WorldWideScience

Sample records for ar em tomografia

  1. Linfangiectasia renal: achado incidental em tomografia computadorizada multicorte e revisão da literatura

    Directory of Open Access Journals (Sweden)

    Rodrigo Abdalla de Vasconcelos

    2012-06-01

    Full Text Available Linfangiectasia renal é uma condição rara, caracterizada por coleções parapiélicas e perirrenais, que pode progredir de assintomática para insuficiência renal crônica. É apresentado um caso de achado incidental em tomografia computadorizada de linfangiectasia renal bilateral em paciente assintomático, com descrição dos principais achados à luz dos métodos de imagem e ampla revisão da literatura.

  2. Tomografia computadorizada na agenesia do corpo caloso: achados em 27 casos

    Directory of Open Access Journals (Sweden)

    MINGUETTI GUILBERTO

    1998-01-01

    Full Text Available Foi realizado estudo retrospectivo de tomografia computadorizada em 27 pacientes com anormalidades anatômicas definidas como agenesia total do corpo caloso, afastando-se os casos de agenesia parcial. Cada caso foi avaliado buscando-se as características tomográficas, incidência por sexo, idade, associação com a clínica e com outras malformações congênitas encefálicas. Nesta casuística, contudo, foram eliminados os casos de agenesia do corpo caloso associados a esquizencefalias, holoprosencefalias e malformações do complexo de Dandy-Walker.

  3. Segmentação pulmonar em estudos de tomografia axial computorizada

    OpenAIRE

    Silva, José Silvestre Serra da

    2005-01-01

    A Tomografia Axial Computorizada (TAC) é um dos meios complementares de diagnóstico médico mais eficiente no estudo das regiões pulmonares. Os métodos de segmentação pulmonar em imagens produzidas por esta modalidade são necessários sempre que se pretenda determinar áreas ou volumes, ou obter informação densitómetria; podem ainda ser integrados no pré-processamento de uma aplicação que envolva a visualização dos pulmões. No âmbito deste trabalho foram desenvolvidos três méto...

  4. Estimativa dos valores de MSAD em procedimentos de tomografia computadorizada utilizando filmes radiocrômicos

    Directory of Open Access Journals (Sweden)

    Bruno Beraldo Oliveira

    2013-04-01

    Full Text Available OBJETIVO: Verificar a viabilidade de filmes radiocrômicos como um dosímetro alternativo para estimativa da dose média em cortes múltiplos a partir dos perfis de kerma. MATERIAIS E MÉTODOS: Os filmes foram distribuídos em cilindros posicionados no centro e nas regiões periféricas de um objeto simulador padrão de abdome utilizado para dosimetria em tomografia computadorizada. RESULTADOS: Os valores de dose média em cortes múltiplos calculados foram 13,6 ± 0,7, 13,5 ± 0,7 e 18,7 ± 1,0 mGy para os valores de passo (pitch de 0,75, 1,00 e 1,50, respectivamente. CONCLUSÃO: Apesar de os resultados mostrarem valores menores que o nível de referência de radiodiagnóstico de 25 mGy estabelecido pela legislação brasileira para exames de abdome, eles sugerem que há espaço para otimização dos procedimentos e uma revisão do valor para o nível de referência de radiodiagnóstico brasileiro.

  5. Otimização da imagem em tomografia computorizada no exame de tórax

    OpenAIRE

    Santos, Maria dos Anjos Pombo Batista dos

    2012-01-01

    A tomografia computorizada (TC) é um método de obtenção de diagnóstico por imagem mais utilizado em todo o mundo e em constante crescimento. A TC desempenha um papel relevante na avaliação morfológica e funcional das patologias torácicas. Em consonância, o crescente aumento da realização dos referidos exames conflui com a necessidade de otimização de protocolos de realização, no que refere à dose de exposição à radiação ionizante, sem perda significativa da qualidade da imagem. O objetivo des...

  6. Controle de qualidade e dosimetria em equipamentos de tomografia computadorizada Quality control and dosimetry in computed tomography units

    Directory of Open Access Journals (Sweden)

    Diana Rodrigues de Pina

    2009-06-01

    Full Text Available OBJETIVO: Avaliação de condições dos equipamentos e dosimetria em setores de tomografia computadorizada utilizando protocolos de cabeça, abdome e coluna lombar em pacientes adultos (em três equipamentos distintos e pediátricos com até um ano e meio de vida (em um dos equipamentos avaliados. MATERIAIS E MÉTODOS: Foram estimados o índice de dose em tomografia computadorizada e a dose média em cortes múltiplos, em exames com pacientes adultos, em três distintos equipamentos. Ainda foram estimadas as doses na superfície de entrada e as doses absorvidas em exame de cabeça para pacientes adultos e pediátricos em um dos equipamentos avaliados. RESULTADOS: Foram realizados testes de controle de qualidade, mecânicos, demonstrando que os equipamentos satisfazem as especificações de uso estabelecidas pelas normas vigentes. Os resultados da dosimetria mostraram que valores de dose média em cortes múltiplos excederam em até 109,0% os valores de níveis de referência, apresentando consideráveis variações entre os equipamentos avaliados neste estudo. As doses absorvidas obtidas com protocolos pediátricos são inferiores aos de pacientes adultos, apresentando redução de até 51,0% na tireoide. CONCLUSÃO: Neste estudo foram avaliadas as condições de operação de três equipamentos tomográficos, estabelecendo quais parâmetros devem ser trabalhados para a implantação de um programa de controle de qualidade nas instituições onde esta pesquisa foi desenvolvida.OBJECTIVE: Evaluation of equipment conditions and dosimetry in computed tomography services utilizing protocols for head, abdomen, and lumbar spine in adult patients (in three different units and pediatric patients up to 18 months of age (in one of the units evaluated. MATERIALS AND METHODS: Computed tomography dose index and multiple-scan average dose were estimated in studies of adult patients with three different units. Additionally, entrance surface doses as well as

  7. Stratus optical coherence tomography findings in patients with retinopathy of prematurity Tomografia de coerência óptica em pacientes com retinopatia da prematuridade

    Directory of Open Access Journals (Sweden)

    Aline do Lago

    2007-02-01

    Full Text Available PURPOSE: To describe morphological features of the macula in patients with retinopathy of prematurity. METHODS: Twelve premature babies with retinopathy of prematurity grades I, II and III underwent dilated fundus examination and optical coherence tomography evaluation. RESULTS: In all thirteen eyes of the twelve premature patients optical coherence tomography revealed a condensed retinal pigmented epithelial layer in the macular-foveal area shown by increased reflectivity. In these eyes the retinal layers were not well differentiated. Foveal depression was clearly evident in 23%. CONCLUSIONS: In premature patients with retinopathy of prematurity, optical coherence tomography revealed poorly differentiated layers in the macular region with increased reflectivity in retinal pigmented epithelial-choriocapillaris zone.OBJETIVO: Descrever os aspectos morfológicos da mácula em pacientes com retinopatia da prematuridade (ROP. MÉTODOS: Doze pacientes com retinopatia da prematuridade graus I, II and III foram submetidos a mapeamento de retina e avaliação por tomografia de coerência óptica. RESULTADOS: Em todos os treze olhos de 12 pacientes a tomografia de coerência óptica mostrou a camada do epitélio pigmentar hiperrefletiva, sendo a área macular com maior intensidade. Nesses olhos as camadas da retina não estavam totalmente diferenciadas. A depressão foveal ficou claramente evidente pela tomografia de coerência óptica em 23%. CONCLUSÃO: Nos pacientes prematuros com retinopatia da prematuridade, a tomografia de coerência óptica mostrou as camadas da retina pouco diferenciadas com aumento da refletividade na área macular do complexo epitélio retiniano pigmentar-coriocapilar.

  8. Papilomatose laringotraqueobrônquica: aspectos em tomografia computadorizada de tórax Laryngotracheobronchial papillomatosis: findings on computed tomography scans of the chest

    OpenAIRE

    Edson Marchiori; Cesar de Araujo Neto; Gustavo de Souza Portes Meirelles; Klaus Loureiro Irion; Gláucia Zanetti; Israel Missrie; Juliana Sato

    2008-01-01

    OBJETIVO: Apresentar os achados em tomografia computadorizada (TC) de tórax em pacientes com papilomatose laringotraqueobrônquica. MÉTODOS: Foram estudadas, retrospectivamente, as TCs de oito pacientes, cinco masculinos e três femininos, com idades variando de 5 a 18 anos, com média de 10,5 anos. Os exames foram analisados por dois radiologistas, de forma independente, e as decisões finais foram obtidas por consenso. RESULTADOS: Os achados mais comuns nas TCs foram as lesões nodulares da traq...

  9. Medidas da umidade relativa do ar em um ambiente fechado

    OpenAIRE

    Costa Eden V.

    2003-01-01

    Umidade do ar e o vapor d'água presente na atmosfera. Neste trabalho medimos a umidade relativa do ar em um ambiente fechado onde a temperatura foi mantida constante. Nestas condições, a umidade cresce até o vapor d'água tornar-se saturado. Neste instante, a umidade é máxima. O aparato experimental utilizado consiste de recipiente fechado de vidro, higrômetro, termômetro e relógio. Trata-se, portanto, de um experimento simples, possível de ser realizado em um laboratório didático e capaz de p...

  10. Tomografia de coerência óptica em osteoma de coróide: relato de caso Optical coherence tomography in choroidal osteoma: case report

    Directory of Open Access Journals (Sweden)

    Mário Junqueira Nóbrega

    2005-10-01

    Full Text Available Os autores apresentam um caso de osteoma de coróide diagnosticado em paciente do sexo masculino aos 62 anos de idade. A lesão bem delimitada e pouco elevada no pólo posterior do olho direito acompanhada de vascularização interna e neovascularização de coróide em sua borda temporal superior e inferior levaram à suspeita do tumor. O diagnóstico de certeza foi obtido com ecografia A e B e tomografia computadorizada. A tomografia de coerência óptica mostrou alta refletividade em toda a espessura do osteoma bem como elevação do complexo EPR-cório-capilar na região da membrana neovascular subretiniana. Embora os achados tomográficos descritos na literatura e os observados neste caso sejam variados, a tomografia de coerência óptica pode colaborar no diagnóstico de osteoma de coróide.The authors present a case of choroidal osteoma diagnosed in a 62-year-old male patient. A well-defined and slightly elevated lesion located in the posterior pole of the right eye associated with internal vasculature and choroidal neovascularization at its superior and inferior temporal edge were suspicious of the tumor. Confirmation of diagnosis was obtained with A and B ecography and computed tomography. Optical coherence tomography showed high reflectivity through its thickness as well as elevation of the RPE-choriocapillaris complex at the choroidal neovascularization site. Although the literature and the present case show several different tomographical findings, optical coherence tomography can help establishing the diagnosis of choroidal osteoma.

  11. Medidas da umidade relativa do ar em um ambiente fechado

    Directory of Open Access Journals (Sweden)

    Costa Eden V.

    2003-01-01

    Full Text Available Umidade do ar e o vapor d'água presente na atmosfera. Neste trabalho medimos a umidade relativa do ar em um ambiente fechado onde a temperatura foi mantida constante. Nestas condições, a umidade cresce até o vapor d'água tornar-se saturado. Neste instante, a umidade é máxima. O aparato experimental utilizado consiste de recipiente fechado de vidro, higrômetro, termômetro e relógio. Trata-se, portanto, de um experimento simples, possível de ser realizado em um laboratório didático e capaz de preencher a lacuna dos livros de texto de física, que, em geral, negligenciam este tópico.

  12. Microbiologia do ar : monitorização do ar em ambiente hospitalar

    OpenAIRE

    Santos, Ana Carina Marques dos

    2008-01-01

    O complexo ambiente hospitalar requer atenção especial, para assegurar uma saudável qualidade do ar interior, protegendo assim os profissionais de saúde e utentes de infecções nosocomiais e de doenças ocupacionais. Embora seja amplamente reconhecido que a contaminação de um bloco operatório seja a principal responsável pela complicação de uma cirurgia, em Portugal, estudos sobre microbiologia do ar a nível hospitalar são escassos. O objectivo deste estudo é investigar a vari...

  13. Tomografia computadorizada em pacientes portadores de neurocisticercose com hipertensão intracraniana por hidrocefalia obstrutiva: comparação com ventriculografia com Dimer-X

    Directory of Open Access Journals (Sweden)

    Benedicto Oscar Colli

    1984-06-01

    Full Text Available Estudo das alterações observadas nas tomografias computadorizadas (TCs de 16 casos de neurocisticercose, com hipertensão intracraniana por hidrocefalia. Todos os casos foram submetidos a radiografias simples do crânio e 12, à ventriculografia com Dimer-X. Nas radiografias simples foram observados sinais de hipertensão intracraniana em 7, calcificações em um, e d foram normais. A TC mostrou parênquima cerebral normal em 9 casos e nos 7 restantes áreas hipodensas arredondadas de tamanho variado, com ou sem retenção de contraste na periferia, e/ou calcificações esparsas no parenquima. Hidrocefalia foi a única alteração observada no sistema ventricular nos casos em que o exame foi realizado previamente à derivação do LCR. As ventriculografias foram analisadas em trabalho anterior e permitiram localizar e determinar as características da obstrução e a presença de massas ocupando espaço dentro dos ventrículos. A comparação das ventriculografias e TCs realizadas na mesma época evidenciou que a primeira fornece melhores informações sobre o sistema ventricular mas, por outro lado, a tomografia fornece informações adicionais sobre o parênquima cerebral. A TC e a ventriculografia são exames que se completam na avaliação e no diagnóstico destes pacientes.

  14. Análise das variações morfológicas da ATM em pacientes com artrite reumatóide através de tomografia computadorizada = Analysis of the morphologyc variations in the TMJ the patients with rheumatoid arthritis through the computer tomography

    Directory of Open Access Journals (Sweden)

    Vasconcelos, Belmiro Cavalcanti do Egito

    2005-01-01

    Full Text Available Realizou-se um estudo qualitativo e quantitativo enfocando as alterações morfométricas da articulação temporomandibular (ATM, em pacientes com o diagnóstico de artrite reumatóide (AR por meio de tomografia computadorizada. Foram analisados 6 casos onde são descritas as alterações estruturais dos componentes ósseos de 12 ATMs. Os resultados indicaram que todas as ATMs apresentaram alterações, sendo as alterações mais freqüentes a esclerose óssea subcondral, seguida do aplainamento da eminência articular. Todos os pacientes apresentaram distúrbio de mobilidade

  15. Angiografia por tomografia computadorizada dos aneurismas intracranianos

    Directory of Open Access Journals (Sweden)

    Laureano Vinícius Santos

    2002-01-01

    Full Text Available Este trabalho foi realizado para avaliar os achados da angiografia por tomografia computadorizada, comparativamente à angiografia por subtração digital, em relação aos aneurismas intracranianos, e a possibilidade da maior utilização da angiografia por tomografia computadorizada no Brasil. Foram analisados oito pacientes que apresentavam um total de sete aneurismas não tratados e um aneurisma tratado. Houve subseqüente correlação com outros trabalhos publicados na literatura médica. Os exames foram realizados em uma clínica e em dois hospitais privados, na cidade do Rio de Janeiro, RJ. Foi demonstrada boa correlação entre os métodos estudados, em relação ao diagnóstico dos aneurismas, no acompanhamento e avaliação pré-terapêutica dessas lesões. A angiografia por tomografia computadorizada foi um exame menos invasivo, de menor custo e maior acessibilidade. Concluiu-se que a angiografia por tomografia computadorizada é um exame que deve ser utilizado com maior freqüência para avaliação nesta enfermidade.

  16. Propedêutica radiológica do impacto femoroacetabular em tempos de tomografia computadorizada e ressonância magnética: o que o radiologista precisa saber

    Directory of Open Access Journals (Sweden)

    Rafael Borges Nunes

    2011-08-01

    Full Text Available Após breve descrição dos tipos de impacto femoroacetabular, este trabalho demonstra o protocolo de radiologia convencional, tomografia computadorizada e ressonância magnética para os casos de impacto, desenvolvido nos últimos oito anos em parceria com serviços de referência em ortopedia. Demonstra-se a propedêutica radiológica básica de cada método, revisando os aspectos mais relevantes na avaliação do quadril.

  17. Aspectos da tomografia computadorizada no linfoma em pacientes abaixo de 20 anos de idade Computed tomography findings in patients less than 20 years old with lymphoma

    Directory of Open Access Journals (Sweden)

    Adriana Moreira Viana Borba

    2007-04-01

    Full Text Available OBJETIVO: Descrever os achados gerais do linfoma em pacientes abaixo de 20 anos de idade e por subtipo histológico. MATERIAIS E MÉTODOS: Estudo retrospectivo do arquivo digital de tomografia computadorizada do Centro de Controle do Câncer do Hospital Universitário Pedro Ernesto da Universidade do Estado do Rio de Janeiro, no período de março de 2003 a julho de 2005. Dos 22 casos - 16 do sexo masculino e 6 do sexo feminino, com média de idade de 11,5 anos -, 12 eram do subtipo Hodgkin e 10 eram não-Hodgkin. RESULTADOS: Dos achados gerais, verificamos as linfonodomegalias mediastinais como o mais freqüente (59%, com predomínio no grupo Hodgkin (75%, seguido por hepatoesplenomegalia (50% e linfonodomegalias cervicais e retroperitoneais (27,3%. No subtipo Hodgkin houve predomínio do acometimento linfonodal, em sucessivas cadeias, seguido pela hepatoesplenomegalia (50%. Verificamos um caso de massa tonsilar unilateral, opacidade pulmonar em "vidro-fosco" e nódulos renais. No subtipo não-Hodgkin houve predomínio extranodal caracterizado por hepatoesplenomegalia (50%, espessamento de alça intestinal (40%, derrame pleural (30%, nódulo pulmonar (20%, ascite (10%, derrame pericárdico (10% e lesões ósseas mistas (10%. CONCLUSÃO: A tomografia computadorizada é de grande valia no diagnóstico, estadiamento e seguimento do linfoma, com achados de alerta como massa linfonodal, notadamente mediastinal, hepatoesplenomegalia, massa unilateral na tonsila e espessamento parietal de alça intestinal.OBJECTIVE: To describe the general findings of lymphoma and their histological patterns in patients less than 20 years old. MATERIALS AND METHODS: Twenty-two cases (16 male and 6 female, mean age 11.5 years from the digital archive of computed tomography at the Cancer Control Center of "Hospital Universitário Pedro Ernesto - Universidade do Estado do Rio de Janeiro", Rio de Janeiro, RJ, Brazil, were retrospectively analyzed in the period between

  18. Otimização da dose em exames de rotina em tomografia computadorizada: estudo de viabilidade em um Hospital Universitário Radiation dose optimization in routine computed tomography: a study of feasibility in a University Hospital

    Directory of Open Access Journals (Sweden)

    Juciléia Dalmazo

    2010-08-01

    Full Text Available OBJETIVO: Estudar a viabilidade de redução da dose de radiação em protocolos de aquisição de imagens de tomografia helicoidal em um hospital universitário. MATERIAIS E MÉTODOS: Foi realizado levantamento de dose de radiação de protocolos de tomografia com objetos simuladores e câmara de ionização. Foram propostas variações de kVp e mAs, determinando-se a média de ruído. Protocolos com valores de ruído menores ou iguais a 1% foram submetidos à avaliação qualitativa de contraste e resolução espacial por três observadores. RESULTADOS: Foram realizados 22 testes de variações para o protocolo de crânio pediátrico, 26 para crânio adulto, 28 para abdome e 18 para tórax. A redução da dose conseguida variou entre 7,4-13% para protocolo de crânio pediátrico, 3,8-25% para crânio adulto, 9,6-34,3% para abdome e 6,4-12% para tórax. Notou-se também que a utilização de ferramentas de janelamento e zoom favoreceu o aceite das imagens pelos observadores. CONCLUSÃO: É possível reduzir os níveis de dose de radiação em até 34,4%, comparativamente aos protocolos utilizados na rotina, mantendo-se o ruído em níveis aceitáveis. O uso de ferramentas de manipulação digital das imagens possibilitou a aceitação de imagens com níveis maiores de ruído, favorecendo o processo de redução de dose de radiação.OBJECTIVE: To study the feasibility of reducing radiation dose in protocols for acquisition of helical computed tomography images in a University Hospital. MATERIALS AND METHODS: A survey of radiation doses in computed tomography protocols was performed with phantoms and ionization chamber. Changes in kVp and mAs were proposed, determining the average noise. Protocols with noise values 1% were submitted to qualitative assessment of contrast and spatial resolution by three observers. RESULTS: Tests of variations were performed with 22 protocols for pediatric skulls, 26 for adult skulls, 28 for abdomen, and 18 for

  19. Pneumonia lipoídica em adultos: aspectos na tomografia computadorizada de alta resolução Lipoid pneumonia in adults: findings on high-resolution computed tomography

    OpenAIRE

    Edson Marchiori; Gláucia Zanetti; Dante L. Escuissato; Arthur Soares Souza Jr.; César de Araújo Neto; Luiz Felipe Nobre; Klaus L. Irion; Rosana Rodrigues; Alexandre Dias Mançano; Domenico Capone; Suzane Mansur Fialho; Carolina Althoff Souza

    2007-01-01

    OBJETIVO: Apresentar os aspectos na tomografia computadorizada de alta resolução do tórax da pneumonia lipoídica exógena por aspiração de óleo mineral, em pacientes adultos MATERIAIS E MÉTODOS: Foram estudados oito pacientes adultos - quatro mulheres e quatro homens - com média de idade de 69,4 anos, todos usuários de óleo mineral para tratamento de constipação intestinal. Os exames foram avaliados por dois radiologistas, de forma independente RESULTADOS: Os achados tomográficos mais comuns f...

  20. Prognóstico visual de 'crosslinking' para ceratocone com base em tomografia de córnea pré-operatória

    Directory of Open Access Journals (Sweden)

    Lopes Bernardo

    2014-08-01

    Full Text Available Objetivo: Verificar índices tomográficos do pré-operatório de pacientes com ceratocone submetidos à crosslinking corneano (CXL como fatores preditivos para a melhora na acuidade visual corrigidas (AVc após um ano. Métodos: Estudo retrospectivo que incluiu 63 olhos de 53 pacientes com ceratocone progressivo submetidos à CXL segundo o protocolo de Dresden: deseptelização corneana, riboflavina 0,1% por 30 minutos e luz ultra-violeta A (UVA a uma irradiância de 3mW/cm2 por 30 minutos. Foram avaliados exames de tomografia corneana com sistema de Scheimpflug rotacional (Pentacam, Oculus antes do CXL e a acuidade visual corrigida antes e após a cirurgia. A análise estatística foi feita com o teste de Kolmorov-Smirnov, teste t de student e curvas de característica operador-receptor (ROC. Resultados: Houve diferença estatisticamente significante (p<0,05 entre os pacientes que obtiveram melhora de AVc em um ano e os que não experimentaram melhora na AVc nesse período nos índices tomográficos pré-operatórios relacionados com espessura e volume corneano. Entre os pacientes que obtiveram melhora na AVc todos possuíam volume corneano em 6,0mm maior que 14,55mm3 e 97,2% deles possuíam volume corneano em 6,5mm maior que 17,76mm3. Assim como, 94,29% desses pacientes apresentavam paquimetria média em 4,0mm maior que 487 μm e 82,86% paquimetria no ponto mais fino maior de 421 μm. Conclusão: Pacientes com ceratocone menos avançado (volume e espessura da córnea maiores no período pré-operatório obtiveram mais chances de ter melhora da AVc um ano após CXL. Estudos prospectivos envolvendo outras variáveis relacionadas com a aberrometria total e o estudo biomecânico da córnea são relevantes para se aumentar a capacidade prognóstica do resultado após CXL.

  1. Estimativa dos valores de MSAD em procedimentos de tomografia computadorizada utilizando filmes radiocrômicos Estimation of MSAD values in computed tomography scans using radiochromic films

    Directory of Open Access Journals (Sweden)

    Bruno Beraldo Oliveira

    2013-04-01

    Full Text Available OBJETIVO: Verificar a viabilidade de filmes radiocrômicos como um dosímetro alternativo para estimativa da dose média em cortes múltiplos a partir dos perfis de kerma. MATERIAIS E MÉTODOS: Os filmes foram distribuídos em cilindros posicionados no centro e nas regiões periféricas de um objeto simulador padrão de abdome utilizado para dosimetria em tomografia computadorizada. RESULTADOS: Os valores de dose média em cortes múltiplos calculados foram 13,6 ± 0,7, 13,5 ± 0,7 e 18,7 ± 1,0 mGy para os valores de passo (pitch de 0,75, 1,00 e 1,50, respectivamente. CONCLUSÃO: Apesar de os resultados mostrarem valores menores que o nível de referência de radiodiagnóstico de 25 mGy estabelecido pela legislação brasileira para exames de abdome, eles sugerem que há espaço para otimização dos procedimentos e uma revisão do valor para o nível de referência de radiodiagnóstico brasileiro.OBJECTIVE: To evaluate the feasibility of using radiochromic films as an alternative dosimeter to estimate the multiple scan average dose on the basis on kerma profiles. MATERIALS AND METHODS: The radiochromic films were distributed in cylinders positioned in the center and in four peripheral bores of a standard abdominal phantom utilized for computed tomography dosimetry. RESULTS: Values for multiple scan average dose values corresponded to 13.6 ± 0.7, 13.5 ± 0.7 and 18.7 ± 1.0 mGy for pitch of 0.75, 1.00 and 1.50, respectively. CONCLUSION: In spite of results showing lower values than the reference level for radiodiagnosis (25 mGy established by the Brazilian regulations for abdominal studies, it is suggested that there is room to optimize procedures and review the reference level for radiodiagnosis in Brazil.

  2. Tomografia computadorizada na avaliação da aspergilose pulmonar angioinvasiva em pacientes com leucemia aguda Computed tomography in the assessment of angioinvasive pulmonary aspergillosis in patients with acute leukemia

    Directory of Open Access Journals (Sweden)

    Renata Carneiro Leão

    2006-10-01

    Full Text Available OBJETIVO: O objetivo deste trabalho foi avaliar os principais achados na tomografia computadorizada de pacientes portadores de leucemia aguda complicada com aspergilose pulmonar angioinvasiva. MATERIAIS E MÉTODOS: Foram estudadas, retrospectivamente, as tomografias computadorizadas de 19 pacientes, avaliando-se a presença de consolidações, nódulos e massas, com ou sem sinal do halo, escavação e sinal do crescente aéreo. RESULTADOS: Áreas de consolidação foram o achado mais comum, ocorrendo em 12 dos 19 casos. A maioria delas apresentou o sinal do halo, enquanto escavação foi encontrada em 5 dos 12 casos com consolidações, sendo um deles com sinal do crescente aéreo. Nódulos e massas ocorreram em, respectivamente, seis e quatro casos, a maioria com sinal do halo. Escavação foi encontrada em apenas um caso de massa. Outros achados observados foram pavimentação em mosaico (dois casos, áreas de vidro fosco esparsas (três casos e envolvimento pleural (sete casos, sob a forma de derrame ou espessamento. CONCLUSÃO: Áreas de consolidação, massas ou nódulo, mesmo solitário, com sinal do halo, quando vistos na tomografia computadorizada em um contexto clínico apropriado, são altamente sugestivos de aspergilose angioinvasiva.OBJECTIVE: The aim of this study was to evaluate the main findings of computed tomography in patients presenting acute leukemia complicated by angioinvasive aspergillosis. MATERIALS AND METHODS: Computed tomography images of 19 patients were retrospectively studied for the presence of consolidations, nodules and masses, with or without presentation of halo sign, cavitation and air crescent sign. RESULTS: Consolidation was the most frequent finding, occurring in 12 of the 19 cases, most of them presenting the halo sign; cavitation was found in 5 of 12 cases, one of them with air crescent sign. Nodules and masses occurred respectively in six and four cases, most of them with halo sign. Cavitation was found

  3. O efeito da "sedação multifásica" no exame de tomografia computadorizada e ressonância magnética em crianças, pais e anestesiologistas

    Directory of Open Access Journals (Sweden)

    Guray Demir

    2012-08-01

    Full Text Available JUSTIFICATIVA E OBJETIVOS: O nosso objetivo foi investigar o efeito da "sedação multifásica" em crianças submetidas à Tomografia Computadorizada (TC ou Ressonância Magnética (RM, em seus pais e nos anestesiologistas responsáveis. "Sedação multifásica" foi definida como "o nível de sedação pretendido obtido com um ou mais agentes através da mesma via ou vias diferentes com mais de uma administração". MATERIAL E MÉTODOS: Cem crianças e seus respectivos pais foram randomicamente designados para um dos dois grupos de estudo. Na fase 1, os pacientes do Grupo I receberam midazolam (0,5 mg.kg-1 em 5 mL de suco de frutas e os pacientes do Grupo II (grupo controle receberam apenas suco de frutas. Na fase 2, após a canulação intravenosa (iv, bolus de propofol foi administrado para alcançar a sedação adequada para realização do exame de imagem. Os escores de ansiedade das crianças e de seus pais foram registrados usando a escala de Oucher e o IDATE, respectivamente, e a satisfação dos pais foi avaliada pela escala analógica visual (EAV. O número de tentativas para canulação iv, tempo de preparação e quantidade de hipnóticos foram registrados. RESULTADOS: O estado de ansiedade das crianças foi semelhante entre os grupos antes da pré-medicação, porém mais tarde esse nível foi menor no Grupo I. Antes do procedimento, o escore dos pais no IDATE foi semelhante, mas depois foi menor no Grupo I. A satisfação dos pais no Grupo I foi maior que no Grupo II. O número de tentativas de canulação iv e a dose necessária de propofol foi menor no Grupo I. CONCLUSÃO: O procedimento de "sedação multifásica" diminui a dor e a ansiedade das crianças e a ansiedade dos pais, aumentando a sua satisfação. Ele fornece uma sedação confortável e segura, pois possui um processo de preparação curto e sem problemas também para o anestesiologista responsável.

  4. VARIABILIDADE TEMPORAL DA TEMPERATURA DO AR EM JABOTICABAL – SP

    Directory of Open Access Journals (Sweden)

    GARCIA, Anice

    2015-05-01

    Full Text Available The study aimed to obtain a monthly average temperature equation estimated from the analysis of the variability of temperatures (maximum, average and minimum, to Jaboticabal /SP. The analysis of the parameters was made monthly, seasonal, annual and interannual. Data (1971-2013 were collected in a Agrometeorological Station of the Universidade Estadual Paulista (UNESP at Jaboticabal Campus(Lat; 21o14’05”S; Long: 48o17’09”O;. Alt: 616.01m. On the data were applied statistical methods (mean, standard deviation and coefficient of variation. Were also correlated the monthly averages obtained by the standard method (INMET and by the method of extreme temperatures. The results showed that standard deviation of the temperatures had a slow variations with low coefficient of variation. The equations obtained between the mean values of standard INMET and the mean of the extreme, can be used for micro region of Jaboticabal with good accuracy in results. Este estudo teve como objetivo analisar a variabilidade de temperatura e obter uma equação mensal de estimativa de temperatura média do ar a partir da análise das temperaturas (máxima, média e mínima, para Jaboticabal –SP. A análise dos elementos foi feita mensal, sazonal, anual e interanualmente. Os dados, referentes ao período de 1971 a 2013, foram coletados na Estação Agroclimatológica da Universidade Estadual Paulista (UNESP – Campus de Jaboticabal (Lat; 21o14’05”S; Long: 48o17’09”O;. Alt: 616.01m. Sobre os dados foram aplicados métodos estatísticos (média, desvio padrão e coeficiente de variação. Foram, também, correlacionadas as médias mensais obtidas pelo método padrão (INMET e pelo método das temperaturas extremas. Os resultados obtidos mostraram que os desvios das temperaturas (máximas, medias e mínimas tiveram variações discretas com consequentes coeficientes de variação baixos para os elementos estudados. As equações obtidas entre as m

  5. Avaliação microbiológica do ar em ambiente hospitalar

    OpenAIRE

    Silva, Emília Rosa Sousa dos Santos

    2008-01-01

    A contaminação do ar é um dos factores apontados como estando na origem de infecções das suturas operatórias, infecções nosocomiais e de outro tipo de patologias como a asma, as rinites e as alergias. A existência de situações epidemiológicas ocorridas em ambientes hospitalares, torna-se altamente perniciosa, uma vez que pode causar mortalidade ou morbilidade dos pacientes, principalmente em indivíduos imunocomprometidos. O presente trabalho reporta sobre um estudo microbiol...

