallization, glass shards had the potential to date the eruption. Volcanic glass is prone to modifications such as hydrous alteration (palagonitization) and devitrification (Cerling et al., 1985). These modifications affect the glass' chemistry and challenge the application of the 40Ar/39Ar method. Gaining precise radiometric ages from two phases has the potential to strengthen a climate-stratigraphic age-model (Stockhecke et al., 2014), and to significantly increase the temporal resolution on the deposition of the lake sediments. Vice versa the core's previous age model has the ability to question the reliability of 40Ar/39Ar eruption ages derived from ternary feldspars and glass shards. Multi- and single-grain total fusion on alkali feldspars from six volcaniclastic deposits resulted in Pleistocene ages that are in good agreement with the predicted age model. Feldspar phenocrysts from three ashes in the core's youngest section yielded consistent isochron ages that are significantly older than the model's prediction. Several distinct stratigraphic and paleomagnetic time markers of similar stratigraphic positions contradict to the older radiometric dates (Stockhecke et al., 2014). Partial resorption features of inherited feldspar domains and the involvement of excess 40Ar indicate incomplete degassing of older domains. To evaluate the magmatic history of the different domains EMPA mappings of trace elements that could be interpreted as Ar diffusion couples are currently conducted. Geochronology on Paleovan cores offers unique opportunities to monitor the effect of alteration on the Ar-systematics of volcanic glass

  13. Dicty_cDB: FC-AR02 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR02 (Link to dictyBase) - - - Contig-U15981-1 FC-AR02P (Li...nk to Original site) FC-AR02F 518 FC-AR02Z 247 FC-AR02P 764 - - Show FC-AR02 Library FC (Link to library) Clone ID FC-AR...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR02Q.Seq.d/ Representative seq. ID FC-AR...02P (Link to Original site) Representative DNA sequence >FC-AR02 (FC-AR02Q) /CSM/FC/FC-AR/FC-AR...logy vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR02 (FC-AR02Q) /CSM/FC/FC-AR/FC-AR

  14. Theoretical photoabsorption spectra of Ar n+ clusters

    Science.gov (United States)

    Doltsinis, Nikos L.; Knowles, Peter J.

    2000-08-01

    The photoabsorption spectra of selected Ar n+ clusters ( n=7, 8, 17, 19, 23) have been investigated theoretically using an extended Diatomics-in-Molecules approach including induced dipole - induced dipole and spin-orbit coupling interaction effects. Our calculations at 0 K confirm the experimentally observed spectral red-shift of the visible photoabsorption peak in the region 15Haberland et al., Phys. Rev. Lett. 67 (1991) 3290] by carrying out finite temperature Monte Carlo simulations.

  15. Escala Diagnóstica Adaptativa Operacionalizada de Autorrelato - EDAO-AR: Evidências de Validade

    Directory of Open Access Journals (Sweden)

    Elisa Medici Pizao Yoshida

    2013-04-01

    Full Text Available A Escala Diagnóstica Adaptativa Operacionalizada-Revisada (EDAO-R fornece medida da eficácia adaptativa, entendida como o grau de sucesso obtido no enfrentamento das vicissitudes da vida. Sua avaliação baseia-se em material de entrevista clínica. O estudo teve por objetivo obter evidências de validade da versão de autorrelato da EDAO-R, ou EDAO-AR. Foram desenvolvidos itens para avaliar a adequação da adaptação de dois setores da personalidade: Afetivo-Relacional (A-R e Produtividade (Pr. A amostra foi composta por 237 pacientes ambulatoriais e acompanhantes. Houve evidências de validade baseada na estrutura interna (consistência interna, análise fatorial, análise de agrupamentos e validade baseada em variáveis externas (relação entre EDAO-AR e Escala de Avaliação de Sintomas-40/EAS-40. Os resultados apontaram boa consistência interna e três dimensões para ambos os setores: foco na situação problema, foco na relação interpessoal e foco no eu. Obteve-se, conforme esperado, correlações negativas entre a EDAO-AR e EAS-40. Foram feitas sugestões para a segunda versão da escala.

  16. Irradiation of samples for 40Ar/39Ar dating using the Soreq Nuclear Research Center IRR-1 Reactor, Israel

    International Nuclear Information System (INIS)

    A facility for the irradiation of geological samples for 40Ar/39Ar dating has been established at the Israel Research Reactor No.1 (IRR-1). A Cd shielded Al irradiation canister is rotated at a position close to the core. The power of the reactor is usually rated at 4.5 MW and the total neutron flux is 1 to 3 x 1013 n/cm2 x s in the center of the core. The ratio of thermal/fast neutrons has been found to be 2 and K2SO4. The Ar production rations for these are: (36Ar/37Ar)Ca = 2.38(±0.28) x 10-4; (39Ar/37Ar)Ca = 12.1(±3.07) x 10-4; (40Ar/39Ar)k = 1.56(±0.40) x 10-2. Irradiations in the reactor are designed to produce 40Ar*/39Ar>1.6 and 40Aratm/37Ar>0.63. This results in convenient measurements with 40Artotal/39Ar near 1. (author)

  17. Arsénico en el agua de bebida: un problema de salud pública Arsênio na água de beber: um problema de saúde pública

    Directory of Open Access Journals (Sweden)

    Alexandra Galetovic Carabantes

    2003-12-01

    Full Text Available La presencia de arsénico en el ambiente es un problema de salud pública debido a que se trata de un evento de alta frecuencia que ha sido detectado en países como Argentina, Brasil, Chile, China, India, México y Taiwán, entre otros. El arsénico fue clasificado por la International Agency for Research on Cancer (IARC, como un agente carcinogénico para humanos con base en estudios epidemiológicos que relacionan la ingestión de arsénico en el agua de bebida y cáncer en la piel y estudios ocupacionales que relacionan la exposición al arsénico y cáncer de pulmón. La Organización Mundial de la Salud (OMS recomienda um valor orientador para agua de bebida de 10 mg As/L. Por su parte la Environmental Protection Agency (EPA, considerando estimativas de riesgo realizadas utilizando modelos estadísticos basados en observaciones en humanos y extrapolando los datos para concentraciones inferiores a 50 µg/L, reducirá el valor guía para arsénico en el agua de bebida de 50 µg/L para 10 µg/L. La utilización de biomarcadores permite el desarrollo de la epidemiología molecular que promete ser una herramienta que ayudará a detectar efectos tempranos en poblaciones expuestas, permitiendo la prevención de efectos nocivos considerando las características genéticas de las poblaciones.A presença de arsênio no ambiente é um problema de saúde pública por ser um evento de alta freqüência detectado em países como Argentina, Brasil, Chile, China, Índia, México e Taiwan, entre outros. O arsênio foi classificado pela Agência Internacional de Pesquisa sobre Câncer (IARC, como um agente carcinogênico para humanos com base em estudos epidemiológicos que relacionam a ingestão de arsênico na água para consumo humano e câncer na pele e estudos ocupacionais que relacionam a exposição ao arsênico e câncer no pulmão.A Organização Mundial da Saúde (OMS recomenda um valor orientador para água de beber de 10 mg As/L, enquanto que a

  18. 40Ar retention in the terrestrial planets.

    Science.gov (United States)

    Watson, E Bruce; Thomas, Jay B; Cherniak, Daniele J

    2007-09-20

    The solid Earth is widely believed to have lost its original gases through a combination of early catastrophic release and regulated output over geologic time. In principle, the abundance of 40Ar in the atmosphere represents the time-integrated loss of gases from the interior, thought to occur through partial melting in the mantle followed by melt ascent to the surface and gas exsolution. Here we present data that reveal two major difficulties with this simple magmatic degassing scenario--argon seems to be compatible in the major phases of the terrestrial planets, and argon diffusion in these phases is slow at upper-mantle conditions. These results challenge the common belief that the upper mantle is nearly degassed of 40Ar, and they call into question the suitability of 40Ar as a monitor of planetary degassing. An alternative to magmatism is needed to release argon to the atmosphere, with one possibility being hydration of oceanic lithosphere consisting of relatively argon-rich olivine and orthopyroxene. PMID:17882213

  19. Ar-O2 rf plasma diagnostics by mass spectrometry

    International Nuclear Information System (INIS)

    An investigation on the nature, energy and fluxes of the dominant species from an rf 13.56 MHz argon-oxygen plasma is realized using quadrupolar mass spectrometer (QMS). The QMS is sampling the plasma species through the anode space charge, being placed on the grounded electrode. The ion energy distributions of the most important ions in plasma, Ar+, Ar++, ArH+, Ar2+, O2+, O+ are investigated. (authors)

  20. High-spin yrast levels of 38Ar

    NARCIS (Netherlands)

    Aarts, H.J.M.; Engelbertink, G.A.P.; Eggenhuisen, H.H.; Ekström, L.P.

    1979-01-01

    High-spin states of 38Ar have been studied with the 35Cl(α, pγ)38Ar reaction at Eα = 18 MeV and with the 24Mg(16O, 2pγ)38Ar reaction at E(16O) = 38 and 45 MeV. The 38Ar level scheme is obtained with the former reaction from a proton-γ coincidence measurement. Gamma-gamma coincidence, γ-ray angular d

  1. Sistema automatizado para aquisição de dados de umidade relativa do ar Automated system for relative humidity data acquisition

    OpenAIRE

    Késia O. da Silva; Sergio O. Moraes; Jarbas H. de Miranda; Anderson M. Palmieri

    2007-01-01

    Devido à importância do ambiente na produção animal e vegetal e, portanto, controle ambiental adequado, o trabalho propõe como objetivo a construção de um sistema de aquisição automatizada de dados de umidade relativa do ar, utilizando-se de microcontrolador de dimensões reduzidas e de baixo custo. A calibração do sensor de umidade relativa foi realizada em três etapas de simulação desenvolvidas em laboratório: caixas perfuradas, dessecador sem tampa contendo sílica-gel em seu fundo e psicrom...

  2. Eficiência de fogões a biomassa e impactos na qualidade do ar interior

    OpenAIRE

    Carvalho, Ricardo Luís Teles de

    2010-01-01

    A combustão residencial de biomassa é uma forma de produção de energia térmica considerada neutra do ponto de vista de CO2 de origem fóssil, mas que pode ter impactos na qualidade do ar. O presente trabalho teve como objectivo analisar o desempenho energético e ambiental de diferentes fogões a biomassa utilizados em habitações unifamiliares. Como resultado da aplicação de um modelo numérico de simulação dinâmica – BSIM Building Simulation – e das experiências realizadas em 6 habitações uni...

  3. Studio del danneggiamento mediante tomografia in luce del sincrotrone: impatto di un cono d’ombra sulla qualità finale delle ricostruzioni

    Directory of Open Access Journals (Sweden)

    Andrea Bernasconi

    2010-07-01

    Full Text Available Un’accurata osservazione della geometria tridimensionale di cricche e difetti è necessaria per lo studio dei meccanismi alla base del processo di danneggiamento. I metodi convenzionali utilizzati a questo scopo sono distruttivi o non possiedono una sufficiente risoluzione. Le tecniche di imaging che utilizzano la luce di sincrotrone, ed in particolare la microtomografia (micro-CT a raggi X, invece, uniscono i vantaggi di una tecnica non distruttiva ad un’elevata risoluzione spaziale e risultano quindi particolarmente interessanti. Un limite all’applicazione di questa tecnica è costituito dalla propensione della cricca a richiudersi una volta rimosso il carico che ha provocato il danneggiamento, superabile attraverso l’impiego di un dispositivo in grado di esercitare un carico di trazione durante l’acquisizione dei dati. Facendo riferimento al set-up sperimentale della linea SYRMEP di Elettra, il sincrotrone di Trieste, e tralasciando per il momento i vincoli legati a pesi e ingombri, è possibile pensare di inserire tra camera di ionizzazione e CCD una macchina per prove di trazione mono-colonna commerciale, in grado di mantenere aperto il difetto per tutta la durata della tomografia. In questo lavoro viene valutato l’impatto di questo vincolo sulla qualità finale delle ricostruzioni.

  4. Dicty_cDB: FC-AR12 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR12 (Link to dictyBase) - - - Contig-U15450-1 FC-AR12E (Li...nk to Original site) - - - - - - FC-AR12E 643 Show FC-AR12 Library FC (Link to library) Clone ID FC-AR12 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR12Q.Seq.d/ Representative seq. ID FC-AR...12E (Link to Original site) Representative DNA sequence >FC-AR12 (FC-AR12Q) /CSM/FC/FC-AR/FC-AR12Q.Seq....cid sequence KMSAKAATKNATKVAVKAPEATTPVETKKSKKDNVMRGLRIEKLVLNICVGESGDRLVRA AKVLEQLTGQTPVYSKARYTVRSFNIRRNEQIAA

  5. Dicty_cDB: FC-AR03 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR03 (Link to dictyBase) - - - Contig-U14922-1 FC-AR03E (Li...nk to Original site) - - - - - - FC-AR03E 619 Show FC-AR03 Library FC (Link to library) Clone ID FC-AR03 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR03Q.Seq.d/ Representative seq. ID FC-AR...03E (Link to Original site) Representative DNA sequence >FC-AR03 (FC-AR03Q) /CSM/FC/FC-AR/FC-AR03Q.Seq....MGELTSAGLSFSSCEIPVRQDIANGYQRLTEVENNIRQGMEDLSNNEQG YFEEGIRDYLRAISSVKELLNDRLDALMSMQNNERNVAAKKEKAAKTTGAKAANMQKEVD DAVRKLTEATTEYEKISASAR

  6. The thermal history of the Lhasa Block, South Tibetan Plateau based on FTD and Ar-Ar dating

    CERN Document Server

    Yang, T F; Lo Chong Huah; Chung, S L; Tien, R L; Xu, R; Deng, W

    1999-01-01

    Twelve basement samples were collected from South Tibet Plateau for FTD and Ar-Ar analysis to demonstrate their uplifting history since Cenozoic era. The preliminary results from different minerals with different closure temperatures, including apatite and zircon for fission-track dating, and K-feldspar, biotite for Ar-Ar dating, show that at least four stages of thermal history can be recognized in the studied area.

  7. A test of the 40Ar/39Ar age spectrum technique on some terrestrial materials

    Science.gov (United States)

    Lanphere, M.A.; Brent, Dalrymple G.

    1971-01-01

    40Ar/39Ar age spectra were determined for 10 terrestrial rock and mineral samples whose geologic history is known from independent evidence. The spectra for six mineral and whole rock samples, including biotite, feldspar, hornblende, muscovite, and granodiorite, that have experienced post-crystallization heating did not reveal the age of crystallization in any obvious way. Minima in the spectra, however, give reasonable maximum ages for reheating and high-temperature maxima can be interpreted as minimum crystallization ages. High-temperature ages of microcline and albite that have not been reheated are approximately 10% younger than the known crystallization age. Apparently there are no domains in these feldspars that have retained radiogenic 40Ar quantitatively. Spectra from two diabase samples that contain significant quantities of excess argon might mistakenly be interpreted as spectra from reheated samples and do not give the age of emplacement. The 40Ar/39Ar age spectrum technique may be a potentially valuable tool for the study of geologic areas with complex histories, but the interpretation of age spectra from terrestrial samples seems to be more difficult than suggested by some previous studies. ?? 1971.

  8. Ar + NO microwave plasmas for Escherichia coli sterilization

    Energy Technology Data Exchange (ETDEWEB)

    Hueso, Jose L; Rico, Victor J; Cotrino, Jose; Gonzalez-Elipe, Agustin R [Instituto de Ciencia de Materiales de Sevilla, Centro Mixto CSIC-Universidad de Sevilla, Centro de Investigaciones Cientificas Isla de la Cartuja, Avda. Americo Vespucio 49, 41092 Sevilla (Spain); Frias, Jose E [Instituto de BioquImica Vegetal y FotosIntesis (IBVF-CSIC). Centro de Investigaciones CientIficas Isla de la Cartuja. Avda Americo Vespucio, 49, 41092 Sevilla (Spain)], E-mail: jhueso@icmse.csic.es

    2008-05-07

    Ar + NO microwave discharges are used for sterilization and the results are compared with additional experiments with Ar, O{sub 2} and N{sub 2}-O{sub 2} plasma mixtures. The NO{sup *} species produced in the Ar-NO mixtures remain up to long distances from the source, thus improving the sterilization efficiency of the process. E. coli individuals exposed to the Ar + NO plasma undergo morphological damage and cell lysis. Combined effects of etching (by O{sup *} and Ar{sup *} species) and UV radiation (from deactivation of NO{sup *} species) are responsible for the higher activity found for this plasma mixture. (fast track communication)

  9. Caso 1/2013: homem de 69 anos com dor súbita em dorso e membro inferior direito e choque

    Directory of Open Access Journals (Sweden)

    Carlos Vinícius Abreu do Espirito Santo

    2013-02-01

    Full Text Available MSM, homem, 69 anos, procurou atendimento médico por dor em dorso esquerdo e membro inferior direito. A radiografia de tórax revelou alargamento do mediastino. Estava em observação quando apresentou rebaixamento da consciência e choque. Foi observado enfisema subcutâneo em hemitórax esquerdo e abolição do murmúrio vesicular em base do mesmo pulmão. Foi feita a intubação orotraqueal e realizada drenagem de hemitórax esquerdo, com saída de líquido serossanguinolento. O ecocardiograma revelou ventrículo esquerdo (D/S: 44/29 mm; septo 12 mm; parede posterior 13 mm; discreta dilatação em raiz da aorta, presença de lâmina de dissecção e hematoma periaórtico. As valvas e pericárdio eram normais. O paciente foi transferido para o InCor. O exame físico (21 out 2004: 10h45 revelou paciente sedado, com intubação orotraqueal, com palidez cutânea, frequência cardíaca 90 bpm, pressão arterial 130 x 80 mmHg, drenagem torácica sanguinolenta do dreno tórax. Eletrocardiograma - frequência 90 bpm, ritmo sinusal, baixa voltagem no plano frontal e diminuição de voltagem em derivações esquerdas (fig. 1. A tomografia revelou enfisema subcutâneo bilateral, aorta torácica com contornos imprecisos na sua porção descendente (da artéria subclávia até porção média, colapso do pulmão esquerdo e grande coleção de características hemáticas em mesmo hemitórax e no mediastino médio e posterior. Pequeno pneumotórax à direita; pequeno derrame pleural à direita com alterações do parênquima subjacente. A análise do coração foi prejudicada pela presença do hemotórax. Durante a realização de tomografia apresentou ausência de pulsos, midríase, com assistolia, sem resposta às manobras de ressuscitação e faleceu (21 out 2011; 15h.

  10. Gunshot wounds to the head. Correlations between CT and clinical findings, neurosurgical treatment and long-term sequels; Traumi cranio-encefalici da proiettile: correlazione tra tomografia computerizzata, clinica, trattamento neurochirurgico e sequele a distanza

    Energy Technology Data Exchange (ETDEWEB)

    Salzano, A.; Nocera, V. [Ospedale S. Giovanni di Dio, Frattamaggiore, NA (Italy). Servizio di Radiologia; De Rosa, A.; Nunziata, A. [Ospedale Loreto Mare, Neaples (Italy). Servizio di Radiologia; Rossi, E.; Brunese, L. [Universita' degli Studi Federico II, Neaples (Italy). Ist. di Scienze Radiologiche; Tuccillo, M. [Azienda Ospedaliera di Rilievo Nazionale A. Cardarelli, Neaples (Italy). Servizio di Radiologia; Grassi, R. [Seconda Universita' degli Studi, Neaples (Italy). Ist. di Radiologia

    2000-03-01

    With the aim of demonstrating the usefulness of computerised tomography (CT) findings in the planning of brain neurosurgery in gunshot victims, for prompt and successful treatment, 30 patients with brain gunshot wounds were examined with CT over 5 years. The mortality rate of firearm wounds of the skull base was 34% higher than that of the hemisphere; this is due to carotid hemorrhage and midbrain damage. Such traumas require emergency radiological diagnosis and neurosurgical treatment because of their severity and early irreversible complications. Complex operations and skilled surgeons may prevent disabling postoperative sequels. CT findings are indispensable and must be correctly interpreted. The radiologist and the neurosurgeon must collaborate closely and both must consider several diagnostic factors affecting surgical planning. [Italian] Scopo dello studio e' stato quello di dimostrare l'utilita' della semeiologia della tomografia computerizzata in relazione con la pianificazione dell'intervento neochirurgico, al fine di attuare con tempestivita' interventi chirurgici soddisfacenti e meno lesivi. Lo studio comprende 30 casi di lesioni cranio-encefaliche da arma da fuoco esaminate con tomografia computerizzata nel periodo di 5 anni. Materiali e metodi utilizzati sono analiticamente descritti. L'esperienza dimostra che nelle lesioni da arma da fuoco del basicranio si nota una mortalita' del 34% superiore rispetto a quelle piu' craniali come quelle emisferiche in relazione a emorragie carotidee e lesioni tronco-mesencefaliche. Tali traumi esigono diagnosi radiologica e terapia neurochirurgica d'urgenza per la gravita' e le precoci complicanze irreversibili. Cio' richiede interventi complessi e manualita' esperte e rapide al fine di evitare sequele postoperatorie invalidanti. La corretta e indispensabile interpretazione dei segni radiologici della tomografia computerizzata deve avvenire in stretta

  11. Operation of a Thick Gas Electron Multiplier (THGEM) in Ar, Xe and Ar-Xe

    International Nuclear Information System (INIS)

    We present the results of our recent studies of a Thick Gaseous Electron Multiplier (THGEM)-based detector, operated in Ar, Xe and Ar:Xe (95:5) at various gas pressures. Avalanche-multiplication properties and energy resolution were investigated with soft x-rays for different detector configurations and parameters. Gains above 104 were reached in a double-THGEM detector, at atmospheric pressure, in all gases, in almost all the tested conditions; in Ar:Xe (95:5) similar gains were reached at pressures up to 2 bar. The energy resolution dependence on the gas, pressure, hole geometry and electric fields was studied in detail, yielding in some configurations values below 20% FWHM with 5.9 keV x-rays

  12. MEIS1 functions as a potential AR negative regulator

    International Nuclear Information System (INIS)

    The androgen receptor (AR) plays critical roles in human prostate carcinoma progression and transformation. However, the activation of AR is regulated by co-regulators. MEIS1 protein, the homeodomain transcription factor, exhibited a decreased level in poor-prognosis prostate tumors. In this study, we investigated a potential interaction between MEIS1 and AR. We found that overexpression of MEIS1 inhibited the AR transcriptional activity and reduced the expression of AR target gene. A potential protein–protein interaction between AR and MEIS1 was identified by the immunoprecipitation and GST pull-down assays. Furthermore, MEIS1 modulated AR cytoplasm/nucleus translocation and the recruitment to androgen response element in prostate specific antigen (PSA) gene promoter sequences. In addition, MEIS1 promoted the recruitment of NCoR and SMRT in the presence of R1881. Finally, MEIS1 inhibited the proliferation and anchor-independent growth of LNCaP cells. Taken together, our data suggests that MEIS1 functions as a novel AR co-repressor. - Highlights: • A potential interaction was identified between MEIS1 and AR signaling. • Overexpression of MEIS1 reduced the expression of AR target gene. • MEIS1 modulated AR cytoplasm/nucleus translocation. • MEIS1 inhibited the proliferation and anchor-independent growth of LNCaP cells

  13. Argon defect complexes in low energy Ar irradiated molybdenum

    Energy Technology Data Exchange (ETDEWEB)

    van Veen, A.; Buters, W.T.M.; van der Kolk, G.J.; Caspers, L.M. (Interuniversitair Reactor Instituut, Delft (Netherlands)); Armstrong, T.R. (Victoria Univ., Wellington (New Zealand). Dept. of Physics)

    1982-03-15

    Thermal desorption spectrometry has been used to study the defects created in Mo irradiated along the <110> direction with Ar ions ranging in energy from 0.1 to 2 keV. In addition to monitoring the release of the implanted Ar, additional information has been obtained by decoration of the defects with low energy helium and subsequent monitoring of the helium release. The studies show evidence that the Ar can be trapped in both substitutional sites and in a configuration in which the Ar is associated with vacancies (ArVsub(n), n >= 2). Most of the Ar implanted at high energy is released at approx. equal to 1500 K by thermal vacancy assisted diffusion. Argon trapped closer to the surface is released at lower temperatures via at least three different surface related release mechanisms. Additional results are presented on the interaction of self interstitial atoms (introduced by 100 eV Xe bombardment) with the Ar defects. Substitutional Ar is found to convert to interstitial Ar which seems to be mobile at room temperature. The Ar-vacancy complexes are found to be reduced to substitutional Ar. The results of atomistic calculations of the release mechanisms will also be presented.