  6. Tomografia computadorizada da matriz óssea mineralizada heteróloga fragmentada e metilmetacrilato na reparação de falhas ósseas segmentares produzidas em tíbia de coelhos

    Directory of Open Access Journals (Sweden)

    S.H. Freitas

    2012-12-01

    Full Text Available Foi realizada falha segmentar de 6mm na região metafisária medial da tíbia de 12 coelhos, seguida de preenchimento desta por matriz óssea mineralizada heteróloga fragmentada conservada em glicerina (98% e metilmetacrilato autoclavado, bem como avaliação por meio da tomografia computadorizada de feixe cônico (cone beam aos 30, 60 e 90 dias. Houve incorporação gradativa do implante no leito receptor em relação ao tempo em 100% dos casos, o que mostra ser este biologicamente compatível, ao promover reparação da falha óssea, sem sinais de infecção, migração e/ou rejeição, caracterizando-se, assim, como nova opção de substituto ósseo para preenchimento de falhas ósseas.

  7. Alterações de tomografia pulmonar de alta resolução em pacientes com artrite reumatoide e suas associações com variáveis clínicas, demográficas, sorológicas e terapêuticas Pulmonary changes on high-resolution computed tomography of patients with rheumatoid arthritis and their association with clinical, demographic, serological and therapeutic variables

    Directory of Open Access Journals (Sweden)

    Thelma Larocca Skare

    2011-08-01

    Full Text Available JUSTIFICATIVA: Pacientes com artrite reumatoide (AR têm manifestações extra-articulares em até 50% dos casos OBJETIVO: Estudar a prevalência das alterações pulmonares à tomografia computadorizada de alta resolução em pacientes com AR e sua associação com variáveis demográficas, clinicas, sorológicas e terapêuticas. MÉTODO: Estudaram-se 71 pacientes com AR para idade de início da doença, tempo de doença, sexo, tabagismo, presença de nódulos reumatoides, síndrome de Sjögren secundária, fator reumatoide, presença de anti-CCP e fator antinuclear, queixas respiratórias, uso de medicamentos e achados pulmonares à tomografia de alta resolução. RESULTADOS: Existiam alterações tomográficas em 55% dos pacientes, sendo as mais comuns as presenças de vidro fosco, bandas parenquimatosas, bronquiectasias de tração e faveolamento. Nenhuma das variáveis clínicas estudadas se associou aos achados tomográficos, exceto a duração de doença que foi maior em pacientes com nódulos pulmonares e lesões reticulares (vidro fosco. CONCLUSÕES: Existe uma alta prevalência de alterações tomográficas na população de AR, as quais não se associam com variáveis clínicas, sorológicas, terapêuticas e demográficas salvo tempo de duração da doençaBACKGROUND: Extra-articular manifestations are found in up to 50% of the patients with rheumatoid arthritis (RA. OBJECTIVE: To assess the prevalence of pulmonary changes on high-resolution computed tomography (HRCT in patients with RA and their association with demographic, clinical, serological and therapeutic variables. METHOD: Seventy-one patients with RA were assessed regarding their age at RA onset, duration of disease, gender, tobacco use, presence of rheumatoid nodules, secondary Sjögren's syndrome, rheumatoid factor, presence of anti-CCP and antinuclear factor, respiratory complaints, use of medications, and pulmonary changes on HRCT. RESULTS: HRCT changes were identifi ed

  8. Fourth ventricle computed tomography indexes: standardisation and characteristics in neurocysticercosis Índices do IV ventrículo em tomografia computadorizada de crânio: padronização e características na neurocisticercose

    Directory of Open Access Journals (Sweden)

    Svetlana Agapejev

    2002-06-01

    Full Text Available OBJECTIVES: to propose standardisation of fourth ventricle dimensions and to study its characteristics in neurocysticercosis. METHOD: a control group (CG constituted by 114 individuals with normal CT, and 80 patients with neurocysticercosis composed the group with neurocysticercosis (GN. Measures of the inner cranial diameter (Cr, fronto-polar distance between both lateral ventricles (FP, antero-posterior (AP and latero-lateral (LL fourth ventricle width based the standardisation of six indexes. RESULTS: AP/Cr, AP/LL and AP/FP were the more discriminative indexes, presenting in CG the mean values of 0.063, 0.267 and 0.582, respectively. The indexes in GN had values statistically higher than in CG. From GN, 51patients had increased indexes values above 2 standard deviation of the CG mean. AP/Ll was > or = 1 in 95% of patients with ventricular shunting and in 88% with depression. It also occurred in 73% patients with satisfactory follow-up and in everybody who died. CONCLUSION: AP/Cr, AP/LL and AP/FP may represent fourth ventricle dimensions.OBJETIVOS: propor padrão de normalidade das dimensões do IVventrículo e estudar suas características em neurocisticercose. MÉTODO: em um grupo controle (GC constituído de 114 indivíduos com tomografias normais e em outro grupo composto de 80 doentes com neurocisticercose (GN, mediram-se a distância fronto-polar de ventrículos laterais (FP e os diâmetros craniano interno (Cr, ântero-posterior (AP e látero-lateral (LL do IVº ventrículo para a padronização de seis índices. RESULTADOS: AP/Cr, AP/LL e AP/FP foram os índices mais discriminatórios e apresentaram, em GC, valores médios de 0,063, 0,267 e 0,582, respectivamente. Em GN os valores foram estatisticamente superiores a GC. Selecionaram-se 51 doentes do GN com índices > ou = 2 desvios-padrão da média em GC. Neles, AP/Ll foi > ou = 1 em 95% doentes com derivação liquórica e em 88% com depressão, ocorrendo em 73% com evolu

  9. Detection of beetle damage in forests by X-ray CT image processing Detecção de danos causados por besouro em florestas com processamento de imagens de tomografia computadorizada de raios X

    Directory of Open Access Journals (Sweden)

    Paulo Estevão Cruvinel

    2003-10-01

    Full Text Available Some beetle species can have devastating economic impacts on forest and nursery industries. A recent example is Anophophora glabripennis, a species of beetle known in the United States as the ''Asian Longhorrned beetle'', which has damaged many American forests, and is a threat which can unintentionally reach south American countries, including Brazil. This work presents a new method based on X-ray computerized tomography (CT and image processing for beetle injury detection in forests. Its results show a set of images with correct identification of the location of beetles in living trees as well as damage evaluation with time.Algumas espécies de besouros têm elevado impacto econômico em florestas e indústrias de móveis. Exemplo recente é aquele produzido pelo besouro Anophophora glabripennis, uma espécie conhecida nos Estados Unidos como Asian Longhorn, que tem produzido danos significativos em várias florestas americanas, representando uma ameaça que poderá encontrar transporte não-intencional para países da América do Sul, inclusive para o Brasil. Neste trabalho é apresentado um novo método com base no uso de tomografia de raios X computadorizada (CT e processamento de imagens digitais para detecção de injúrias causadas por besouros em florestas. Os resultados mostram a correta identificação da localização de besouros em árvores vivas, como também fornecem uma avaliação do estrago temporal causado.

  10. Estudo comparativo entre tomografia computadorizada de alta resolução e radiografia de tórax no diagnóstico da silicose em casos incipientes

    Directory of Open Access Journals (Sweden)

    CARNEIRO ANA PAULA SCALIA

    2001-01-01

    Full Text Available Introdução:A radiografia de tórax (RX ainda é, no dias atuais, o principal método de diagnóstico da silicose, seguindo-se as normas da Organização Internacional do Trabalho (OIT. A interpretação radiológica de casos iniciais é difícil, podendo ocorrer divergências mesmo entre leitores experientes. Recentemente, tem sido considerada a possibilidade de utilização da tomografia computadorizada com técnica de alta resolução (TCAR para avaliação de casos incipientes. Objetivo: Comparar os resultados da RX com a TCAR. Material e métodos: Foi avaliado um grupo inicial de 135 ex-mineiros, cujas radiografias foram examinadas por três leitores, no período de novembro de 1997 a dezembro de 1999. Indicou-se TCAR para 68 pacientes, cuja mediana de três leituras radiológicas foi menor ou igual a 1/0. As tomografias foram avaliadas por dois leitores e, em casos de divergência, houve participação de um terceiro leitor. As TCAR foram classificadas de acordo com a profusão de micronódulos em categorias de 0 a 3. Os resultados de TCAR e RX foram comparados através do teste de McNemar, coeficiente Kappa ponderado e modelos log-lineares. Resultados e conclusão: Houve boa concordância entre os métodos quanto à classificação na categoria 0, ou seja, os dois métodos mostraram-se equivalentes para excluir o diagnóstico de silicose. Porém, para o diagnóstico da doença, caracterizado por classificação na categoria 1 ou superior, não foi obtida boa concordância entre os métodos.

  11. Tomografia computorizada : análise e optimização das práticas na realização de exames em adultos e pediátricos : análise do nível de adequação às recomendações internacionais

    OpenAIRE

    Silva, Ricardo Alexandre Crispim da

    2014-01-01

    A Tomografia Computorizada (TC) é uma modalidade de imagem com crescente utilização em diagnóstico, tendo sofrido desenvolvimentos tecnológicos importantes nas últimas duas décadas. Na última década, em Portugal, verificou-se um crescimento anual do número de equipamentos de TC instalados e do número de exames realizados. Apesar do aumento da utilização, a TC constitui a fonte de radiodiagnóstico que mais contribui para a dose efectiva da população e para o aumento dos riscos, estocásticos...

  12. Fibrose maciça progressiva em trabalhadores expostos à sílica: achados na tomografia computadorizada de alta resolução Progressive massive fibrosis in silica-exposed workers: high-resolution computed tomography findings

    Directory of Open Access Journals (Sweden)

    Ângela Santos Ferreira

    2006-12-01

    Full Text Available OBJETIVO: Avaliar as características radiológicas das massas conglomeradas pela tomografia computadorizada de alta resolução de tórax. MÉTODOS: Foram selecionados 75 pacientes silicóticos, a maioria jateadores de areia, portadores de fibrose maciça progressiva, atendidos no Hospital Universitário Antônio Pedro entre 1986 e 2004. Os pacientes foram submetidos a avaliação clínica, radiografia simples de tórax e tomografia computadorizada de alta resolução. RESULTADOS: Mais da metade dos pacientes com silicose complicada mostrou na radiografia de tórax grandes opacidades dos tipos B e C, denotando a gravidade da doença nesses pacientes. Dos 75 casos, apenas um apresentou massa unilateral simulando câncer de pulmão. Quarenta e quatro pacientes realizaram tomografia computadorizada de alta resolução do tórax. As massas predominaram nos terços superiores e posteriores (88,6%. Broncograma aéreo e calcificações no interior das massas foram observados em 70,4% e 63,8% dos casos, respectivamente. História de tuberculose foi relatada em 52% dos pacientes estudados. CONCLUSÃO: Na grande maioria dos casos as massas eram bilaterais, predominando nas regiões póstero-superiores dos pulmões, com broncogramas aéreos e calcificações de permeio. Associação com calcificações linfonodais foi um achado freqüente. A exposição a elevadas concentrações de poeira e a tuberculose foram consideradas fatores de risco para o desenvolvimento da fibrose maciça progressiva.OBJECTIVE: To evaluate the radiological characteristics of conglomerate masses using high-resolution computed tomography of the chest. METHODS: From among the patients treated between 1986 and 2004 at the Antonio Pedro University Hospital, 75 patients with silicosis and massive fibrosis, most working in the field of sandblasting, were selected for study. These patients were submitted to a clinical evaluation, chest X-ray and high-resolution computed tomography of

  13. Tuberculose pulmonar: achados na tomografia computadorizada de alta resolução do tórax em pacientes com doença em atividade comprovada bacteriologicamente Pulmonary tuberculosis: findings on high resolution computerized tomography of active disease on patients with bacteriological confirmation

    Directory of Open Access Journals (Sweden)

    CRISTIANE ALÓ CAMPOS

    2002-01-01

    Full Text Available Objetivo: Descrever os achados em pacientes com tuberculose pulmonar em atividade na tomografia computadorizada de alta resolução e o padrão de distribuição das lesões pelo parênquima pulmonar. Casuística e método: Foram analisadas retrospectivamente as tomografias de alta resolução de 42 pacientes com diagnóstico bacteriológico de tuberculose pulmonar ou forte suspeita clínica, com posterior confirmação bacteriológica. Resultados: Os principais sinais sugestivos de atividade encontrados foram nódulos do espaço aéreo (83%, nódulos centrolobulares (74%, aspecto de árvore em brotamento (67%, cavitações (67%, espessamento das paredes brônquicas (55%, consolidações (48%, opacidade em vidro fosco (21%, e espessamento do interstício pulmonar (9%. Conclusão: A tomografia computadorizada de alta resolução do tórax pode sugerir fortemente atividade da doença, sendo particularmente útil nos pacientes com baciloscopias negativas e/ou radiografias indeterminadas, permitindo a instituição de tratamento adequado, antes mesmo do crescimento da micobactéria em meio de cultura.Background: The aim of this study was to describe the signs of active tuberculosis in patients submitted to high resolution computerized tomography and the distribution of lesions along the pulmonary parenchyma. Material and methods: The high resolution CTs performed on 42 patients with tuberculosis either bacteriologically diagnosed or clinical suspected and later confirmed by bacteriological tests were studied. Results: The signs of disease activity observed were airspace nodule (83%, centrilobular nodule (74%, tree-in-bud pattern (67%, cavitations (67%, bronchial thickening (55%, parenchymal consolidations (48%, ground glass opacity (21% and thickening of the inter and intralobular septa (9%. Conclusion: High resolution computed tomography can be strongly suggestive of disease activity, is particularly helpful in patients with negative smear and

  14. Esvaziamento gástrico após administração oral de contraste em tomografia computadorizada do abdômen: descrição de seis casos

    Directory of Open Access Journals (Sweden)

    Martins Fernando Antonio Nogueira da Cruz

    2004-01-01

    Full Text Available JUSTIFICATIVA E OBJETIVOS: A lesão pulmonar secundária à aspiração do conteúdo gástrico é complicação associada à perda dos reflexos protetores das vias aéreas. Neste contexto, a realização de exames tomográficos que incluem a contrastação do trato digestivo exige particular atenção em crianças abaixo de cinco anos, que necessitam anestesia geral ou sedação para assegurar imobilidade durante o procedimento. A indução da anestesia ou sedação, após ingestão da solução de contraste pode trazer risco substancial para a broncoaspiração do conteúdo gástrico. Isto faz com que se opte por administrar o contraste por sonda gástrica após a intubação traqueal, uma vez que não se conhece o tempo de esvaziamento gástrico após utilização de solução contrastante. Esta conduta representa aumento do tempo de anestesia, o que resulta em constante questionamento sobre a possibilidade de esvaziamento do conteúdo gástrico em tempo inferior a uma hora. Seis casos de pacientes submetidos à tomografia de abdômen foram avaliados quanto ao esvaziamento gástrico por meio da realização de cortes tomográficos na topografia do estômago, com o objetivo de determinar a presença ou ausência de conteúdo residual líquido nesse órgão, após a administração da solução de contraste. RELATO DOS CASOS: Foram avaliadas seis crianças submetidas à tomografia contrastada do abdômen. Duas, não anestesiadas, apresentaram expressivo resíduo líquido gástrico decorridos 50 e 45 minutos, respectivamente, da ingestão de contraste. Quatro, submetidas à anestesia geral, também apresentaram resíduo líquido gástrico decorridos 40 a 50 minutos da administração de contraste via sonda oro/nasogástrica. Em duas destas persistiu apreciável resíduo líquido no estômago, mesmo após a aspiração do conteúdo pela sonda. CONCLUSÕES: Nos casos observados, o período de 40 a 50 minutos foi insuficiente para o esvaziamento do

  15. Skull radiographs and computed tomography scans in children and adolescents with mild head trauma Radiografia simples e tomografia computadorizada do crânio em crianças e adolescentes vítimas de traumatismo craniano leve

    Directory of Open Access Journals (Sweden)

    José Roberto Tude Melo

    2008-01-01

    Full Text Available OBJECTIVE: To identify which pediatric patients with mild head trauma are candidates for skull radiographs or cranial computed tomography (CCT scans. METHOD: Patients with mild head trauma aged from 0 to 19 years presenting to the Emergency Department of a trauma centre from Salvador City, Brazil, between May 2007 and May 2008. RESULTS: A total of 1888 mild head trauma patients were admitted; mean age was 7.4 (±5.5 years. A total of 1956 skull radiographs and 734 CCT scans were performed. About 44.4% patients with Glasgow coma score (GCS 13 and 55.4% with GCS 14 had abnormal CCT scans. In patients with multiple traumas, 16% had abnormal findings on CCT scans. CONCLUSION: We strongly recommend routine CCT studies to patients with GCS of 13 and 14 or to multiple trauma victims, independently of score. Routine screening skull radiographs were not useful in the evaluation of mild head trauma patients in this study.OBJETIVO: Identificar quais os pacientes na faixa pediátrica com trauma craniencefálico leve são candidatos para a realização de radiografia simples ou tomografia computadorizada do crânio (TCC. MÉTODO: Pacientes com trauma craniano leve, entre 0 e 19 anos, admitidos em um centro de referência em traumatologia, na cidade do Salvador, Brasil, entre maio 2007 e maio 2008. RESULTADOS: Foram atendidos 1888 pacientes com trauma craniano leve, com idade média de 7,4 (±5,5 anos. Um total de 1956 radiografias simples e 734 TCC foram realizadas. Em 44,4% dos pacientes com escala de coma de Glasgow (GCS 13 e 55.4% com GCS 14, tiveram TCC com achados anormais. Em pacientes com múltiplos traumas, 16% possuíam alterações na TCC. CONCLUSÃO: Recomendamos TCC em pacientes com GCS 13 e 14 ou naqueles com traumas múltiplos, independente do GCS. Radiografias simples do crânio como rotina, não foram identificadas como úteis, no presente estudo.

  16. Diagnóstico de rinossinusite crônica em pacientes com fibrose cística: correlação entre anamnese, nasofibroscopia e tomografia computadorizada Diagnosis of chronic rhinosinusitis in patients with cystic fibrosis: correlation between anamnesis, nasal endoscopy and computed tomography

    Directory of Open Access Journals (Sweden)

    Letícia Boari

    2005-12-01

    Full Text Available O comprometimento nasossinusal é uma das principais manifestações otorrinolaringológicas da fibrose cística. Na literatura, é descrita a alta incidência de rinossinusite crônica nesses pacientes. Apesar de mais de 90% dos casos apresentarem panopacificação dos seios da face em exames de imagem, tais achados são raramente acompanhados de sintomas. Por isso, o profissional tem dificuldade de diagnosticar a doença nasossinusal em pacientes com fibrose cística. Dentre os métodos disponíveis para essa avaliação, o questionário (sintomas, a nasofibroscopia (sinais e a tomografia computadorizada têm grande importância. OBJETIVO: Avaliar o diagnóstico de rinossinusite crônica em pacientes portadores de fibrose cística por meio de questionário (anamnese; nasofibroscopia e tomografia computadorizada de seios da face e comparar os seus achados. FORMA DE ESTUDO: Clínico prospectivo transversal. MATERIAL E MÉTODO: Avaliação de 34 pacientes - maiores de 6 anos de idade e portadores de fibrose cística - por meio de questionário, nasofibroscopia (escore de Lund-Kennedy e tomografia computadorizada de seios da face (escore de Lund-Mackay. RESULTADOS: Observou-se que o diagnóstico de rinossinusite crônica foi positivo em: 20,58% dos casos pelo questionário; 73,52% dos casos pela nasofibroscopia e 93,54% dos casos pela tomografia computadorizada. A diferença entre os resultados foi estatisticamente significante. Verificou-se uma correlação de 55,1% entre as estratificações dos escores de nasofibroscopia e de tomografia computadorizada. CONCLUSÃO: O diagnóstico positivo da rinossinusite crônica foi predominantemente observado pela tomografia computadorizada. O diagnóstico negativo foi predominante na avaliação pelo questionário. Houve diferença estatisticamente significante entre os meios de avaliação. A nasofibroscopia é um excelente recurso que deve ser utilizado na avaliação de rinossinusite crônica em fibrose

  17. Opacidades em vidro fosco nas doenças pulmonares difusas: correlação da tomografia computadorizada de alta resolução com a anatomopatologia Ground-glass opacity in diffuse lung diseases: high-resolution computed tomography-pathology correlation

    OpenAIRE

    Maria Lúcia de Oliveira Santos; Edson Marchiori; Alberto Domingues Vianna; Arthur Soares Souza Jr.; Heleno Pinto de Moraes

    2003-01-01

    Opacidade em vidro fosco é achado freqüentemente visto na tomografia computadorizada de alta resolução do tórax e se traduz pelo aumento do coeficiente de atenuação dos pulmões, mas sem apagar as marcas broncovasculares. Por sua inespecificidade, a associação com outros achados radiológicos, clínicos e anatomopatológicos deve ser considerada para uma interpretação diagnóstica mais correta. Neste trabalho foram analisados 62 exames tomográficos de pacientes com doenças pulmonares difusas, de 1...

  18. Pneumonia lipoídica em adultos: aspectos na tomografia computadorizada de alta resolução Lipoid pneumonia in adults: findings on high-resolution computed tomography

    Directory of Open Access Journals (Sweden)

    Edson Marchiori

    2007-10-01

    Full Text Available OBJETIVO: Apresentar os aspectos na tomografia computadorizada de alta resolução do tórax da pneumonia lipoídica exógena por aspiração de óleo mineral, em pacientes adultos MATERIAIS E MÉTODOS: Foram estudados oito pacientes adultos - quatro mulheres e quatro homens - com média de idade de 69,4 anos, todos usuários de óleo mineral para tratamento de constipação intestinal. Os exames foram avaliados por dois radiologistas, de forma independente RESULTADOS: Os achados tomográficos mais comuns foram as consolidações com áreas de densidade de gordura de permeio, e o padrão de pavimentação em mosaico. As lesões foram bilaterais em seis pacientes, e unilaterais em dois CONCLUSÃO: O encontro de consolidações pulmonares com áreas de densidade de gordura de permeio, associado à história clínica do uso de óleo mineral, é diagnóstico de pneumonia lipoídica exógena.OBJECTIVE: The present study was aimed at describing the findings on high-resolution computed tomography in patients with exogenous lipoid pneumonia secondary to mineral oil aspiration MATERIALS AND METHODS: Eight adult patients - four men and four women - with mean age of 69.4 years were studied. All of the patients were users of mineral oil for treating intestinal constipation. High-resolution computed tomography studies of these patients were blindly evaluated by two radiologists. RESULTS: Air-space consolidation with areas of fat density and crazy paving pattern were the most frequent findings. The lesions were bilateral in six cases and unilateral in two CONCLUSION: Air-space consolidation with areas of fat density, associated with a clinical history of mineral oil ingestion virtually indicates a diagnosis of exogenous lipoid pneumonia.

  19. Persistent asthma in adults: comparison of high resolution computed tomography of the lungs after one year of follow-up Asma persistente em adultos: comparação da tomografia computadorizada de tórax de alta resolução após um ano de seguimento

    Directory of Open Access Journals (Sweden)

    Alberto Cukier

    2001-06-01

    Full Text Available OBJECTIVE: The aims of this study were to evaluate the role of high resolution computed tomography of the torax in detecting abnormalities in chronic asthmatic patients and to determine the behavior of these lesions after at least one year. METHOD: Fourteen persistent asthmatic patients with a mean forced expiratory volume in 1-second that was 63% of predicted and a mean forced expiratory volume in 1-second /forced vital capacity of 60% had two high resolution computed tomographys separated by an interval of at least one year. RESULTS: All 14 patients had abnormalities on both scans. The most common abnormality was bronchial wall thickening, which was present in all patients on both computed tomographys. Bronchiectasis was suggested on the first computed tomography in 5 of the 14 (36% patients, but on follow-up, the bronchial dilatation had disappeared in 2 and diminished in a third. Only one patient had any emphysematous changes; a minimal persistent area of paraseptal emphysema was present on both scans. In 3 patients, a "mosaic" appearance was observed on the first scan, and this persisted on the follow-up computed tomography. Two patients had persistent areas of mucoid impaction. In a third patient, mucus plugging was detected only on the second computed tomography. CONCLUSIONS: We conclude that there are many abnormalities on the high resolution computed tomography of patients with persistent asthma. Changes suggestive of bronchiectasis, namely bronchial dilatation, frequently resolve spontaneously. Therefore, the diagnosis of bronchiectasis by high resolution computed tomography in asthmatic patients must be made with caution, since bronchial dilatation can be reversible or can represent false dilatation. Nonsmoking chronic asthmatic subjects in this study had no evidence of centrilobular or panacinar emphysema.OBJETIVO: Avaliar o papel da tomografia computadorizada de tórax de alta resolução em detectar alterações estruturais

  20. Análise por tomografia computadorizada do teto etmoidal: importante área de risco em cirurgia endoscópica nasal Computed tomography assessment of the ethmoid roof: a relevant region at risk in endoscopic sinus surgery

    Directory of Open Access Journals (Sweden)

    Soraia Ale Souza

    2008-06-01

    Full Text Available OBJETIVO: Avaliar a profundidade das fossas olfatórias e a freqüência de assimetria na altura e na inclinação lateral do contorno do teto etmoidal. MATERIAIS E MÉTODOS: Estudo retrospectivo de 200 tomografias computadorizadas dos seios da face no plano coronal realizadas no período de agosto a dezembro de 2006. As profundidades das fossas olfatórias foram classificadas segundo Keros. O teto etmoidal foi avaliado quanto à simetria entre os lados. RESULTADOS: O tipo de Keros mais encontrado foi o tipo II (73,3%, seguido do tipo I (26,3% e do tipo III (0,5%. Em 12% (24 exames havia assimetria entre os lados quanto à altura do teto etmoidal, e em 48,5% (97 exames observou-se assimetria do contorno do teto, com inclinação lateral da lâmina crivosa de um dos lados. CONCLUSÃO: Em relação à profundidade das fossas olfatórias, o tipo II de Keros foi o mais freqüente. Verificou-se que a assimetria do teto do seio etmoidal, na maioria dos casos, estava relacionada com a inclinação lateral da lamela lateral da lâmina crivosa.OBJECTIVE: To evaluate the olfactory fossae depth according to the Keros' classification and determine the incidence and degree of asymmetry in the height and contour of the ethmoid roof. MATERIALS AND METHODS: Retrospective analysis of 200 coronal computed tomography studies of paranasal sinuses performed in the period between August and December, 2006. RESULTS: According to the Keros' classification, olfactory fossae type II was most frequently found in 73.3% of cases followed by type I in 26.3% and type III in 0.5% of cases. Asymmetry in the ethmoid roof height was found in 12% of cases (24 computed tomography studies, and contour asymmetry was found in 48.5% (97 computed tomography studies, with flattening of the ethmoid roof on one of the sides. CONCLUSION: As regards the olfactory fossae depth, the Keros' type II was most frequently found. In most of cases, the ethmoid roof asymmetry was related to angulation

  1. Estudo exploratorio da qualidade do ar em escolas de educacao basica, Coimbra, Portugal

    Directory of Open Access Journals (Sweden)

    Ana Maria Conceicao Ferreira

    2013-12-01

    Full Text Available OBJETIVO : Analisar a qualidade do ar em escolas de educação básica e suas condições estruturais e funcionais. MÉTODOS : Foi avaliada a qualidade do ar de 51 escolas (81 salas de aula de educação básica da cidade de Coimbra, Portugal, tanto na parte interior das salas como na exterior, durante as quatro estações do ano, de 2010 a 2011. Foram avaliadas a temperatura (Tº, umidade relativa (Hr, concentrações de monóxido de carbono (CO, dióxido de carbono (CO 2 , ozona (O 3 , dióxido de nitrogênio (NO 2 , dióxido de enxofre (SO 2 , compostos orgânicos voláteis (COV, formaldeído e material particulado (PM 10 , de novembro de 2010 a fevereiro de 2011 (outono/inverno e de março de 2011 a junho de 2011 (primavera/verão. Procedeu-se ao preenchimento de uma grelha de caracterização das condições estruturais e funcionais das escolas. Aplicaram-se os testes estatísticos t- Student para amostras emparelhadas e o teste t de Wilcoxon. RESULTADOS : Em 47 escolas, as concentrações médias de CO 2 encontravam-se acima da concentração máxima de referência (984 ppm mencionada na legislação portuguesa. Os valores máximos de concentração encontrados no interior das salas foram críticos, principalmente no outono/inverno (5.320 ppm. As concentrações médias de COV e de PM 10 no interior ultrapassaram a concentração máxima de referência legislada em algumas escolas. Não foram detetados valores relevantes (risco de CO, formaldeído, NO 2 , SO 2 e O 3 . CONCLUSÕES : Houve maior concentração de poluentes no interior das salas, comparativamente com o exterior. A inadequada ventilação está associada à elevada concentração de CO 2 nas salas de aula.

  2. Validation of computed tomography protocols for simulated mandibular lesions: a comparison study Validação de protocolos de tomografia computadorizada para lesões simuladas em mandíbula: estudo comparativo

    Directory of Open Access Journals (Sweden)

    Andréia Perrella

    2007-06-01

    Full Text Available Computed tomography is the choice technique to assess oral and maxillofacial osseous lesions because it provides hard and soft tissues visualization in one examination without superimposition of surrounding structures. This examination offers a significant advance in maxillofacial lesions detection with an excellent anatomic resolution. The aim of this research was to evaluate the validity of two protocols, in axial sections, in simulated mandibular lesions. Two CT protocols were obtained in dry mandibles in which perforations were done simulating lesions. Two observers, previously calibrated, evaluated the images according to different parameters. The results indicated that the sensitivity and specificity in lesion detection were 100% for both protocols, but the detection of loci number of multilocular lesions and the location and detection of medullar invasion obtained reduced validity values, which were influenced by the acquisition protocol. We concluded that thinner axial slices and reconstructions were more effective in detecting early medullar invasion and loci number. Thicker protocols were not considered appropriate to detect multilocular lesions and early stages of medullar invasion.A tomografia Computadorizada é a técnica de escolha no exame de lesões ósseas orais e maxilo-faciais porque proporciona a visualização de tecidos duros e moles em aquisição única e sem sobreposição de estruturas adjacentes. Este exame oferece um avanço significativo na detecção de lesões maxilo-faciais, com excelente resolução anatômica. O objetivo desta pesquisa foi avaliar a validade de dois protocolos, em secções axiais, em lesões simuladas de mandíbula. Dois protocolos de TC foram obtidos em mandíbulas secas em que foram feitas perfurações, simulando lesões. Dois observadores previamente calibrados avaliaram as imagens seguindo parâmetros diversos. Como resultados pudemos observar que a sensibilidade e a especificidade foram

  3. Computed tomography scan of the head in patients with migraine or tension-type headache Tomografia computadorizada do crânio em pacientes com migrânea ou cefaléia tensional

    Directory of Open Access Journals (Sweden)

    Marcelo Moraes Valença

    2002-09-01

    Full Text Available A retrospective study was performed in order to evaluate the frequency of abnormalities found by computed tomography (CT scan of the head in 78 patients with migraine or tension-type headache. In the present study CT scan was normal in 61.5% of the patients with migraine or tension-type headache. A number of abnormalities were encountered in more than one third of the patients studied, including inflammatory sinus disease (19.2%, cysticercosis (3.9%, unruptuted cerebral aneurysm (2.6%, basilar impression (2.6%, intracranial lipoma (2.6%, arachnoid cyst (2.6%, empty sella (2.6%, intracranial neoplasm (2.6%, and others (2.6%. None of these lesions were symptomatic or responsible by the headache picture, therefore, considered incidental findings. In conclusion, the fortuitous encounter of some abnormalities on CT scan of the head is often higher than what we could predict in patients suffering migraine or tension-type headache. We briefly discuss clinical, epidemiologic, and practical management of some of the abnormalities detected by CT scan as well as the indication to request a neuroimaging investigation.Um estudo retrospectivo foi realizado visando avaliar a frequência de anormalidades encontradas durante a realização de estudo por tomografia computadorizada (TC em 78 pacientes com migrânea ou cefaléia do tipo tensional. A TC foi normal em 61,5% dos pacientes examinados. Em um terço dos pacientes estudados foram detectadas anormalidades, como doença inflamatória dos seios paranasais (19,2%, cisticercose (3,9%, aneurisma cerebral não-roto (2,6%, impressão basilar (2,6%, lipoma intracraniano (2,6%, cisto aracnoideo (2,6%, sela vazia (2,6%, neoplasia intracraniana (2,6% e outras afecções (2,6%. Nenhuma destas lesões era sintomática (achado incidental. Concluindo, o encontro fortuito de algumas anormalidades na TC é frequentemente mais elevado do que se prediz em pacientes com cefaléia primária. Nós discutimos brevemente alguns

  4. Planosol soil sample size for computerized tomography measurement of physical parameters Tamanho de amostras para a determinação de parâmetros físicos em planossolo por tomografia computadorizada

    Directory of Open Access Journals (Sweden)

    Alceu Pedrotti

    2003-12-01

    Full Text Available Computerized tomography (CT is an important tool in Soil Science for noninvasive measurement of density and water content of soil samples. This work aims to describe the aspects of sample size adequacy for Planosol (Albaqualf and to evaluate procedures for statistical analysis, using a CT scanner with a 241Am source. Density errors attributed to the equipment are 0.051 and 0.046 Mg m-3 for horizons A and B, respectively. The theoretical value for sample thickness for the Planosol, using this equipment, is 4.0 cm for the horizons A and B. The ideal thickness of samples is approximately 6.0 cm, being smaller for samples of the horizon B in relation to A. Alternatives for the improvement of the efficiency analysis and the reliability of the results obtained by CT are also discussed, and indicate good precision and adaptability of the application of this technology in Planosol (Albaqualf studies.A técnica da tomografia computadorizada (TC permite medir a densidade e a umidade de amostras de solo, constituindo uma importante ferramenta na Ciência do Solo. Este trabalho tem como objetivos descrever os aspectos da adequação do tamanho de amostras de um Planossolo e os procedimentos de avaliação e estudos por análise estatística, empregando-se um minitomógrafo computadorizado de raios gama com fonte de 241Am. O valor do erro atribuído ao equipamento são 0,051 e 0,046 Mg m-3, respectivamente, para os horizontes A e B. O valor teórico da espessura da amostra do Planossolo para uso na técnica de TC com fonte de 241Am é, aproximadamente, 4,0 cm para os horizontes A e B. Já a espessura ideal de amostras é de aproximadamente 6,0 cm, sendo menor para amostras do horizonte B em relação ao A. Obteve-se boa precisão e adaptabilidade no emprego da TC para estudos de Planossolos.