  14. MEIS1 functions as a potential AR negative regulator

    Energy Technology Data Exchange (ETDEWEB)

    Cui, Liang [Department of Urology, Chinese PLA Medical School/Chinese PLA General Hospital, Beijing 100853 (China); Department of Urology, Civil Aviation General Hospital/Civil Aviation Medical College of Peking University, Beijing 100123 (China); Li, Mingyang [Department of Gastroenterology, Nan Lou Division, Chinese PLA Medical School/Chinese PLA General Hospital, Beijing 100853 (China); Feng, Fan [Department of Pharmacy, General Hospital of Shenyang Military Command, Shenyang 110016 (China); Yang, Yutao [Beijing Institute for Neuroscience, Capital Medical University, Beijing 100069 (China); Hang, Xingyi [National Scientific Data Sharing Platform for Population and Health, Beijing 100730 (China); Cui, Jiajun, E-mail: cuijn@ucmail.uc.edu [Department of Cancer and Cell Biology, University of Cincinnati College of Medicine, Cincinnati, OH 45267 (United States); Gao, Jiangping, E-mail: jpgao@163.com [Department of Urology, Chinese PLA Medical School/Chinese PLA General Hospital, Beijing 100853 (China)

    2014-10-15

    The androgen receptor (AR) plays critical roles in human prostate carcinoma progression and transformation. However, the activation of AR is regulated by co-regulators. MEIS1 protein, the homeodomain transcription factor, exhibited a decreased level in poor-prognosis prostate tumors. In this study, we investigated a potential interaction between MEIS1 and AR. We found that overexpression of MEIS1 inhibited the AR transcriptional activity and reduced the expression of AR target gene. A potential protein–protein interaction between AR and MEIS1 was identified by the immunoprecipitation and GST pull-down assays. Furthermore, MEIS1 modulated AR cytoplasm/nucleus translocation and the recruitment to androgen response element in prostate specific antigen (PSA) gene promoter sequences. In addition, MEIS1 promoted the recruitment of NCoR and SMRT in the presence of R1881. Finally, MEIS1 inhibited the proliferation and anchor-independent growth of LNCaP cells. Taken together, our data suggests that MEIS1 functions as a novel AR co-repressor. - Highlights: • A potential interaction was identified between MEIS1 and AR signaling. • Overexpression of MEIS1 reduced the expression of AR target gene. • MEIS1 modulated AR cytoplasm/nucleus translocation. • MEIS1 inhibited the proliferation and anchor-independent growth of LNCaP cells.

  15. Achados tomográficos em 1000 pacientes consecutivos com antecedentes de crises epilépticas

    Directory of Open Access Journals (Sweden)

    Trentin Ana Paula

    2002-01-01

    Full Text Available Analizamos retrospectivamente as tomografias computadorizadas (TC de crânio de 1000 pacientes consecutivos, com história clínica de crises epilépticas classificadas do ponto de vista clínico em generalizadas (CG e parciais (CP. Nossos resultados mostraram a presença de CG em 70,7% dos pacientes, sendo 57,1% do sexo masculino e 42,9% do sexo feminino e, CP em 29,3%, sendo 60,0% do sexo maculino e 40,0% do sexo femninino. As faixas etárias de maior incidência foram entre 0 a 10 (31,0% e 11 a 20 (21,8% anos nos pacientes com CG e 0 a 10 (24,5%, 21 a 30 (16,7% e 31 a 40 anos (18,4% nos pacientes com CP. Os resultados tomográficos no grupo com CG foram: normais (48,8% e alterados em 51,2%, sendo esses achados definidos como calcificações/cisticercose (14,0%, neurocisticercose/cistos (9,6% hidrocefalia (4,4%, infarto (4,2%, indefinido (4,0%, tumor (2,5% entre outros (12,5,%. Nos pacientes com CP os exames tomográficos foram normais em 37,4%, alterados em 62,7%, tendo os diagnósticos de neurocisticercose/cistos (12,2%, calcificações/cisticercose (11,2%, tumor (10,5%, indefinido (8,1%, infarto (5,4%, hidrocefalia (3,7% e outros (11,6%. Salientamos a importância da TC em pacientes com epilepsia, particularmente para o diagnóstico de neurocisticercose.

  16. Métodos de análise da composição corporal em adultos obesos

    Directory of Open Access Journals (Sweden)

    Rávila Graziany Machado de Souza

    2014-10-01

    Full Text Available Os métodos de avaliação da composição corporal em obesos têm sido amplamente discutidos, uma vez que nesses indivíduos a avaliação é dificultada devido às limitações dos equipamentos e características dos métodos utilizados. Esta sessão temática tem o objetivo de esclarecer as características, vantagens e limitações dos métodos de avaliação da composição corporal em adultos obesos. A quantificação de gordura corporal e mas-sa livre de gordura, assim como a avaliação da perda de massa muscular e de massa óssea em obesos são temas de grande interesse científico, uma vez que são utilizados para diagnosticar a obesidade osteosarcopênica. A avaliação da composição corporal de obesos pelo modelo de múltiplos compartimentos é padrão-ouro na prática científica. Por outro lado, o método de absorciometria radiológica de feixe duplo é considerado o padrão de referência em pesquisas e na prática clínica. Estudos indicam que a ressonância magnética e a tomografia computadorizada, em alguns casos, são fortemente correlacionadas com a absorciometria radiológica de feixe duplo. Os demais métodos apresentam limitações em avaliar a composição corporal, bem como suas modificações durante a redução ponderal em indivíduos obesos.

  17. 40Ar/39Ar and cosmic ray exposure ages of plagioclase-rich lithic fragments from Apollo 17 regolith, 78461

    Science.gov (United States)

    Das, J. P.; Baldwin, S. L.; Delano, J. W.

    2016-01-01

    Argon isotopic data is used to assess the potential of low-mass samples collected by sample return missions on planetary objects (e.g., Moon, Mars, asteroids), to reveal planetary surface processes. We report the first 40Ar/39Ar ages and 38Ar cosmic ray exposure (CRE) ages, determined for eleven submillimeter-sized (ranging from 0.06 to 1.2 mg) plagioclase-rich lithic fragments from Apollo 17 regolith sample 78461 collected at the base of the Sculptured Hills. Total fusion analysis was used to outgas argon from the lithic fragments. Three different approaches were used to determine 40Ar/39Ar ages and illustrate the sensitivity of age determination to the choice of trapped (40Ar/36Ar)t. 40Ar/39Ar ages range from ~4.0 to 4.4 Ga with one exception (Plag#10). Surface CRE ages, based on 38Ar, range from ~1 to 24 Ma. The relatively young CRE ages suggest recent re-working of the upper few centimeters of the regolith. The CRE ages may result from the effect of downslope movement of materials to the base of the Sculptured Hills from higher elevations. The apparent 40Ar/39Ar age for Plag#10 is >5 Ga and yielded the oldest CRE age (i.e., ~24 Ma). We interpret this data to indicate the presence of parentless 40Ar in Plag#10, originating in the lunar atmosphere and implanted in lunar regolith by solar wind. Based on a chemical mixing model, plagioclase compositions, and 40Ar/39Ar ages, we conclude that lithic fragments originated from Mg-suite of highland rocks, and none were derived from the mare region.

  18. Anormalidades de fluxo sangüíneo cerebral em indivíduos dependentes de cocaína Cerebral blood flow abnormalities in cocaine dependent subjects

    OpenAIRE

    Sergio Nicastri; Buchpiguel, Carlos A.; Andrade, Arthur G.

    2000-01-01

    INTRODUÇÃO: Nos últimos anos, tem havido relatos de anormalidades do fluxo sanguíneo cerebral em indivíduos com o abuso de cocaína, detectadas por meio de tomografia computadorizada por emissão de fóton único (SPECT). Esse padrão anormal de perfusão cerebral tem sido associado a prejuízos cognitivos mas não a alterações observáveis por meio de exames de neuroimagem estrutural. Um problema envolvendo a maioria dos trabalhos publicados sobre esse tema é a inclusão de um grande número de usuário...

  19. Argon in hornblende, biotite and muscovite in geologic cooling - Ar-40/Ar-39-investigations

    International Nuclear Information System (INIS)

    The results of the Ar-40/Ar-39 studies are discussed under the aspect of whether the age data of the minerals indicate a cooling process. The author hopes that isotope dating of minerals with different closing temperatures will describe the temperature/time history of an area in the temperature range of 600 to 2000C. The findings are analyzed under three aspects: How much do they contribute to the initial methodological question, what do they contribute to the regional geology of the areas investigated, and in what respects do they extent the present knowledge of the geochronological analysis, i.e. its techniques and interpretation. (orig.)

  20. Ar-Ar Dating of Martian Chassignites, NWA2737 and Chassigny, and Nakhlite MIL03346

    Science.gov (United States)

    Bogard, D. D.; Garrison, D. H.

    2006-01-01

    Until recently only three nakhlites and one chassignite had been identified among martian meteorites. These four exhibit very similar radiometric ages and cosmic ray exposure (CRE) ages, indicating that they may have derived from a common location on Mars and were ejected into space by a single impact. This situation is quite different from that of martian shergottites, which exhibit a range of radiometric ages and CRE ages (1). Recently, several new nakhlites and a new martian dunite (NWA2737) have been recognized. Here we report our results of Ar-39-Ar-40 dating for the MIL03346 nakhlite and the NWA2737 "chassignite", along with new results on Chassigny.

  1. Vaporization of the Ar+Ni system

    International Nuclear Information System (INIS)

    Using the 4π multidetector INDRA, collisions between 36Ar and 58Ni have been investigated over a broad bombarding energy range, from 32 to 95 AMeV. The onset for complete vaporization of the system into neutrons, H and He isotopes as well as the evolution with energy of the isotopic composition of the vaporization events were determined. Binary dissipative collisions are found to be the dominant mechanism producing the vaporization events. A statistical sequential decay of the two partners is a possible explanation for the vaporization events observed. (author) 18 refs.; 3 figs

  2. SUMER-IRIS Observations of AR11875

    Science.gov (United States)

    Schmit, Donald; Innes, Davina

    2014-05-01

    We present results of the first joint observing campaign of IRIS and SOHO/SUMER. While the IRIS datasets provide information on the chromosphere and transition region, SUMER provides complementary diagnostics on the corona. On 2013-10-24, we observed an active region, AR11875, and the surrounding plage for approximately 4 hours using rapid-cadence observing programs. These datasets include spectra from a small C -class flare which occurs in conjunction with an Ellerman-bomb type event. Our analysis focusses on how the high spatial resolution and slit jaw imaging capabilities of IRIS shed light on the unresolved structure of transient events in the SUMER catalog.

  3. The Spectroscopic study of 33Ar

    International Nuclear Information System (INIS)

    The proton-rich nucleus 33Ar has been produced at the low-energy facility SPIRAL at GANIL. Spectroscopic studies of gamma and p emission of this nucleus were performed with the 'Silicon Cube' detection system. The analysis of proton and gamma singles and coincidence spectra allowed us to establish a complete decay scheme of this nucleus. The comparison of the Gamow-Teller strength distribution deduced from our experiment and the theoretical one obtained with the Shell Model permitted the determination of a quenching factor for the Gamow-Teller strength.

  4. Dicty_cDB: FC-AR10 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR10 (Link to dictyBase) - - - Contig-U15065-1 FC-AR10P (Li...nk to Original site) FC-AR10F 417 FC-AR10Z 438 FC-AR10P 855 - - Show FC-AR10 Library FC (Link to library) Clone ID FC-AR...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR10Q.Seq.d/ Representative seq. ID FC-AR...10P (Link to Original site) Representative DNA sequence >FC-AR10 (FC-AR10Q) /CSM/FC/FC-AR/FC-AR...DILSYI*k*kk*k*kpi*i*i*ik Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR10 (FC-AR

  5. Dicty_cDB: FC-AR05 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR05 (Link to dictyBase) - G24049 DDB0188590 Contig-U15127-1 FC-AR...05Z (Link to Original site) - - FC-AR05Z 510 - - - - Show FC-AR05 Library FC (Link to library) Clone ID FC-AR...7-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR05Q.Se...q.d/ Representative seq. ID FC-AR05Z (Link to Original site) Representative DNA sequence >FC-AR05 (FC-AR05Q) /CSM/FC/FC-AR/FC-AR...C-AS24Q) /CSM/FC/FC-AS/FC-AS24Q.Seq.d/ 381 e-105 FC-AR05 (FC-AR05Q) /CSM/FC/FC-AR/FC-AR05Q.Seq.d/ 381 e-105

  6. Dicty_cDB: FC-AR16 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR16 (Link to dictyBase) - - - Contig-U15457-1 FC-AR16E (Li...nk to Original site) - - - - - - FC-AR16E 387 Show FC-AR16 Library FC (Link to library) Clone ID FC-AR16 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR16Q.Seq.d/ Representative seq. ID FC-AR...16E (Link to Original site) Representative DNA sequence >FC-AR16 (FC-AR16Q) /CSM/FC/FC-AR/FC-AR16Q.Seq....26 0.0 VFG822 (VFG822Q) /CSM/VF/VFG8-A/VFG822Q.Seq.d/ 726 0.0 FC-AR16 (FC-AR16Q) /CSM/FC/FC-AR/FC-AR16Q.Seq.

  7. Dicty_cDB: FC-AR17 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR17 (Link to dictyBase) - - - Contig-U15982-1 FC-AR17P (Li...nk to Original site) FC-AR17F 264 FC-AR17Z 543 FC-AR17P 807 - - Show FC-AR17 Library FC (Link to library) Clone ID FC-AR...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR17Q.Seq.d/ Representative seq. ID FC-AR...17P (Link to Original site) Representative DNA sequence >FC-AR17 (FC-AR17Q) /CSM/FC/FC-AR/FC-AR...gy vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR17 (FC-AR

  8. Dicty_cDB: FC-AR01 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR01 (Link to dictyBase) - - - Contig-U15659-1 FC-AR01Z (Li...nk to Original site) - - FC-AR01Z 467 - - - - Show FC-AR01 Library FC (Link to library) Clone ID FC-AR01 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR01Q.Seq.d/ Representative seq. ID FC-AR...01Z (Link to Original site) Representative DNA sequence >FC-AR01 (FC-AR01Q) /CSM/FC/FC-AR/FC-AR01Q.Seq....es producing significant alignments: (bits) Value FC-AR01 (FC-AR01Q) /CSM/FC/FC-AR/FC-AR01Q.Seq.d/ 910 0.0 S

  9. Dicty_cDB: FC-AR23 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR23 (Link to dictyBase) - - - Contig-U15115-1 FC-AR23Z (Li...nk to Original site) - - FC-AR23Z 557 - - - - Show FC-AR23 Library FC (Link to library) Clone ID FC-AR23 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR23Q.Seq.d/ Representative seq. ID FC-AR...23Z (Link to Original site) Representative DNA sequence >FC-AR23 (FC-AR23Q) /CSM/FC/FC-AR/FC-AR23Q.Seq....vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR23 (FC-AR23Q) /CSM/FC/FC-AR/FC-AR

  10. O perfil Brasileiro de propriedade intelectual em radiologia e diagnóstico por imagem em um contexto internacional, nos anos 2000-2009

    Directory of Open Access Journals (Sweden)

    Paulo Roberto Barbosa Serapião

    2011-08-01

    Full Text Available OBJETIVO: Analisar a inovação tecnológica brasileira na área de radiologia e diagnóstico por imagem, em termos de indicadores de patentes. MATERIAIS E MÉTODOS: Este é um estudo analítico-exploratório de informações recuperadas por meio de consultas cruzadas nas bases de dados dos escritórios de propriedade intelectual do Brasil (Instituto Nacional da Propriedade Industrial - INPI, dos Estados Unidos (United States Patent and Trademark Office - USPTO e da Europa (European Patent Office - EPO. RESULTADOS: Foram encontradas 277.057 patentes. Desse total, 7.800 foram registradas no INPI (3%, 65.428 (24% registradas no EPO e 203.829 (73% emitidas no USPTO. O Brasil é o país signatário em 1.732 patentes publicadas no INPI, 80 no EPO e 26 no escritório USPTO. Globalmente, 219.993 (79% patentes referiam-se a dispositivos eletrônicos ligados a informática em saúde, ultrassonografia, ressonância magnética, tomografia computadorizada e procedimentos de geração, comunicação e arquivamento de imagens, e 57.064 (21% das patentes tratavam das tecnologias relacionadas a radioproteção e dosimetria, física nuclear, eletroterapia, terapia magnética e radioterapia. CONCLUSÃO: Os resultados obtidos apontam para a fragilidade da produção nacional de inovação tecnológica registrada em patentes, no campo de radiologia e diagnóstico por Imagem.

  11. Espondilite tuberculosa em adolescente Tuberculous spondylitis in teenager

    Directory of Open Access Journals (Sweden)

    Marta Maciel Lyra Cabral

    2005-06-01

    Full Text Available Relata-se o caso de uma adolescente com tuberculose osteoarticular em coluna lombossacral, uma localização incomum. O seu diagnóstico permanece um desafio por apresentar sintomas gerais inespecíficos e lesões ósseas que podem ser confundidas com outras afecções. A doença é degenerativa e de prognóstico reservado. São discutidos aspectos clínicos, laboratoriais e de imagem, incluindo tomografia computadorizada e ressonância magnética. A reação em cadeia da polimerase, usando o marcador IS 6110 para M. tuberculosis, foi positiva, sugerindo fortemente a presença do patógeno. Este ensaio é particularmente indicado quando se exige um diagnóstico de tuberculose rápido e sensível.This article presents a case report of osteoarticular tuberculosis affecting lumbar sacral column non-typical attack. The diagnosis remains a medical challenge because the symptoms and bone lesions are not specific and can be mislead with other morbidity such as inflammatory, circulatory, metabolic, traumatic, congenital and tumoral diseases. The disease is degenerative and the prognosis not satisfactory. Besides the clinical aspects and laboratory, imaging results, including computed tomography and magnetic ressonance, are discussed. A PCR system targeting the IS 6110 of M. tuberculosis was positive, strongly suggesting the presence of this pathogen. This assay would be particularly indicated when quick and sensitive diagnosis of tuberculosis is required.

  12. New high-precision 40Ar/39Ar ages on Oligocene volcanic rocks of northwestern Kenya

    Science.gov (United States)

    Brown, Francis H.; Jicha, Brian R.

    2016-02-01

    New, high-precision 40Ar/39Ar ages from volcanic rocks in northwestern Kenya are provided for some areas of exposure in this remote area. We report seven 40Ar/39Ar ages generated from single crystal total fusion experiments on alkali feldspar separated from volcanic rocks in the Mogila, Songot, and Lokwanamur Ranges and the Gatome valley. A rhyolite from the lower part of the sequence in the Mogila Range yielded ages of 32.31 ± 0.06 Ma and 32.33 ± 0.07 Ma, and a rhyolite near the top of that sequence yielded 31.67 ± 0.04 Ma. A single sample from the Songot Range yielded an age of 32.49 ± 0.07 Ma, slightly older than the rocks collected from Mogila. In both ranges the early Oligocene rhyolites are underlain by basalts, as is also the case in the Labur Range. Ages of 25.95 ± 0.03 Ma, 25.91 ± 0.04 Ma, and 27.15 ± 0.03 Ma were measured on alkali feldspar from rhyolites from the Lokwanamur Range, and the nearby Gatome valley. All of these rocks are part of an episode of widespread volcanism in northwestern Kenya in the mid-to late Oligocene that is not currently known from the Ethiopian Rift Valley.

  13. Solo de um gato preto em clarinetas de neve: autobiografias de Érico Veríssimo em ponto e contraponto

    OpenAIRE

    Eva Paulino Bueno

    2011-01-01

    No início do segundo volume de suas memórias, <em style="mso-bidi-font-style: normal;">Solo de clarinetaem>, Érico Veríssimo está relatando suas angústicas e incertezas antes de começar a escrever <em style="mso-bidi-font-style: normal;">O arquipélagoem>, a última parte da sua...

  14. Contributions to the 37Ar background by research reactor operations

    International Nuclear Information System (INIS)

    Radioargon has been identified as a useful nuclide for verifying compliance with the Comprehensive Nuclear-Test-Ban Treaty. Use of 37Ar to identify a nuclear explosion requires quantification of contributions to the 37Ar background at a potential measurement site. A method of estimating 37Ar release activities using isotopes of radioxenon and radioargon has been developed in this paper. Numerical solutions to the system of equations describing air-activation in a reactor were used to determine ratios of release activities for 135Xe/133Xe, 133mXe/131mXe, and 37Ar /41Ar as function of irradiation time and off-gas residence time prior to measurement and release. Published radioactive noble gas effluent data for the High Flux Isotope Reactor, HFIR (ORNL) from the year 1996 to 2010 were compiled as a test data set to predict the 37Ar release on a yearly basis. An average 37Ar release rate of 1.86 x 1010 Bq per year was calculated. The estimated release rate was used as a source term for atmospheric transport to run a test case for 37Ar release over a typical HFIR operation cycle. Results showed that ground-level concentrations of 37Ar did not exceed the minimum detectable concentration for a 37Ar field measurement system beyond the immediate vicinity of the release point. (author)

  15. Reference Gene Selection in the Desert Plant <em>Eremosparton songoricuem>m>

    Directory of Open Access Journals (Sweden)

    Dao-Yuan Zhang

    2012-06-01

    Full Text Available <em>Eremosparton songoricum em>(Litv. Vass. (<em>E. songoricumem> is a rare and extremely drought-tolerant desert plant that holds promise as a model organism for the identification of genes associated with water deficit stress. Here, we cloned and evaluated the expression of eight candidate reference genes using quantitative real-time reverse transcriptase polymerase chain reactions. The expression of these candidate reference genes was analyzed in a diverse set of 20 samples including various <em>E. songoricumem> plant tissues exposed to multiple environmental stresses. GeNorm analysis indicated that expression stability varied between the reference genes in the different experimental conditions, but the two most stable reference genes were sufficient for normalization in most conditions.<em> EsEFem> and <em>Esα-TUB> were sufficient for various stress conditions, <em>EsEF> and <em>EsACT> were suitable for samples of differing germination stages, and <em>EsGAPDH>and <em>Es>UBQ em>were most stable across multiple adult tissue samples. The <em>Es18Sem> gene was unsuitable as a reference gene in our analysis. In addition, the expression level of the drought-stress related transcription factor <em>EsDREB2em>> em>verified the utility of<em> E. songoricumem> reference genes and indicated that no single gene was adequate for normalization on its own. This is the first systematic report on the selection of reference genes in <em>E. songoricumem>, and these data will facilitate future work on gene expression in this species.