  5. Efeitos da embalagem em ar, sob vácuo e em atmosfera modificada sobre a qualidade de filetes de peixe-porco Balistes capriscus

    OpenAIRE

    Guerra, Luís Miguel Valadas Horta Silva

    2013-01-01

    Dissertação de mest, Tecnologia de Alimentos, Instituto Superior de Engenharia, Univ. do Algarve, 2013 Este trabalho teve como objetivo o estudo do efeito de diferentes modos de embalagem (em ar, sob vácuo e em atmosfera modificada) sobre a qualidade (em termos físico-químicos e microbiológicos) e o tempo de conservação útil de filetes de peixe-porco (Balistes capriscus). Para tal, foram estudados parâmetros físicos (textura e cor) e químicos (pH e azoto básico volátil total, ABVT) em funç...

  6. Obstrução em alça fechada com ruptura do ceco: aspectos na tomografia computadorizada - relato de um caso Computed tomography findings in closed obstruction of the small bowel associated with rupture of the cecum: a case report

    OpenAIRE

    Sheila Jandhyra Vianna Crespo; Edson Marchiori; Luis Fernando Mendes

    2001-01-01

    A obstrução intestinal em alça fechada determina uma situação de extrema gravidade, com conseqüências sérias, podendo por vezes levar ao óbito. Os autores descrevem um caso de obstrução intestinal secundária a câncer no sigmóide, destacando a importância da tomografia computadorizada na análise das alterações patológicas na rotina de abdome agudo.Closed loop obstruction of the bowel is an extremely grave condition that may lead to serious consequences and even be fatal. The authors describe a...

  7. Obstrução em alça fechada com ruptura do ceco: aspectos na tomografia computadorizada - relato de um caso Computed tomography findings in closed obstruction of the small bowel associated with rupture of the cecum: a case report

    Directory of Open Access Journals (Sweden)

    Sheila Jandhyra Vianna Crespo

    2001-06-01

    Full Text Available A obstrução intestinal em alça fechada determina uma situação de extrema gravidade, com conseqüências sérias, podendo por vezes levar ao óbito. Os autores descrevem um caso de obstrução intestinal secundária a câncer no sigmóide, destacando a importância da tomografia computadorizada na análise das alterações patológicas na rotina de abdome agudo.Closed loop obstruction of the bowel is an extremely grave condition that may lead to serious consequences and even be fatal. The authors describe a case of a patient with intestinal obstruction secondary to cancer of the sigmoid and highlight the importance of computed tomography in the analysis of the pathological changes in routine management of patients with acute abdomen.

  8. Tomografia computadorizada no seguimento de pacientes com tumores intracranianos

    Directory of Open Access Journals (Sweden)

    Gilberto Machado de Almeida

    1981-03-01

    Full Text Available A tomografia computadorizada tem grande valor no controle dos pacientes com tumores cerebrais. Imediatamente após o ato cirúrgico pode ser útil para avaliar a retirada do processo expansivo ou para comprovar a área atingida. Nos primeiros dias após a intervenção tem sido indicada principalmente quando há piora do quadro neurológico. Nestas condições, o exame permite verificar a existência de ar, edema, hematoma, desvios ventriculares e hidrocéfalo. Os dados fornecidos são mais precisos que os obtidos com outros exames neuror-radiológicos ou com a medida contínua da pressão intracraniana, métodos menos inócuos. A longo prazo a tomografia permite o diagnóstico precoce de recidivas, a avaliação da eficácia de tratamentos radio ou quimioterápicos e o controle do hidrocéfalo. Ainda não é possível fazer o diagnóstico diferencial entre radio-necrose e recidiva tumoral.

  9. Aspectos Tectônicos das Intrusões dos Granitos do Cerne, Passa Três e Rio Abaixo, Sudeste do Pré-cambriano Paranaense. Estudo Baseado em Datações 39Ar-40Ar em Micas

    Directory of Open Access Journals (Sweden)

    Leonardo Fadel Cury

    2008-04-01

    Full Text Available Os stocks graníticos do Cerne, Passa Três e Rio Abaixo são representados por corpos elípticos, alongados segundo NE-SW(granitos do Cerne e Passa Três e com formas “ovóides” (Granito Rio Abaixo, intrusivos nas seqüências metavulcanossedimentaresda porção sudeste do Cinturão Ribeira, no Estado do Paraná. Esses corpos são representados principalmente por biotitasienogranitos,monzogranitos e quartzo-sienitos porfiríticos, com megacristais de microclínio, isótropos ou com foliação de fluxomagmático, podendo apresentar termos deformados em regiões restritas às zonas de contato. Mostram afinidades petrológicas,geoquímicas e geocronológicas, com características semelhantes aos granitos tipo-A, porém, enriquecidos em Ba, Sr e Zr. Análises40Ar-39Ar em biotitas do Granito do Cerne indicaram idade integrada de 557 ± 2 Ma, valor este relativamente próximo à idade decristalizaç��o dos zircões de aproximadamente 563 Ma, definida por Cury (2003. Determinações 40Ar-39Ar obtidas em rochasencaixantes (muscovitas xistos das vizinhanças do Granito do Cerne apresentam idades mais antigas (800-1200 Ma, o quepermite concluir que a intrusão do granito, bem como o evento metamórfico regional ocorrido durante o Ciclo Brasiliano, nãoatingiram temperaturas suficientes para apagar o registro isotópico das muscovitas (T < 300oC. Os stocks graníticos do Cerne,Passa Três e Rio Abaixo representam magmatismo tardi-orogênico no contexto das deformações presentes no Domínio Apiaí eao arco-magmático Três Córregos-Cunhaporanga (630-590 Ma, relacionado aos estágios finais de transpressão, onde suacolocação é intimamente associada às zonas de cisalhamento transcorrente e desenvolvimento das grandes antiformas e sinformas.Tal período (Proterozóico Superior/Cambriano representa um importante marco na região, associado aos ajustes finais relacionadosà aglutinação do Supercontinente Gondwana.

  10. AVALIAÇÕES DA QUALIDADE DO AR EM PAULÍNIA-SP*

    OpenAIRE

    Mirian Ramos Gutjahr; José Roberto Tarifa

    2004-01-01

    A obtenção de dados relativos à poluição do ar é sistematicamentedifícil. O presente trabalho aborda a utilizaçãode dados ‘proxi’ ou indiretos e sua comparaçãocom dados de monitoramento da qualidade do ar, como propósito de avaliar a qualidade do ar no municípiode Paulínia/SP. Levantamentos pontuais de poluição doar foram realizados pela agência ambiental na RegiãoMetropolitana de São Paulo – RMSP, Cubatão e outros17 municípios do Estado, que tem sido alvo de maioratenção quanto à qualidade a...

  11. Curvas de isodose no ar em uma sala de mamografia Air isodose curves in a mammography room

    Directory of Open Access Journals (Sweden)

    Maria Cecília Baptista Todeschini Adad

    2008-08-01

    Full Text Available OBJETIVO: O objetivo deste trabalho foi obter a distribuição da dose absorvida no ar numa sala de mamografia durante a simulação de um exame mamográfico, visando a reavaliar a necessidade do uso de barreiras de proteção radiológica nessas salas e a exposição das pacientes. MATERIAIS E MÉTODOS: Os dados da dose absorvida no ar foram coletados mediante simulação de exame mamográfico de um simulador de mama de BR12, em um equipamento Senograph 600T-Senix HF. Para tal, 158 pastilhas de CaSO4 foram distribuídas em malhas retangulares em torno do bucky, em três alturas distintas. RESULTADOS: O valor mais elevado da dose absorvida no ar, registrado no ponto central da superfície do simulador, centralizado no feixe primário, foi de 8,33 mGy, enquanto o menor valor registrado, devido exclusivamente ao espalhamento, foi de 0,008 mGy. CONCLUSÃO: Estes resultados indicam que o uso de blindagem adicional nas salas de mamografia pode não ser necessário na incidência crânio-caudal, desde que as distâncias consideradas neste trabalho sejam observadas. No entanto, eles enfatizam a necessidade de proteção da paciente.OBJECTIVE: The present study was aimed at evaluating the absorbed dose in air in a medical examination room during a mammography simulation, to re-evaluate the level of patients' exposure as well as the necessity of radiological protection barriers. MATERIALS AND METHODS: Data regarding absorbed dose in air were collected during mammography simulation with a BR12 breast phantom in a Senograph 600T-Senix HF mammograph. For this purpose, 158 CaSO4 dosimeters were distributed over rectangular grids around the bucky at three different heights. RESULTS: The highest value for absorbed dose in air recorded on the center of the phantom surface and centralized on the primary beam was 8.33 mGy, while the lowest value recorded exclusively due to radiation scattering was 0.008 mGy. CONCLUSION: These results indicate that the utilization

  12. Estudo da drenagem linfática e eficácia da tomografia computadorizada na detecção de metástases linfonodais em pacientes clinicamente N0 com carcinoma espinocelular de boca e orofaringe Lymphatic drainage and efficiency of computed tomography in the detection of lymph node metastasis in N0 staged patients with squamous cell carcinoma of the mouth and oropharynx

    Directory of Open Access Journals (Sweden)

    Addah Regina da Silva Freire

    2002-03-01

    Full Text Available O exame clínico não é suficiente para avaliar, com precisão, o envolvimento linfonodal em carcinomas de boca e orofaringe. Avaliamos 21 pacientes portadores de carcinoma espinocelular de boca e orofaringe, estadiados clinicamente como N0. Em todos os pacientes foi feita tomografia computadorizada de face e pescoço, e linfocintilografia. A sensibilidade e a especificidade da tomografia computadorizada foram de 16% e 73% para o lado homolateral, e 0% e 90% para o contralateral, respectivamente. Drenagem linfática foi vista em 76,2% dos casos. A não-migração ocorreu em casos de difícil injeção do radiofármaco, como fossa amigdaliana e região retromolar. A migração bilateral ocorreu apenas em casos de soalho bucal, em que havia envolvimento da linha mediana. A partir desses resultados conclui-se que a tomografia computadorizada foi menos eficiente que o exame clínico. Porém, o tomógrafo utilizado foi o não-helicoidal e, portanto, a eficácia do tomógrafo helicoidal não foi avaliada. A linfocintilografia foi útil na avaliação de pacientes clinicamente N0 e estamos utilizando o método para avaliar linfonodo sentinela nos carcinomas de boca.Clinical examination alone is not sufficient to precisely evaluate lymph node involvement in head and neck cancer. The results of computed tomography of the neck and lymphoscintigraphy were evaluated in 21 patients with carcinoma of the mouth and oropharynx staged N0. Nine patients were treated by homolateral and 12 by bilateral neck dissection. Sensitivity and specificity of computed tomography were 16% and 73% for homolateral side and 0% and 90% for contralateral side, respectively. Lymphatic drainage was observed in 76.2% of the cases. No-migration was associated with cases involving the retromolar region and tonsillar fossa, where injection of the 99mTc-Dextran 500 is more difficult. Bilateral migration occurred only in carcinomas of the floor of the mouth, with involvement of the

  13. Avaliação da concordância interobservador na análise da tomografia computadorizada sem contraste no diagnóstico da urolitíase em pacientes com cólica renal aguda Interobserver agreement on non-contrast computed tomography interpretation for diagnosis of urolithiasis in patients with acute flank pain

    Directory of Open Access Journals (Sweden)

    Luís Ronan Marquez Ferreira de Souza

    2006-10-01

    Full Text Available OBJETIVO: Avaliar a reprodutibilidade da tomografia computadorizada sem contraste na avaliação da litíase ureteral e os sinais secundários de obstrução do sistema coletor em pacientes com cólica renal aguda. MATERIAIS E MÉTODOS: Estudo prospectivo de 52 pacientes com diagnóstico clínico de cólica renal aguda submetidos a exame de tomografia computadorizada de abdome sem contraste. Os exames foram realizados com técnica helicoidal e posteriormente analisados por três observadores independentes, com a concordância interobservador avaliada pelo método estatístico kappa (kapa. Foram analisados os parâmetros: a presença, localização e mensuração dos cálculos ureterais; b dilatação do sistema coletor intra-renal; c heterogeneidade da gordura perirrenal; d dilatação ureteral; e edema da parede ureteral (sinal do halo. RESULTADOS: Foram encontrados 40 cálculos ureterais na tomografia computadorizada (77%. A concordância interobservador para a identificação do cálculo ureteral e da dilatação ureteral foi quase perfeita (kapa = 0,89 e kapa = 0,87, respectivamente, substancial para dilatação do sistema coletor intra-renal (kapa = 0,77 e moderada para heterogeneidade da gordura perirrenal e para edema da parede ureteral (kapa = 0,55 e kapa = 0,56, respectivamente. CONCLUSÃO: A tomografia computadorizada de abdome sem contraste apresenta elevada reprodutibilidade na avaliação da litíase ureteral e dos sinais secundários de obstrução do sistema coletor.OBJECTIVE: To evaluate the interobserver agreement on non-contrast computed tomography interpretation by a group of experienced abdominal radiologists, for the study of urolithiasis in patients presenting acute flank pain. MATERIALS AND METHODS: Prospective study of 52 patients submitted to non-contrast enhanced helical computed tomography. The images were subsequently analyzed by three independent observers, with the interobserver agreement assessed by means of the

  14. Por Quê Dançar Na Escola Em Uma Época De Crise?

    Directory of Open Access Journals (Sweden)

    Débora Barreto

    2009-12-01

    Full Text Available De um modo geral, na maioria das academias, a dança tem sido ensinada de forma a se dicotomizar corpo e mente, valorizando apenas a técnica e a alta performance (as "ninfas" e "sílfides" virtuosas e estimulando a "ego-ação" do dançarino. No entanto, com base em autores como TAYLOR, BABIN, FREIRE e outros, pode-se pensar o ensino da dança como um "diálogo de corpos", no qual corpo e mente, conhecimento intuitivo e racional, sejam integrados, respeitando-se, assim, a liberdade de cada indivíduo de refletir criticamente sabre o significado da arte de dançar.

  15. Carcinoma de células transicionais do trato urinário: aspectos da tomografia computadorizada

    Directory of Open Access Journals (Sweden)

    Almeida Junior José Guiomar de

    2003-01-01

    Full Text Available Embora relativamente incomum, o carcinoma de células transicionais do trato urinário é o segundo tumor mais freqüente do rim. Neste trabalho foram analisadas, de forma retrospectiva, as tomografias computadorizadas de dez pacientes com carcinoma de células transicionais confirmado por exame histopatológico. A bexiga foi acometida em 60% dos casos, o sistema pielocalicinal em 60% e o ureter em 10% deles. Lesões sincrônicas estiveram presentes em 40% das vezes. Os aspectos encontrados foram lesões vegetantes, espessamento da parede do ureter e lesões infiltrativas do rim. Foram descritos dois casos de tumores calcificados e um carcinoma de células transicionais surgindo no interior de um divertículo de bexiga. A tomografia computadorizada detectou extensão local do tumor em 80% dos pacientes e lesão a distância em 20%. A tomografia computadorizada permitiu caracterizar a extensão da doença, localmente e a distância, possibilitando que um grupo selecionado de pacientes pudesse ser tratado de forma conservadora.

  16. Efeitos Tóxicos de Arsênio em Eisenia Andrei em Exposição a Solos do Entorno de Minerações de Ouro

    Directory of Open Access Journals (Sweden)

    Rodrigo Henrique Alves

    2015-06-01

    Full Text Available Os produtos das atividades de mineração têm grande relevância econômica no Estado de Minas Gerais, Brasil. No entanto, seus inúmeros danos à biota, incluindo a fauna edáfica, resultam na necessidade de recuperação e biomonitoramento dessas áreas e do seu entorno. Considerando a importância ecológica e o potencial bioindicador das minhocas, o objetivo deste estudo foi avaliar a toxicidade de arsênio presente em solos do entorno de minerações de ouro, nas bacias dos rios Doce e São Francisco, a oligoquetas da espécie Eisenia andrei Bouché. Amostras de solos dessas áreas foram caracterizadas em relação às suas propriedades físicas e químicas, incluindo os metais Fe, Al, Cu, Ni, Zn e Mn e do metaloide As; com elas, foram conduzidos bioensaios, que avaliaram a sobrevivência, reprodução e variação da biomassa dos organismos. Também foram realizados testes de sensibilidade dessa espécie ao As adicionado a solo artificial tropical e em solo natural. Houve evidente efeito tóxico sobre a reprodução dessa espécie, que esteve altamente correlacionado com as concentrações de As nas amostras (r = -0,80. Amostras de solos naturais de locais avaliados nas duas áreas apresentaram concentrações de As acima do limite estipulado pela Resolução Conama nº 420 de 2009, chegando a 2.388,2 mg kg-1. A CL50 do As em solo artificial tropical (207,4 mg kg-1 foi seis vezes menor que a do solo natural (1.248,1 mg kg-1. A menor biodisponibilidade do As nos solos naturais foi atribuída a sua associação com o minério de Fe presente nas amostras. Concluiu-se que os solos do entorno de áreas de mineração causaram toxicidade crônica a E. andrei, em termos de sua reprodução, o que demonstrou o potencial de danos dessas atividades sobre a fauna edáfica dessas áreas. O estudo também forneceu informações ecotoxicológicas que podem ser úteis em avaliações de risco ambiental em solos tropicais.

  17. Efeitos Tóxicos de Arsênio em Eisenia Andrei em Exposição a Solos do Entorno de Minerações de Ouro

    OpenAIRE

    Rodrigo Henrique Alves; Arnola Cecilia Rietzler

    2015-01-01

    Os produtos das atividades de mineração têm grande relevância econômica no Estado de Minas Gerais, Brasil. No entanto, seus inúmeros danos à biota, incluindo a fauna edáfica, resultam na necessidade de recuperação e biomonitoramento dessas áreas e do seu entorno. Considerando a importância ecológica e o potencial bioindicador das minhocas, o objetivo deste estudo foi avaliar a toxicidade de arsênio presente em solos do entorno de minerações de ouro, nas bacias dos rios Doce e São Francisco, a...

  18. Image quality and volume computed tomography air kerma index (C{sub vol}) evaluation in Recife; Avaliacao da qualidade de imagem e do indice volumetrico de Kerma ar em tomografia computadorizada (C{sub vol}) em Recife

    Energy Technology Data Exchange (ETDEWEB)

    Andrade, Marcos Ely Almeida

    2008-07-01

    The Computed Tomography (CT) is an important diagnostic imaging method, widely used. However, in spite of all the advantages and technologic advances within the CT scanners, the tomographic procedures result in high absorbed doses to patients. The main objective of this work was to perform a dosimetric study of CT scanners located at Recife and to evaluate the image quality on CT examinations in these equipment. The volume CT air kerma index (C{sub VOL}) and air kerma length product (P{sub KL,CT}) were estimated. These values were calculated using normalized weighted air kerma indexes in CT standard dosimetry phantoms ({sub n}C{sub W}), supplied by ImPACT group for several CT scanners, and the scan parameters of routine head, routine chest and hi-resolution chest CT exams performed at 20 institutions. The irradiation parameters of 15 adult patients for each CT procedure were registered at six participating centres, at which the phantom from the American College of Radiology (ACR) CT accreditation protocol was used for the image quality measurements. For routine head exams, the C{sub VOL} values varied between 12 and 58 mGy (at the posterior fossa) and 15 to 58 mGy (at the cerebrum) and the P{sub KL,CT}, from 150 to 750 mGy{center_dot}cm. The C{sub VOL} values for routine chest procedures varied from 3 to 26 mGy and the P{sub KL,CT}, between 120 and 460 mGy{center_dot}cm. In relation to Hi-resolution chest exams, C{sub VOL} values were from 1.0 to 2.7 mGy and the P{sub KL,CT} values varied between 24 and 67 mGy{center_dot}cm. The image quality evaluations results showed that almost all scanners presented at least one inadequacy. One of the equipment presented faults at 70% of the tests. With regard to the image noise, only two scanners presented acceptable results. From these results, it is possible to conclude that the volume CT air kerma index values are lower than the European reference levels. However, the image quality of these CT scanners does not attend the ACR requirements, suggesting the need to implement quality assurance programs at the evaluated institutions. (author)

  19. Quantificação em escala de bancada do volume de ar em ligações prediais de água Measuring air volume in household pipes by means of a pilot scale study

    OpenAIRE

    Ney Procópio Lopes; Márcia Lara; Marcelo Libânio

    2011-01-01

    A presente pesquisa em escala piloto, simulando trecho de uma rede interligada a um ramal predial, visou quantificar o volume de ar aferido pelos hidrômetros residenciais. Para tal fim, testaram-se ventosas, bloqueadores de ar e válvulas eliminadoras de ar. Sob condições normais de operação da rede, o volume de ar medido pelos hidrômetros é comparável ao encontrado na água natural, não justificando a instalação de equipamento de eliminação de ar de qualquer natureza. Todavia, logo após esvazi...

  20. Densitometria da vértebra dorsal, osso pleural e osso neural em tartarugas verdes hígidas por tomografia computadorizada quantitativa Densitometry of dorsal vertebrae, pleural bone and neural bone in healthy green sea turtles by quantitative computed tomography

    Directory of Open Access Journals (Sweden)

    Jannine Forattini de Oliveira

    2012-08-01

    Full Text Available A tomografia computadorizada quantitativa (TCQ é uma técnica com alta sensibilidade, aplicabilidade e precisão no diagnóstico de perda de massa óssea, entretanto a falta de valores de normalidade para animais silvestres limita a sua aplicação clínica. O presente estudo objetiva estabelecer valores médios de radiodensidade do osso trabecular das vértebras dorsais, osso pleural e osso neural de tartarugas marinhas juvenis hígidas utilizando a TCQ. Para isso, utilizou-se um grupo experimental de cinco animais que foram submetidos a exames de tomografia computadorizada helicoidal, sendo as mensurações da radiodensidade óssea realizadas ao nível da terceira, quarta e quinta vértebras dorsais. Os valores médios de radiodensidade do osso trabecular das vértebras dorsais, osso pleural e osso neural foram, respectivamente, de 287,4±39,1, 1093,74±100,4 e 1089,6±86,5 unidades Hounsfield (HU. Estudos complementares devem ser realizados em diferentes espécies e faixas etárias de quelônios para favorecer a aplicação clínica desta técnica.Quantitative computed tomography (QCT is a technique with high sensitivity, applicability and accuracy in the diagnosis of bone loss; however the lack of normal values for wild animals limits their clinical application. This study aims to establish medium values radiodensity trabecular bone of the dorsal vertebrae, bone pleural and neural bone in healthy juvenile sea turtles using the QTC. For this we used an experimental group of five animals that underwent helical computed tomography, and measurements of bone radiodensity conducted at the level of the third, fourth and fifth dorsal vertebrae. The medium values of radiodensity trabecular bone of the dorsal vertebrae, pleural bone, and neural bone were respectively 287.4±39.1, 1093.74±100.4, and 1089.6±86.5 Hounsfield units (HU. Further studies should be performed in different species and ages of turtles to encourage the clinical application of

  1. Edema pulmonar hidrostático: aspectos na tomografia computadorizada de alta resolução Hydrostatic pulmonary edema: high-resolution computed tomography aspects

    OpenAIRE

    Cláudia Maria Cunha Ribeiro; Edson Marchiori; Rosana Rodrigues; Emerson Gasparetto; Arthur Soares de Souza Júnior; Dante Escuissato; Luiz Felipe Nobre; Gláucia Zanetti; César de Araujo Neto; Klaus Irion

    2006-01-01

    OBJETIVO: A proposta deste estudo foi caracterizar por meio de tomografia computadorizada de alta resolução do tórax as principais alterações pulmonares do edema pulmonar hidrostático. MÉTODOS: Foram analisadas, retrospectivamente, as tomografias de quinze pacientes com quadro clínico de edema pulmonar hidrostático, divididos em cinco principais grupos etiológicos: insuficiência cardíaca congestiva, valvulopatia mitral aguda, infarto agudo do miocárdio, miocardite e mediastinite fibrosante, t...

  2. A tomografia computadorizada na avaliação do comprometimento abdominal na paracoccidioidomicose

    Directory of Open Access Journals (Sweden)

    Roberto Martinez

    1988-06-01

    Full Text Available A tomografia computadorizada foi utilizada para avaliar o comprometimento abdominal em 25 doentes deparacoccidioidomicose. Existiam lesões intra-abdominais em, respectivamente, 75%e23% dos doentes com asformas aguda ("juvenil" e crônica ( do adulto '. A alteração mais freqüente foi o aumento dos gânglios linfáticos abdominais (12/25 casos; outras lesões foram: calcificação de gânglios linfáticos em 4 casos; obstrução das vias biliares em 5 doentes ictéricos; abscessos ou calcificação esplénica em 3 casos; 2 doentes mostraram lesões incomuns: aumento e irrgularidade do pâncreas em um e múltiplos abscessos nos músculos psoas em outro. Conclui-se que a tomografia computadorizada é procedimento útil na avaliação da disseminação da paracoccidioidomicose ao abdome e no diagnóstico de suas complicações abdominais.Computerised tomography was utilized in 25 paracoccidioidomycosis patients to evaluate abdominal involvement. This was observed in patients, 75% of acute (juvenile type and 23% of chronic (adult type patients. The most frequent alteration was abdominal lymphnode enlargement (12/25 cases. Other lesions consisted of lymphnode calcification in 4 cases, biliary tract obstruction in 5 icteric patients, splenic abscess or calcification in 3 cases. Two patients had unusual lesions: one with pancreatic enlargement and irregularity and other with multiple abscesses in both psoas muscles. It was concluded that computerised tomography is a useful procedure for evaluating paracoccidioidomycosis dissemination to the abdomen and for the diagnosis of its abdominal complications.

  3. Tomografia computadorizada aplicada a estudos de um Planossolo

    Directory of Open Access Journals (Sweden)

    Pedrotti Alceu

    2003-01-01

    Full Text Available Na busca de técnicas mais apuradas para a determinação e avaliação de parâmetros físicos do solo com aplicabilidade em várzeas, vem se destacando a tomografia computadorizada, por medir a densidade e a umidade com boa sensibilidade e alta resolução espacial. O presente trabalho teve como objetivo descrever aspectos e procedimentos da calibração de um minitomógrafo de raios-X e gama para estudo da densidade e umidade de um Planossolo no Rio Grande do Sul, bem como estabelecer parâmetros estatísticos para sua adequada utilização. A calibração do minitomógrafo foi obtida pela regressão linear entre as unidades tomográficas (UT, apresentadas pelo programa de reconstrução de imagem, e os coeficientes de atenuação linear (µl, cm-1, medidos por transmissão direta de raios gama, em amostras dos horizontes A e B do Planossolo, água destilada, benzina e alumínio. Para as medidas de transmissão direta de radiação utilizaram-se recipientes com água destilada, benzina, solo e Al, obtendo-se as seguintes fórmulas para o cálculo da densidade do solo no horizonte A: Ds = [(UT/986,16-(0,200xteta]/0,267; e no horizonte B: Ds = [(UT/986,16-(0,200xteta]/0,297, em que UT é o valor médio de UT em cada linha e teta é a umidade volumétrica da amostra de solo, em m³ m-3. Com as configurações obtidas, verificou-se variabilidade média de 2,74% e 0,73%, respectivamente, em termos de homogeneidade e repetibilidade. Os erros atribuídos ao equipamento são de 0,051 e 0,046 Mg m-3, respectivamente, nos horizontes A e B, revelando precisão e adaptabilidade no emprego da técnica em estudos do Planossolo.

  4. DESCRIÇÃO DA TEMPERATURA E UMIDADE RELATIVA DO AR EM DIFERENTES LOCALIDADES NO BAIRRO DO PARQUE DEZ - MANAUS/AM

    Directory of Open Access Journals (Sweden)

    José Carlos Ramos Monteiro

    2014-08-01

    Full Text Available Manaus tem sofrido com o rápido crescimento da atividade imobiliária sem preocupação com a preservação de grande parte de suas áreas verdes, ocasionando modificações nas variáveis como a temperatura e a umidade relativa do ar. O presente estudo acompanhou as variações temporais e espaciais de temperatura e umidade relativa do ar e fez comparações entre suas características nos diferentes usos e ocupações do solo do Bairro do Parque Dez, área centro sul do município de Manaus em diferentes dias e horários. Na rotatória do Parque do Mindu a média de temperatura chegou a 37,08°C entre às 14hs e 15hs e a menor registrada foi de 26,50°C, entre o horário de 8hs e 9hs. No mês de outubro de 2012 a temperatura na Av. Perimetral entre 14h e 15h apresentou valores de 31,96°C e a menor média registrada aconteceram entre 21h e 22h, registrando 29,3°C. Em relação à umidade relativa do ar em setembro/2012 foi observada média de 72% com variação de 65% a 80%, em outubro/2012 a média foi de 64% com variação entre 63% a 75%, em março/2013 a média foi de 88% com variação entre 80% a 95%. Interações ocorreram principalmente no horário e mês sobre a temperatura ambiente e umidade relativa do ar. Conclui-se que o efeito da urbanização tornasse mais evidente quando se constata que as tendências positivas estão altamente correlacionadas com a tendência de crescimento da área urbana. Palavras-chave: Microclima, Conforto térmico, Metereologia, Amazônia, Clima urbano. DOI: http://dx.doi.org/10.18561/2179-5746/biotaamazonia.v4n2p20-27

  5. Controle de fungos presentes no ar e em sementes de feijão durante armazenamento Control of fungi present in the air and bean seeds during storage

    OpenAIRE

    Flávio M. Borém; Osvaldo Resende; José da C Machado; Isa M. R. Fontenelle; Frederico F. de Sousa

    2006-01-01

    Objetivou-se, no presente trabalho, avaliar a eficácia de um equipamento redutor de inóculo (ERI) na preservação da qualidade sanitária de sementes de feijão (Phaseolus vulgaris L.) durante o armazenamento em estruturas herméticas com circulação de ar forçado. A presença de inóculo no ar foi monitorada a partir da exposição de placas de Petri com meio de cultura BDA salino, contando-se o número de unidades formadoras de colônias (UFC) dos fungos Aspergillus spp. e Penicillium spp. As análises...

  6. Central nervous system abnormalities on midline facial defects with hypertelorism detected by magnetic resonance image and computed tomography Anomalias de sistema nervoso central em defeitos de linha média facial com hipertelorismo detectados por ressonância magnética e tomografia computadorizada

    Directory of Open Access Journals (Sweden)

    Vera Lúcia Gil-da-Silva-Lopes

    2006-12-01

    Full Text Available The aim of this study were to describe and to compare structural central nervous system (CNS anomalies detected by magnetic resonance image (MRI and computed tomography (CT in individuals affected by midline facial defects with hypertelorism (MFDH isolated or associated with multiple congenital anomalies (MCA. The investigation protocol included dysmorphological examination, skull and facial X-rays, brain CT and/or MRI. We studied 24 individuals, 12 of them had an isolated form (Group I and the others, MCA with unknown etiology (Group II. There was no significative difference between Group I and II and the results are presented in set. In addition to the several CNS anomalies previously described, MRI (n=18 was useful for detection of neuronal migration errors. These data suggested that structural CNS anomalies and MFDH seem to have an intrinsic embryological relationship, which should be taken in account during the clinical follow-up.Este estudo objetivou descrever e comparar as anomalias estruturais do sistema nervoso central (SNC detectadas por meio de ressonância magnética (RM e tomografia computadorizada (TC de crânio em indivíduos com defeitos de linha média facial com hipertelorismo (DLMFH isolados ou associados a anomalias congênitas múltiplas (ACM. O protocolo de investigação incluiu exame dismorfológico, RX de crânio e face, CT e RM de crânio. Foram estudados 24 indivíduos, sendo que 12 apresentavam a forma isolada (Grupo I e os demais, DLMFH com ACM de etiologia não esclarecida (Grupo II. Não houve diferença entre os dois grupos e os resultados foram agrupados. Além de várias anomalias de SNC já descritas, a RM foi útil para detecção de erros de migração neuronal. Os dados sugerem que as alterações estruturais de SNC e os DLMFH têm relação embriológica, o que deve ser levado em conta durante o seguimento clínico.