  16. Arsenic phytoextraction and hyperaccumulation by fern species Fitoextração e hiperacumulação de arsênio por espécies de samambaias

    Directory of Open Access Journals (Sweden)

    Maria Isidoria Silva Gonzaga

    2006-02-01

    Full Text Available Arsenic (As is an ubiquitous trace metalloid found in all environmental media. Its presence at elevated concentrations in soils derives from both anthropogenic and natural inputs. Arsenic is a toxic and carcinogenic element, which has caused severe environmental and health problem worldwide. Technologies currently available for the remediation of arsenic-contaminated sites are expensive, environmentally disruptive, and potentially hazardous to workers. Phytoextraction, a strategy of phytoremediation, uses plants to clean up contaminated soils and has been successfully applied to arsenic contaminated soils. It has the advantage of being cost-effective and environmentally friendly. A major step towards the development of phytoextraction of arsenic-impacted soils is the discovery of the arsenic hyper accumulation in ferns, first in Pteris vittata, which presented an extraordinary capacity to accumulate 2.3% arsenic in its biomass. Another fern, Pityrogramma calomelanos was found to exhibit the same hyperaccumulating characteristics. After that, screening experiments have revealed that the Pteris genus is really unique in that many species have the potential to be used in phytoextraction of arsenic. In general, these plants seem to have both constitutive and adaptive mechanisms for accumulating or tolerating high arsenic concentration. In the past few years, much work has been done to understand and improve the hyperaccumulating capability of these amazing plants. In particular, the field of molecular biology seems to hold the key for the future of the phytoremediation.O arsênio e um metalóide traço encontrado basicamente em todos os ambientes. Elevadas concentrações de arsênio no solo podem acontecer naturalmente devido ao intemperismo de rochas ricas em arsênio, como também de atividades antropogênicas. O arsênio é um elemento tóxico e cancerígeno. Em muitas partes do mundo, a contaminação pelo arsênio tem causado problemas

  17. What to teach to patients with heart failure and why: the role of nurses in heart failure clinics ¿Qué enseñar a los pacientes con insuficiencia cardiaca y por qué?: el papel de los enfermeros en clínicas de insuficiencia cardíaca O que ensinar aos pacientes com insuficiência cardíaca e por quê: o papel dos enfermeiros em clínicas de insuficiência cardíaca

    Directory of Open Access Journals (Sweden)

    Eneida Rejane Rabelo

    2007-02-01

    ón para el manejo de la enfermedad y el desarrollo de la capacidad de autoayuda. En este artículo revisaremos en detalle aspectos de la educación para pacientes con insuficiencia cardiaca dada por enfermeros.O principal objetivo do tratamento da insuficiência cardíaca (IC consiste em alcançar e manter a estabilidade clínica dos pacientes. Vários estudos demonstram que programas multidisciplinares para educação sistemática sobre a doença são estratégias positivas para estes pacientes. Enfermeiros engajados em clínicas de IC desempenham papel fundamental no processo de educação e acompanhamento dos pacientes. Os objetivos deste processo são ensinar, reforçar, melhorar e avaliar constantemente as habilidades dos pacientes para o autocuidado, que incluem a monitorização do peso, a restrição de sódio e de líquidos, a realização de atividade física, o uso regular das medicações, a monitorização de sinais e de sintomas de piora da doença e o contato precoce com a equipe assistencial. Desta forma, a educação para o entendimento da IC, e o desenvolvimento de habilidades para o autocuidado, são considerados chaves para melhorar a adesão, evitar crises de descompensação e conseqüentemente manter a estabilidade clínica dos pacientes. Neste artigo nos revisamos detalhadamente os aspectos envolvidos no processo de educação dispensados aos pacientes por enfermeiros no contexto das clínicas de IC.

  18. Identification and analysis of ARS function of six plant MARs

    Institute of Scientific and Technical Information of China (English)

    LI Hong; YANG Yutao; ZHANG Kewei; ZHENG Chengchao

    2004-01-01

    Six plant MARs isolated from tobacco and Arabdiposis were investigated for their ARS activity in yeast.The results showed that among the six plant MARs, only TM1 and AM4 had strong ARS activity which was almost the same as that of ARS from yeast chromosome. In order to further identify the core region of the two MARs for the ARS activity, a series of subclones were created by PCR strategy,and the corresponding subclones were designated as TM1-1,TM1-2, TM1-3, AM4-1, AM4-2 and AM4-3, respectively. Our studies revealed that TM1-3 and AM4-3 not only had higher ARS activity, but also displayed higher transformation frequency, plasmid stability and growth rate compared to their intact MARs, TM1 and AM4. These data present an important clue for further elucidating the relationship between MAR and ARS.

  19. Empilhamento de ar e compressão torácica aumentam o pico de fluxo da tosse em pacientes com distrofia muscular de Duchenne Air stacking and chest compression increase peak cough flow in patients with Duchenne muscular dystrophy

    Directory of Open Access Journals (Sweden)

    Magneide Fernandes Brito

    2009-10-01

    Full Text Available OBJETIVO: Avaliar a eficiência da tosse através do uso de duas manobras manuais de auxílio à tosse. MÉTODOS: Foram selecionados 28 pacientes portadores de distrofia muscular de Duchenne em uso de ventilação mecânica não-invasiva noturna e CVF OBJECTIVE: To evaluate cough efficiency using two manually-assisted cough techniques. METHODS: We selected 28 patients with Duchenne muscular dystrophy. The patients were receiving noninvasive nocturnal ventilatory support and presented FVC values < 60% of predicted. Peak cough flow (PCF was measured, with the patient seated, at four time points: at baseline, during a spontaneous maximal expiratory effort (MEE; during an MEE while receiving chest compression; during an MEE after air stacking with a manual resuscitation bag; and during an MEE with air stacking and compression (combined technique. The last three measurements were conducted in random order. The results were compared using Pearson's correlation test and ANOVA with repeated measures, followed by Tukey's post-hoc test (p < 0.05. RESULTS: The mean age of the patients was 20 ± 4 years, and the mean FVC was 29 ± 12%. Mean PCF at baseline, with chest compression, after air stacking and with the use of the combined technique was 171 ± 67, 231 ± 81, 225 ± 80, and 292 ± 86 L/min, respectively. The results obtained with the use of the combined technique were significantly better than were those obtained with the use of either technique alone (F[3.69] = 67.07; p < 0.001. CONCLUSIONS: Both chest compression and air stacking techniques were efficient in increasing PCF. However, the combination of these two techniques had a significant additional effect (p < 0.0001.

  20. Sinais de uretelolitíase na tomografia computadorizada helicoidal sem contraste: ensaio iconográfico e revisão de literatura Ureterolithiasis signs on unenhanced helical computed tomography: iconographic essay and literature review

    Directory of Open Access Journals (Sweden)

    Renata La Rocca Vieira

    2004-12-01

    Full Text Available O principal sinal diagnóstico de ureterolitíase na tomografia computadorizada é a visualização direta do cálculo no interior do ureter. Todavia, a sua caracterização pode ser prejudicada devido a suas pequenas dimensões, variação da respiração entre a aquisição dos cortes tomográficos, escassez de gordura retroperitoneal ou eliminação recente do cálculo. Neste contexto, foram descritos diversos sinais secundários de obstrução ureteral, observados na tomografia computadorizada, que podem auxiliar no diagnóstico de casos duvidosos, além de quantificar o grau de obstrução urinária.The most important diagnostic sign of ureterolithiasis is the direct visualization of the stone within the ureter. However, in some patients with ureterolithiasis stone visualization may be impaired due to stone small size or low attenuation, respiratory artifacts between data acquisitions, low amount of retroperitoneal fat or recent elimination of the stone. In this context, we describe many secondary computed tomography signs of ureteral obstruction that may useful in the diagnosis of inconclusive cases, and also quantify the degree of urinary obstruction.

  1. Plasma AR and abiraterone-resistant prostate cancer.

    Science.gov (United States)

    Romanel, Alessandro; Gasi Tandefelt, Delila; Conteduca, Vincenza; Jayaram, Anuradha; Casiraghi, Nicola; Wetterskog, Daniel; Salvi, Samanta; Amadori, Dino; Zafeiriou, Zafeiris; Rescigno, Pasquale; Bianchini, Diletta; Gurioli, Giorgia; Casadio, Valentina; Carreira, Suzanne; Goodall, Jane; Wingate, Anna; Ferraldeschi, Roberta; Tunariu, Nina; Flohr, Penny; De Giorgi, Ugo; de Bono, Johann S; Demichelis, Francesca; Attard, Gerhardt

    2015-11-01

    Androgen receptor (AR) gene aberrations are rare in prostate cancer before primary hormone treatment but emerge with castration resistance. To determine AR gene status using a minimally invasive assay that could have broad clinical utility, we developed a targeted next-generation sequencing approach amenable to plasma DNA, covering all AR coding bases and genomic regions that are highly informative in prostate cancer. We sequenced 274 plasma samples from 97 castration-resistant prostate cancer patients treated with abiraterone at two institutions. We controlled for normal DNA in patients' circulation and detected a sufficiently high tumor DNA fraction to quantify AR copy number state in 217 samples (80 patients). Detection of AR copy number gain and point mutations in plasma were inversely correlated, supported further by the enrichment of nonsynonymous versus synonymous mutations in AR copy number normal as opposed to AR gain samples. Whereas AR copy number was unchanged from before treatment to progression and no mutant AR alleles showed signal for acquired gain, we observed emergence of T878A or L702H AR amino acid changes in 13% of tumors at progression on abiraterone. Patients with AR gain or T878A or L702H before abiraterone (45%) were 4.9 and 7.8 times less likely to have a ≥50 or ≥90% decline in prostate-specific antigen (PSA), respectively, and had a significantly worse overall [hazard ratio (HR), 7.33; 95% confidence interval (CI), 3.51 to 15.34; P = 1.3 × 10(-9)) and progression-free (HR, 3.73; 95% CI, 2.17 to 6.41; P = 5.6 × 10(-7)) survival. Evaluation of plasma AR by next-generation sequencing could identify cancers with primary resistance to abiraterone. PMID:26537258

  2. Behaviour of AR glass fibre for building structural applications

    OpenAIRE

    Miravete, A.; Mieres, J. M.; Calvo, I; Comino, P.; Chiminelli, A.; Cuatrero, J.; Tolosana, N.

    2005-01-01

    The AR glass reinforcement fibres were designed to resist the alkalis from the concrete. This is the main reason for its utilisation as a short-fibre-reinforcement of mortar and concrete for the last decades. Originally, the AR glass fibre sizing was not compatible with synthetic resins, so that this type of reinforcement was applied exclusively to mortar and concrete matrices. Recently, due to the developments of sizing, which are compatible with synthetic resins, the AR- glass fibres may be...

  3. Opera ar drama... Aleksejus Kartavovas Vilniuje

    OpenAIRE

    Bakutytė, Vida

    2007-01-01

    Straipsnio objektas – vienas iš reikšmingų laikotarpių Lietuvos profesionalaus teatro meno, ypač muzikinio, raidoje. Ši tema mažai tyrinėta muzikos ir teatro istorikų. Keturis sezonus (1887–1891) Vilniaus miesto teatrui vadovavęs talentingas teatro organizatorius Aleksejus Kartavovas iškėlė Vilniaus sceną į pirmaujančiųjų gretas, suaktyvino operos raidą kokybės linkme. Publikacijos tikslas – atskleisti aplinkybes, padėjusias ar trukdžiusias įgyvendinti A. Kartavovo numatytus planus, išryškint...

  4. Sensibility of different wheat varieties (strains) to Ar+ implantation

    International Nuclear Information System (INIS)

    The sensibility of different wheat varieties (strains) to Ar+ implantation was studied. The results showed that the survival rate of 21 wheat varieties (strains) at the dose of 6 x 1016 Ar+/cm2 could be divided into five groups: surplus sensitive varieties (strains), sensitive varieties (strains), transitional varieties (strains), obtuse varieties (strains) and surplus obtuse varieties (strains). The sensibility of wheat varieties (strains) to Ar+ injection is high-moisture-fertility wheat varieties (strains) > medium-moisture-fertility wheat varieties (strains) > dry land wheat varieties (strains). The study has provided theoretical basis in induced mutation medial lethal dose of different wheat varieties (strains) to Ar+ implantation. (authors)

  5. Practical reactor production of {sup 41}Ar from argon clathrate

    Energy Technology Data Exchange (ETDEWEB)

    Mercer, J.R. E-mail: jmercer@pharmacy.ualberta.ca; Duke, M.J.M.; McQuarrie, S.A

    2000-06-01

    The radionuclide {sup 41}Ar has many ideal properties as a gas flow tracer. However, the modest cross-section of {sup 40}Ar for thermal neutron activation makes preparation of suitable activities of {sup 41}Ar technically difficult particularly for low flux reactors. Argon can however be trapped in a molecular complex called a clathrate that can then be irradiated. We prepared argon clathrate and explored its irradiation and stability characteristics. Argon clathrate can be used to provide gigabecquerel quantities of {sup 41}Ar even with low power reactors.