  7. Aspectos da tomografia de coerência óptica na doença de Stargardt: relato de caso Optical coherence tomography aspects of Stargardt's disease: case report

    Directory of Open Access Journals (Sweden)

    Enéias Bezerra Gouveia

    2006-08-01

    Full Text Available O termo fundus flavimaculatus (doença de Stargardt descreve um grupo de distrofias maculares hereditárias caracterizadas por múltiplos "flecks" amarelados em nível do epitélio pigmentar da retina. Os autores descrevem os achados de tomografia de coerência óptica (OCT em paciente portador de doença de Stargardt e sugerem que a OCT tem validade como exame subsidiário no estudo das características da retina de pacientes portadores da doença de Stargardt, embora estudos envolvendo maior número de pacientes sejam indicados para permitir traçar-se o perfil das alterações mais comuns nestes casos.The term fundus flavimaculatus (Stargardt disease describes a group of inherited macular dystrophies characterized by multiple yellow to yellow-white flecks at the level of the retinal pigment epithelium. The authors describe findings in the patient with Stargardt's disease using optical coherence tomography (OCT, and suggest the examination to be valid as subsidiary method in the study of the characteristics of the retina in Stargardt's disease patients, but studies involving a series of patients should be able to show the most frequent findings in these cases.

  8. Modelagem matemática do crescimento de fungos filamentosos sobre superfícies úmidas e nutritivas em contato com o ar

    OpenAIRE

    Coradin, Juliana Hey

    2010-01-01

    Resumo: O crescimento de fungos filamentosos sobre superfícies úmidas e nutritivas em contato com o ar é um fenômeno importante em processos de grande destaque, como na fermentação no estado sólido (FES) e na decomposição da matéria orgânica. Ele ocorre por meio do aumento de biomassa através de estruturas fúngicas individuais que se assemelham a “tubos” microscópicos, conhecidas como hifas. Dentro delas ocorre um conjunto de fenômenos físicos e biológicos que já estão bem caracterizados iso...

  9. Opacidades em vidro fosco nas doenças pulmonares difusas: correlação da tomografia computadorizada de alta resolução com a anatomopatologia Ground-glass opacity in diffuse lung diseases: high-resolution computed tomography-pathology correlation

    Directory of Open Access Journals (Sweden)

    Maria Lúcia de Oliveira Santos

    2003-12-01

    Full Text Available Opacidade em vidro fosco é achado freqüentemente visto na tomografia computadorizada de alta resolução do tórax e se traduz pelo aumento do coeficiente de atenuação dos pulmões, mas sem apagar as marcas broncovasculares. Por sua inespecificidade, a associação com outros achados radiológicos, clínicos e anatomopatológicos deve ser considerada para uma interpretação diagnóstica mais correta. Neste trabalho foram analisados 62 exames tomográficos de pacientes com doenças pulmonares difusas, de 14 etiologias diferentes, em que opacidades em vidro fosco foram o achado único ou predominante, e feita correlação anatomopatológica por meio de biópsias ou necropsias. Na pneumocistose as opacidades em vidro fosco corresponderam, histologicamente, à ocupação alveolar por material espumoso contendo parasitos; no carcinoma bronquíolo-alveolar, a espessamento dos septos alveolares e ocupação de sua luz por muco e células tumorais; na paracoccidioidomicose, a espessamento dos septos alveolares, áreas de fibrose e alvéolos contendo exsudato broncopneumônico; na sarcoidose, a fibrose ou a acúmulo de granulomas; na fibrose pulmonar idiopática, a espessamento dos septos alveolares por fibrose; na bronquiolite obliterante com pneumonia em organização, a pneumonia intersticial com áreas de organização intra-alveolar. A ocupação alveolar por sangue foi observada nos casos de leptospirose, hemossiderose idiopática, metástases de tumor renal e na aspergilose invasiva; por vacúolos de gordura na pneumonia lipídica; por material protéico e lipoprotéico na silicoproteinose e na proteinose alveolar; e por líquido de edema na insuficiência cardíaca congestiva.Ground-glass opacity is a finding frequently seen in high-resolution computed tomography examinations of the chest and is characterized by hazy increased attenuation of lung, however without blurring of bronchial and vascular margins. Due to its unspecificity

  10. Avaliação da tomografia de coerência óptica em pacientes portadores de degeneração macular relacionada à idade tratada com terapia fotodinâmica com verteporfina Ocular coherence tomography in age-related macular degeneration patients treated with photodynamic therapy with vertepofirin

    Directory of Open Access Journals (Sweden)

    Arnaldo Furman Bordon

    2008-12-01

    Full Text Available OBJETIVO: Identificar os achados na tomografia de coerência óptica (OCT e suas variações ao longo de 12 meses, em pacientes portadores de degeneração macular relacionada à idade (DRMI, submetidos à terapia fotodinâmica com verteporfina (TFD. DESENHO DO ESTUDO: Série de casos, aberto, não aleatório e intervencionista. MÉTODOS: Pacientes acima de 50 anos, portadores de DMRI neovascular foram submetidos ao exame oftalmológico completo, angiofluoresceinografia e OCT antes do início do tratamento (V0 e 3, 6, 9 e 12 meses após (V3, V6, V9 e V12, respectivamente. O tratamento empregado foi a TFD. A acuidade visual (AV foi mensurada usando-se a tabela do ETDRS. Realizaram-se as medições das espessuras foveais: espessura intraretiniana foveal (FIRT, espessura foveal do complexo coriocapilar - EPR (FCC-EPRT e espessura foveal total (TFT. Realizaram-se as mensurações das espessuras extrafoveais, em um raio de 1500 µ da fóvea: espessura intraretiniana extrafoveal (EFIRT, espessura extrafoveal do complexo coriocapilar - EPR (EFCC-EPRT e espessura extrafoveal total (TEFT. Análise estatística foi realizada usando-se a análise de variância em blocos. RESULTADOS: Vinte e três olhos de 23 pacientes foram avaliados. Foram identificados nove achados à OCT: 1º espessamento das camadas intraretinianas na fóvea; 2º espessamento das camadas intraretinianas na região extrafoveal; 3º espessamento do complexo coriocapilar-EPR (FCC-EPRT na fóvea; 4º espessamento do complexo coriocapilar-EPR na área extrafoveal; 5º presença de fluido sub-EPR; 6º presença de fluido sub-retiniano; 7º presença de fluido intraretiniano; 8º presença da membrana hialóide posterior aderida à retina; 9º presença da depressão foveal. Na visita inicial a FIRT e a TFT foram respectivamente 398,5 µ e 639,2 µ. Em V12 foram 173,7 µ e 423,9 µ. A variação foi estatisticamente significante (p = 0,008 e p = 0,003, respectivamente. As outras espessuras

  11. Lesões traumáticas do parênquima pulmonar: aspectos na tomografia computadorizada Traumatic lung lesions: computed tomography findings

    Directory of Open Access Journals (Sweden)

    Alessandro Severo Alves de Melo

    2003-06-01

    Full Text Available As lesões pulmonares são achados freqüentes no trauma torácico, sendo cada vez mais diagnosticadas pela tomografia computadorizada, em especial pelo rápido tempo de aquisição decorrente da técnica helicoidal, que permite a avaliação de pacientes em estado grave, possibilitando a adoção de conduta terapêutica eficiente. Os autores estudaram 150 pacientes vítimas de trauma torácico submetidos a tomografia computadorizada, que apresentaram lesões pulmonares, representadas por contusões, atelectasias, lacerações e hematomas pulmonares. As contusões pulmonares se caracterizaram por consolidações e atenuação em vidro fosco, sendo as lesões pulmonares mais comuns. As atelectasias foram observadas com os padrões subsegmentar e compressiva, e foram a segunda lesão mais comum. As lacerações se apresentaram como consolidações com ar ou nível líquido no interior. Os hematomas pulmonares representaram a lesão pulmonar mais rara, presentes em apenas cinco casos, caracterizados por opacidades arredondadas. Neste trabalho o trauma torácico fechado predominou, com 120 casos, enquanto o trauma aberto ocorreu em 30 casos. As causas de trauma fechado, em ordem decrescente de freqüência, foram: colisão automobilística, atropelamento, queda de altura, acidente de motocicleta e espancamento. A forma penetrante de traumatismo torácico decorreu de duas causas de agressão: lesão por arma de fogo e lesão por arma branca.Traumatic lesions of the lung are common findings in patients with thoracic trauma. These lesions are increasingly diagnosed using computed tomography, mostly due to the fast acquisition time helical techniques that allow evaluation of critically ill patients and an efficient therapeutic management. The authors studied 150 patients with thoracic trauma submitted to computed tomography that demonstrated lung contusions, atelectasies, lacerations and hematomas. Lung contusions were the most frequent lesions

  12. Biomassa microbiana em amostras de solos secadas ao ar e reumedecidas Microbial biomass in air dried and rewetted soil samples

    Directory of Open Access Journals (Sweden)

    Antônio Samarão Gonçalves

    2002-05-01

    Full Text Available O objetivo do trabalho foi avaliar a viabilidade do condicionamento de amostras como terra fina secada ao ar (TFSA por curto período, para a determinação do carbono da biomassa microbiana (BMS-C, pelo método da fumigaçãoextração, e verificar a respiração microbiana basal (RB do solo. O condicionamento como TFSA, procedendo-se à fumigação para a análise da BMS-C imediatamente ou 24 horas após o reumedecimento, proporcionou valores de BMS-C para os solos Podzólicos, Latossolo Vermelho-Amarelo álico e Orgânico, semelhantes aos valores dos seus controles. Os solos Glei Pouco Húmico e Vertissolo apresentaram valores de BMS-C similares aos do controle a partir de 24 horas de incubação; o solo Planossolo arenoso apresentou valores similares aos do controle com 72 horas, e a Rendizina, com 168 horas de incubação. Na maioria dos solos, a RB determinada na TFSA apresentou valores maiores do que os do tratamento-controle, quando avaliada imediatamente ou 24 horas após o reumedecimento a 60% da capacidade máxima de retenção de água, seguida de queda e manutenção em níveis semelhantes ao do controle nos períodos subseqüentes. O précondicionamento, de curta duração, como TFSA, é promissor para a determinação da BMS-C, quando níveis e períodos adequados de reumedecimento são adotados.The objective of this work was to evaluate the utilization of short term air dried soil samples in a determination of soil microbial biomass (SMB-C, by a fumigationextraction method, and soil microbial basal respiration (BR. Zero time or 24 hours rewetting incubation period before fumigation procedure gave values of SMB-C similar to those of the control for the Podzolic soils, Allic RedYellow Latosol and Organic soil. Low Humic Gley and Vertisol soils gave values of SMB-C similar to those of the control for periods of incubation equal or higher than 24 hours. Planosol (sandy soil and Rendzina soils gave values of SMB-C similar to the

  13. Correlação entre a escala de coma de Glasgow e os achados de imagem de tomografia computadorizada em pacientes vítimas de traumatismo cranioencefálico

    Directory of Open Access Journals (Sweden)

    Fabiana Lenharo Morgado

    2011-02-01

    Full Text Available OBJETIVO: Determinar a correlação da escala de coma de Glasgow, fatores causais e de risco, idade, sexo e intubação orotraqueal com os achados tomográficos em pacientes com traumatismo cranioencefálico. MATERIAIS E MÉTODOS: Foi realizado estudo transversal prospectivo de 102 pacientes, atendidos nas primeiras 12 horas, os quais receberam pontuação segundo a escala de coma de Glasgow e foram submetidos a exame tomográfico. RESULTADOS: A idade média dos pacientes foi de 37,77 ± 18,69 anos, com predomínio do sexo masculino (80,4%. As causas foram: acidente automobilístico (52,9%, queda de outro nível (20,6%, atropelamento (10,8%, queda ao solo ou do mesmo nível (7,8% e agressão (6,9%. No presente estudo, 82,4% dos pacientes apresentaram traumatismo cranioencefálico de classificação leve, 2,0% moderado e 15,6% grave. Foram observadas alterações tomográficas (hematoma subgaleal, fraturas ósseas da calota craniana, hemorragia subaracnoidea, contusão cerebral, coleção sanguínea extra-axial, edema cerebral difuso em 79,42% dos pacientes. Os achados tomográficos de trauma craniano grave ocorreram em maior número em pacientes acima de 50 anos (93,7%, e neste grupo todos necessitaram de intubação orotraqueal. CONCLUSÃO: Houve significância estatística entre a escala de coma de Glasgow, idade acima de 50 anos (p < 0,0001, necessidade de intubação orotraqueal (p < 0,0001 e os achados tomográficos.

  14. Efeitos transversais da expansão rápida da maxila em pacientes com má oclusão de Classe II: avaliação por Tomografia Computadorizada Cone-Beam Transverse effects of rapid maxillary expansion in Class II malocclusion patients: a Cone-Beam Computed Tomography study

    Directory of Open Access Journals (Sweden)

    Carolina Baratieri

    2010-10-01

    Full Text Available OBJETIVO: avaliar por meio de Tomografia Computadorizada Cone-Beam (TCCB os efeitos transversais, imediatos e após o período de contenção, da expansão rápida da maxila (ERM em pacientes com má oclusão de Classe II. MÉTODOS: dezessete crianças (idade inicial média de 10,36 anos com má oclusão de Classe II e deficiência transversal esquelética da maxila foram submetidas ao protocolo de ERM com aparelho expansor de Haas. TCCBs foram realizadas antes dos procedimentos clínicos (T1, imediatamente após a estabilização do parafuso expansor (T2 e após completados 6 meses de contenção e removido o aparelho (T3. Com o software Dolphin, foram possíveis a manipulação das imagens e as mensurações. O teste t de Student pareado foi utilizado para identificar significância estatística (pOBJECTIVE: The aim of this study was to evaluate by Cone-Beam Computed Tomography (CBCT transversal responses, immediately and after the retention period, to rapid maxillary expansion (RME, in Class II malocclusion patients. METHODS: Seventeen children (mean initial age of 10.36 years, with Class II malocclusion and skeletal constricted maxilla, underwent Haas´ protocol for RME. CBCT scans were taken before treatment (T1, at the end of the active expansion phase (T2 and after the retention period of six months (T3. The scans were managed in Dolphin software, where landmarks were marked and measured, on a coronal slice passing through the upper first molar. The paired Student´s t-test was used to identify significant differences (p<0.05 between T2 and T1, T3 and T2, and T3 and T1. RESULTS: Immediately after RME, the mean increase in maxillary basal, alveolar and dental width was 1.95 mm, 4.30 mm and 6.89 mm, respectively. This was accompanied by buccal inclination of the right (7.31° and left (6.46° first molars. At the end of the retention period, the entire transverse dimension increased was maintained and the dentoalveolar inclination resumed

  15. Correlação entre a escala de coma de Glasgow e os achados de imagem de tomografia computadorizada em pacientes vítimas de traumatismo cranioencefálico

    OpenAIRE

    Fabiana Lenharo Morgado; Luiz Antônio Rossi

    2011-01-01

    OBJETIVO: Determinar a correlação da escala de coma de Glasgow, fatores causais e de risco, idade, sexo e intubação orotraqueal com os achados tomográficos em pacientes com traumatismo cranioencefálico. MATERIAIS E MÉTODOS: Foi realizado estudo transversal prospectivo de 102 pacientes, atendidos nas primeiras 12 horas, os quais receberam pontuação segundo a escala de coma de Glasgow e foram submetidos a exame tomográfico. RESULTADOS: A idade média dos pacientes foi de 37,77 ± 18,69 anos, com ...

  16. Ars disyecta Ars disyecta

    Directory of Open Access Journals (Sweden)

    Alejandra Castillo

    2012-07-01

    Full Text Available Bajo la nominación Ars Disyecta se busca exponer el vínculo entre artes visuales, feminismo y metamorfosis. Las prácticas artísticas feministas aquí presentadas se proponen perturbar el espacio metafórico heredado de la diferencia sexual (pensemos, por ejemplo, en las palabras engendramiento, matriz, vida, compenetración o invaginamiento. En este sentido, la nominación Ars disyecta pone en escena un conjunto de prácticas e intervenciones que intentan interrumpir la matriz de la diferencia, desestabilizando lo femenino desde aquellas figuras que se resisten a la lógica de la totalidad y de un tiempo propio. Buscando seguir la huella de un arte disyecto es que interrogaré en este ensayo aquellas autorías feministas que en el arte contemporáneo trafican con las huellas del contagio, la mutación y la alteridad.This article aims to present the relation between visual arts, feminism I and metamorphosis. The feminist artistic practices portrayed in this article attempt to question categories inherited from the metaphor of sexual difference such as engendering, matrix and life. From this perspective, Ars disyecta will establish a set of artistic practices and interventions that intend to interrupt the proper idea of «feminine difference». Following this line of argument, I will discuss in this article a few contemporary feminist works of art that could be defined by words such as contagious, mutation and otherness.

  17. A tomografia computadorizada de alta resolução na avaliação da toxicidade pulmonar por amiodarona High-resolution computed tomography of amiodarone pulmonary toxicity

    OpenAIRE

    Daniela Peixoto Consídera; Edson Marchiori; Arthur Soares Souza Jr.; Gláucia Zanetti; Dante L. Escuissato; Emerson L. Gasparetto; César de Araújo Neto; Ronaldo de Souza Leão Lima; Sérgio Salles Xavier; Roberto Coury Pedrosa

    2006-01-01

    OBJETIVO: Avaliar as principais alterações identificadas na tomografia computadorizada de alta resolução do tórax em pacientes com toxicidade pulmonar pela amiodarona. MATERIAIS E MÉTODOS: Foram avaliadas dez tomografias computadorizadas de alta resolução de tórax de pacientes com pneumonite pela amiodarona, seis desses pacientes do sexo masculino e quatro do sexo feminino, com idade média de 73,5 anos. RESULTADOS: Os achados tomográficos mais relevantes foram opacidades lineares ou reticular...

  18. Quantificação em escala de bancada do volume de ar em ligações prediais de água Measuring air volume in household pipes by means of a pilot scale study

    Directory of Open Access Journals (Sweden)

    Ney Procópio Lopes

    2011-12-01

    Full Text Available A presente pesquisa em escala piloto, simulando trecho de uma rede interligada a um ramal predial, visou quantificar o volume de ar aferido pelos hidrômetros residenciais. Para tal fim, testaram-se ventosas, bloqueadores de ar e válvulas eliminadoras de ar. Sob condições normais de operação da rede, o volume de ar medido pelos hidrômetros é comparável ao encontrado na água natural, não justificando a instalação de equipamento de eliminação de ar de qualquer natureza. Todavia, logo após esvaziamento da rede interligada ao ramal, a sobremedição pode atingir até 21% em condições de pressão máxima na rede de distribuição (500 kPa. Por fim, verificou-se que a menor vazão afluente associa-se ao maior volume de ar aferido pelo hidrômetro. Dessa forma, é possível supor que os consumidores situados na menor faixa de consumo sejam os mais prejudicados pela situação de desabastecimento.The purpose of the present work is to evaluate the volume of air measured in domestic water supply pipe connections. Tests were performed to evaluate the efficiency and applicability of air reducing valves in domestic water supply connections. The results obtained under regular water supply conditions showed that the volume of air in the water measured by the hydrometers is comparable to the one found in natural waters. On the other hand, other tests, right after emptying the network connected to the domestic water supply pipe, revealed that the volume of water which gets to the gauged reservoir comprehends up to 21% of the total air-water volume recorded by the hydrometer for the experiments performed under pressure of 500 kPa.

  19. Tomografia por emissão de pósitrons (PET) no tórax: resultados preliminares de uma experiência brasileira

    OpenAIRE

    TERRA FILHO MÁRIO; BOMBARDA SIDNEY; SOARES JÚNIOR JOSÉ; MENEGHETTI JOSÉ CLÁUDIO

    2000-01-01

    Novos métodos não invasivos estão sendo desenvolvidos para a detecção de neoplasias malignas pulmonares. Dentre estes destaca-se a tomografia por emissão de pósitrons (PET), que utiliza como radiotraçador a deoxi-2-D glicose marcada com fluor-18 (FDG). Objetivo: Avaliar os resultados do FDG-PET, realizado em câmara híbrida com circuito de coincidência em pacientes portadores de doenças pleuropulmonares infecciosas ou tumorais. Material e Métodos: Foram avaliados 15 pacientes divididos em: gru...

  20. Práticas cirúrgicas baseadas em evidências: tomografia computadorizada helicoidal no diagnóstico da apendicite aguda Evidence-based surgical practices: helical computed tomography in acute appendicitis diagnosis

    Directory of Open Access Journals (Sweden)

    Carlos Alberto Guimarães

    2008-08-01

    Full Text Available Os cirurgiões são instados a não somente ler os artigos dos periódicos, mas também a compreendê-los e analisá-los criticamente quanto à validade. Eles cuidam melhor dos seus pacientes se são capazes de analisar criticamente a literatura e aplicar os resultados a sua prática. Este é o segundo artigo de uma série - Práticas Cirúrgicas Baseadas em Evidência - que tem por objetivo apresentar a avaliação crítica de um teste diagnóstico.Surgeons are told that they need not only read journal articles, but also understand them and make a critical appraisal of their validity. They offer better care if they are able to appraise critically the original literature and apply the results to their practice. This is the second article of a series - Evidence-Based Surgical Practices - which focus on critical appraisal of a diagnostic test.

  1. Malária pulmonar: aspectos na tomografia computadorizada de alta resolução - relato de caso

    Directory of Open Access Journals (Sweden)

    Rodrigues Rosana

    2004-01-01

    Full Text Available Neste trabalho é relatado o caso de paciente do sexo masculino, de 38 anos de idade, que desenvolveu quadro de malária com comprometimento pulmonar. A tomografia computadorizada de alta resolução evidenciou espessamento de septos interlobulares e de bainhas peribroncovasculares, com áreas esparsas de atenuação em vidro fosco e de consolidações, além de derrame pleural bilateral, aspectos compatíveis com edema pulmonar. O paciente recebeu tratamento específico, evoluindo bem e tendo alta 11 dias após a internação.

  2. Malária pulmonar: aspectos na tomografia computadorizada de alta resolução - relato de caso

    OpenAIRE

    Rodrigues Rosana; Marchiori Edson; Souza Daniel Andrade Tinoco de

    2004-01-01

    Neste trabalho é relatado o caso de paciente do sexo masculino, de 38 anos de idade, que desenvolveu quadro de malária com comprometimento pulmonar. A tomografia computadorizada de alta resolução evidenciou espessamento de septos interlobulares e de bainhas peribroncovasculares, com áreas esparsas de atenuação em vidro fosco e de consolidações, além de derrame pleural bilateral, aspectos compatíveis com edema pulmonar. O paciente recebeu tratamento específico, evoluindo bem e tendo alta 11 di...

  3. Sistematização do estudo anatômico do aqueduto vestibular por tomografia computadorizada de alta resolução em pacientes com doenças de Ménière unilateral Systematization of vestibular aqueduct anatomical study by high-resolution computed tomography in patients with unilateral Ménière's disease

    Directory of Open Access Journals (Sweden)

    Eliézia Helena de Lima Alvarenga

    2006-10-01

    Full Text Available OBJETIVO: Sistematizar a avaliação do aqueduto vestibular por tomografia computadorizada de alta resolução (TCAR em pacientes com doença de Ménière unilateral e comparar com um grupo-controle. MATERIAIS E MÉTODOS: Selecionamos 20 pacientes com doença de Ménière unilateral, segundo critérios da Academia Americana de Otorrinolaringologia - Cirurgia de Cabeça e Pescoço, e um grupo-controle composto por dez indivíduos com avaliação auditiva normal, totalizando 60 orelhas, distribuídas igualmente em três grupos: grupo I - doença de Ménière, orelha comprometida; grupo II - doença de Ménière, orelha não-comprometida; grupo III - controle. Submetemos os pacientes à TCAR de ossos temporais. O estudo das imagens foi feito de modo cego, procurando avaliar a visibilidade da porção descendente do aqueduto vestibular. Os dados obtidos foram correlacionados com os respectivos grupos. RESULTADOS: A visualização do aqueduto vestibular foi de 95% no grupo I, 90% no grupo II e 100% no grupo III. CONCLUSÃO: É possível sistematizar a avaliação por TCAR do aqueduto vestibular, com aquisição axial, usando a mesma técnica radiológica, conhecimento anatômico e seguimento seqüencial das estruturas da orelha interna. Com esta sistematização houve alta taxa de visualização do aqueduto vestibular, sem diferença estatisticamente significante entre os grupos.OBJECTIVE: To systematize the assessment of vestibular aqueduct by high-resolution computed tomography (HRCT in patients with unilateral Ménière's disease as compared with a control group. MATERIALS AND METHODS: We have selected 20 patients with unilateral Ménière's disease, according to the guidelines proposed by the American Academy of Otolaryngology - Head and Neck Surgery. The control group consisted of ten individuals with normal audiometric tests. Overall, we have studied 60 ears, equally divided into three groups: group I - Ménière's disease, affected ear; group

  4. Adjuvantes e assistência de ar em pulverizador de barras sobre a deposição da calda e controle de Phakopsora pachyrhizi (Sydow & Sydow

    Directory of Open Access Journals (Sweden)

    Hélio Oliveira Aguiar Júnior

    2011-09-01

    Full Text Available Com o intuito de melhorar a cobertura da pulverização e diminuir as perdas na produtividade da cultura da soja, o estudo objetivou avaliar o efeito da adição de adjuvantes à calda combinado ou não ao uso da assistência de ar sobre a deposição da pulverização, controle de Phakopsora pachyrhizi H. Sydow & P. Sydow, perdas de produção (peso de 1000 grãos e produtividade da cultura (kg ha-1. Dois experimentos a campo foram conduzidos na cultura da soja, variedade Conquista, safra agrícola 2008/09. Um deles no delineamento em blocos ao acaso com três doses de adjuvantes associados a um marcador cúprico combinadas a dois níveis de ar na barra de pulverização (0 e 29 km h-1, totalizando 6 tratamentos e 4 repetições. Outro experimento foi instalado no mesmo local do anterior. O delineamento experimental utilizado foi o de blocos ao acaso com 7 tratamentos: fungicida e dois adjuvantes associados ao fungicida, combinados a dois níveis de ar na barra de pulverização (0 e 29 km h-1, mais testemunha, e 4 repetições. Após a pulverização do fungicida piraclostrobina + epoxiconazole com diferentes tecnologias, procedeu-se a avaliação da severidade da doença através da estimativa da área abaixo da curva de progresso da doença (AACPD e da produtividade da cultura da soja. A assistência de ar na velocidade máxima gerada pelo ventilador (29 km h-1, combinada ao fungicida piraclostrobina + epoxiconazole mais o adjuvante organosiliconado Silwet L-77 contribuiu para melhor controle da ferrugem asiática, proporcionando incremento na produtividade e no peso de 1000 grãos.

  5. Controle de fungos presentes no ar e em sementes de feijão durante armazenamento Control of fungi present in the air and bean seeds during storage

    Directory of Open Access Journals (Sweden)

    Flávio M. Borém

    2006-09-01

    Full Text Available Objetivou-se, no presente trabalho, avaliar a eficácia de um equipamento redutor de inóculo (ERI na preservação da qualidade sanitária de sementes de feijão (Phaseolus vulgaris L. durante o armazenamento em estruturas herméticas com circulação de ar forçado. A presença de inóculo no ar foi monitorada a partir da exposição de placas de Petri com meio de cultura BDA salino, contando-se o número de unidades formadoras de colônias (UFC dos fungos Aspergillus spp. e Penicillium spp. As análises sanitárias das sementes foram realizada pelo método do papel de filtro (Blotter test, calculando-se o índice de ocorrência de Aspergillus spp. e Penicillium spp. Durante o período de armazenamento, houve um aumento na incidência de fungos nas sementes, independente da presença dos ERI. Nas amostragens realizadas na entrada da caixa com a presença dos ERI, não foram encontradas unidades formadoras de colônias. Com o aumento do fluxo de ar utilizado no sistema, notou-se que este efeito foi transferido para a saída da caixa. Nas condições especificadas, os ERI foram incapazes de controlar os fungos de armazenamento, Aspergillus spp e Penicillium spp, nas sementes de feijão, porém foram eficazes no controle dos seus esporos presentes no ar.The objective of the present work was to evaluate the efficiency of inoculum reducing equipment (IRE in the maintenance of quality of bean seeds during storage in hermetic structures with circulation of forced air. The inoculum's presence in the air was monitored by the exposition of Petri dishes with culture medium (saline BDA by counting the number of colonies units of Aspergillus and Penicillium. The quality analysis of seeds were performed by the blotter test. The occurrence index was calculated for Aspergillus spp and Penicillium spp. The fungal occurrence increased during the storage period, in spite of the IRE presence. Fungal colonies were not found in the air samples collected at the box

  6. Manifestações clínicas de pacientes com diagnóstico de neurocisticercose por tomografia computadorizada

    Directory of Open Access Journals (Sweden)

    PFUETZENREITER MÁRCIA REGINA

    1999-01-01

    Full Text Available Foram estudados através de entrevistas semi-estruturadas pacientes submetidos a tomografia computadorizada de crânio em um centro de diagnóstico por imagem na cidade de Lages. Realizaram-se entrevistas em 42 pacientes positivos para cisticercose cerebral e 57 pacientes sem alterações patológicas ao referido exame. Os pacientes com diagnóstico positivo relataram com maior frequência manifestações clínicas relacionadas à neurocisticercose, sendo este fato mais marcante para o sexo feminino, com exceção de convulsões, que ocorreram mais no sexo masculino (19,05% que no feminino (7,14%. A maior percentagem de diagnósticos de formas inativas (83,33% e o relato de sintomas em um tempo mais prolongado entre os entrevistados positivos sugerem que o problema é antigo.

  7. Qualidade do ar em ambientes internos hospitalares: estudo de caso e análise crítica dos padrões atuais Indoor air quality in hospitals: a case study and a critical review of current standards

    OpenAIRE

    Marina Eller Quadros; Henrique de Melo Lisboa; Vetúria Lopes de Oliveira; Waldir Nagel Schirmer

    2009-01-01

    O objetivo deste trabalho foi avaliar a qualidade do ar em três categorias de ambientes hospitalares: unidade de terapia intensiva (UTI) adulto, UTI neonatal (UTN) e centro cirúrgico de um hospital em Florianópolis, Brasil. Avaliaram-se a concentração de dióxido de carbono, a vazão e renovação de ar nas salas do centro cirúrgico. A concentração de bioaerossóis foi estimada em um dia de avaliação para cada ambiente. Não se observou relação entre a concentração de bioaerossóis e o tempo de uso ...

  8. Alterações dimensionais do côndilo mandibular em indivíduos de 3 a 20 anos de idade usando tomografia computadorizada de feixe cônico: um estudo preliminar Mandibular condyle dimensional changes in subjects from 3 to 20 years of age using Cone-Beam Computed Tomography: a preliminary study

    Directory of Open Access Journals (Sweden)

    José Valladares Neto

    2010-10-01

    Full Text Available INTRODUÇÃO: o exame de tomografia computadorizada de feixe cônico (TCFC oferece excelente representação dos tecidos duros da articulação temporomandibular (ATM. OBJETIVO: investigar as alterações morfológicas do côndilo mandibular, da infância à idade adulta, utilizando a TCFC. MÉTODOS: um estudo transversal foi conduzido envolvendo 36 côndilos de 18 indivíduos com idades variando entre 3 e 20 anos. As imagens dos côndilos foram obtidas por meio do sistema i-CAT e medidas com uma ferramenta do programa específica para ATM, que permite cortes perpendiculares à cabeça do côndilo, com correção individual em função das diferenças angulares de cada um. As maiores distâncias nas vistas lateral e frontal foram consideradas tanto para os côndilos do lado direto como para os do lado esquerdo. RESULTADOS: a dimensão lateral do côndilo mandibular parece ser estabelecida de maneira precoce, sofrendo poucas alterações com o passar dos anos, enquanto a dimensão frontal tende a aumentar. Assimetrias entre o côndilo esquerdo e o direito foram comumente observadas; no entanto, tais diferenças não apresentaram significância estatística para as vistas lateral (P=0,815 e frontal (P=0,374. CONCLUSÕES: os côndilos apresentaram simetria com relação ao tamanho, sendo observado crescimento apenas na dimensão frontal Os resultados sugerem que a TCFC constitui-se numa ferramenta útil na mensuração e avaliação das dimensões condilares.INTRODUCTION: Cone-Beam Computed Tomography (CBCT imaging provides an excellent representation of the temporomandibular joint bone tissues. OBJECTIVE: The aim of this study was to investigate morphological changes of the mandibular condyle from childhood to adulthood using CBCT. METHODS: A cross-sectional study was conducted in 36 condyles of 18 subjects from 3 to 20 years of age. Condyles were scanned with the i-CAT Cone-Beam 3D imaging system and linear dimensions were measured with a

  9. Complicações pulmonares após uso de crack: achados na tomografia computadorizada de alta resolução do tórax Pulmonary complications of crack cocaine use: high-resolution computed tomography of the chest

    OpenAIRE

    Alexandre Mançano; Edson Marchiori; Gláucia Zanetti; Dante Luiz Escuissato; Beatriz Cunha Duarte; Lourenço de Araujo Apolinário

    2008-01-01

    Relatamos os achados na tomografia computadorizada de alta resolução de um paciente que, após uso de cocaína fumada (crack), desenvolveu quadro de hemoptise, dispnéia e dor torácica súbitas. As radiografias de tórax mostravam consolidações predominando em lobos superiores. A tomografia de alta resolução evidenciava opacidades em vidro fosco, consolidações e nódulos do espaço aéreo. Nova tomografia de controle, após suspensão da droga e uso de corticóides, mostrou regressão parcial das lesões ...