  6. Hyperdeformed band in the 36Ar nucleus?

    International Nuclear Information System (INIS)

    Complete text of publication follows. The exotic shapes of atomic nuclei has attracted much attention recently both from the experimental and from the theoretical sides. E.g. the superdeformed (SD) shape in N = Z nuclei were observed experimentally during the last decade. In particular the SD band of the 36Ar nucleus was detected in 2000 [1]. Following the experimental observation a considerable theoretical effort has been concentrated on this band. In [2] e.g. the possible binary clusterizations of this state was studied systematically. Similar studies have been done also for the ground, and the hyperdeformed band. The latter one had been predicted from alphacluster model calculations [3]. The possible binary cluster-configurations are important not only for the better understanding of the structure of the shape isomers, but also from the viewpoint of predicting the favoured reaction channels to populate these states. This is the straightforward consequence of the close relation between the clusterization and reaction channels. (In fact, a cluster-configuration is defined by the reaction channel in which it can be observed.) One of the interesting conclusions of the work [2] was, that the hyperdeformed (HD) state of the 36Ar nucleus could be populated in the 24Mg+12C and 20Ne+16O reactions. A recent analysis of the 24Mg+12C elastic scattering [4] revealed the fact that the cross section can be described only by supposing resonances on top of the potential scattering. This very careful analysis incorporated phase-shift study, as well as Regge-pole and energy-dependent resonance calculations. The existence of five resonances have been proved, which have angular momenta 2, 4, 6, 7, 8. These states together with the resonances from the 20Ne+16O reactions seem to establish a rotational band, as shown in the upper part of Fig. 1. Its moment of inertia is in a very good agreement with that of the HD shape predicted from alpha-cluster model [3]. The similarity of the

  7. Synthesis, Crystal Structure and Luminescent Property of Cd (II Complex with <em>N-Benzenesulphonyl-L>-leucine

    Directory of Open Access Journals (Sweden)

    Xishi Tai

    2012-09-01

    Full Text Available A new trinuclear Cd (II complex [Cd3(L6(2,2-bipyridine3] [L =<em> Nem>-phenylsulfonyl-L>-leucinato] has been synthesized and characterized by elemental analysis, IR and X-ray single crystal diffraction analysis. The results show that the complex belongs to the orthorhombic, space group<em> Pem>212121 with<em> aem> = 16.877(3 Å, <em>b> em>= 22.875(5 Å, <em>c em>= 29.495(6 Å, <em>α> em>= <emem>= <emem>= 90°, <em>V> em>= 11387(4 Å3, <em>Z> em>= 4, <em>Dc>= 1.416 μg·m−3, <emem>= 0.737 mm−1, <em>F> em>(000 = 4992, and final <em>R>1 = 0.0390, <em>ωR>2 = 0.0989. The complex comprises two seven-coordinated Cd (II atoms, with a N2O5 distorted pengonal bipyramidal coordination environment and a six-coordinated Cd (II atom, with a N2O4 distorted octahedral coordination environment. The molecules form one dimensional chain structure by the interaction of bridged carboxylato groups, hydrogen bonds and p-p interaction of 2,2-bipyridine. The luminescent properties of the Cd (II complex and <em>N-Benzenesulphonyl-L>-leucine in solid and in CH3OH solution also have been investigated.

  8. Ar-39 - Ar-40 Evidence for an Approximately 4.26 Ga Impact Heating Event on the LL Parent Body

    Science.gov (United States)

    Dixon, E. T.; Bogard, D. D.; Rubin, A. E.

    2003-01-01

    Miller Range 99301 is a type 6, unbrecciated LL chondrite. MIL 99301 is of interest because some compositional and petrographic features suggest it experienced rather high shock grades, whereas other features suggest it is relatively unshocked. Inconsistent shock indicators could be explained if MIL 99301 was shocked but then partly annealed by heat produced by impacts on the parent body. The hypothesis that MIL 99301 experienced high temperature metamorphism (type 6) followed by a later shock event that heated, but did not melt, the constituent feldspar can be evaluated using (39)Ar-(40)Ar chronology. This is because (39)Ar-(40)Ar ages of shocked ordinary chondrites are generally <4.2 Ga, whereas (39)Ar-(40)Ar ages of unshocked meteorites are generally older, and between 4.52 - 4.38 Ga.

  9. Reactivation episodes of the romeral fault system in the northwestern part of central andes, colombia, through 39ar-40ar and k-ar results

    OpenAIRE

    VINASCO VALLEJO, CESAR JAVIER; Cordani, Umberto

    2013-01-01

    Direct dating of reactivation of the San Jerónimo Fault (SJF), easternmost limit of the Romeral fault system (RFS), is presented through 39Ar-40Ar and K-Ar results in neo-formed micas and mylonitic bands of strongly hidrothermalized gabbros. Published cooling and crystallization ages from sin-tectonic magmatic rocks exposed in the western fl ank of the Central Cordillera have suggest that tectonic evolution of the paleo-fault system began since Triassic and Lower Jurassic before the installat...

  10. Geochronological stages of magmatism of Sorsk copper-molybdenum-porphyry are district, Kuznetsk Alatau (K-Ar, Ar-Ar and Rb-Sr methods)

    International Nuclear Information System (INIS)

    Studies on biotite, amphibole and feldspar rocks were conducted through K-Ar, 39Ar-40Ar and Rb-Sr methods for evaluation of geochronological stages of magmatism development of the Sorsk copper-molybdenum-porphyry ore district. It is shown that general duration of magmatism development at the Sorsk district exceeds 100 mln years with intervals between individual magmatic pulses about 30 mln years. Dating by magmatites, related to ore-bearing porphyry complex and ore-metasotamic formations, is within the interval of 380-400 mln years. 13 refs.; 2 figs

  11. Fístula coronariana para ventrículo esquerdo: diagnóstico por tomografia computadorizada

    Directory of Open Access Journals (Sweden)

    Roberto Moreno Mendonça

    2011-10-01

    Full Text Available Fístulas de artérias coronárias são raras, sendo diagnosticadas mais frequentemente pelo ecocardiograma ou pela cineangiocoronariografia, entretanto, a angiotomografia computadorizada (angio-TC das coronárias ganha espaço. Essa patologia apresenta incidência baixíssima, sendo as fístulas originadas da coronária direita mais frequentes. Fístulas coronarianas para câmaras cardíacas direitas são mais incidentes, sendo raras para o ventrículo esquerdo (VE. O tratamento pode ser cirúrgico ou percutâneo. Este relato descreve caso de fístula coronariana para VE diagnosticada pela angio-TC das coronárias em homem de 46 anos, hipertenso, assintomático com teste ergométrico positivo para isquemia. Angio-TC de coronárias descartou doença obstrutiva, porém revelou fístula coronariana conectando-se com cavidade ventricular esquerda.

  12. Ab Initio Potential Curve for ArH+%ArH+势能曲线的从头计算

    Institute of Scientific and Technical Information of China (English)

    王胜龙; 屈军艳; 郭锐; 赵新生

    2001-01-01

    The molecular parameters of ArH+ have been calculated with different quantum chemistry methods and basis sets.Based on the data from QCISD/Aug cc pVTZ ab initio calculation for different configurations of ArH+ and the experimental data,an accurate potential curve for ArH+ has been constructed.The molecular properties,such as dissociation energy,equilibrium bond length,and vibrational energy levels,can be accurately reproduced.

  13. 40Ar-39Ar age of carbonatite-alkaline magmatism in Sung Valley, Maghalaya, India

    Indian Academy of Sciences (India)

    Jyotiranjan S Ray; Kanchan Pande

    2001-09-01

    40Ar-39Ar analyses of one alkali pyroxenite whole rock and two phlogopite separates of calcite carbonatites from the Sung Valley carbonatite-alkaline complex, which is believed to be a part of the Rajmahal-Bengal-Sylhet (RBS) ood basalt province, yielded indistinguishable plateau ages of 108.8 ± 2.0 Ma, 106:4 ± 1.3 Ma and 107.5 ± 1.4 Ma, respectively. The weighted mean of these ages, 107.2 ± 0.8 Ma, is the time of emplacement of this complex. This implies that Sung Valley complex and probably other such complexes in the Assam-Meghalaya Plateau postdate the main ood basalt event (i.e., the eruption of tholeiites) in the RBS province by ∼10 Ma.

  14. Acoustic resonance spectroscopy (ARS): ARS300 operations manual, software version 2.01

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-07-25

    Acoustic Resonance Spectroscopy (ARS) is a nondestructive evaluation technology developed at the Los Alamos National Laboratory. The ARS technique is a fast, safe, and nonintrusive technique that is particularly useful when a large number of objects need to be tested. Any physical object, whether solid, hollow, or fluid filled, has many modes of vibration. These modes of vibration, commonly referred to as the natural resonant modes or resonant frequencies, are determined by the object`s shape, size, and physical properties, such as elastic moduli, speed of sound, and density. If the object is mechanically excited at frequencies corresponding to its characteristic natural vibrational modes, a resonance effect can be observed when small excitation energies produce large amplitude vibrations in the object. At other excitation frequencies, i.e., vibrational response of the object is minimal.

  15. Support for the Astronomically Calibrated 40Ar/39Ar Age of Fish Canyon Sanidine

    DEFF Research Database (Denmark)

    Rivera, Tiffany; Storey, Michael; Zeeden, Christian;

    2011-01-01

    Fish Canyon sanidine (FCs) is the neutron fluence monitor most widely used in Cenozoic argon geochronology. Recommend published ages for FCs have been determined through various intercalibration techniques, but have varied by up to 2% over the last three decades. The robust quality of the...... astronomical timescale, with precision better than 0.1% for the last 10 million years for directly tuned sections, suggests intercalibration with K-bearing minerals intercalated in astronomically tuned stratigraphic sections as the best way to proceed with addressing the true age of FCs. Recently, Kuiper, et...... al. (2008) determined an astronomically calibrated 40Ar/39Ar age of 28.201 0.046 Ma (2), relative to the indirect astronomically tuned Moroccan Melilla Basin Messâdit section. Here, we provide independent verification for the Kuiper, et al. (2008) FCs age using sanidines extracted from the A1 tephra...

  16. 40Ar/39Ar Age of the Lathrop Wells Volcanic Center, Yucca Mountain, Nevada.

    Science.gov (United States)

    Turrin, B D; Champion, D; Fleck, R J

    1991-08-01

    Paleomagnetic and (40)Ar/(39)Ar analyses from the Lathrop Wells volcanic center, Nevada, indicate that two eruptive events have occurred there. The ages (136 +/- 8 and 141 +/- 9 thousand years ago) for these two events are analytically indistinguishable. The small angular difference (4.7 degrees ) between the paleomagnetic directions from these two events suggests they differ in age by only about 100 years. These ages are consistent with the chronology of the surficial geological units in the Yucca Mountain area. These results contradict earlier interpretations of the cinder-cone geomorphology and soil-profile data that suggest that at least five temporally discrete eruptive events occurred at Lathrop Wells approximately 20,000 years ago. PMID:17772371

  17. 40Ar/39Ar dating and paleo-magnetism of traps from Ethiopia, Deccan and Siberia

    International Nuclear Information System (INIS)

    Recent studies have shown that major flood basalt provinces have been emplaced as short events (∼ 1 Myr), more or less synchronous with climatic crises and mass extinctions. We present new geochronologic (40Ar/39Ar) and magneto-stratigraphic results for the Ethiopian traps, one of the last remaining flood basalts for which little of such data were available. The ages obtained in a 2000 m thick section are indistinguishable. Moreover, magneto-stratigraphy reveals a simple 3-chron reverse-normal-reverse sequence. Although magnetic chrons cannot be yet unambiguously identified, there is more likelihood for the normal sub-chron in the main basaltic pile to correspond to 11N, supporting a brief duration (less than 1.5 Ma). The Ethiopian traps erupted near 30 Ma at or near the time of the cold and dry climate, major Antarctic ice sheet advance, and the largest sea-level drop in the Tertiary. Bhandari et al. (GRL, 1995) have discovered inter-traps sediments with a triple iridium anomaly in a series of seven basaltic lava flows in the Kutch area of the North Western Deccan traps of India. Plagioclases from three flows above the iridium bearing sediments yield 39Ar/40Ar plateau ages near 65.0 Ma: these flows have unambiguously reversed magnetic polarity interpreted as chron 29R. As a preliminary summary, evidence of the KTB asteroid impact is confirmed in the Deccan traps, showing that they are coeval events in a general sense (in a Ma long window) though clearly with vastly different time constants. This is compatible with paleontologic evidence of two scales of extinctions, one quasi-instantaneous and the other on the order of 105 to 106 yrs. Clearly, the impact cannot have caused trap eruptions. On the other hand, the exact age and significance of the lower flows more altered remains to be analyzed further as they pertained to the much debated question of duration of Deccan trap volcanism. (author)

  18. 40 Ar/ 39 Ar radiometric dating to constrain the volcanic stratigraphy: The Mt. Etna methodological case.

    OpenAIRE

    De Beni, E.; Istituto Nazionale di Geofisica e Vulcanologia, Sezione Catania, Catania, Italia; Groppelli, G.; Istituto per la Dinamica dei Processi Ambientali–Sezione di Milano, Consiglio Nazionale delle Ricerche, via Mangiagalli 34, 20133 Milano, Italy

    2010-01-01

    Although ~50 radiometric age analyses have been performed on Etna, and there are many historical references, these are not enough to temporally constrain the geo- logical evolution of the volcano. In particular, a new stratigraphic framework based on lithostratigraphic and unconformity-bounded units has pointed out the presence of some stratigraphic uncertainty that can be resolved only with radiometric dating. For this reason, a dating project applying the 40 Ar/ ...

  19. 40Ar/39Ar geochronology and paleomagnetism of Independence volcano, Absaroka volcanic supergroup, Beartooth mountains, Montana

    Science.gov (United States)

    Harlan, S.S.; Snee, L.W.; Geissman, J.W.

    1996-01-01

    Independence volcano is a major volcanic complex in the lower part of the Absaroka Volcanic Supergroup (AVS) of Montana and Wyoming. Recently reported Rb-Sr mineral dates from the complex give apparent ages of 91 and 84 Ma, whereas field relationships and the physical and compositional similarity of the rocks with other dated parts of the AVS indicate an Early to Middle Eocene age for eruption and deposition. To resolve the conflict between age assignments based on stratigraphic correlations and Rb-Sr dates, we report new paleomagnetic data and 40Ar/39Ar dates for Independence volcano. Paleomagnetic data for the stock and an and andesite plug that cuts the stock are well grouped, of reverse polarity, and yield a virtual geomagnetic pole that is essentially identical to Late Cretaceous and Tertiary reference poles. The reverse polarity indicates that the magnetization of these rocks is probably younger than the Cretaceous normal superchron, or less than about 83.5 Ma. Hornblende from a volcanic breccia near the base of the volcanic pile gives a 40Ar/39Ar age of 51.57 Ma, whereas biotites from a dacite sill and a granodiorite stock that forms the core of the volcano give dates that range from 49.96 to 48.50 Ma. These dates record the age of eruption and intrusion of these rocks and clearly show that the age of Independence volcano is Early to Middle Eocene, consistent with stratigraphic relations. We suggest that the Rb-Sr mineral dates from the Independence stock and related intrusions are unreliable.

  20. Arís 2.1: Adapting Arís for Object Oriented Language

    OpenAIRE

    Rahman, Fahrurrozi

    2014-01-01

    In the software development area, software verification is important such that it can guarantee the software fulfills its requirements. Despite its importance, verifying software is difficult to achieve. Additional knowledge and effort are needed to write specification especially if the software is complex and big in size. Nevertheless, there are some software that already have verified specifications. This project will focus on extending Arís (Analogical Reasoning for reuse of Im...

  1. Dicty_cDB: FC-AR21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR21 (Link to dictyBase) - - - Contig-U16455-1 FC-AR21Z (Li...nk to Original site) - - FC-AR21Z 528 - - - - Show FC-AR21 Library FC (Link to library) Clone ID FC-AR21 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR21Q.Seq.d/ Representative seq. ID FC-AR...21Z (Link to Original site) Representative DNA sequence >FC-AR21 (FC-AR21Q) /CSM/FC/FC-AR/FC-AR21Q.Seq....omology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR21 (FC-AR

  2. Spatial autocorrelation method using AR model; Kukan jiko sokanho eno AR model no tekiyo

    Energy Technology Data Exchange (ETDEWEB)

    Yamamoto, H.; Obuchi, T.; Saito, T. [Iwate University, Iwate (Japan). Faculty of Engineering

    1996-05-01

    Examination was made about the applicability of the AR model to the spatial autocorrelation (SAC) method, which analyzes the surface wave phase velocity in a microtremor, for the estimation of the underground structure. In this examination, microtremor data recorded in Morioka City, Iwate Prefecture, was used. In the SAC method, a spatial autocorrelation function with the frequency as a variable is determined from microtremor data observed by circular arrays. Then, the Bessel function is adapted to the spatial autocorrelation coefficient with the distance between seismographs as a variable for the determination of the phase velocity. The result of the AR model application in this study and the results of the conventional BPF and FFT method were compared. It was then found that the phase velocities obtained by the BPF and FFT methods were more dispersed than the same obtained by the AR model. The dispersion in the BPF method is attributed to the bandwidth used in the band-pass filter and, in the FFT method, to the impact of the bandwidth on the smoothing of the cross spectrum. 2 refs., 7 figs.

  3. Optical coherence tomography and indocyanine green angiography findings in acute syphilitic posterior placoid choroidopathy: case report Achados da tomografia de coerência óptica e angiografia com indocianina verde na coroidopatia placóide posterior aguda sifilítica: relato de caso

    Directory of Open Access Journals (Sweden)

    Daniel Meira-Freitas

    2009-12-01

    Full Text Available The optical coherence tomography (OCT and indocyanine green angiography (ICGA findings of a 58-year-old male with acute syphilitic posterior placoid chorioretinitis are reported herein. Best-corrected visual acuity was 20/150 in the right eye (OD and 20/30 in the left eye (OS at presentation. On funduscopy, there was a central subretinal placoid yellowish lesion in OD. VDRL and serum FTA-ABS were positive. OCT showed increased reflectance and thickening of the subfoveal RPE-choriocapillaris complex corresponding to the lesion in OD. ICGA revealed a hypofluorescent spot corresponding to the lesion in OD and confluent small dots extending to periphery, without any correspondence in fundus examination. The same dots were also seen in OS, even though no lesions could be observed clinically. Intravenous ceftriaxone 2 g daily was given for 10 days. One month after the first visit, visual acuity improved to 20/30 and marked improvement of the lesion was seen. OCT was normal in both eyes at the final visit.Relatamos aqui os achados da tomografia de coerência óptica (OCT e angiografia com indocianina verde (ICGA de um paciente masculino de 58 anos com a coroidopatia placóide posterior aguda sifilítica. A acuidade visual corrigida na apresentação foi de 20/150 no olho direito (OD e 20/30 no olho esquerdo (OE. A fundoscopia evidenciou lesão sub-retiniana placóide amarelada central no OD. As sorologias VDRL e FTA-ABS foram positivas. OCT evidenciou aumento de refletividade subfoveal e espessamento do complexo EPR-coriocapilar correspondente à lesão do OD. ICGA revelou hipofluorescência local correspondente à lesão do OD e pequenos pontos confluentes que se estendiam para a periferia, sem qualquer correspondência na fundoscopia. O mesmo também foi visto no OE, embora nenhuma lesão pode ser observada clinicamente. Ceftriaxona 2 g intravenosa diária foi administrada durante 10 dias. Um mês após a primeira visita, a acuidade visual do OD foi

  4. Evaluation of Antioxidant and Antiproliferative Properties of Three <em>Actinidia> (<em>Actinidia> <em>kolomikta>, <em>Actinidia argutaem>, <em>Actinidia> <em>chinensis> Extracts <em>in Vitroem>

    Directory of Open Access Journals (Sweden)

    Jia-Ren Liu

    2012-05-01

    Full Text Available The total phenolic content, total flavonoid content, vitamin C content, and antioxidant activities of ethanol extracts from different kiwifruit varieties (<em>Actinidia> <em>kolomikta>, <em>Actinidia argutaem>, <em>Actinidia> <em>chinensis> were determined in this study. Multiple scavenging activity assays including the hydroxyl radical, O2·radical, DPPH, and the ABTS+ radical scavenging activity assays were used to identify the antioxidant activities of <em>Actinidia> extracts. The cell viability of HepG2 and HT-29 cells was also examined in this study. The results demonstrated that the <em>Actinidia kolomiktaem> extract had a higher antioxidant activity than the other two <em>Actinidia> extracts. There is a positive correlation between antioxidant activity and the polyphenols and vitamin C content in all three extracts (<em>R>2 ≥ 0.712, <em>p> em>< 0.05. The <em>Actinidia argutaem> extract had the highest inhibitory effect on HepG2 and HT-29 cell growth. These results provide new insight into the health functions of fruit and demonstrate that <em>Actinidia> extracts can potentially have health benefits.

  5. RECONSTRUCTION OF AR DEPTH PROFILES FROM PIXE MEASUREMENTS

    NARCIS (Netherlands)

    OSIPOWICZ, T; LIEW, SC; LOH, KK; ORLIC, [No Value; TANG, SM; WEBER, T

    1994-01-01

    We report on the application of an iterative maximum likelihood algorithm [1] to the reconstruction of depth profiles from PIXE measurements. PIXE spectra of 450 and 800 keV Ar implanted Al samples were taken at 1.5 and 1.3 MeV He+ energy and at angles ranging from 18 to 83-degrees. The measured Ar

  6. Experimental introduction of excess Ar40 into a granitic melt

    Science.gov (United States)

    Fyfe, W.S.; Lanphere, M.A.; Dalrymple, G.B.

    1969-01-01

    Samples of a Precambrian granite were melted in sealed capsules to produce a radiogenic Ar40 atmosphere over the melt. The amount of Ar40 incorporated in the quenched charge was then determined. Under these experimental conditions the amount of argon dissolved in the quenched melt was appreciable and could be an important source of error in potassiumargon dating. ?? 1969 Springer-Verlag.

  7. Aspects of What Makes or Breaks a Museum AR Experience

    DEFF Research Database (Denmark)

    Madsen, Claus B.; Madsen, Jacob Boesen; Morrison, Ann

    2012-01-01

    The paper critically evaluates central aspects of an iPad AR application developed for a museum context. The application is designed for children aged 8 to 12 and mixes AR and mini-game elements to convey dramatized historical events. The game has been deployed for roughly 3 months and the findin...

  8. In Vitro Activity of AR-709 against Streptococcus pneumoniae▿

    OpenAIRE

    Jansen, W.T.M.; Verel, A.; Verhoef, J.; Milatovic, D.

    2008-01-01

    We investigated the in vitro activity of AR-709, a novel diaminopyrimidine antibiotic currently in development for treatment of community-acquired upper and lower respiratory tract infections, against 151 Streptococcus pneumoniae strains from various European countries. AR-709 showed excellent activity against both drug-susceptible and multidrug-resistant pneumococci.

  9. Espessura do tecido subcutaneo como preditor independente de ruido em imagem de TC cardiaca

    Directory of Open Access Journals (Sweden)

    Henrique Lane Staniak

    2014-01-01

    Full Text Available Fundamento: Há poucos dados sobre a definição de parâmetros simples e robustos para predizer artefato de imagem em tomografia computadorizada (TC cardíaca. Objetivos: Avaliar o valor da simples medida da espessura do tecido subcutâneo (espessura pele-esterno como preditor de artefato de imagem em TC cardíaca. Métodos: O estudo avaliou 86 pacientes submetidos a angiotomografia computadorizada cardíaca (ATCC com sincronização prospectiva com ECG e avaliação de escore de cálcio coronário com 120 kV e 150 mA. A qualidade da imagem foi medida objetivamente pelo artefato de imagem na aorta em ATCC, sendo 'artefato baixo' definido como aquele < 30 UH. Os diâmetros torácicos anteroposterior e laterolateral, o artefato de imagem na aorta e a espessura pele-esterno foram medidos como preditores de artefato em ATCC. A associação de preditores e artefato de imagem foi avaliada usando-se correlação de Pearson. Resultados: A dose média de radiação foi 3,5 ± 1,5 mSv. O artefato de imagem médio na ATCC foi de 36,3 ± 8,5 UH, sendo o artefato de imagem médiona fase sem contraste do exame de 17,7 ± 4,4 UH. Todos os preditores foram independentemente associados com artefato em ATCC. Os melhores preditores foram espessura pele-esterno, com correlação de 0,70 (p < 0,001, e artefato de imagem na fases em contraste,com correlação de 0,73 (p < 0,001. Ao avaliar a habilidade de predizer artefato de imagem baixo, as áreas sob a curva ROC para o artefato de imagem na fases em contraste e para a espessura pele-esterno foram 0,837e 0,864, respectivamente. Conclusão: Tanto espessura pele-esterno quanto artefato de escore de cálcio são preditores simples e precisos de artefato de imagem em ATCC. Tais parâmetros podem ser incorporados aos protocolos de TC padrão para ajustar adequadamente a exposição à radiação.