  10. A neurocisticercose no Rio Grande do Norte antes e depois da tomografia computadorizada: apresentação de um caso

    Directory of Open Access Journals (Sweden)

    Ivanilton Galhardo

    1993-11-01

    Full Text Available Os autores fazem referência ao aparecimento de vários casos de neurocisticercose no Rio Grande do Norte após a chegada da tomografia computadorizada (TC ao Estado e enfatizam esse tipo de exame para o diagnóstico da parasitose no sistema nervoso. Apresentam um caso como sendo o primeiro diagnosticado e divulgado no Congresso Brasileiro de Neurologia realizado em Porto Alegre - RS, em outubro-1992. O diagnóstico foi feito, especialmente, pela TC e pela reação de hemaglutinação no líquido céfaloraqueano.

  11. Tomografia por emissão de pósitrons com FDG-18F na avaliação de pacientes com artrite reumatoide – revisão sistemática

    Directory of Open Access Journals (Sweden)

    Dalton Alexandre dos Anjos

    2014-12-01

    Full Text Available Introdução A artrite reumatoide (AR é uma doença caracterizada pela inflamação da membrana sinovial. Diversos autores têm investigado o papel da tomografia por emissão de pósitrons (PET com flúor-18 (FDG-18F na AR. Objetivos Revisão sistemática da literatura atual sobre o papel do PET com FDG-18F no diagnóstico, determinação da atividade da doença e avaliação da resposta ao tratamento em pacientes com AR. Métodos Foram realizadas buscas nas bases de dados Medline, Biblioteca Cochrane, Lilacs, Pubmed e Scopus nos idiomas português, inglês e espanhol, utilizando as palavras-chave «artrite reumatoide», «sinovite», «FDG», «PET», «metabolismo glicolítico» e «atividade da doença». Resultados 142 artigos foram inicialmente identificados, dos quais apenas 40 relacionavam-se diretamente ao tema. Foram selecionados 12 artigos originais e três relatos de caso que preenchiam os critérios de inclusão. Discussão A presença de fibroblastos e macrófagos ativados no pannus é responsável pela intensa captação periarticular de FDG-18F. Os padrões de captação não permitem o diagnóstico diferencial com outras artrites. A intensidade de captação e o número de articulações envolvidas são parâmetros metabólicos de atividade da doença que apresentam boa correlação com os índices compostos. Estudos longitudinais de PET têm se mostrado úteis na avaliação da resposta ao tratamento com anti-TNF. Quando realizado precocemente, PET pode predizer a resposta terapêutica. Conclusão Embora o real papel dessa nova técnica na investigação da AR ainda não esteja estabelecido, PET com FDG-18F é uma ferramenta promissora na determinação da atividade e na predição de resposta ao tratamento de pacientes com AR.

  12. Distribuição vertical e horizontal de temperaturas do ar em ambientes protegidos Vertical and horizontal distribution of air temperature in a plastic greenhouse

    Directory of Open Access Journals (Sweden)

    Raquel A. Furlan

    2002-04-01

    Full Text Available Este trabalho foi realizado na área experimental do Departamento de Engenharia Rural da Escola Superior de Agricultura "Luiz de Queiroz", Piracicaba, SP, Brasil, em dois ambientes protegidos construídos no sentido leste-oeste, com área total de 112 m² e coberto com plástico (150 micra, tratado contra raios ultravioleta. Para caracterizar a distribuição espacial da temperatura do ar no ambiente protegido, instalaram-se termopares (cobre-constantã formando malhas, com espaçamento horizontal entre eles de 3,0 m e nas alturas de 0,5, 1,0, 2,0, 3,0 e 4,0 m em relação ao solo. Os dados foram armazenados a cada 15 min por sistemas automáticos de aquisição de dados nos ambientes protegidos. O sistema de nebulização constituiu-se de duas linhas com 70 bocais totais, instalados a uma altura de 3,0 m, utilizando-se uma pressão de trabalho de 200 kPa. A nebulização não afetou o gradiente vertical de temperatura, que manteve a tendência de aumento de temperatura com a altura, em relação ao nível do solo, enquanto o efeito na redução de temperatura pelo sistema de nebulização somente foi eficaz durante a realização da mesma. Para a representação da distribuição espacial de temperatura do ar no ambiente protegido nos diferentes níveis de altura, construiu-se superfícies isotérmicas a partir dos resultados. Verifica-se que a nebulização apresentou maior efeito na homogeneização da distribuição de temperatura no ambiente protegido no nível referente a 2,0 m de altura, em relação ao solo.This work was conducted in the experimental area of the Department of Rural Engineering of "Escola Superior de Agricultura Luiz de Queiroz", University of São Paulo, Piracicaba, São Paulo, Brazil. Two greenhouses were installed in the east-west direction, with 6.4 m of width, 17.5 m of length and 3.0 m high, with total area of 112 m²; covered by plastic of 150 micra thickness, treated against ultra violet rays. To characterize the

  13. Teor de arsênio e adsorção competitiva arsênio/fosfato e arsênio/sulfato em solos de Minas Gerais, Brasil Arsenate content, and arsenate/phosphate and arsenate/sulphate competitive adsorption in soils from Minas Gerais, Brazil

    Directory of Open Access Journals (Sweden)

    Mari Lucia Campos

    2013-06-01

    Full Text Available A alta toxicidade de As para homens e animais gera a necessidade de estudos do comportamento químico do arsenato nos solos que possam auxiliar na mitigação de áreas contaminadas com arsênio. Este trabalho teve por objetivo avaliar o teor total e a adsorção de As na ausência e presença dos ânions fosfato e sulfato em seis diferentes classes de solos do estado de Minas Gerais, Brasil. Os solos alvo deste estudo são: o Neossolo Flúvico (RU, Gleissolo Háplico (GX, Gleissolo Melânico (GM, Latossolo Vermelho Distrófico (LVd, coletados em Lavras; Neossolo Quartzarênico (RQ, coletado em Itutinga e o Latossolo Amarelo Distrófico (LAd, coletado em Rosário, no estado de Minas Gerais. As amostras de solo foram secas, moídas e peneiradas em peneira de 2,0mm para execução do teste de adsorção e peneiradas em peneira plástica com malha de 1,5mm para determinação do teor de As, o qual foi determinado pelo método 3051A. A adsorção de As foi avaliada na dose de1500µmol L-1 de As, 1500µmol L-1 de As + 1500µmol L-1 de P e 1500µmol L-1 de As + 750µmolL-1 de S, em relação solo:solução final de 1:100, a pH 5,5 e força iônica de 15mmol L-1. Os seis solos apresentaram teor médio de As entre 0,14 e 9,3mgkg-1. A porcentagem adsorvida de arsênio na ausência dos outros ânions seguiu a sequência GM>LVd=RU=LAd=GX=RQ. A adição de fosfato e sulfato reduziu a porcentagem de arsênio adsorvido e, por consequência, houve um aumentou na concentração de arsênio disponível na solução do solo.The high toxicity of arsenic to humans and animals creates the need to study the chemical behavior of arsenate in soils that can help in the mitigation of areas contaminated with arsenic. This work aimed to evaluate the total content and adsorption in the absence and presence of phosphate and sulfate anions in six different soil classes in the state of Minas Gerais, Brazil. Soils aim of this study are: Fluvic Neosol (RU, Haplic Gleysol (GX

  14. Dançar o adolescer: estudo fenomenológico com um grupo de dança de rua em uma escola

    Directory of Open Access Journals (Sweden)

    Renata Marques Rego Miranda

    2010-12-01

    Full Text Available Esta pesquisa propôs-se a compreender os sentidos atribuídos à experiência de dançar por adolescentes praticantes da dança de rua no contexto de uma escola púbica de uma cidade do interior do Estado São Paulo. Trata-se de um estudo qualitativo de caráter exploratório e de inspiração fenomenológica. O referencial teórico norteador foi a psicologia de orientação humanista, especificamente a Abordagem Centrada na Pessoa (ACP, desenvolvida por Carl Rogers. A pesquisadora acompanhou, semanalmente, durante seis meses as aulas de dança e, posteriormente, realizou entrevistas individuais com sete alunos. Foram construídas sete narrativas focadas na experiência vivida pelos participantes da pesquisa sob o prisma da relação intersubjetiva estabelecida entre a pesquisadora e os alunos. Verificou-se que a experiência em foco proporcionou aos alunos a emergência de elementos típicos da experiência de adolescer, o que permitiu concluir que há uma aproximação com a proposta de aprendizagem significativa, desenvolvida por Rogers.

  15. Deposição e perdas da calda em feijoeiro em aplicação com assistência de ar na barra pulverizadora Spray deposition and spray loss using air-assistance boom on bean plants

    Directory of Open Access Journals (Sweden)

    Carlos Gilberto Raetano

    2004-01-01

    Full Text Available Com o objetivo de avaliar a influência da assistência de ar na deposição da calda de pulverização, em plantas de feijoeiro (Phaseolus vulgaris aos 26 dias após a emergência (DAE, com pontas de pulverização de jato cônico vazio (JA-0,5 e JA-1 e jato plano (AXI-110015, e volumes de calda, foi realizado um experimento em delineamento inteiramente casualizado, utilizando como traçador o íon cobre. Alvos coletores (papel de filtro com 3 x 3 cm foram afixados nas superfícies adaxial e abaxial de folíolos posicionados nas partes superior e inferior das plantas. Para aplicar a solução traçadora, utilizou-se pulverizador com barras de 14 metros, com e sem assistência de ar, volumes de 60 e 100 L.ha-1, e velocidade do ar correspondente a 50% da rotação máxima do ventilador. Após a aplicação, os coletores foram lavados individualmente em solução extratora de ácido nítrico a 1,0 mol.L-1, e a quantificação dos depósitos através de espectrofotometria. A assistência de ar não influenciou na deposição da calda tanto a 60 quanto a 100 L.ha-1. O maior volume proporcionou maiores depósitos, sendo constatadas elevadas perdas para o solo (mais de 60%.Aiming to evaluate the effect of air-assistance in spray deposition on bean plants (Phaseolus vulgaris with hollow nozzles (JA-0,5 and JA-1 and flat fan nozzle type (AXI-110015, and volume rates by air-assisted and non-assisted sprayers, a completely randomized experiment was carried out using copper ion as a tracer to the evaluation of the deposits. At 26 days after emergence, artificial targets were positioned on the upper and under-side of the leaflets, on the top and bottom parts of the same plants under spray boom. For the application of tracer solution it was used a fourteen meter boom sprayer with and without air-assistance at 60 and 100 L.ha-1 of volume rates. The air flow was 50% of the maximum fan rotation. After application, targets were individually washed with an

  16. Avaliação da concentração de monóxido de carbono no ar exalado em tabagistas com DPOC Evaluation of the exhaled carbon monoxide levels in smokers with COPD

    OpenAIRE

    Gustavo Chatkin; José Miguel Chatkin; Gabriel Aued; Guilherme Oliveira Petersen; Edna Thais Jeremias; Flávia Valladão Thiesen

    2010-01-01

    OBJETIVO: Medir os níveis de monóxido de carbono no ar exalado (COex) em tabagistas com e sem DPOC. MÉTODOS: Tabagistas frequentadores dos ambulatórios do Hospital São Lucas em Porto Alegre (RS) entre setembro de 2007 e março de 2009 foram convidados a participar do estudo. Os participantes responderam a um questionário com características demográficas e epidemiológicas e realizaram espirometria, medição de cotinina urinária e de COex. Os participantes foram agrupados conforme a presença de D...

  17. Tomografia computadorizada na avaliação da densidade de um solo do semi-árido brasileiro

    Directory of Open Access Journals (Sweden)

    L. Fante Junior

    2002-12-01

    Full Text Available A densidade do solo de amostras indeformadas foi determinada por meio das técnicas de tomografia computadorizada e do torrão impermeabilizado, visando à identificação de processos de compactação do solo e a comparação de métodos. A pesquisa também visou auxiliar um levantamento pedológico elaborado com fins de classificação de terras para irrigação. As amostras de solo foram coletadas da região semi-árida de Petrolina (PE, ao longo de perfis do solo, da superfície até 1 m de profundidade, em camadas de 0,1 m e em duas áreas distintas quanto à sua ocupação vegetal e manejo: (1 vegetação natural (caatinga; (2 área cultivada e irrigada por pivô central. As tomografias foram realizadas com um tomógrafo de primeira geração, constituído por uma fonte de radiação gama de 137Cs e um detetor cintilador de NaI(Tl, com eletrônica padrão de espectrometria gama e sistema de movimentação de amostra controlados por uma interface específica acoplada a um microcomputador. Na área de caatinga, os resultados evidenciam a ocorrência de um adensamento do solo em camadas mais profundas, abaixo de 0,4 m, bem como de uma camada adensada e, ou, compactada entre aproximadamente 0 e 0,4 m, na área cultivada com pivô central, possivelmente em virtude da ação de máquinas e implementos utilizados no preparo e cultivo do solo.

  18. Daños tóxicos en tejidos vegetales, producidos por aguas contaminadas con arsénico en Zimapán, Hidalgo, México Danos tóxicos em tecidos vegetais, produzidos por águas contaminadas com arsênio em Zimapán, Hidalgo, México

    Directory of Open Access Journals (Sweden)

    Francisco Prieto García

    2006-03-01

    Full Text Available Según estudios realizados en el periodo de 1992-1998 en las aguas de los pozos, norias y manantiales, del municipio de Zimapán, Estado de Hidalgo, México, se corroboró que existía un incremento en el contenido de arsénico rebasando los límites máximos permisibles por la Norma Oficial Mexicana. La determinación de arsénico en las muestras de aguas se realizó por absorción atómica (AAS, mediante generador de hidruros (GH. En este estudio se utilizó el Vicia faba como un bioensayo para evaluar el daño genotóxico con la prueba de inducción de micronúcleos por exposición al agua de Zimapán, contaminada con As en células de raíces. Se utilizó como ensayo de control un agua de pozo de similares características del municipio de Pachuca, pero con contenidos de As por debajo de los límites de detección. Los resultados mostraron que el agua de esta región presenta altas concentraciones de arsénico y que puede provocar efectos genotóxicos que se manifiestan por la inducción de micronúcleos en las células meristemáticas de raíces de tejidos vegetales sensible.Estudos feitos no período de 1992-1998 nas águas dos poços da municipalidade de Zimapán, estado do Hidalgo, México, demostram o aumento na concentração de arsênio ultrapassando os limites máximos permissíveis pela norma oficial mexicana. A determinação de arsênio nas amostras de água foi feita por absorção atômica (AA, por meio do gerador de hidruros (GH. Neste estudo, o Vicia faba foi usado como bioensaio para avaliar os danos genotóxicos com o teste da indução dos micronúcleos pela exposição à água de Zimapán, contaminada com arsênio em células de raízes. Como controle, foi usada uma água com similares características, do município de Pachuca, mas com índices abaixo dos limites de detecção. Os resultados mostraram que a água desta região apresenta altas concentrações de arsênico e que os efeitos genotóxicos manifestam-se pela

  19. Diagnóstico auxiliado por computador na detecção de nódulos pulmonares pela tomografia computadorizada com múltiplos detectores: estudo preliminar de 24 casos Detection of pulmonary nodules by computer-aided diagnosis in multidetector computed tomography: preliminary study of 24 cases

    OpenAIRE

    Julia Capobianco; Dany Jasinowodolinski; Gilberto Szarf

    2008-01-01

    OBJETIVOS: Avaliar o desempenho de um programa para auxílio na detecção de nódulos pulmonares em tomografia computadorizada com múltiplos detectores (TCMD). MÉTODOS: Foram avaliadas 24 tomografias computadorizadas de tórax consecutivas realizadas no Centro de Medicina Diagnóstica Fleury no período de 07/10/2006 a 19/10/2006 usando um tomógrafo helicoidal multidetectores de 64 canais. O estudo compreendeu 12 pacientes do sexo feminino e 12 do sexo masculino, com idades variando entre 35 e 77 a...

  20. Quando a fase de equilíbrio pode ser suprimida nos exames de tomografia computadorizada de abdome?

    Directory of Open Access Journals (Sweden)

    Priscila Silveira Salvadori

    2013-04-01

    Full Text Available OBJETIVO: Avaliar a necessidade de realização da fase de equilíbrio nos exames de tomografia computadorizada de abdome. MATERIAIS E MÉTODOS: Realizou-se estudo retrospectivo, transversal e observacional, avaliando 219 exames consecutivos de tomografia computadorizada de abdome com contraste intravenoso, realizados num período de três meses, com diversas indicações clínicas. Para cada exame foram emitidos dois pareceres, um avaliando o exame sem a fase de equilíbrio (primeira análise e o outro avaliando todas as fases em conjunto (segunda análise. Ao final de cada avaliação, foi estabelecido se houve mudança nos diagnósticos principais e secundários, entre a primeira e a segunda análise. Foi utilizada a extensão do teste exato de Fisher para avaliar a modificação dos diagnósticos principais (p 0,999. Com relação aos diagnósticos secundários, cinco exames (2,3% foram modificados. CONCLUSÃO: Para indicações clínicas como estadiamento tumoral, abdome agudo e pesquisa de coleção abdominal, a fase de equilíbrio não acrescenta contribuição diagnóstica expressiva, podendo ser suprimida dos protocolos de exame.

  1. Densidade de um planossolo sob sistemas de cultivo avaliada por meio da tomografia computadorizada de raios gama Bulk density of an alfisol under cultivation systems in a long-term experiment evaluated with gamma ray computed tomography

    OpenAIRE

    Adilson Luís Bamberg; Eloy Antonio Pauletto; Algenor da Silva Gomes; Luís Carlos Timm; Luiz Fernando Spinelli Pinto; Ana Cláudia Rodrigues de Lima; Thiago Rech da Silva

    2009-01-01

    A sustentabilidade do arroz (Oryza sativa L.) irrigado em solos de várzea está alicerçada na utilização da rotação e sucessão de culturas, fundamentais para o controle do arroz-vermelho e preto. Os reflexos sobre os atributos dos solos de várzea merecem estudos em especial sobre a compactação do solo. O objetivo deste trabalho foi identificar camadas compactadas em Planossolo submetido a diferentes sistemas de cultivo e preparo, avaliando-se a densidade do solo (Ds) pela Tomografia Computador...

  2. Tomografia por emissão de pósitrons (PET) no tórax: resultados preliminares de uma experiência brasileira Thoracic positron emission tomography: preliminary results of a Brazilian experiment

    OpenAIRE

    MÁRIO TERRA FILHO; SIDNEY BOMBARDA; JOSÉ SOARES JÚNIOR; JOSÉ CLÁUDIO MENEGHETTI

    2000-01-01

    Novos métodos não invasivos estão sendo desenvolvidos para a detecção de neoplasias malignas pulmonares. Dentre estes destaca-se a tomografia por emissão de pósitrons (PET), que utiliza como radiotraçador a deoxi-2-D glicose marcada com fluor-18 (FDG). Objetivo: Avaliar os resultados do FDG-PET, realizado em câmara híbrida com circuito de coincidência em pacientes portadores de doenças pleuropulmonares infecciosas ou tumorais. Material e Métodos: Foram avaliados 15 pacientes divididos em: gru...

  3. Ars Electronica

    DEFF Research Database (Denmark)

    Kristensen, Thomas Bjørnsten

    2009-01-01

    Anmeldelse af Ars Electronica festivalen 3. - 8. september, 2009 i Linz, Østrig, der fejrede 30 års jubilæum under temaet "Human Nature". Festivalen fokuserer på interaktion mellem menneske, teknologi, kunst og samfund med særlig vægt på udviklingen af computeren og det digitale. Udgivelsesdato: 15.12...

  4. Avaliação do ambiente solo-semente por meio da tomografia computadorizada Evaluation of the soil-seed environment through computerized tomography

    OpenAIRE

    Alcir José Modolo; Haroldo Carlos Fernandes; João de Mendonça Naime; Carlos Ernesto G.R. Schaefer; Nerilson Terra Santos; João Cleber Modernel da Silveira

    2008-01-01

    O condicionamento físico do solo ao redor das sementes reveste-se de grande importância para o bom desenvolvimento inicial da cultura, assegurando uma população sadia de plantas. O adequado contato solo-semente é um pré-requisito para a rápida emergência e o bom estabelecimento da cultura. Neste trabalho, objetivou-se utilizar a tomografia computadorizada de resolução milimétrica para determinação do ambiente solo-semente em sistema de plantio direto, logo após o plantio da cultura da soja. U...

  5. Estereoscopio com tela holografica para ver tomografias

    CERN Document Server

    Lunazzi, J J; Magalhaes, D S F

    2010-01-01

    A estereoscopia eh uma tecnica que permite a observacao de imagens tridimensionais, mas estah sempre associada com o uso de algum equipamento especial para visualizacao, como oculos bicolores ou polarizados. Para o uso em aplicacoes medicas o emprego de tais equipamentos pode inviabilizar sua utilizacao durante procedimentos cirurgicos, por exemplo. Neste trabalho apresentamos um novo tipo de estereoscopio que utiliza uma tela holografica para geracao de imagens tridimensionais sem o uso de qualquer equipamento adicional. Apresentamos a descricao do equipamento utilizado e resultados das imagens visualizadas.

  6. TEMPERATURA DO AR NO INTERIOR DO CANAL DE CULTIVO E CRESCIMENTO DA ALFACE EM FUNÇÃO DO MATERIAL DE COBERTURA DA MESA DE CULTIVO HIDROPÔNICO - NFT

    Directory of Open Access Journals (Sweden)

    MATTOS KAREN MARIA DA COSTA

    2001-01-01

    Full Text Available Estudou-se o efeito de diferentes tipos de material de cobertura de mesas de cultivo hidropônico-NFT na temperatura do interior das canaletas e no crescimento da alface (Lactuca sativa L., cv. Verônica. Em comparação ao tratamento-controle (tubos de polipropileno, utilizaram-se mantas de polietileno dupla face (branco e preto e de Tetra-Pak®. O experimento foi realizado no Núcleo Experimental de Campinas, do Instituto Agronômico (22°54'S, 47°05'W, 674 m de altitude, usando-se mesas de cultivo com 24 m de comprimento, dividida em quatro blocos simétricos com os tratamentos distribuídos ao acaso. Sessenta termopares foram instalados no interior dos tubos para avaliar a temperatura interna do ar; armazenaram-se os sinais em um datalogger. Os valores medidos no interior dos tubos foram sempre superiores aos externos. Entretanto, nos tubos protegidos com Tetra-Pak®, os dados da temperatura interna do ar foram sempre de menor magnitude e, os de massa fresca de plantas de alface, superiores aos demais tratamentos. Essas diferenças foram estatisticamente significativas pelo teste de Tukey ao nível de 5%. No período noturno, nenhuma diferença de comportamento foi obtida entre os três tratamentos usados.

  7. Abrasão a ar: efeito no preparo cavitário e na microinfiltração em dentes decíduos = Air Abrasion: effect on cavity preparation and on microleakage in primary teeth

    Directory of Open Access Journals (Sweden)

    Antunes, Lívia Azeredo Alves

    2014-01-01

    Full Text Available Objetivo: Comparar os efeitos da abrasão a ar e ponta diamantada de alta rotação sobre a topografia de preparos cavitários e a microinfiltração em dentes decíduos. Métodos: Neste estudo in vitro, as cavidades foram preparadas nas superfícies de 60 dentes, utilizando ambas as técnicas em cada dente. Vinte dentes foram escolhidos aleatoriamente para uma análise descritiva da topografia. Metade dos dentes restantes (20 foram tratados com um sistema adesivo de condicionamento total e a outra metade tratada com um sistema adesivo auto-condicionante e todas as amostras foram restauradas com resina. Depois disso, as amostras foram preparadas para os testes de microinfiltração e avaliadas por dezenas. Os dados estatísticos foram avaliados e um nível de significância de 5 % foi adotado para todos os testes. Resultados: A técnica de abrasão a ar produziu topografia diferenciada e aumentou a formação da camada de smear layer (Test qui-quadrado Stuart -Maxwell, p=0,03. Infiltração não foi influenciada por qualquer um dos sistemas de adesivos usados para preparações de cavidade (teste de Wilcoxon, p=0,08. No entanto, a ponta diamantada de alta rotação proporcionou mais infiltração independente do adesivo utilizado (Mann-Whitney, p=0,04; p=0,01. Conclusão: A técnica de abrasão a ar demonstrou ser uma boa alternativa para a prevenção de infiltração durante a preparação da cavidade em dentes decíduos

  8. Condicionamento de ar em salas de operação e controle de infecção - uma revisão

    Directory of Open Access Journals (Sweden)

    May Socorro Martinez Afonso

    2006-04-01

    Full Text Available Revisão bibliográfica, realizada junto aos bancos de dados MED LINE, LILACS, SCIELO, Ministério da Saúde e outros buscadores, com o objetivo de identificar os fatores que torna o ar condicionado fonte de contaminação ambiental. O ar é contaminado por partículas que transportam microrganismos. As fontes de partículas incluem pacientes e equipe cirúrgica. O controle da temperatura, umidade relativa, pressão, número de trocas de ar realizadas por hora, paramentação, tráfego, número de pessoas nas salas e manutenção e limpeza do sistema de ar condicionado dos centros cirúrgicos, são fatores importantes na redução do número de microrganismos no ambiente de sala de operação.

  9. Implicações de redes temáticas em blogs na Análise de Redes Sociais (ARS: estudo de caso de blogs sobre autismo e síndrome de Asperger

    Directory of Open Access Journals (Sweden)

    Sandra Portella Montardo

    2010-12-01

    Full Text Available Neste estudo objetiva-se apontar especificidades de redes temáticas em blogs de familiares de Pessoas com Necessidades Especiais (PNE com relação à Análise de Redes Sociais (ARS. Nosso objeto de estudo são as redes sociais em blogs de familiares de pessoas com autismo e com síndrome de Asperger. Sob o prisma da Inclusão Social (IS e da Inclusão Digital (ID, percebe-se que a especificação da temática em torno das quais essas redes se formam é condição sine qua non para o seu estabelecimento. Esse foco sugere uma problematização do conceito de laços fracos e laços fortes. A netnografia é a metodologia utilizada para análise dos blogs selecionados. Frente a isso, a análise de capital social e de laços sociais de forma interdependente - o que consiste numa adaptação a um modelo de estrutura de redes proposto - revelou-se pertinente para a identificação da IS em redes temáticas na web.

  10. Uso da tomografia por impedância elétrica torácica como ferramenta de auxílio às manobras de recrutamento alveolar na síndrome do desconforto respiratório agudo: relato de caso e breve revisão da literatura

    Directory of Open Access Journals (Sweden)

    Regis Goulart Rosa

    2015-12-01

    Full Text Available RESUMO A tomografia por impedância elétrica torácica constitui ferramenta de monitorização não invasiva, em tempo real, da distribuição regional da ventilação pulmonar. Sua utilização à beira do leito em pacientes com síndrome do desconforto respiratório agudo tem o potencial de auxiliar na condução de manobras de recrutamento alveolar, frequentemente necessárias em casos de hipoxemia refratária. Neste relato de caso, apresentamos os resultados e a interpretação da monitorização da tomografia por impedância elétrica torácica em um paciente com síndrome do desconforto respiratório agudo, durante manobras de recrutamento alveolar, com aplicação transitória de altas pressões alveolares e titulação da pressão positiva ao final da expiração ideal. Adicionalmente, apresentamos uma breve revisão da literatura a respeito do uso de manobras de recrutamento alveolar e monitorização com tomografia por impedância elétrica torácica em pacientes com síndrome do desconforto respiratório agudo.

  11. Tomografia computadorizada das células etmoidais intra e extramurais: ensaio iconográfico

    Directory of Open Access Journals (Sweden)

    Fabrício Guimarães Gonçalves

    2011-10-01

    Full Text Available O desenvolvimento dos seios paranasais é um processo intricado que se inicia na vida intrauterina e termina na idade adulta. Dos seios da face, as células etmoidais são provavelmente as estruturas mais complexas e as que estão associadas com o maior número de variantes da normalidade. Variações no padrão de pneumatização das células etmoidais podem ser divididas em intra ou extramurais. Intramurais são aquelas que ao se desenvolverem mantêm contato com o labirinto etmoidal, e extramurais as que se desenvolvem isoladamente. A tomografia computadorizada é a ferramenta mais útil na avaliação de processos inflamatórios dos seios paranasais. De igual modo, ela é importante para o planejamento pré-operatório e controle pós-operatório, pois possibilita grande detalhe anatômico das estruturas normais e detecção precisa de suas variantes. Neste ensaio iconográfico os autores descrevem as principais variantes da normalidade do labirinto etmoidal e suas relações com estruturas adjacentes. Cirurgias endoscópicas para o tratamento de afecções dos seios paranasais têm-se tornado cada vez menos invasivas, o que certamente aumentará a demanda por relatórios de imagem cada vez mais ricos em detalhes desta região.

  12. LINFOMAS PULMONARES: CORRELAÇÃO DA TOMOGRAFIA COMPUTADORIZADA DE ALTA RESOLUÇÃO COM A ANATOMOPATOLOGIA

    Directory of Open Access Journals (Sweden)

    Marchiori Edson

    2002-01-01

    Full Text Available Neste trabalho são descritos os aspectos tomográficos de alta resolução dos linfomas pulmonares e feita correlação com os achados anatomopatológicos. Com este objetivo, foram revisados as tomografias computadorizadas de alta resolução do tórax e os dados histopatológicos de dez pacientes com diagnóstico confirmado de linfoma não-Hodgkin ou de doença de Hodgkin. Os resultados obtidos foram confrontados com os descritos na literatura. Os achados radiológicos mais comumente vistos neste estudo foram as consolidações parenquimatosas, localizadas, com broncogramas aéreos de permeio (n = 8. Em menor freqüência, foram encontrados múltiplos nódulos parenquimatosos (n = 4, espessamento peribroncovascular (n = 3 e opacidades em vidro fosco (n = 2. Na correlação com a anatomia patológica, as consolidações corresponderam a preenchimento alveolar por células neoplásicas, o espessamento peribroncovascular se deveu a infiltração das bainhas peribroncovasculares por células linfomatosas e a atenuação em vidro fosco se associou com infiltração dos septos alveolares por tais células.

  13. Poluição do ar e doenças respiratórias e cardiovasculares: estudo de séries temporais em Cubatão, São Paulo, Brasil

    Directory of Open Access Journals (Sweden)

    Adelaide Cassia Nardocci

    2013-09-01

    Full Text Available Foi avaliado o impacto da poluição do ar nas internações por doenças respiratórias e cardiovasculares em residentes do Município de Cuba-tão, São Paulo, Brasil. Utilizaram-se modelos de séries temporais, com modelos aditivos generalizados, em regressão de Poisson, testando como variáveis independentes as concentrações diárias de material particulado (PM10; dióxido de enxofre (SO2 e o ozônio (O3. Como variáveis de controle a temperatura, umidade, dias da semana e feriados. Para cada incremento de 10µg/m³ de PM10, encontrou-se um excesso de internações de 4,25% (IC95%: 2,82; 5,71; 5,74% (IC95%: 3,80; 7,71 e 2,29% (IC95%: 0,86; 3,73 para doenças respiratórias totais, doenças respiratórias em menores de 5 anos e doenças cardiovasculares em maiores de 39 anos, respectivamente. O SO2 apresentou relação com as doenças cardiovasculares em maiores de 39 anos de 3,51% (IC95%: 1,24; 5,83 e o O3 com as doenças cardiovasculares em maiores de 39 anos: 2,85% (IC95%: 0,77; 4,98 e doenças respiratórias em menores de 5 anos: 3,91% (IC95%: 1,37; 6,51. Os efeitos da poluição atmosférica na saúde em Cubatão são pronunciados, indicando a necessidade de melhoria das políticas de controle.