  10. Polycyclic orogeny in Central Ogcheon metamorphic belt, Korea: evidence from 40Ar/39Ar hornblende ages

    International Nuclear Information System (INIS)

    Full text: The Ogcheon fold-thrust belt is one of the key Phanerozoic belts for delineating the regional correlation in East Asia including mainland China and Japan. This NE-trending belt consists of the Ogcheon metamorphic belt (OMB) in the southwest and the Taebaeksan sedimentary zone in the northeast. The OMB comprises Late (?) Proterozoic to Paleozoic metasedimentary and metavolcanic sequences intruded by Mesozoic granitoids. The age of initial intracontinental rifting is constrained to be earlier than 756 Ma by the U-Pb zircon age of a felsic metavolcanic rock (Lee et al., 1998, Precamb. Res. 89, 47-57). Polyphase tectonism in the OMB is characterised by the Middle Paleozoic Ogcheon orogeny responsible for the ductile stacking of thrust nappes and the Triassic Songrim orogeny occurring at shallower depths under the brittle-ductile transitional regime (Cluzel et al., 1990, Tectonophysics, 183, 41-56). Peak metamorphic conditions of the former are in the range of 5-8 kbar and 520-590 deg C, whereas those of the latter are 1-3 kbar and 350-500 deg C (Min and Cho, 1998, Lithos, 43, 31-51). Major ambiguity in the polycyclic model of the OMB results from the lack of isotopic age data. In order to determine the age of peak metamorphism, we analysed hornblende crystals of quartzose amphibole schists in central OMB, using the 40Ar/39Ar dating technique. Mineral assemblages of amphibole schists are represented by calcic amphiboles + plagioclase + epidote ± garnet + quartz + titanite + Fe-Ti oxide (magnetite or ilmenite). Amphibole separates commonly display discordant age spectra. Nevertheless, amphiboles of five analysed samples yield 40Ar/39Ar intercept dates ranging from 432±4 Ma to 499±10 Ma. Three of them yield plateau dates of 440-492 Ma, defined by more than three contiguous steps accounting for >50% of the total 39ArK released. Two of these plateau dates (465±4 Ma and 492±4 Ma) are from hornblende fractions of different grain size in a garnet

  11. 40Ar/39Ar geochronology of the El Teniente porphyry copper deposit

    International Nuclear Information System (INIS)

    breccias. Phyllic alteration primarily occurs as quartz-sericite haloes of quartz-sulfide-sulfate veinlets within the perimeter of the orebody, and slightly overprints potassic alteration. Propylitic alteration occurs largely peripheral to ore-grade rock. The relatively restricted development of phyllic alteration and the occurrence of the central breccia conflict with the classic porphyry copper model of Lowell and Gilbert (1970), but El Teniente may be regarded as a 'variation on a theme' of the classic model, as suggested by Gustafson and Hunt (1975). The exceedingly large size of the El Teniente deposit, coupled with its apparently young mineralization age prompted us to initiate a systematic 40Ar/39Ar study whose goals are to determine the age(s) of the hydrothermal event(s) that produced such a remarkable copper concentration and ultimately to estimate the duration of the hydrothermal activity at El Teniente. This is particularly relevant to an understanding of the processes that formed super-giant high-grade copper deposits in the Chilean Andes and elsewhere. We report here 32 total fusion 40Ar/39Ar ages from sericite and biotite from different lithologic units of El Teniente and five step-heating 40Ar-39Ar ages of samples previously dated using conventional K-Ar methods (Cuadra, 1986) (au)

  12. Ar-40/Ar-39 age constraints for the Jaramillo Normal Subchron and the Matuyama-Brunhes geomagnetic boundary

    Science.gov (United States)

    Izett, Glen A.; Obradovich, John D.

    1994-02-01

    Our mid-Pleistocene Ar-40/Ar-39 age recalibration of the geomagnetic polarity timescale is nearly in accord with the oxygen isotope, climate record calibration of the astronomical timescale proposed by Johnson (1982) and Shackleton et al. (1990). Ar-40/Ar-39 ages of a normally magnetized rhyolite dome in the Valles caldera, northern Mexico, yielded a weighted-mean age of 1.004 +/- 0.019 Ma. A K-Ar age of 0.909 +/- 0.019 Ma for this rock by Doell and Dalrymple (1966) was the linchpin for the recognition and calibration of the Jaramillo Normal Subchron (JNS). Other Ar-40/Ar-39 ages from the Valles caldera and Ar-40/Ar-39 ages of Ivory Coast tektites indicate that the JNS began at about 1.11 Ma and ended before 0.92 Ma, probably near 0.97 Ma. The Matuyama-Brunhes boundary occurred between 0.79 Ma and 0.76 Ma on the basis of Ar-40/Ar-39 sanidine ages from (1) three reversely magnetized rhyolite domes of the Valles caldera (0.793 +/- 0.018 Ma, 0.794 +/- 0.007 Ma, and 0.812 +/- 0.023 Ma) and pumice (0.789 +/- 0.006 Ma) from the reversely magnetized Oldest Toba Tuff of Sumatra and (2) pumice (0.764 +/- 0.005 Ma and 0.757 +/- 0.009 Ma) from the lower and upper units of the normally magnetized Bishop Tuff. The age of the boundary may be close to 0.77 Ma as deduced from rates of sedimentation in ancient Lake Bonneville, Utah.

  13. Eruption age of an approximately 100,000-year-old basalt from Ar-40/Ar-39 analysis of partially degassed xenoliths

    Science.gov (United States)

    Gillespie, A. R.; Huneke, J. C.; Wasserburg, G. J.

    1984-01-01

    Eleven samples from five partially degassed Mesozoic granitic xenoliths and two late Pleistocene host basalt samples from Sawmill Canyon in Sierra Nevada, California, have been analyzed using stepwise Ar-40/Ar-39 dating techniques. The petrography and analytic techniques are described and the results are presented. Isotopic compositions of Ar released from the xenoliths in several extraction steps at temperatures below about 900 C were colinear in Ar-36/Ar-40 versus Ar-39/Ar-40 diagrams and defined isochrons, giving a mean age of degassing of 119,000 + or - 7000 yr. Ar-40 extracted at higher temperatures included ancient radiogenic Ar-40 that never diffused from the xenoliths during immersion in the magma. This Ar-40 caused an increase in the apparent age for the high-temperature extractions. The high precision of the eruption age determined by this method is comparable to that obtained elsewhere by conventional K/Ar dating of sanidine.

  14. Touch interface for markless AR based on Kinect

    Science.gov (United States)

    Hsieh, Ching-Tang; Kuo, Tai-Ku; Wang, Hui-Chun; Wu, Yeh-Kuang; Chang, Liung-Chun

    2014-01-01

    We develop an augmented reality (AR) environment with hidden-marker via touch interface using Kinect device, and then also set up a touch painting game with the AR environment. This environment is similar to that of the touch screen interface which allows user to paint picture on a tabletop with his fingers, and it is designed with depth image information from Kinect device setting up above a tabletop. We incorporate support vector machine (SVM) to classify painted pictures which correspond to the inner data and call out its AR into the tabletop in color images information from Kinect device. Because users can utilize this similar touch interface to control AR, we achieve a marker-less AR and interactive environment.

  15. Avaliação da concentração de alfa 1-antitripsina e da presença dos alelos S e Z em uma população de indivíduos sintomáticos respiratórios crônicos Determination of alpha 1-antitrypsin levels and of the presence of S and Z alleles in a population of patients with chronic respiratory symptoms

    OpenAIRE

    Heliane Guerra Serra; Carmen Sílvia Bertuzzo; Mônica Corso Pereira; Cláudio Lúcio Rossi; Walter Pinto Júnior; Ilma Aparecida Paschoal

    2008-01-01

    OBJETIVO: Determinar a concentração de alfa 1-antitripsina (AAT) e a prevalência dos alelos S e Z em indivíduos sintomáticos respiratórios crônicos. MÉTODOS: Pacientes com tosse crônica e dispnéia foram submetidos à avaliação clínica, espirometria, tomografia computadorizada de tórax, dosagem de AAT por nefelometria e pesquisa das mutações S e Z por reação em cadeia da polimerase. Foram consideradas como variáveis dependentes a concentração de AAT e o tabagismo. RESULTADOS: Dos 89 pacientes i...

  16. Synthesis, structural characterization, and spectroscopy of the cadmium-cadmium bonded molecular species Ar'CdCdAr' (Ar' = C6H3-2,6-(C6H3-2,6-Pri2)2).

    Science.gov (United States)

    Zhu, Zhongliang; Fischer, Roland C; Fettinger, James C; Rivard, Eric; Brynda, Marcin; Power, Philip P

    2006-11-29

    The synthesis and first structural characterization of a cadmium-cadmium bonded molecular compound Ar'CdCdAr' (Ar' = C6H3-2,6-(C6H3-2,6-Pri2)2) are reported. The existence of the Cd-Cd bond was established by 113Cd NMR spectroscopy and X-ray diffraction (Cd-Cd = 2.6257(5) A). Like its group 12 analogue Ar'ZnZnAr', DFT calculations showed that Ar'CdCdAr' had significant p-character in the Cd-Cd sigma-bonding HOMO. PMID:17117840

  17. <em>α>-Glucosidase Inhibitory Constituents from <em>Acanthopanax senticosusem> Harm Leaves

    Directory of Open Access Journals (Sweden)

    Hai-Xue Kuang

    2012-05-01

    Full Text Available A new triterpene glycoside, 3-<em>O-[(α>-L-rhamnopyranosyl(1→2]-[<em>β>-D-glucuronopyranosyl-6-<em>O>-methyl ester]-olean-12-ene-28-olic acid (1 and a new indole alkaloid, 5-methoxy-2-oxoindolin-3-acetic acid methyl ester (5 were isolated from the leaves of <em>Acanthopanax senticosusem> Harms along with six known compounds. The structures of the new compounds were determined by means of 2D-NMR experiments and chemical methods. All the isolated compounds were evaluated for their glycosidase inhibition activities and compound 6 showed significant <em>α>-glucosidase inhibition activity.

  18. Proton resonance spectroscopy in 36Ar

    International Nuclear Information System (INIS)

    Excitation functions for proton elastic scattering and for proton-induced reactions on 35Cl were measured with the KN Van de Graaff accelerator and associated high resolution system at TUNL. Differential cross sections for 35Cl(p,p0), (p,p1), (p,p2), (p, α0), and (p, α1) were measured in the range Ep = 0.6 to 4.0 MeV. The data were measured at five angles with an overall resolution of about 350 eV. The measured excitation functions were analyzed with a multi-level, multi-channel R-matrix formalism for approximately 200 levels. Resonance parameters were extracted. The resonance parameters included resonance energy, total angular momentum, parity, partial elastic and reaction widths, channel spin or orbital angular momentum mixing ratios, and for some resonances the relative signs of width amplitudes. A number of resonances have strong level-level interference effects. Comparison of these data with the Porter-Thomas distribution resulted in good agreement of almost all channels which had a statistically significant number of resonances. These comparisons indicate that nearly all the proton and alpha strength in 36Ar for this energy range was seen in the present study. The s-wave proton strength function ratio for s = 1 and s = 2 resonances was found to be consistent with previous measurements for 4N nuclei

  19. Notificação compulsória da cisticercose em Ribeirão Preto - SP Compulsory notification of cysticercosis in Ribeirão Preto - SP, Brazil

    OpenAIRE

    Osvaldo M. Takayanagui; Ana Alice M. C. Castro e Silva; Roseli C. Santiago; Newton S. Odashima; Vera C. Terra; Angela M.M. Takayanagui

    1996-01-01

    A cisticercose é grave problema de saúde pública