  14. SECAGEM DE SEMENTES DE SOJA EM SILO COM DISTRIBUIÇÃO RADIAL DO FLUXO DE AR: I. MONITORAMENTO FÍSICO DRYING OF SOYBEAN SEEDS IN A RADIAL AIR FLOW DRYER: I. PHYSICAL MONITORING

    Directory of Open Access Journals (Sweden)

    LUIZ CARLOS MIRANDA

    1999-11-01

    Full Text Available O trabalho foi desenvolvido com o objetivo de avaliar a evolução física do processo de remoção de água das sementes em secador estacionário, com cilindro central perfurado e distribuição radical de ar. A pesquisa foi conduzida com sementes de soja, variando o fluxo (26,9, 28,4 e 33,2 m³/minuto/t e a temperatura do ar insuflado (42, 46 e 50ºC, considerando a posição das sementes (17, 34 e 51 cm em relação ao cilindro de insuflação e o tempo de secagem (zero a doze horas, com intervalos de duas horas. Foram caracterizados o ar ambiente, o ar insuflado, as temperaturas e os teores de água da massa, as velocidades e curvas de secagem. As avaliações realizadas destacaram vantagens físicas operacionais da combinação de 28,4 m³/minuto/t com 46ºC e o contrário, com a combinação de 26,9 m³/minuto/t com 42ºC.The purpose of this research was to study several physical parameters of soybean seed drying submitted to stationary process with radial air distribution by combining different air flows (26.9, 28.4 and 33.2 m³/minute/ton and temperatures (42, 46 and 50ºC, considering seed positions in the seed mass (17, 34 and 51 cm in relation to the insuflation cylinder and drying periods (zero to twelve hours with two-hour intervals. Environmental air, insuflation air, seed temperatures, moisture content of seeds, drying speed and drying curves were characterized. Considering the evaluated parameters during the drying process, the physical advantages of the combination of 28.4 m³/minute/ton with 46ºC, and the desadvantage of the combination of 26.9 m³/minute/ton with 42ºC were observed.

  15. Microbiological air quality of processing areas in a dairy plant as evaluated by the sedimentation technique and a one-stage air sampler Qualidade microbiológica do ar de ambientes de processamento em indústria de laticínios avaliada por amostrador de ar de um estágio e pela técnica da sedimentação

    Directory of Open Access Journals (Sweden)

    Valéria Costa Salustiano

    2003-07-01

    Full Text Available The microbiological air quality at processing areas in a dairy plant was evaluated by using a one-stage air sampler, based on Andersen principles (impaction technique and by culture settling plate technique, also known as sedimentation technique. Among these areas, milk reception, packaging, and pasteurization rooms were included. Rooms where cheese, yogurt, butter and "doce de leite"(Latin American typical treat made of concentrated milk and sugar are made were also evaluated. For all processing areas, the numbers of mesophilic aerobic bacteria and yeast and molds recovered by air sampler were higher than 90 CFU·m-3 - the maximum value recommended by American Public Health Association (APHA. In four of the six processing areas, the microbial numbers were higher than APHA's standard (30 CFU.cm-2.week-1 according to culture settling plate technique. The results showed a difference (pFoi avaliada a microbiota do ar dos ambientes de recepção, embalagem e pasteurização de leite, produção de queijos, de iogurte e de doce de leite e manteiga em uma indústria de laticínios pelas técnicas de sedimentação e de impressão em ágar utilizando um amostrador de ar de um estágio baseado no princípio de Andersen. As contagens de microrganismos mesófilos aeróbios e de fungos filamentosos e leveduras pela técnica impressão em ágar ultrapassaram 90UFC·m-3 de ar, valor máximo recomendado pela APHA. Pela técnica de sedimentação, as contagens microbianas do ar de quatro ambientes também ultrapassaram 30UFC·cm-2·semana-1, conforme recomendação da APHA. Os ambientes diferiram (p<0,05 apenas para os números de Staphylococcus aureus. (<1,0 a 4,3 UFC.m-3. As contagens microbianas por impressão em ágar foram de 2 a 10 vezes maiores que as obtidas por sedimentação, evidenciando a maior capacidade da impressão em ágar em determinar microrganismos do ar, inclusive patógenos. Quanto à distribuição da microbiota do ar, houve a predomin

  16. Ar-Ar_Redux: rigorous error propagation of 40Ar/39Ar data, including covariances

    Science.gov (United States)

    Vermeesch, P.

    2015-12-01

    Rigorous data reduction and error propagation algorithms are needed to realise Earthtime's objective to improve the interlaboratory accuracy of 40Ar/39Ar dating to better than 1% and thereby facilitate the comparison and combination of the K-Ar and U-Pb chronometers. Ar-Ar_Redux is a new data reduction protocol and software program for 40Ar/39Ar geochronology which takes into account two previously underappreciated aspects of the method: 1. 40Ar/39Ar measurements are compositional dataIn its simplest form, the 40Ar/39Ar age equation can be written as: t = log(1+J [40Ar/39Ar-298.5636Ar/39Ar])/λ = log(1 + JR)/λ Where λ is the 40K decay constant and J is the irradiation parameter. The age t does not depend on the absolute abundances of the three argon isotopes but only on their relative ratios. Thus, the 36Ar, 39Ar and 40Ar abundances can be normalised to unity and plotted on a ternary diagram or 'simplex'. Argon isotopic data are therefore subject to the peculiar mathematics of 'compositional data', sensu Aitchison (1986, The Statistical Analysis of Compositional Data, Chapman & Hall). 2. Correlated errors are pervasive throughout the 40Ar/39Ar methodCurrent data reduction protocols for 40Ar/39Ar geochronology propagate the age uncertainty as follows: σ2(t) = [J2 σ2(R) + R2 σ2(J)] / [λ2 (1 + R J)], which implies zero covariance between R and J. In reality, however, significant error correlations are found in every step of the 40Ar/39Ar data acquisition and processing, in both single and multi collector instruments, during blank, interference and decay corrections, age calculation etc. Ar-Ar_Redux revisits every aspect of the 40Ar/39Ar method by casting the raw mass spectrometer data into a contingency table of logratios, which automatically keeps track of all covariances in a compositional context. Application of the method to real data reveals strong correlations (r2 of up to 0.9) between age measurements within a single irradiation batch. Propertly taking

  17. Qualidade do ar interno em ambientes hospitalares climatizados: verificação de parâmetros físicos e da concentração de dióxido de carbono

    Directory of Open Access Journals (Sweden)

    Waldir Nagel Schirmer

    2010-01-01

    Full Text Available Em hospitais, a presença de poluentes no ar interno cria condições que podem comprometer a recuperação dos pacientes e afetar aprodutividade dos funcionários. Assim, estes estabelecimentos necessitam de sistemas de climatização que forneçam taxas deventilação adequadas para garantir o conforto de seus ocupantes e a assepsia dos ambientes. Os objetivos deste trabalho foram avaliara qualidade do ar interno em um centro cirúrgico e uma unidade de terapia intensiva através da verificação dos parâmetros físicos deconforto e das concentrações de dióxido de carbono, seguindo-se a metodologia recomendada pela Resolução n° 09 da AgênciaNacional de Vigilância Sanitária (ANVISA, bem como propor um sistema de ar condicionado para cada um dos ambientes queatendesse à NBR 7256. Os resultados obtidos permitiram afirmar que a qualidade do ar interno destes ambientes pode ser melhorada,pois muitos dos parâmetros avaliados apresentaram valores superiores aos recomendados pela resolução. As altas concentrações deCO2 obtidas nestes dois ambientes hospitalares, por exemplo, podem ser justificadas pela falta de renovação de ar, uma vez que osaparelhos de climatização utilizados são desprovidos desta função. Sugere-se que sejam efetuadas mudanças nos sistemas declimatização, fazendo-se uso daqueles que contemplem a renovação do ar a taxas aceitáveis pela legislação vigente.Abstract In hospitals, the presence of pollutants in theindoor air creates conditions that may prejudice the recoveryof patients and affect the productivity of employees. Thus,these places need air conditioning well designed, to provideadequate ventilation rates to ensure the comfort of itsoccupants and the aseptic of environments. The present studyfocused on evaluating the indoor air quality (IAQ in a surgicalcenter and an intensive care unit, by checking the physicalparameters of comfort and the concentrations of carbondioxide, following the procedure

  18. Consistency of ocular coherence tomography fast macular thickness mapping in diabetic diffuse macular edema Consistência da tomografia de coerência óptica no edema macular difuso diabético

    Directory of Open Access Journals (Sweden)

    Fábio Petersen Saraiva

    2007-01-01

    Full Text Available OBJECTIVES: To investigate optical coherence tomography consistency on foveal thickness, foveal volume, and macular volume measurements in patients with and without diffuse diabetic macular edema. INTRODUCTION: Optical coherence tomography represents an objective technique that provides cross-sectional tomographs of retinal structure in vivo. However, it is expected that poor fixation ability, as seen in diabetic macular edema, could alter its results. Several authors have discussed the reproducibility of optical coherence tomography, but only a few have addressed the topic with respect to diabetic maculopathy. METHODS: The study recruited diabetic patients without clinically evident retinopathy (control group and with diffuse macular edema (case group. Only one eye of each patient was evaluated. Five consecutive fast macular scans were taken using Ocular Coherence Tomography 3; the 6 mm macular map was chosen. The consistency in measurements of foveal thickness, foveal volume, and total macular volume for both groups was evaluated using the Pearson's coefficient of variation. The T-test for independent samples was used in order to compare measurements of both groups. RESULTS: Each group consisted of 20 patients. All measurements had a coefficient of variation less than 10%. The most consistent parameter for both groups was the total macular volume. DISCUSSION: Consistency in measurement is a mainstay of any test. A test is unreliable if its measurements can not be correctly repeated. We found a good index of consistency, even considering patients with an unstable gaze. CONCLUSIONS: Optical coherence tomography is a consistent method for diabetic subjects with diffuse macular edema.OBJETIVOS: Investigar a consistência das medidas de espessura foveal, volume foveal e volume macular total feitas pela tomografia de coerência óptica em pacientes com e sem edema macular difuso diabético. INTRODUÇÃO: A tomografia de coerência óptica é uma t

  19. Efeito do 1-metilciclopropeno na conservação de maçãs 'Royal Gala' em ar refrigerado e atmosfera controlada Effects of 1-methylcyclopropene on 'Royal Gala' apples stored in refrigerated air and controlled atmosphere

    Directory of Open Access Journals (Sweden)

    Adriana Regina Corrent

    2004-08-01

    Full Text Available Maçãs 'Royal Gala', colhidas em dois estádios de maturação, foram tratadas com 1-MCP (1-metilciclopropeno nas concentrações de 0; 625 e 1250 nL.L-1, durante 48 horas, à temperatura de 20 ± 2 ºC. Após este tratamento, foram armazenadas em dois diferentes sistemas: em atmosfera controlada à temperatura de 0 ± 0,5 ºC, 2,1 a 2,3 kPa de CO2 , 1,8 a 2,0 kPa de O2 e umidade relativa de 95 ± 5 %, durante 9 meses. Em ar refrigerado a 0,5 ± 0,5 ºC e 95 ± 5 % de umidade relativa, durante 8 meses. As análises realizadas demonstraram a eficiência do 1-MCP em controlar a maturação das frutas durante o armazenamento em ambas as condições e pontos de colheita. A aplicação do 1-MCP reduziu drasticamente a produção de etileno, diminuiu a perda de firmeza, além de preservar a acidez total titulável.In the present work were evaluated the effects of 1-MCP on 'Royal Gala' apples stored in refrigerated air and controlled atmosphere. 'Royal Gala' apples were harvested at two ripeness stages and treated with 1-methylcyclopropene (1-MCP using two concentrations 625 and 1250 nL.L-1 which were applied during 48 hours at temperature of 20 ± 2 ºC. The control fruit was only kept in air. After the treatments the apples were stored in either controlled atmosphere 2,1 to 2,3 kPa CO2, 1,8 to 2,0 kPa O2 and 95 ± 0,5 % of relative humidity for 9 months at 0 ± 0,5 ºC or in refrigerated air storage at 0,5 ± 0,5 ºC and 95 ± 0,5 % of relative humidity, for 8 months. The 1-MCP applications on apples in both storages and ripening stages reduced dramatically the ethylene production. Pulp firmness losses and titratable acidity were also significanthy higher compared to control fruit.

  20. Study of the relationship and importance of clinical semiology, axial computed tomography and electroneuromyography in lumbar radioculopathies Estudo da relação e da importância entre a semiologia clínica, tomografia axial computadorizada e eletroneuromiografia nas radiculopatias lombares

    Directory of Open Access Journals (Sweden)

    Emílio Cezar Mamede Murade

    2002-12-01

    Full Text Available The authors evaluated forty-three patients with clinical suspect of lumbar radiculopathy caused by disk hernia, concerning to clinical semiology, computed tomography and electromyography were studied and their correlations. The clinical semiology was altered in 100,0% of the patients, the computed tomography in 90,7% and the electromyography in 88,7%. The correlation among the three exams didn´t show any prevalency among any of the possible associations. The authors emphasize the importance of clinical semiology, computed tomography and electromyography for a more accurate diagnosis of lumbar radiculopathy following by disk hernia.Os autores estudaram 43 pacientes com suspeita clínica de radiculopatia lombar, causada por hérnia de disco, relacionando os achados da semiologia clínica, tomografia axial computadorizada e eletroneuromiografia, entre si. A semiologia clínica estava alterada em 100,0% dos pacientes, a tomografia axial computadorizada em 90,7% e a eletroneuromiografia em 88,7%. A correlação entre os três exames não mostrou prevalência entre nenhuma associação. Os autores enfatizam a importância da semiologia clínica, tomografia axial computadorizada e eletroneuromiografia para maior exatidão diagnóstica das radiculopatias lombares por hérnia de disco.

  1. Seguimento de portadores de coriorretinopatia serosa central por meio da tomografia de coerência óptica Evaluation of central serous chorioretinopathy with optical coherence tomography

    Directory of Open Access Journals (Sweden)

    Otacílio de Oliveira Maia Júnior

    2006-04-01

    Full Text Available OBJETIVO: Avaliar a tomografia de coerência óptica como método objetivo de diagnóstico e de seguimento da coriorretinopatia serosa central. MÉTODOS: Estudo observacional descritivo de 16 (dezesseis olhos de portadores de coriorretinopatia serosa central unilateral, em fase aguda. Estes pacientes foram submetidos à medida da acuidade visual e a exame oftalmológico completo, incluindo biomicroscopia da mácula, angiofluoresceinografia e tomografia de coerência óptica. Nenhum dos pacientes foi submetido a qualquer tipo de tratamento. RESULTADO: Dos 16 casos consecutivos de coriorretinopatia serosa central, 12 pacientes completaram o seguimento até a resolução da doença. A idade variou entre 27 e 50 anos, com média de 38,9 anos. A predominância foi do sexo masculino. Na tomografia de coerência óptica, o descolamento da retina neurossensorial foi observado em todos os casos e 33,3% dos pacientes apresentaram descolamento do epitélio pigmentado da retina. Houve diferença significativa em todas as variáveis estudadas, constatando melhora na acuidade visual, diminuição na espessura e no volume macular na resolução da doença. CONCLUSÃO: Tomografia de coerência óptica mostrou boa eficácia para detectar e quantificar alterações maculares em olhos com coriorretinopatia serosa central, podendo ser útil em avaliações clínicas na fase aguda e na resolução da doença.PURPOSE: To evaluate optical coherence tomography as an objective diagnostic and follow-up method for central serous chorioretinopathy. METHODS: Observational descriptive study of 16 (sixteen eyes of 16 patients with unilateral acute central serous chorioretinopathy. These patients had their visual acuity measured and complete ophthalmological examination was performed, including macular slit lamp examination, angiofluoresceinography and optical coherence tomography. No treatment was given to any patient. RESULTS: Of the 16 central serous chorioretinopathy eyes

  2. Malária pulmonar: aspectos na tomografia computadorizada de alta resolução - relato de caso Pulmonary malaria: high-resolution computed tomography findings - a case report

    OpenAIRE

    Rosana Rodrigues; Edson Marchiori; Daniel Andrade Tinoco de Souza

    2004-01-01

    Neste trabalho é relatado o caso de paciente do sexo masculino, de 38 anos de idade, que desenvolveu quadro de malária com comprometimento pulmonar. A tomografia computadorizada de alta resolução evidenciou espessamento de septos interlobulares e de bainhas peribroncovasculares, com áreas esparsas de atenuação em vidro fosco e de consolidações, além de derrame pleural bilateral, aspectos compatíveis com edema pulmonar. O paciente recebeu tratamento específico, evoluindo bem e tendo alta 11 di...

  3. Assessment of arsenic toxicity in spiked soils and water solutions by the use of bioassays Evaluación de la toxicidad del arsénico en suelos y soluciones contaminadas mediante el uso de bioensayos Avaliação da toxicidade de arsénio em solos contaminados e em soluções aquosas com recurso a bioensaioS

    Directory of Open Access Journals (Sweden)

    Francisco José Martín Peinado

    2012-11-01

    concentración efectiva de arsénico que reduce un 50% la variable respuesta (EC50 fue de 1,52 ppm para el ensayo con L. sativa y 4,98 ppm para el ensayo con V. fischeri, indicando que el bioensayo con L. sativa fue más sensible a las concentraciones de arsénico en las soluciones contaminadas.O Arsénio (As constitui um grave problema ambiental devido à sua ampla utilização e elevado potencial tóxico . Para além disso, este elemento tende a acumular-se nos solos devido à sua baixa mobilidade. Neste estudo, fez-se uma avaliação do potencial de toxicidade do As em solos e soluções aquosas de amostras laboratoriais contaminadas com este elemento, recorrendo a bioensaios com Vibrio fischeri e Lactuca sativa. Os solos contaminados com 100 ppm de arsénio registaram uma redução da solubilidade do As na solução do solo ao longo do tempo, enquanto que para os períodos de incubação mais longos (8 semanas, as respostas à toxicidade em todas as amostras neste tipo de bioensaios foi insignificante. Em soluções aquosas contaminadas com concentrações crescentes de arsénio (0, 0,1, 1, 10, 12.5, 25, 50, and100 ppm As, observaram-se reduções significativas no elongamento das raízes e na luminiscênciar espetivamente na alface e nos bioensaios com bactérias. A concentração efetiva de As (EC50 apresentou os valores de 1,52 ppm para a L. sativa e 4,98 ppm para a V. fischeri, o que indica que os bioensaios com L. sativa foram mais sensíveis às concentrações de As nas soluções contaminadas.

  4. Temperaturas de acionamento de sistemas de climatização para perus em épocas de baixa umidade relativa do ar Activating temperatures of ventilation systems for turkeys in low humidity periods

    Directory of Open Access Journals (Sweden)

    Angélica S. Mendes

    2010-10-01

    Full Text Available Este estudo teve o objetivo de avaliar distintos programas de acionamento dos sistemas de climatização (ventiladores e nebulizadores, visando a aprimorar o ambiente interno e o bemestar das aves, evitando possíveis perdas produtivas e gastos excessivos em energia elétrica. O estudo foi conduzido em dois aviários localizados no município de Uberlândia - MG, durante a época de baixa umidade relativa do ar (junho a dezembro. Os aviários foram comparados sob os parâmetros de concentrações de CO2, temperatura e umidade relativa do ar, temperatura superficial da cama e índices produtivos. Os dados climáticos foram submetidos à análise de variância, e os dados produtivos submetidos ao teste de Qui-quadrado, utilizando-se do software MINITAB V.14. Os resultados apontados pelos tratamentos 1 e 2 mostraram que as concentrações de CO2 no ar (372,70 e 379,46 ppm, respectivamente estiveram abaixo dos limites máximos recomendados internacionalmente para ambos os sistemas. As temperaturas internas (26,23 e 26,56 ºC, respectivamente estiveram sempre acima do recomendado para as aves, e os níveis de umidade relativa do ar (69,73 e 70,42, respectivamente estiveram, em média, na faixa recomendada, para ambos os sistemas. Conclui-se que o aviário programado para acionar o sistema de climatização mais tardiamente consumiu menos energia elétrica, apresentou melhor conversão alimentar, menor incidência de artrite, porém maior percentual de mortalidade.This study aimed to evaluate different turn on systems of climatization (fans and fogging sprinklers to improve the internal environment and the birds' welfare, avoiding productive losses and expensive wastes in electrical energy. The study was conducted in a commercial property with two poultry houses, located in Uberlândia, MG, Brazil, during the phase of low relative humidity of the air (June to December. The poultry houses were compared under the parameters of concentration of CO2

  5. EPIDEMIOLOGICAL ASPECTS OF A FOCUS OF Tunga penetrans INFESTATION IN OUTDOOR PIG PRODUCTION ASPECTOS EPIDEMIOLÓGICOS DE UM FOCO DE TUNGÍASE (Tunga penetrans, SIPHONAPTERA EM UM SISTEMA INTENSIVO DE SUÍNOS CRIADOS AO AR LIVRE

    Directory of Open Access Journals (Sweden)

    Doralice Pedroso de Paiva

    2007-09-01

    Full Text Available

    The outdoors intensive-type pig production is characterized by maintaining swine during reproductive, pregnancy and nursing periods on pasture limited by wiring and/or electric fences. The aim of the present report was to describe the epidemiological aspects of an outbreak of Tunga penetrans in an outdoor pig production system. A total of six mature boars, 9 lactating sows, 13 pregnant sows, 9 mating sows, 20 suckling pigs and 34 weaned pigs were clinically examined. None of the boars were infested, while 50% of all sows examined had the parasite lesions, most frequently observed in the breast area, thus resulting in agalactia in lactating sows due to obstruction of the galactophorus channel, with subsequent involution of the mammary gland. In 90% of suckling piglets walking difficulty was observed, caused by the presence of the parasite in the hoofs, with 25% of these animals also showing hock lesions (farm number 1, n = 48. Similar lesions were observed in 100% of 40-47 days old weaned pigs (farm number 2, n = 24 and in 80% of 70 days old weaned pigs (farm number 3, n = 10, all of which had been transferred to finishing units in a confinement system. Therefore we conclude that Tunga penetrans can infest pigs reared or kept outdoors, causing agalactia in lactating sows, and walking disorders in suckling and weaned pigs.

    KEY-WORDS: Chiggers, agalactia in sows; outdoors pig production.

    O sistema intensivo de produção de suínos criados ao ar livre (SISCAL é caracterizado por manter os suínos em piquetes com cobertura vegetal, nas fases de reprodução, maternidade e creche, cercados com tela e/ou fios de arame eletrificado. Este trabalho teve por objetivo relatar

  6. Qualidade do ar em ambientes internos hospitalares: estudo de caso e análise crítica dos padrões atuais Indoor air quality in hospitals: a case study and a critical review of current standards

    Directory of Open Access Journals (Sweden)

    Marina Eller Quadros

    2009-09-01

    Full Text Available O objetivo deste trabalho foi avaliar a qualidade do ar em três categorias de ambientes hospitalares: unidade de terapia intensiva (UTI adulto, UTI neonatal (UTN e centro cirúrgico de um hospital em Florianópolis, Brasil. Avaliaram-se a concentração de dióxido de carbono, a vazão e renovação de ar nas salas do centro cirúrgico. A concentração de bioaerossóis foi estimada em um dia de avaliação para cada ambiente. Não se observou relação entre a concentração de bioaerossóis e o tempo de uso das salas de cirurgia. A concentração média de bioaerossóis foi de 231 UFC.m-3 para fungos e de 187 UFC.m-3 para bactérias. Os ambientes avaliados atendiam aos valores recomendados pela legislação vigente. Os resultados permitiram avaliar criticamente essa legislação e apresentar sugestões para estabelecimento de uma resolução específica para ambientes hospitalares no Brasil.The objective of this paper was to evaluate the air quality in three indoor hospital environments: a neonatal intensive care unit (ICU, an adult ICU and a surgical ward of a hospital in Florianópolis, Brazil. Carbon dioxide concentrations, exchange air flow rates as well as fungi and bacteria concentrations were measured in these rooms. Bioaerosol concentrations were evaluated throughout one-work day for each operating room. No relationship was observed between bioaerosol concentration and the period of use in the surgical ward. Average bioaerosol concentrations were of 231 UFC.m-3 for filamentous fungi and 187 UFC.m-3 for bacteria. All environments evaluated were, overall, in compliance with current legislations. Results allowed a critical review of the present regulations and suggestions for the establishment of a specific regulation for hospital environments in Brazil.

  7. Tomografia computadorizada das patologias acometendo o compartimento iliopsoas

    Directory of Open Access Journals (Sweden)

    Montandon Cristiano

    2001-01-01

    Full Text Available Este trabalho tem como objetivo revisar as patologias que acometem o compartimento iliopsoas. Foi realizada análise retrospectiva de casos com acometimento do compartimento iliopsoas avaliados por tomografia computadorizada (TC, no Departamento de Radiologia da Faculdade de Ciências Médicas da Universidade Estadual de Campinas, nos últimos dez anos, confirmados por biópsia cirúrgica ou percutânea. Os principais diagnósticos encontrados foram neoplasias, abscessos e hematomas. Os achados tomográficos baseiam-se na extensão do acometimento iliopsoas, no grau de atenuação, margens da lesão, presença de gás e/ou calcificações, destruição óssea, infiltração da gordura e acometimento de estruturas abdominais adjacentes. A TC é o método de escolha na avaliação do compartimento iliopsoas, podendo ser utilizada para orientar biópsias percutâneas, cirúrgicas ou drenagem. Porém, os achados isolados do estudo por TC, sem o conhecimento da história clínica, não são específicos para permitir a diferenciação das diversas patologias que acometem o compartimento iliopsoas.

  8. POTENCIAL DE SECAGEM DO MILHO A GRANEL COM AR NATURAL EM BOTUCATU – SP DRYING POTENTIAL OF MAIZE GRAINS IN BULK WITH NATURAL AIR IN BOTUCATU, SP

    Directory of Open Access Journals (Sweden)

    Vicente A. Gonçalves

    2007-09-01

    Full Text Available

    A secagem de grãos com ar natural é um processo dependente das condições climáticas locais, constantemente oscilantes no tempo. Através do emprego de modelos matemáticos de simulação foi avaliada a possibilidade de realização da secagem do milho a granel com ar natural para as condições climáticas de Botucatu, com base nos registros horários de temperatura de bulbo seco e umidade relativa dos anos de 1971 a 1975 e de 1977 a 1981. O processo contínuo de secagem do milho com ar natural, nas condições analisadas, não permite a redução do teor de umidade final ao nível recomendado ao armazenamento seguro. A simulação da secagem intermitente, realizada nos períodos das 9 às 17 h, 9 às 18 h e 8 às 18 h, indica a possibilidade de redução do teor de umidade do milho, base úmida, a nível entre 12,1 e 17,3%, para o teor de unidade inicial de 22%, entre 12,4 e 15,5%, para o teor de umidade inicial de 20% e entre 13,1 e 14,7% para o de 18%, quando realizada a secagem no período máximo admissível.

    PALAVRAS-CHAVE: Secagem; Ar natural; Milho; Teor de umidade de equilíbrio.

    Grain drying using ambient was simulated under weather conditions in Botucatu. Hourly weather records, fry bulb temperature and relative humidity, from 1971 through 1975 and from 1977 through 1981, were used to calculate adiabatic drying potential of the ambient air. Historical weather records from 1971 were selected to simulate ambient air corn drying. Ambient air corn drying systems operating continuously are not feasible to reduce the moisture content of the grain to the moisture levels recommended for safe storage. Selective fan operation, from 9 a. m. to 5 a. m. , from 9 a. m. to 6 p. m. and from 8 a. m. to 6 p. m. , indicates the possibility to reduce corn moisture contents, wet

  9. Educação ao ar livre pela aventura: o aprendizado de valores morais em expedições à natureza Education outdoors through adventure: learning moral values in nature expeditions

    Directory of Open Access Journals (Sweden)

    Flavio Theodor Kunreuther

    2012-06-01

    Full Text Available A educação ao ar livre, por meio de cursos no formato expedição, ainda acontece de forma tímida no Brasil. Entende-se por expedição uma experiência educacional contínua, de múltiplos dias, em que alunos e instrutores aventuram-se em um trajeto em área remota da natureza de forma autossuficiente. O presente estudo analisa os cursos desse tipo. Por meio de entrevistas e questionários semiestruturados, investigou-se a aprendizagem dos alunos segundo suas próprias percepções e as dos educadores da instituição, com ênfase no desenvolvimento moral do indivíduo. Como parte do estudo de caso sobre um aluno adolescente participante de um dos cursos, entrevistou-se também uma psicóloga que coordena um abrigo para menores. Os resultados encontrados indicam que os cursos de educação ao ar livre caracterizam-se por experiências que estimulam trabalhos em grupo, debates sobre justiça e solidariedade, e reflexões sobre valores e princípios como coragem, esforço pessoal, disciplina, respeito e superação de limites. Os resultados também indicam que tal proposta educacional aufere experiências sensíveis e de conexão do ser humano com a natureza. Muito embora haja potencial educacional para a educação ao ar livre, a atuação do educador perante seus alunos é fundamental para que as experiências sejam física e psicologicamente seguras, alcancem seus potenciais pedagógicos de desenvolvimento da moralidade e ajudem as pessoas a desenvolverem uma consciência ambiental, manifestada por meio de ações concretas ao retornarem dos cursos para suas comunidades.Open air education through courses organized as expeditions is still incipient in Brazil. We understand an expedition as a continued educational experience taking several days in which students and instructors venture into a remote natural area in a self-sufficient way. The present study analyzes courses of this type. Using interviews and semi-structured questionnaires, it

  10. A poluição do ar em ambientes internos e a síndrome dos edifícios doentes Air pollution in internal environments and sick building syndrome

    Directory of Open Access Journals (Sweden)

    Waldir Nagel Schirmer

    2011-08-01

    Full Text Available A Qualidade do Ar Interno (QAI surgiu como ciência a partir da década de 70 com a crise energética e a consequente construção dos edifícios selados (desprovidos de ventilação natural, principalmente nos países desenvolvidos, e se destacou após a descoberta de que a diminuição das taxas de troca de ar nesses ambientes era a grande responsável pelo aumento da concentração de poluentes no ar interno. Admite-se que a ventilação seja um dos principais fatores que interferem na qualidade do ar interno e que os próprios ocupantes dos edifícios contribuem substancialmente com a poluição destes ambientes através de suas atividades. Sabe-se ainda que a má qualidade do ar interno está associada a doenças (como tosse, rinite, alergia, etc. e à Síndrome dos Edifícios Doentes (SED. Para amostragem de substâncias gasosas no ar de ambientes internos dispõe-se de diversas metodologias, sendo as principais: sistemas passivos de monitoramento, sistemas ativos e automáticos. Para a efetiva promoção de um ambiente saudável, deve-se conciliar a aplicação de legislações específicas com pesquisas e conscientização dos ocupantes dos edifícios. Essa revisão objetiva relacionar os diferentes contaminantes encontrados em ambientes internos, seus efeitos à saúde humana e suas metodologias de amostragem.Indoor Air Quality (IAQ emerged as a science from the 1970s onwards with the energy crisis and the subsequent construction of sealed buildings (without natural ventilation. This mainly occurred in developed countries and it soon came to public attention that lower levels of air exchange in these environments was the main culprit for the increase in concentration of indoor air pollutants. It is common knowledge that ventilation is one of the principal factors that interfere with air quality in indoor environments and that the occupants contribute to the pollution of these environments with their activities. Furthermore, poor indoor

  11. Sarcoidose pulmonar: achados na tomografia computadorizada de alta resolução Pulmonary sarcoidosis: high-resolution computed tomography findings

    Directory of Open Access Journals (Sweden)

    Bruno Barcelos da Nóbrega

    2005-06-01

    Full Text Available A sarcoidose é uma doença sistêmica de causa indeterminada, caracterizada por granulomas não-caseosos. Embora possa afetar qualquer órgão, esta doença tem sua morbi-mortalidade relacionada principalmente ao acometimento pulmonar, presente em 80% a 90% dos pacientes. Este artigo ilustra as principais manifestações pulmonares da sarcoidose na tomografia computadorizada de alta resolução, incluindo as formas típicas e atípicas.Sarcoidosis is a systemic disease of unknown etiology, characterized by noncaseating granulomas. Although it may affect any organ, morbidity and mortality are most commonly related to pulmonary involvement, which is found in 80-90% of patients. This study illustrates the principal manifestations of sarcoidosis seen in high-resolution computed tomography scans, including typical as well as atypical forms.

  12. AVALIAÇÃO DA QUALIDADE DO AR PELA MUDANÇA DA MATRIZ ENERGÉTICA EM USINA TERMOELÉTRICA: ÓLEO PARA MISTURA ÓLEO-GÁS NATURAL

    Directory of Open Access Journals (Sweden)

    Fernando Pêgas da Silva

    2016-08-01

    Full Text Available O petróleo ainda é a mais importante fonte de energia até o presente momento; porém, por razões ambientais as usinas térmicas a óleo diesel no Estado do Amazonas estão sendo convertidas ao gás natural, com o fortalecimento do processo marcado pela presença e intensificação das empresas na Zona Franca de Manaus e crescimento demográfico da Região Metropolitana de Manaus. A partir deste cenário que impacta diretamente a qualidade do ar, buscou-se caracterizar as mudanças dos índices dos efluentes gasosos quando da alteração da matriz energética de óleo combustível para gás natural na usina Companhia Energética Manauara (UTE Manauara – Manaus/AM. A metodologia utilizada empregou os dados (de 2007 a 2013 resultantes do monitoramento de emissões gasosas (NO2, SO2, material particulado e qualidade do ar (partículas totais em suspensão, NO2, SO2, CO, O3,fumaça. A partir destes observou-se que os parâmetros analisados apresentaram no geral um comportamento positivo à mudança de combustível, diferenciado apenas para o NO2. Havendo necessidade de adequação da legislação ambiental para o estabelecimento de limites precisos para a mistura óleo-gás natural, segundo critérios de qualidade para a região Amazônica.

  13. Avaliação da artéria etmoidal anterior pela tomografia computadorizada no plano coronal Anterior ethmoidal artery evaluation on coronal CT scans

    Directory of Open Access Journals (Sweden)

    Soraia Ale Souza

    2009-02-01

    Full Text Available O conhecimento da localização da artéria etmoidal anterior (AEA constitui etapa importante na cirurgia do recesso do seio frontal e do etmóide anterior. A tomografia computadorizada (TC, em especial no plano coronal pode fornecer reparos anatômicos que identificam o trajeto da AEA. OBJETIVO: Identificar os reparos anatômicos que caracterizam o trajeto da AEA na parede medial da órbita e na parede lateral da fossa olfatória. Verificar a correlação entre a presença de pneumatização supra-orbitária e a visualização do etmoidal anterior (canal da AEA. CASUÍSTICA E MÉTODOS: Estudo retrospectivo de 198 tomografias computadorizadas dos seios paranasais no plano coronal do período de agosto a dezembro de 2006. RESULTADOS: Pneumatização supra-orbitária foi identificada em 35% (70 exames. O canal da AEA foi caracterizado em 41% (81 exames. O sulco etmoidal anterior foi visualizado em 98% (194 dos exames e o forame etmoidal anterior foi identificado em todos os exames (100%. CONCLUSÃO: O forame etmoidal anterior e o sulco etmoidal anterior foram referências anatômicas presentes em quase 100% dos exames avaliados. Houve correlação entre a presença de pneumatização supra-orbitária e a caracterização do canal da AEA.The anterior ethmoidal artery (AEA is an important point for frontal and ethmoid sinuses surgery. CT scans can identify landmarks to help the surgeon find the AEA. AIM: To identify the landmarks of the AEA on the orbital medial wall and on the lateral wall of the olfactory fossa. and to correlate the presence of supraorbital ethmoidal cells with spotting the anterior ethmoidal artery canal. MATERIALS AND METHODS: Retrospective review of 198 direct coronal paranasal sinuses computed tomography (CT scans from August to December, 2006. RESULTS: Supraorbital pneumatization was seen in 35% (70 scans. The AEA canal was seen in 41% (81 scans. The anterior ethmoidal sulcus was seen in 98% (194 scans and the anterior

  14. Complicações pulmonares após uso de crack: achados na tomografia computadorizada de alta resolução do tórax Pulmonary complications of crack cocaine use: high-resolution computed tomography of the chest

    Directory of Open Access Journals (Sweden)

    Alexandre Mançano

    2008-05-01

    Full Text Available Relatamos os achados na tomografia computadorizada de alta resolução de um paciente que, após uso de cocaína fumada (crack, desenvolveu quadro de hemoptise, dispnéia e dor torácica súbitas. As radiografias de tórax mostravam consolidações predominando em lobos superiores. A tomografia de alta resolução evidenciava opacidades em vidro fosco, consolidações e nódulos do espaço aéreo. Nova tomografia de controle, após suspensão da droga e uso de corticóides, mostrou regressão parcial das lesões e aparecimento de escavações. A correlação entre os achados clínicos, laboratoriais e de imagem permitiu o diagnóstico de "pulmão de crack".Here, we report high-resolution computed tomography (HRCT findings in a patient who developed sudden hemoptysis, dyspnea and chest pain after smoking crack cocaine. Chest X-rays showed consolidations, primarily in the upper lobes, and HRCT scans showed ground glass attenuation opacities, consolidations and air-space nodules. A follow-up CT, after drug use discontinuation and administration of corticosteroids, showed partial resolution of pulmonary lesions and the appearance of cavitations. Clinical, imaging and laboratory findings led to a diagnosis of 'crack lung'.

  15. Aspectos de contaminação biológica em filtros de condicionadores de ar instalados em domicílios da cidade de Manaus - AM Aspects of biological contamination in air conditioning filters installed in Manaus city houses (AM

    Directory of Open Access Journals (Sweden)

    Elizabeth Ferreira Cartaxo

    2007-06-01

    Full Text Available Este trabalho apresenta resultados da pesquisa de contaminação dos filtros de condicionadores de ar instalados no setor residencial da cidade de Manaus. A pesquisa foi realizada no âmbito do projeto CAEMA (Condicionadores de Ar, Energia e Meio Ambiente que consistiu na troca de aparelhos de ar condicionado ineficientes por eficientes na zona urbana da cidade. Dos 500 condicionadores de ar retirados do sistema pelo projeto, foram selecionados 50 filtros (10% para a análise de contaminação biológica, tendo sido identificada uma enorme variedade de agentes prejudiciais à saúde humana, entre bactérias e fungos. A bactéria mais vezes identificada foi a Staphylococcus sp e o fungo mais freqüente foi o Penicillium sp. Também foi possível verificar, por meio de entrevistas telefônicas junto a 37 usuários desses equipamentos, a grande incidência de sintomas associados a problemas de insuficiente qualidade de ar nos ambientes residenciais. Circunstâncias que motivaram a oportunidade desta pesquisa também impossibilitaram a coleta das amostras por unidade de volume, com os condicionadores ainda em funcionamento. Esse fato não comprometeu os objetivos da pesquisa, de promover a reflexão sobre os cuidados com a correta limpeza dos condicionadores de ar residenciais.This work presents the results of a research about the contamination caused by air conditioners filters that are installed in the residential area in Manaus. The research took place in the scope of CAEMA’s project (Conditioning of Air, Energy and Environment, which one consisted in changing inefficient conditional air devices for efficient ones in the urban zone of the city. Amongst 500 air conditioners removed of the system by the project, 50 filters (10% were selected for biological contamination analysis, having been identified an enormous variety of agents, like bacteria and fungus, that are harmful for human health. The most identified bacterium was the Staphylococcus

  16. Mediastinite aguda: aspectos de imagem pós-cirurgias cardíacas na tomografia computadorizada de multidetectores Acute mediastinitis: multidetector computed tomography findings following cardiac surgery

    Directory of Open Access Journals (Sweden)

    Clarissa Aguiar de Macedo

    2008-08-01

    Full Text Available Mediastinite pós-cirurgias torácicas é definida como a infecção dos órgãos e tecidos do espaço mediastinal, ocorrendo em 0,4% a 5% dos casos. A gravidade da infecção pós-operatória varia desde infecção de tecidos superficiais da parede torácica até mediastinite fulminante com envolvimento esternal. O critério diagnóstico da tomografia computadorizada para mediastinite aguda pós-cirúrgica é a presença de coleção mediastinal, podendo estar associada ou não a anormalidades periesternais como edema/borramento de partes moles, separação dos segmentos esternais com reabsorção óssea marginal, esclerose e osteomielite. Achados associados incluem linfonodomegalias, consolidações pulmonares e derrame pleural e pericárdico. Pequenas coleções e gás mediastinais podem ser usualmente encontradas em pós-operatório recente de cirurgias torácicas sem a presença de infecções, limitando a eficácia da tomografia computadorizada nas duas primeiras semanas. Após esse período, a tomografia alcança quase 100% de sensibilidade e especificidade. Pacientes com suspeita clínica de mediastinite devem ser submetidos a exame de tomografia para pesquisa de coleções, identificando a extensão da doença e sua natureza. A versão de multidetectores propicia recursos de reconstruções em diversos planos e janelas, contribuindo especialmente para o estudo do esterno.Postoperative mediastinitis is defined as an infection of the organs and tissues in the mediastinal space, with an incidence ranging between 0.4% and 5% of cases. This disease severity varies from infection of superficial tissues in the chest wall to fulminant mediastinitis with sternal involvement. Diagnostic criterion for postoperative detection of acute mediastinitis at computed tomography is the presence of fluid collections and gas in the mediastinal space, which might or might not be associated with peristernal abnormalities such as edema of soft tissues

  17. Teores de nutrientes em cultivares de café arábica submetidos à deriva de glyphosate Nutrient content in arabica coffee cultivars subjected to glyphosate drift

    Directory of Open Access Journals (Sweden)

    A.C França

    2010-12-01

    Full Text Available Avaliaram-se, neste trabalho, os efeitos do glyphosate sobre os teores foliares de nutrientes em três cultivares de café (Coffea arabica. Utilizou-se o esquema fatorial (3 x 5 em delineamento de blocos casualizados, com quatro repetições, sendo os tratamentos compostos por três cultivares de café: Catucaí Amarelo (2 SL, Oeiras (MG-6851 e Topázio (MG-1190; e cinco doses de glyphosate (0; 57,6; 115,2; 230,4; e 460,8 g ha-1. Aos 45 e 120 DAA, coletaram-se folhas (terceiro par de ramos plagiotrópicos, contidos na parte mediana das plantas. Os sintomas de intoxicação foram caracterizados por clorose e estreitamento do limbo foliar para os três cultivares de café. Houve redução nos teores foliares de N, P, K, Cu e Zn aos 45 DAA e de N, K, Mn e Zn aos 120 DAA nas plantas de café tratadas com glyphosate, independentemente do cultivar utilizado. O cultivar Topázio apresentou as maiores reduções nos teores foliares de Fe e Mn, aos 45 DAA, e de P e Fe, aos 120 DAA.The effects of glyphosate on the foliar levels of nutrients in three coffee cultivars (Coffea arabica were evaluated in this work. A factorial (3 x 5 was used in a randomized block design with four replications, with treatments consisting of three coffee varieties: Catucaí Amarelo (2 SL, Oeiras (MG-6851 and Topázio (MG-1190 and five glyphosate doses (0, 57.6, 115.2, 230.4 and 460.8 g ha-1. At 45 and 120 DAA, leaves (third pair from plagiotrophic branches were collected from the medium part of the plants. Glyphosate intoxication symptoms were characterized by chlorosis and leaf narrowing for the three coffee varieties. There was a reduction in foliar levels of N, P, K, Cu and Zn at 45 DAA, and N, K, Mn and Zn at 120 DAA, in coffee plants treated with glyphosate, regardless of the cultivar used. Cultivar Topázio showed the greatest reductions in the foliar levels of Fe and Mn, at 45 DAA and P and Fe, at 120 DAA, when treated with glyphosate.

  18. Daños tóxicos en tejidos vegetales, producidos por aguas contaminadas con arsénico en Zimapán, Hidalgo, México Danos tóxicos em tecidos vegetais, produzidos por águas contaminadas com arsênio em Zimapán, Hidalgo, México

    OpenAIRE

    Francisco Prieto García; María de Los Ángeles Lechuga Vargas; María Aurora Méndez Marzo; Enrique Barrado Esteban; Juan Carlos Ggaytán Oyarzún

    2006-01-01

    Según estudios realizados en el periodo de 1992-1998 en las aguas de los pozos, norias y manantiales, del municipio de Zimapán, Estado de Hidalgo, México, se corroboró que existía un incremento en el contenido de arsénico rebasando los límites máximos permisibles por la Norma Oficial Mexicana. La determinación de arsénico en las muestras de aguas se realizó por absorción atómica (AAS), mediante generador de hidruros (GH). En este estudio se utilizó el Vicia faba como un bioensayo para evaluar...

  19. A tomografia computadorizada de alta resolução na avaliação da toxicidade pulmonar por amiodarona High-resolution computed tomography of amiodarone pulmonary toxicity

    Directory of Open Access Journals (Sweden)

    Daniela Peixoto Consídera

    2006-04-01

    Full Text Available OBJETIVO: Avaliar as principais alterações identificadas na tomografia computadorizada de alta resolução do tórax em pacientes com toxicidade pulmonar pela amiodarona. MATERIAIS E MÉTODOS: Foram avaliadas dez tomografias computadorizadas de alta resolução de tórax de pacientes com pneumonite pela amiodarona, seis desses pacientes do sexo masculino e quatro do sexo feminino, com idade média de 73,5 anos. RESULTADOS: Os achados tomográficos mais relevantes foram opacidades lineares ou reticulares em seis casos (60%, pequenos nódulos com densidade elevada em seis casos (60%, consolidações densas em três casos (30% e aumento da densidade do parênquima hepático em cinco de oito casos em que havia estudo tomográfico do abdome superior (62,5%. CONCLUSÃO: A tomografia computadorizada de alta resolução é um exame importante na avaliação de pacientes com toxicidade pulmonar pela amiodarona, devendo ser realizada sempre que houver suspeita deste diagnóstico. O achado de espessamento de septos interlobulares associado a lesões com aumento de densidade é altamente sugestivo deste diagnóstico.OBJECTIVE: To evaluate the main findings of chest high-resolution computed tomography in patients with amiodarone pulmonary toxicity. MATERIALS AND METHODS: Ten patients - six male and four female, average age of 73.5 years - with amiodarone-induced pneumonitis have undergone chest high-resolution computed tomography. RESULTS: The most relevant tomographic findings were linear or reticular opacities in six cases (60%, small high density nodules in six cases (60%, dense consolidations in three cases (30% and increased density in the hepatic parenchyma in five of eight cases in which there was a superior abdomen CT scan (62.5%. CONCLUSION: The high-resolution computed tomography is a valuable non-invasive test for evaluating patients with amiodarone pulmonary toxicity and should always be performed when one suspects of the presence of this

  20. Tomografia computadorizada de alta resolução na silicose: correlação com radiografia e testes de função pulmonar High-resolution computed tomography in silicosis: correlation with chest radiography and pulmonary function tests

    OpenAIRE

    Agnaldo José Lopes; Roberto Mogami; Domenico Capone; Bernardo Tessarollo; Pedro Lopes de Melo; José Manoel Jansen

    2008-01-01

    OBJETIVO: Correlacionar os parâmetros tomográficos com os de função pulmonar em portadores de silicose, bem como comparar os resultados da tomografia computadorizada de alta resolução (TCAR) com os da radiografia de tórax. MÉTODOS: Foi realizado um estudo de corte transversal, em que foram avaliados 44 pacientes não-tabagistas e sem história pregressa de tuberculose. As radiografias foram classificadas de acordo com a proposta da Organização Internacional do Trabalho. Utilizando um sistema de...

  1. Edema pulmonar hidrostático: aspectos na tomografia computadorizada de alta resolução Hydrostatic pulmonary edema: high-resolution computed tomography aspects

    Directory of Open Access Journals (Sweden)

    Cláudia Maria Cunha Ribeiro

    2006-12-01

    Full Text Available OBJETIVO: A proposta deste estudo foi caracterizar por meio de tomografia computadorizada de alta resolução do tórax as principais alterações pulmonares do edema pulmonar hidrostático. MÉTODOS: Foram analisadas, retrospectivamente, as tomografias de quinze pacientes com quadro clínico de edema pulmonar hidrostático, divididos em cinco principais grupos etiológicos: insuficiência cardíaca congestiva, valvulopatia mitral aguda, infarto agudo do miocárdio, miocardite e mediastinite fibrosante, tendo sido sete pacientes classificados no primeiro grupo e dois em cada um dos demais. RESULTADOS: Os principais achados do edema hidrostático foram opacidades em vidro fosco (100%, espessamento dos septos interlobulares (100%, derrame pleural (87% e espessamento do interstício peribroncovascular (80%. Outros achados menos comuns foram aumento do calibre dos vasos, consolidações e nódulos do espaço aéreo. CONCLUSÃO: O padrão predominante encontrado nos pacientes estudados foi o de opacidades em vidro fosco associadas a espessamento dos septos interlobulares (padrão de pavimentação em mosaico, com derrame pleural bilateral, predominante à direita.OBJECTIVE: This study aimed to use high-resolution computed tomography scans of the chest to characterize the principal alterations occurring in cases of hydrostatic pulmonary edema. METHODS: A retrospective analysis was made of the tomography scans of 15 patients presenting clinical profiles of hydrostatic pulmonary edema. The cases were divided into five groups by etiology: congestive heart failure (n = 7; acute mitral valve disease (n = 2; acute myocardial infarction (n = 2; myocarditis (n = 2; and fibrosing mediastinitis (n = 2. RESULTS: The principal findings in the cases of hydrostatic pulmonary edema were ground-glass opacities (in 100%, interlobular septal thickening (in 100%, pleural effusion (in 87% and peribronchovascular interstitial thickening (in 80%. Other, less common

  2. Mudanças na estrutura do solo avaliada com uso de tomografia computadorizada Soil structure changes evaluated with computed tomography

    Directory of Open Access Journals (Sweden)

    Luiz Fernando Pires

    2010-04-01

    Full Text Available O objetivo deste trabalho foi avaliar, em escala milimétrica, a modificação da densidade e da porosidade de amostras deformadas de solo submetidas a ciclos de umedecimento e secamento (U-S, por meio da tomografia computadorizada de raios gama. Amostras com 98,1 cm³ foram preparadas procedendo ao peneiramento do solo em malha de 2 mm e acondicionamento de forma homogênea em tubos de PVC. As amostras de solo foram submetidas a um, dois e três ciclos de U-S. As amostras controle não foram submetidas a nenhum ciclo de U-S. Após a aplicação dos ciclos de U-S, a porosidade das amostras diminuiu e as camadas de solo se adensaram. Os dados de tomografia computadorizada permitiram análise contínua da densidade do solo e de sua porosidade, em camadas milimétricas (0,08 cm, o que não pode ser alcançado facilmente por métodos tradicionais usados em física do solo.The objective of this work was to evaluate in millimetric scale changes in soil bulk density and porosity, using the gamma-ray computed tomography in soil samples with disturbed structure due to wetting and drying (W-D cycles. Soil samples with 98.1 cm³ were sieved using a 2 mm mesh and homogenously packed in PVC cylinders. Soil samples were submitted to 1, 2, and 3 W-D cycles. Control samples were not submitted to W-D cycles. After repetitions of W-D cycles, soil sample porosity decreased and soil layers became denser. Computed tomography allowed a continuous analysis of soil bulk density and also soil porosity along millimetric (0.08 cm layers, what cannot be provided by traditional methods used in soil physics.

  3. Tendências anuais e sazonais nos extremos de temperatura do ar e precipitação em campina grande - pb

    Directory of Open Access Journals (Sweden)

    Leydson Galvíncio Dantas

    2015-12-01

    Full Text Available RESUMO Devido à rápida expansão urbana e potencial turístico da região, o objetivo deste estudo foi a obtenção da distribuição temporal dos índices de extremos climáticos dependentes de dados diários de temperatura e precipitação, definido pela OMM, para o período de 1975 a 2011, e utilizando os testes estatísticos não paramétricos obter a magnitude das tendências dos referidos índices para a cidade de Campina Grande - PB. Os resultados mostram que as temperaturas mínimas e máxima diárias têm aumentado gradativamente ao longo das últimas décadas, apresentando tendências sazonais crescentes ao longo dos anos e que as temperaturas mínimas tiveram maior aumento. O número de dias e noites quentes por ano tem aumentado, proporcionando assim uma redução significativa dos dias e noites frias. Foi observado que as temperaturas mínimas e máximas apresentam maiores tendências de aumento nas estações do outono e primavera, respectivamente. Baseado nos índices extremos de precipitação, mesmo sem significância estatística, foi observado que as chuvas intensas tendem a aumentar, ocorrendo em um período menor de tempo.

  4. Análise da castanha do cajueiro por tomografia de ressonância magnética Cashew nut analysis by magnetic resonance tomography

    Directory of Open Access Journals (Sweden)

    João Rodrigues de Paiva

    2004-11-01

    Full Text Available O objetivo deste trabalho foi avaliar a técnica de tomografia de ressonância magnética na análise de castanhas de cajueiro, em relação ao método tradicional, visando sua aplicação na seleção de clones. Amostras de castanhas de 40 clones de cajueiro comum, colhidas na safra de 2002, foram analisadas por ambos os métodos. Pelo método tradicional, a maioria dos clones apresentou altos e médios valores dos indicadores industriais massa de castanha, massa de amêndoa e rendimento industrial e baixos índices de quebra das amêndoas. Pela tomografia, a maioria dos clones apresentou castanhas com espaços vazios entre a amêndoa e o endocarpo, que podem proteger a amêndoa durante a decorticação. Os resultados dos dois métodos foram complementares, e a tomografia, além de alternativa promissora na avaliação da qualidade de castanha, pode subsidiar outras áreas de pesquisa relacionadas ao estudo da castanha.The objective of this work was to evaluate the technique of magnetic resonance tomography for cashew nut analysis, compared to the traditional method of clone selection. Samples of cashew nut from 40 clones harvested in 2002 were analyzed using both methods. Using traditional method most of clones showed high and medium values of the industrial indicators nut and seed mass and industrial yield and low values of seed breakage. By magnetic resonance tomography majority of clones showed cashew nuts with empty spaces between the nut and the endocarp, which can protect the seed during decortication. The results for the two methods were complementary and the tomography, besides being a promising option for the quality evaluation of cashew nut, can give support to other researches related to cashew nut study.

  5. Modelo harmônico para a estimativa da temperatura do ar média mensal em diferentes locais do Estado do Rio Grande do Sul Harmonic model for estimating the average monthly air temperature in different locations of Rio Grande do Sul State, Brazil

    OpenAIRE

    Alberto Cargnelutti Filho; Ronaldo Matzenauer; Jaime Ricardo Tavares Maluf; Bernadete Radin

    2010-01-01

    O objetivo deste trabalho foi ajustar o modelo harmônico para a estimativa da temperatura do ar média mensal em 37 locais do Estado do Rio Grande do Sul, com os dados do período de 1931 a 2000. Em cada local, os dados de 1931 a 1990 (60 anos) foram utilizados para estimar os coeficientes do modelo harmônico, e os dados de 1991 a 2000 (10 anos), para a validação do modelo. Foram testadas a normalidade e homogeneidade de variâncias, estimadas tendências e incorporadas aos modelos harmônicos con...

  6. Optimizing the width of strip weeding in arabica coffee in relation to crop age Largura da faixa de controle de plantas daninhas em café arábica em função da idade do cafeeiro

    Directory of Open Access Journals (Sweden)

    FC. Araújo

    2012-03-01

    Full Text Available The aim of this study was to determine the weed strip control (WSC required for adequate coffee growth after transplanting. A non-irrigated, field-planted (spaced 3.80 x 0.70 m crop was used. The experimental design was a randomized block, with four replicates. The treatments were arranged in a 9 x 18 split-plot design to test the WSC of 0, 15, 30, 45, 60, 90, 120, 150, and 190 cm, which involved continuously hand-weeding at each side of the coffee row, and 18 coffee growth measurements. Multiple regression analyses were carried out relating to growth-variables as a function of both WSC and growth-evaluation times. Brachiaria decumbens was the main weed accomplishing 88.5% of the total weed dry mass. The minimum width of the WSC increases as the crop ages after transplanting. Assuming reductions of 2% and 5% in the maximum coffee growth, the recommended WSC was 75 and 52 cm at 4 months after transplanting (MAT, 104 and 85 cm at 6 MAT, 123 and 105 cm at 9 MAT, 134 and 116 cm at 12 MAT, 142 and 124 cm at 15 MAT, and 148 and 131 cm at 18 MAT, respectively. It was concluded that integrated weed management in young coffee crops must focus on the weed control only in a minimum range along coffee rows, which increases with coffee plant age, keeping natural vegetation in the inter-rows.O objetivo deste estudo consistiu em determinar a faixa ideal de controle de plantas daninhas (FCPD necessária para um crescimento adequado do cafeeiro após o transplantio. Foi utilizada uma lavoura não irrigada, implantada no espaçamento de 3,80 x 0,70 m, em dezembro de 2008. O delineamento experimental foi em blocos casualizados, com quatro repetições. Os tratamentos foram dispostos em um esquema de parcelas subdivididas (9 x 18 para testar as FCPDs de 0, 15, 30, 45, 60, 90, 120, 150 e 190 cm, mantidas com capina contínua em cada lado da linha de café, bem como seus efeitos ao longo de 18 meses após o transplantio (MAT. Efetuaram-se análises de regressão m

  7. Pneumonia lipídica - aspectos na tomografia computadorizada: relato de caso Lipoid pneumonia: computed tomography findings - a case report

    Directory of Open Access Journals (Sweden)

    Janos Farias

    2004-02-01

    Full Text Available Os autores relatam um caso de pneumonia lipídica em um paciente de 80 anos de idade, que iniciou o quadro com dispnéia em repouso. Havia história de constipação crônica, com uso freqüente de laxativos oleosos. O paciente apresentava diminuição do nível de consciência e os familiares relatavam tosse e engasgos freqüentes, durante o uso do medicamento. As radiografias de tórax demonstravam consolidação localizada no segmento posterior do lobo superior do pulmão direito, além de opacidades mal definidas nos lobos inferiores e que não se modificavam em exames sucessivos. A tomografia computadorizada de alta resolução mostrou consolidações com medidas de densidade negativas em seu interior, variando de -29 a -83 UH, e opacidades em vidro fosco localizadas no lobo superior do pulmão direito e nos lobos inferiores, com predomínio nos segmentos posteriores. O diagnóstico foi feito através do lavado bronco-alveolar, que evidenciou a presença do material oleoso. O paciente foi orientado a interromper o uso de laxativos oleosos e não retornou para o controle ambulatorial.The authors report a case of lipoid pneumonia in an 80-year-old man with chronic constipation in regular use of mineral oil as a laxative. According to his family, he experienced coughing episodes when he took his medication. He also presented dyspnea at rest and diminished consciousness levels. Chest radiographs showed a consolidation area in the posterior segment of right upper lobe, which did not change on successive exams. High resolution computed tomography demonstrated low-density consolidation with negative Hounsfield units (-29 to -83 UH and ground-glass opacities in the right upper lobe and inferior lobes. These opacities predominated in the posterior regions of the lungs. The diagnosis was confirmed by the presence of oil material on bronchoalveolar washing. The patient was advised to discontinue the ingestion of mineral oil and did not return for

  8. Resistência parcial à necrose dos frutos em genótipos de café arábica Partial resistance to fruit necrosis in arabic coffee genotypes

    Directory of Open Access Journals (Sweden)

    Gustavo Hiroshi Sera

    2009-01-01

    Full Text Available Neste trabalho, objetivou-se identificar em genótipos de café arábica (Coffea arabica L. fontes de resistência à necrose de frutos em condições de campo. As variáveis resistência à necrose de frutos ("NF", quantidade média de frutos por nó produtivo ("FN" e índice de luminosidade dentro da copa da planta ("LUM" foram avaliadas em ensaio de campo no IAPAR (Londrina, em dezembro de 2004, em cafeeiros com três anos de idade. Foi avaliada a variável "NF", atribuindo notas de 1 a 5 sendo 1 para plantas com 0 % a 5 % de frutos necrosados. "FN" foi avaliada seguindo uma escala de notas de 1 a 5, onde 1 representa plantas com 0 a 3 frutos/ nó e nota 5 com mais do que 15 frutos/ nó. A avaliação da variável "LUM" foi visual e seguiu as notas de 1 a 5, onde 1 representa plantas com pouca luminosidade dentro da copa da planta. Dos 19 genótipos avaliados, 2 apresentaram moderada resistência, 7 moderada suscetibilidade, 5 suscetíveis e 5 altamente suscetíveis. As cultivares Obatã IAC 1669-20 e Catucaí Vermelho 4-79 apresentaram o melhor nível de resistência parcial de campo, ou seja, com moderada resistência à necrose de frutos associada ao Colletotrichum spp.The aim of this research was to identify in Coffea arabica L. coffee genotypes resistance sources to fruit necrosis in field conditions. The variables fruit necrosis ("NF", fruits per productive nodes average ("FN" and luminosity index inside of the plant canopy ("LUM" were evaluated in field assay at IAPAR (Londrina, in December 2004 on three years old coffee trees. The "NF" variable were evaluated attributing scores from 1 to 5, where score 1 represented plants with 0 to 5 % of necrosed fruits. "FN" were evaluated following a score scale from 1 to 5, where score 1 represented plants with 0 to 3 fruits/ node and score 5 with more than 15 fruits/ node. The evaluation of the variable "LUM" was visual and followed the scores from 1 to 5, where score 1 represented plants with

  9. Round alectasis: Study with linear tomography, computed tomography and bronchography. Atelectasia redonda: Estudio con tomografia lineal, tomografia computerizada y broncografia

    Energy Technology Data Exchange (ETDEWEB)

    Garcia Aguayo, F.J.; Calpe, J.L.; Chiner, E.

    1990-01-01

    Diagnosis of round atelectasis (RA) has been carried out in five patients with simple radiography (SR) and linear tomography (LT). These procedures showed in all patients curved bronchovascular parcel towards pseudotumor, main diagnosis criterior. Computed tomography effectiveness was less than SR and LT, but revealed bilateral lesion in patient and moreover, shape, size and relations of RA with pleura. CT also showed in a patient AR development from effusion of slow resolution, corroborating pathogenic hypothesis of Hanke. In four cases bronchography was performed, confirming curvature and bronchial penetration in AR. (Author)

  10. Variações anatômicas e sinusopatias: estudo por tomografia computadorizada Anatomical variations and sinusitis: a computed tomographic study

    Directory of Open Access Journals (Sweden)

    Marcio M. Kinsui

    2002-10-01

    Full Text Available Introdução: A tomografia computadorizada tem sido cada vez mais utilizada para a identificação e avaliação das variações anatômicas das cavidades nasais que podem levar às sinusites. Objetivo: Avaliar, por meio da tomografia computadorizada, a incidência de espessamento mucoso nos seios paranasais de pacientes com sintomas de sinusite e a correlação entre sinusopatias e presença de célula de Haller, concha média bolhosa e desvio de septo nasal localizado no meato médio. Forma de Estudo: Clínico retrospectivo. Material e Método: Foram avaliadas retrospectivamente 150 tomografias computadorizadas de seios paranasais de pacientes com idade igual ou superior a 13 anos, realizadas no Departamento de Diagnóstico por Imagem da Universidade Federal de São Paulo - Escola Paulista de Medicina, no período de julho de 1999 a outubro de 2001. Foram excluídos os exames de pacientes com pós-operatório de cirurgias de seios paranasais e de base de crânio, além dos portadores de lesões tumorais envolvendo estas regiões. Resultados: 70% dos pacientes apresentavam espessamento mucoso em pelo menos um dos seios paranasais. Observou-se a freqüência de 52,7% de sinusopatia maxilar, 28,0% de etmoidal, 13,0% de esfenoidal e 8,3% de frontal. Concha média bolhosa foi encontrada em 33,3% das cavidades nasais, desvio de septo nasal localizado no meato médio em 23,3% e célula de Haller em 9,3%. Conclusões: Os seios paranasais mais freqüentemente acometidos foram, em ordem decrescente: maxilar, etmoidal, esfenoidal e frontal. Não foi observado correlação entre sinusopatias e presença de célula de Haller, concha média bolhosa e desvio de septo nasal localizado no meato médio.Introduction: Computed tomography has been increasingly used both to identify and to evaluate anatomy variations of nasal cavities that can lead to the development of sinusitis. Purpose: The purpose of the present study is to determine the incidence of mucosal

  11. Estado nutricional e teste do hidrogênio no ar expirado com lactose e lactulose em crianças indígenas terenas Nutritional status and breath hydrogen test with lactose and lactulose in Terena Indian children

    Directory of Open Access Journals (Sweden)

    Gildney Maria dos Santos Alves

    2002-04-01

    Full Text Available Objetivo: avaliar o estado nutricional, a absorção e a tolerância à lactose e a ocorrência de sobrecrescimento bacteriano no intestino delgado.Métodos: estudo transversal envolvendo todas as 264 crianças índias Terenas, menores de 10 anos, das aldeias Limão Verde e Córrego Seco, em Aquidauana (MS. O estado nutricional foi avaliado pelo peso e pela estatura, relacionados com a referência do NCHS. Após a ingestão de 18 gramas de lactose, foi avaliada sua absorção, pelo teste do hidrogênio no ar expirado, e a tolerância de acordo com o aparecimento de manifestações clínicas. Sobrecrescimento bacteriano no intestino delgado foi avaliado com o teste do hidrogênio no ar expirado após a administração de lactulose (5g. Resultados: a mediana dos escores Z do peso-idade, peso-estatura e estatura-idade para as crianças com idade inferior a 12 meses (n=34 foram, respectivamente: -0,66, +0,60 e -0,85. Entre 1 e 5 anos (n=111 foram, respectivamente: -0,50, +0,28 e -1,17. Entre os 5 e 10 anos (n=119, estes valores foram, respectivamente: -0,09, +0,50 e -0,60. Após os 4 anos (n=197, absorção deficiente e má absorção de lactose foi observada em 89,3% das 197 crianças avaliadas. Intolerância à lactose foi observada em 37,1% destas 197 crianças. Sobrecrescimento bacteriano no intestino delgado foi caracterizado em 11,5% das crianças índias terenas (n=252.Conclusões: a prevalência de desnutrição atual foi baixa, mas a mediana de estatura para idade foi inferior à referência do NCHS. Prevalência de deficiência ontogenética de lactase é elevada. Sobrecrescimento bacteriano sugere a existência de enteropatia ambiental assintomática nas crianças índias terenas.Objective: to evaluate the nutritional status, absorption and tolerance of lactose and the occurrence of small-bowel bacterial overgrowth. Methods: a cross-sectional study including all 264 Terena Indian children younger than 10 years from two tribes (Lim

  12. VAZÕES ESPECÍFICAS MÍNIMAS PARA SECAGEM DO MILHO COM AR NATURAL EM BOTUCATU-SP MINIMUM AIRFLOW RATES TO DRY CORN GRAIN WITH NATURAL AIR IN BOTUCATU-SP

    Directory of Open Access Journals (Sweden)

    V. A. Gonçalves

    2007-09-01

    Full Text Available

    Recomendam-se à secagem com ar natural vazões específicas suficientemente baixas, reduzindo a potência requerida pelo ventilador e contribuindo para o arrefecimento da sobressecagem. Através de modelos matemáticos de simulação foram determinadas as vazões específicas mínimas necessárias à secagem com ar natural do milho a granel, nas condições climáticas do município de Botucatu, no Estado de São Paulo, correspondentes aos meses de março a junho do ano de 1971, cujo potencial de secagem foi o mais drástico dentro de um período de 10 anos analisado. Foram considerados para o milho os teores de umidade inicial, base úmida, de 22%, 20% e 18%, obtendo-se os respectivos períodos de armazenamento seguro de 7, 11 e 29 dias, em função da temperatura média de 23,40C do mês de março de 1975, a mais elevada do período de 10 anos analisado. Outrossim, as médias empregadas, temperatura de bulbo seco e umidade relativa, foram obtidas a partir dos registros horários do termo-higrógrafo, localizado na Estação Meteorológica da Faculdade de Ciências Agronômicas de Botucatu, no Estado de São Paulo. Foi considerada somente a secagem seletiva dentro dos períodos diários das 9 às 17 horas, 9 às 18 horas e 8 às 18 horas, dada a impossibilidade de realização da secagem contínua, já que as condições de equilíbrio entre o ar e o grão não possibilitaram a redução do teor de umidade final ao nível recomendado ao armazenamento seguro. Constatou-se que a queda do teor de umidade de equilíbrio do grão em poucos pontos percentuais acarreta elevados decrementos nas vazões específicas mínimas requeridas. Outrossim, uma redução de poucas horas no período diário de operação do ventilador requer significativos incrementos nas vazões específicas mínimas para a realização da secagem dentro do tempo de secagem admissível.

  1. PREVALÊNCIA DE DOENÇAS INFECCIOSAS EM REBANHO DE SUÍNOS CRIADOS AO AR LIVRE NA REGIÃO SUDOESTE DO PARANÁ, BRASIL PREVALENCE OF INFECTIOUS DISEASES IN A PIG BREEDING HERD RAISED OUTDOORS IN THE SOUTH-WESTERN REGION OF PARANÁ, BRAZIL

    OpenAIRE

    Laerte Francisco Filippsen; Denyse Maria Galvão Leite; Aparecido da Silva; Gilberto Alexandre Vargas

    2001-01-01

    O presente trabalho objetivou determinar a prevalência de doenças infecciosas em rebanho de suínos criados ao ar livre na região sudoeste do Paraná, no período de outubro de 1996 a junho de 1999. Foram examinados um total de 969 animais. Todas as ocorrências de enfermidades observadas nos animais foram registradas. Os animais mortos no período, além de um leitão por lote, sacrificado aos 28 dias pós-desmame, foram necropsiados. Amostras de sangue foram coletadas para realização de exames soro...

  2. Qualidade de maçãs ‘Gala’ armazenadas em atmosfera controlada dinâmica e estática com renovação do ar Quality of ‘Gala’ apples stored in dynamic and static controlled atmosphere with air renovation

    OpenAIRE

    Auri Brackmann; Ricardo Fabiano Hettwer Giehl; Josuel Alfredo Vilela Pinto; Cristiano André Steffens; Ivan Sestari

    2005-01-01

    Este experimento teve como objetivo avaliar o efeito da remoção periódica da atmosfera das câmaras de atmosfera controlada com ar e nova instalação, bem como o uso da atmosfera dinâmica, sobre a manutenção da qualidade da maçã 'Gala'. Os tratamentos utilizados foram: (1) controle (sem renovação); (2) renovação da atmosfera diariamente durante o resfriamento dos frutos; (3) renovação da atmosfera diariamente durante o resfriamento e mensalmente no período de armazenamento em atmosfera controla...

  3. Análise de dentição mista: tomografia versus predição e medida radiográfica Mixed-dentition analysis: tomography versus radiographic prediction and measurement

    OpenAIRE

    Letícia Guilherme Felício; Antônio Carlos de Oliveira Ruellas; Ana Maria Bolognese; Eduardo Franzotti de Sant'Anna; Mônica Tirre de Souza Araújo

    2010-01-01

    OBJETIVO: o objetivo dos autores desse estudo foi comparar o método de análise de dentição mista que utiliza tomografia computadorizada de feixe cônico para avaliar os diâmetros dos dentes intraósseos com os métodos de Moyers, Tanaka-Johnston e radiografias oblíquas em 45º. MÉTODOS: foram realizadas medidas, na arcada inferior, dos diâmetros mesiodistais dos incisivos permanentes irrompidos, nos modelos de gesso com auxílio de paquímetro digital e estimativa do tamanho de pré-molares e canino...

  4. Correlação entre hipótese diagnóstica e laudo de tomografia axial computadorizada craniana Correlation between diagnostic hypothesis and result of cranial computed axial tomography

    OpenAIRE

    Edison Matos Nóvak; Fábio Terabe; André Luís Nasimoto; Paulo Henrique Migliari de Carvalho; Ariane Desirée Loper; Fabiana Schenato Büchele; Júlio César Nogara

    2001-01-01

    Para avaliar a utilização da tomografia axial computadorizada craniana (TC) em nosso meio, analisamos as solicitações de 367 exames consecutivos no período compreendido entre 07/1995 e 07/1996. Houve ampla variação da faixa etária, com média de 31,7 ± 22,9 anos. As especialidades que mais solicitaram o exame foram: Neurologia (36,2%), Pronto Atendimento (17,4%), Neuropediatria (16,9%) e Clínica Médica (5,9%). As indicações mais frequentes para o exame foram: convulsão (30%), cefaléia (26,2%),...

  5. CARCINOMA BRONQUÍOLO-ALVEOLAR: ASPECTOS NA TOMOGRAFIA COMPUTADORIZADA DE ALTA RESOLUÇÃO

    OpenAIRE

    Moreira Luiza Beatriz Melo; Marchiori Edson; Melo Alessandro Severo Alves de; Magnago Marcelo; Muniz Maria Angélica Soares; Irion Klaus

    2002-01-01

    O carcinoma bronquíolo-alveolar é um tipo de carcinoma broncogênico de crescimento insidioso, que surge nas paredes das vias aéreas distais e se dissemina utilizando o septo alveolar como um estroma, preservando a arquitetura pulmonar. Neste trabalho foram analisadas as tomografias computadorizadas de alta resolução de 17 pacientes com carcinoma bronquíolo-alveolar. Ao contrário do relatado na literatura, foram observados predomínio no sexo masculino (71%) e maior freqüência da associação das...

  6. Technical competence in cardiovascular magnetic resonance and computed tomography; Competencia tecnica em ressonancia e tomografia cardiovascular

    Energy Technology Data Exchange (ETDEWEB)

    Fernandes, Juliano Lara; Shiozaki, Afonso Akio; Azevedo Filho, Clerio Francisco de; Rochitte, Carlos Eduardo; Pinto, Ibraim Marciarelli Francisco; Lopes, Marly Maria Uellendahl; Schvartzman, Paulo Roberto, E-mail: jlaraf@fcm.unicamp.br [Universidade de Campinas (UNICAMP/GERT) SP (Brazil). Grupo de Estudo em Ressonancia e Tomografia Cardiovascular

    2009-10-15

    Cardiovascular magnetic resonance and computed tomography have evolved as very practical and useful techniques applied in clinical cardiology. Due to their rapid acceptance in the cardiology community and widespread use, training of both cardiologists and radiologists on this subspecialty has not been homogeneous so far. This in part explains significant differences observed in the diverse background found in today’s practicing physicians who execute these exams. In order to guide training facilities as well as both payers, contractors and general cardiologists ordering the exam, this document provides a minimum standard that should be accomplished by all physicians who pursue education in the field and for those who already practice in it. The clinical competences listed in this statement are by no means thorough but should be required by all those involved in cardiovascular magnetic resonance and computed tomography as the customary requirements for current and future practitioners. (author)

  7. Dose assessment in pediatric computerized tomography; Avaliacao de doses em tomografia computadorizada pediatrica

    Energy Technology Data Exchange (ETDEWEB)

    Vilarinho, Luisa Maria Auredine Lima

    2004-07-01

    The objective of this work was the evaluation of radiation doses in paediatric computed tomography scans, considering the high doses usually involved and the absence of any previous evaluation in Brazil. Dose values were determined for skull and abdomen examinations, for different age ranges, by using the radiographic techniques routinely used in the clinical centers investigated. Measurements were done using pencil shape ionization chambers inserted in polymethylmethacrylate (PMMA) phantoms. These were compact phantoms of different diameters were specially designed and constructed for this work, which simulate different age ranges. Comparison of results with published values showed that doses were lower than the diagnostic reference levels established to adults exams by the European Commission. Nevertheless, doses in paediatric phantoms were higher than those obtained in adult phantoms. The paediatric dose values obtained in Hospitals A and B were lower than the reference level (DRL) adopted by SHIMPTON for different age ranges. In the range 0 - 0.5 year (neonatal), the values of DLP in Hospital B were 94 por cent superior to the DRL For the 10 years old children the values of CTDI{sub w} obtained were inferior in 89 por cent for skull and 83 por cent for abdomen examinations, compared to the values published by SHRIMPTON and WALL. Our measured CTDI{sub w} values were inferior to the values presented for SHRIMPTON and HUDA, for all the age ranges and types of examinations. It was observed that the normalized dose descriptors values in children in the neonatal range were always superior to the values of doses for the adult patient. In abdomen examinations, the difference was approximately 90% for the effective dose (E) and of 57%.for CTDI{sub w} . (author)

  8. Quantitative analyses of maxillary sinus using computed tomography Análise quantitativa dos seios maxilares por meio da tomografia computadorizada

    Directory of Open Access Journals (Sweden)

    Andréia Perella

    2003-09-01

    Full Text Available The aim of this study was to evaluate the precision and accuracy of linear measurements of maxillary sinus made in tomographic films, by comparing with 3D reconstructed images. Linear measurements of both maxillary sinus in computed tomography CT of 17 patients, with or without lesion by two calibrated examiners independently, on two occasions, with a single manual caliper. A third examiner has done the same measurements electronically in 3D-CT reconstruction. The statistical analysis was performed using ANOVA (analyses of variance. Intra-observer percentage error was little in both cases, with and without lesion; it ranged from 1.14% to 1.82%. The inter-observer error was a little higher reaching a 2.08% value. The accuracy presented a higher value. The perceptual accuracy error was higher in samples, which had lesion compared to that which had not. CT had provided adequate precision and accuracy for maxillary sinus analyses. The precision in cases with lesion was considered inferior when compared to that without lesion, but it can't affect the method efficacy.O objetivo deste trabalho foi avaliar a precisão e acurácia de medidas lineares da região de seio maxilar realizadas em filmes tomográficos, por meio de comparação com a reconstrução da imagem em 3D. Medidas lineares de ambos os seios maxilares foram realizadas em tomografias computadorizadas (2D-TC de 17 pacientes, normais e com lesão, por dois examinadores, calibrados, separadamente, duas vezes cada um, utilizando um compasso. Um terceiro observador realizou as mesmas medidas eletronicamente na reconstrução 3D-TC. ANOVA (análise de variância foi utilizado para análise estatística. A porcentagem de erro intra-examinadores foi pequena em ambos os casos, com ou sem lesão, variando de 1,14% a 1,82%. O erro inter-examinadores foi maior alcançando o valor de 2,08% .O erro percentual de acurácia nas amostras com lesão foram maiores comparando-as às que não tinham lesão. A

  9. Deformação flexural adquirida da articulação interfalângica distal em poldros

    OpenAIRE

    Curto, Teresa Margarida Pereira Costa e

    2012-01-01

    Dissertação de Mestrado Integrado em Medicina Veterinária Numa coudelaria de cavalos Lusitanos em Torres Vedras foi observado, desde 2008, o desenvolvimento de deformações flexurais (DF) adquiridas nos membros torácicos dos poldros em crescimento. As lesões foram estudadas em onze animais através da realização do exame físico de estado geral, exame ortopédico, exames radiográfico, ultrasonográfico e tomografia axial computorizada, goniometria, medição de osso cortical do tercei...

  10. Avaliação pulmonar em crianças portadoras de cardiopatia congênita acianótica e hiperfluxo pulmonar através de tomografia computadorizada Evaluación pulmonar en niños portadores de cardiopatía congénita acianótica e hiperflujo pulmonar a través de tomografía computadorizada Computed tomography in pulmonary evaluation of children with acyanotic congenital heart defect and pulmonary hyperflow

    Directory of Open Access Journals (Sweden)

    Solange Gimenez

    2009-10-01

    Full Text Available JUSTIFICATIVA E OBJETIVOS: Disfunção respiratória é frequente em crianças com cardiopatias congênitas acianóticas com hiperfluxo pulmonar (CCAHP, porém pouco é conhecido sobre a estrutura pulmonar destes pacientes. O objetivo deste estudo foi quantificar os volumes de gás e tecido e a distribuição da aeração pulmonar nesta população. MÉTODOS: Após aprovação do Comitê de Ética institucional e obtenção do consentimento escrito pós-informado, foram obtidas tomografias computadorizadas torácicas em sete crianças com CCAHF. As imagens pulmonares direita e esquerda foram contornadas em todas as imagens e os volumes e pesos pulmonares foram computados a partir dos dados volumétricos. As comparações entre esquerda e direita foram analisadas usando teste t de Student pareado e as correlações através de regressão exponencial. RESULTADOS: A idade mediana foi 20 meses e o peso foi de 9,9 kg. Volume pulmonar total (VPT foi de 66,7 ± 23,1 mL.kg-1, o de tecido 33,5 ± 15,7 mL.kg-1 e o de gás 33,1 ± 8,3 mL.kg-1. O pulmão direito representou 57,9% e o pulmão esquerdo 42,1% do VPT (p JUSTIFICATIVA Y OBJETIVOS: La disfunción respiratoria es frecuente en niños con cardiopatías congénitas acianóticas con hiperflujo pulmonar (CCAHP, sin embargo, se conoce muy poco sobre la estructura pulmonar de esos pacientes. El objetivo de este estudio, fue cuantificar los volúmenes de gas y tejido y la distribución de la aeración pulmonar en esa población. MÉTODOS: Después de la aprobación por parte del Comité de Ética Institucional y de la obtención del consentimiento escrito informado, se obtuvieron tomografías computadorizadas torácicas en siete niños con CCAHF. Las imágenes pulmonares derecha e izquierda fueron perfiladas en todas las imágenes, y los volúmenes y los pesos pulmonares fueron computados a partir de los datos volumétricos. Las comparaciones entre izquierda y derecha fueron analizadas usando el test t de

  11. Avaliação do edema macular após cirurgia não complicada de facoemulsificação com implante de lente intraocular por meio da tomografia de coerência óptica spectral domain

    Directory of Open Access Journals (Sweden)

    Everton Paroschi Corrêa

    2013-12-01

    Full Text Available OBJETIVO: Avaliar o edema macular após cirurgia não complicada de facoemulsificação com implante de lente intraocular por meio da tomografia de coerência óptica spectral domain (OCT-SD. MÉTODOS: Foi realizado estudo prospectivo em 62 olhos de pacientes submetidos à facoemulsificação com implante de lente intraocular. Os pacientes foram avaliados antes e após a cirurgia, no primeiro dia, e na primeira, segunda e quarta semanas. Acuidade visual (AV, células na câmara anterior e tomografia de coerência óptica macular cubo 200x200 foram medidos. RESULTADOS: Após a cirurgia de facoemulsificação houve melhora da acuidade visual, inflamação decrescente, e a espessura e o volume macular aumentaram. Ocorreu um caso de edema macular cistoide. Houve correlação inversa fraca entre a acuidade visual e a espessura macular central, e entre a acuidade visual e o volume macular. Foi observada correlação direta fraca entre a inflamação e o volume macular. CONCLUSÃO: Edema macular subclínico desenvolve-se mesmo após cirurgia de catarata não complicada em pacientes não predispostos. A tomografia de coerência óptica spectral domain foi capaz de detectar pequenos aumentos na espessura macular no período avaliado.

  12. Estimativa da produtividade de arroz irrigado em função da radiação solar global e da temperatura mínima do ar Rice yield estimates based on global solar radiation and minimum air temperature

    Directory of Open Access Journals (Sweden)

    Silvio Steinmetz

    2013-02-01

    Full Text Available Considerando-se a importância da produção do arroz irrigado no Estado do Rio Grande do Sul e que o seu desempenho é influenciado pelas condições meteorológicas, o objetivo deste trabalho foi estimar a produtividade de grãos dessa cultura em função da radiação solar global e da temperatura mínima do ar, usando procedimentos de análise de regressão linear simples e múltipla. Realizou-se um experimento de campo, em Capão do Leão, RS, durante três anos agrícolas. Empregaram-se, em cada ano agrícola, seis datas de semeadura e oito cultivares de diferentes grupos de comprimento de ciclo. Dez colmos principais de cada cultivar foram marcados, para determinarem-se os principais estádios de desenvolvimento. A variável dependente (Y foi a média da produtividade de quatro repetições, de cada época de semeadura, e as variáveis independentes foram: a média da radiação solar global (X¹, a média da temperatura mínima do ar (X² e a média da temperatura mínima do ar elevada ao quadrado (X³, computadas em quatro períodos de desenvolvimento da planta para a radiação solar global e em três períodos para a temperatura mínima do ar. A maioria das variáveis, quando testadas isoladamente, apresentou uma relação linear significativa com a produtividade, mas os coeficientes de determinação (r² foram mais elevados nas regressões lineares múltiplas envolvendo as principais variáveis. Modelos de regressão que utilizam como variáveis preditoras a radiação solar global e a temperatura mínima do ar, em diferentes períodos de desenvolvimento da planta, mostram-se adequados para a estimativa da produtividade de grãos de arroz irrigado.Considering the importance of irrigated rice production in the State of Rio Grande do Sul and that its performance is influenced by the weather conditions, the objective of this study was to estimate the grain yield of this crop as a function of global solar radiation and minimum air

  13. Vascular injuries in intestinal obstruction. The role of computed tomography; Complicazioni vascolari nelle occlusioni intestinali: ruolo della tomografia computerizzata

    Energy Technology Data Exchange (ETDEWEB)

    Vinci, R.; Angelelli, G.; Stabile Ianora, A.A.; Gaballo, A.; Rotondo, A. [Bari Univ., Bari (Italy). Dipt. di Medicina Interna e Medicina Pubblica, Serv. di Diagnostica per Immagini

    1999-09-01

    The paper investigates computerized tomography capabilities in showing vascular complications secondary to intestinal obstruction and for assessing the site and cause of obstruction. [Italian] Scopo del lavoro e' lo studio dell'uso della tomografia computerizzata nel riconoscimento di complicanze vascolari secondarie ad occlusione intestinale e della presenza, della natura e della sede dell'ostacolo alla canalizzazione intestinale.

  14. ARS Biodiesel Research Initiatives

    Science.gov (United States)

    Biodiesel activities within ARS are concerned with the production, quality, and properties of this alternative fuel from agriculturally derived fats and oils. Currently, in the absence of tax incentives, biodiesel production when using refined fats and oils and conventional alkali transesterificati...

  15. Paracoccidioidomicose pulmonar: aspectos na tomografia computadorizada de alta resolução High-resolution computed tomography findings in pulmonary paracoccidioidomycosis

    Directory of Open Access Journals (Sweden)

    Maria Angélica Soares Muniz

    2002-06-01

    Full Text Available O comprometimento pulmonar na paracoccidioidomicose é muito freqüente, podendo até ser a única manifestação da doença. Neste trabalho são analisados os aspectos encontrados nas tomografias computadorizadas de alta resolução do tórax de 30 pacientes com paracoccidioidomicose confirmada. Por meio desta análise foram determinados os achados mais comuns e suas formas de apresentação e distribuição nos pulmões. Os aspectos mais freqüentemente observados foram: espessamento esparso de septos interlobulares (96,7%, opacidades em vidro fosco (66,7%, nódulos (60%, aumento irregular do espaço aéreo (enfisema paracicatricial (56,7%, espessamento de paredes brônquicas (46,7%, espessamento pleural (36,7%, cavidades (36,7%, dilatação da traquéia (33,3%, distorção arquitetural (30%, consolidação do espaço aéreo (30%, bandas parenquimatosas (23,3%, reticulado intralobular (13,3% e espessamento irregular do interstício axial peri-hilar (10%. A radiografia do tórax apresenta limitada capacidade de avaliar doenças pulmonares difusas, tornando a tomografia computadorizada de alta resolução do tórax essencial para avaliação dos pacientes com paracoccidioidomicose pulmonar.Pulmonary disease in paracoccidioidomycosis is very common and in some cases can be the sole manifestation of the disease. We studied the findings observed in 30 patients with pulmonary paracoccidioidomycosis submitted to high-resolution computed tomography in order to determine the most frequent findings, presentation patterns and distribution of paracoccidioidomycosis lesions in the lungs. The most frequent findings observed on high-resolution computed tomography were: interlobular septal thickening (96.7%, ground-glass opacities (66.7%, nodules (60%, irregular air-space enlargement (56.7%, bronchial wall thickening (46.7%, pleural thickening (36.7%, cavitation (36.7%, tracheal dilatation (33.3%, architectural distortion (30%, air-space consolidation (30

  16. Application of the total etching technique or self-etching primers on primary teeth after air abrasion Aplicação da técnica de condicionamento total ou de "primers" autocondicionantes em dentes decíduos após abrasão a ar

    Directory of Open Access Journals (Sweden)

    Fábio Renato Manzolli Leite

    2005-09-01

    Full Text Available Since the use of air abrasion has grown in pediatric dentistry, the aim of this study was to evaluate, by means of shear bond strength testing, the need to use the total etching technique or self-etching primers on dentin of primary teeth after air abrasion. Twenty-five exfoliated primary molars had their occlusal dentin exposed by trimming and polishing. Specimens were treated by: Air abrasion + Scotchbond MultiPurpose adhesive (G1; 37% phosphoric acid + Scotchbond MP adhesive (G2; Clearfil SE (G3; Air abrasion + 37% phosphoric acid + Scotchbond MP adhesive (G4; Air abrasion + Clearfil SE (G5. On the treated surface, a cylinder of 2 mm by 6 mm was made using a composite resin (Z100. Duncan's test showed that: (G2 = G3 = G5 > (G1 = G4. The use of a self-etching primer on air abraded dentin is recommended to obtain higher bond strengths.Como o uso da abrasão a ar tem aumentado em odontopediatria, o objetivo deste trabalho foi avaliar a resistência ao cisalhamento da resina composta Z100 sobre a superfície dentinária de dentes decíduos após abrasionamento a ar associado ou não a técnica de condicionamento total (ácido fosfórico + Scotchbond Multi Purpose ou "primer" autocondicionante (Clearfil SE Bond. A superfície oclusal de 25 molares decíduos foi removida para exposição completa da superfície dentinária. Após polimento com lixas abrasivas, foram divididos em 5 grupos (5 espécimes em cada tratados por abrasão + adesivo Scotchbond (G1; condicionamento ácido + adesivo Scotchbond (G2; adesivo Clearfil (G3; abrasão a ar + condicionamento ácido + adesivo Scotchbond (G4; abrasão a ar + adesivo Clearfil (G5. Uma matriz bipartida foi adaptada à superfície dentinária e preenchida com resina composta. Após polimerização, corpos-de-prova de 2 mm x 6 mm foram obtidos. O teste de Duncan mostrou a desigualdade (G1 = G4 < (G2 = G3 = G5. Desse modo, conclui-se que, após o abrasionamento dentinário, deve ser utilizado o sistema de

  17. Avaliação da composição química de milho seco e armazenado em silo tipo alambrado com ar natural forçado Evaluation of chemical composition of corn dried and stored with forced natural air

    Directory of Open Access Journals (Sweden)

    Luiz Carlos Gutkoski

    2009-12-01

    Full Text Available O trabalho objetivou estudar o efeito da umidade de colheita e do tempo de armazenamento em grãos de milho secos e armazenados em silos com ar natural forçado. Grãos de milho colhidos com 17,8; 18,9 e 20,5% de água foram acondicionados em silos tipo alambrado com fundo falso perfurado e com ventiladores ligados ininterruptamente até a secagem. Amostras de milho foram coletadas nos tempos zero, 4, 8, 22 e 112 dias, em seis alturas de camada de cada silo (10, 60, 110, 160, 210 e 260 cm. A composição química foi determinada pelo uso de Espectrofotômetro do Infravermelho Proximal (NIR e os resultados expressos em porcentagem e em base seca. Os dados foram analisados estatisticamente (Anova e nas interações significativas, elaborados os gráficos de regressão. Nas determinações de proteínas, lipídios, matéria seca e fibra em detergente neutro as interações foram significativas ao nível de 5% de probabilidade de erro, enquanto que em cinzas, umidade e carboidratos não foram verificadas diferenças significativas. A aeração natural forçada é capaz de reduzir a umidade do milho para 13%, sendo tecnicamente viável em propriedades familiares.The aim of this work was to study the effects of moisture at harvest and time of storage upon grains of corn dried and stored in bins with forced natural air. Grains of corn harvested with 17.8; 18.9, and 20.5% of water were stored in drying bins with false floor with fans working full-time until drying. Samples of corn were collected at zero, 4, 8, 22, and 112 days from six different heights in each bin (10, 60, 110, 160, 210 and 260 cm. The chemical composition was determined through Near-Infrared Spectrophotometer (NIR and the results were expressed in percentage at dry basis. The data were statistically analyzed (Anova and for the significant interactions graphics of regression were provided. In the process of determination of protein, fat, dry matter, and neutral detergent fiber the

  18. Avaliação da epífora de cães usando dacriocistografia e tomografia computadorizada

    Directory of Open Access Journals (Sweden)

    Nivea M.G. Vieira

    2015-12-01

    Full Text Available Resumo: A avaliação da epífora pode ser feita por exames clínicos, testes de excreção lacrimal, exames contrastados, como avaliação radiológica e estudo tomográfico; estes dois últimos permitem análise minuciosa das estruturas. O presente estudo teve como objetivo avaliar a via lacrimal excretora com uso de radiografia e tomografia computadorizada contrastadas, feitas em animais com epífora, comparando-se com animais sadios, sem essa afecção. Foram utilizados 20 cães, de raças e pelagens variadas, machos e fêmeas, com peso de 1 a 20 kg, com 0,7 a 8 anos de idade, apresentando epífora (grupo epífora - GE. Como grupo de controle (GC, foram utilizados 15 cães, sem alterações clínicas de drenagem do sistema lacrimonasal de raças e pelagens variadas, machos e fêmeas, pesando 1 a 20 kg, com 0,7 a 8 anos. Foi proposta a divisão do sistema de drenagem lacrimal em quatro regiões. Na região 1, o GE teve 29 (76,3% animais com dilatação visibilizada pelo R-X e 32 (84,2% pela TC; no GC, 4 (12,5% no R-X e 1 (3,1% na TC demonstraram dilatação. Na região 3, 13 (34,2% cães evidenciaram dilatação do DLN no R-X e 14 (36,8% na TC; e 21 (55,3% comunicação do ducto lacrimonasal com o seio nasal pelo R-X e 28 (73,7% pela TC. Já no GC, 15 (46,9% pelo R-X e 22 (68,7% pela TC possuíam comunicação do ducto lacrimonasal com o seio nasal. Concluiu-se que: dilatações também podem ser observadas em alguns cães sem sinal clínico da afecção; comunicação do ducto lacrimonasal com o seio nasal não indica alteração causadora de epífora, pois está presente em animais com e sem afecção; os dados do presente estudo confirmam que o exame DCG por si pode dar importantes informações, de forma semelhante à TC, devendo-se recorrer à ela apenas quando houver dúvidas sobre lesões ósseas, fraturas e corpos estranhos não detectados pelo primeiro.

  19. Aquisição e manipulação de imagens por tomografia computadorizada da região maxilofacial visando à obtenção de protótipos biomédicos Acquisition and manipulation of computed tomography images of the maxillofacial region for biomedical prototyping

    Directory of Open Access Journals (Sweden)

    Maria Inês Meurer

    2008-02-01

    Full Text Available O processo de construção de protótipos biomédicos surgiu da união das tecnologias de prototipagem rápida e do diagnóstico por imagens. No entanto, este processo é complexo, em função da necessária interação entre as ciências biomédicas e a engenharia. Para que bons resultados sejam obtidos, especial atenção deve ser dispensada à aquisição das imagens por tomografia computadorizada e à manipulação dessas imagens em softwares específicos. Este artigo apresenta a experiência multidisciplinar de um grupo de pesquisadores com a aquisição e a manipulação de imagens por tomografia computadorizada do complexo maxilofacial, visando à construção de protótipos biomédicos com finalidade cirúrgica.Biomedical prototyping has resulted from a merger of rapid prototyping and imaging diagnosis technologies. However, this process is complex, considering the necessity of interaction between biomedical sciences and engineering. Good results are highly dependent on the acquisition of computed tomography images and their subsequent manipulation by means of specific softwares. The present study describes the experience of a multidisciplinary group of researchers in the acquisition and manipulation of computed tomography images of the maxillofacial region aiming at biomedical prototyping for surgical purposes.

  20. BACTERIAL DETERIORANTS IN CHICKEN BREAST FILLET PACKAGED IN AIR, VACUUM AND IRRADIATED: BACTERIOLOGICAL GROWTH PARAMETERS AND SHELF-LIFE BACTÉRIAS DETERIORANTES EM FILÉS DE FRANGO EMBALADOS EM AR, VÁCUO E IRRADIADOS: PARÂMETROS BACTERIOLÓGICOS DE DESENVOLVIMENTO E PRAZO COMERCIAL

    Directory of Open Access Journals (Sweden)

    Samira Pirola Santos Mantilla

    2009-10-01

    Full Text Available

    The objective of this research was to evaluate the effect of packaging in 100% air and vacuum, combined with radiation (2 kGy and 3 kGy, on chicken breast fillet shelf-life by evaluation of bacterial deteriorants growth and pH variation parameters. The vacuum packaging increased shelf-life, when compared to commercial packaging in 100% air, both in non-irradiated and irradiated to 3 kGy fillets. The irradiation increased the shelf-life of fillet samples at both doses. The lactic acid bacteria were the organisms that most developed in irradiated samples, showing greater radioresistance, as compared to other microorganisms studied, while the enterobacteria showed greater sensitivity to treatment with ionizing radiation. The vacuum packaging, combined with irradiation, can be used to improve the safety of chicken breast fillets and to extend its shelf-life.

    KEY-WORDS: Deterioration; chicken meat; vacuum packaging; meat radiation.

    O objetivo deste experimento foi avaliar o efeito do uso de embalagens, em 100% ar e a vácuo, combinadas com a radiação gama (2 kGy e 3 kGy, no aumento do prazo de validade comercial de filé de peito de

  1. Ars Electronica tulekul / Rael Artel

    Index Scriptorium Estoniae

    Artel, Rael, 1980-

    2003-01-01

    6.-11. IX toimub Austrias Linzis "Ars Electronica" festival, mille teema on "Code - The Language of Our Time". Festivali kavast, osalejatest, ava-performance'ist "Europe - A Symphonic Vision", näitusest "Cyberarts 2003. Prix Ars Electronica"

  2. ARABIC LIGHT STEMMER (ARS

    Directory of Open Access Journals (Sweden)

    ASMA AL-OMARI

    2014-12-01

    Full Text Available Stemming is a main step used to process textual data. It is usually used in several types of applications such as: text mining, information retrieval (IR, and natural language processing (NLP. A major task in stemming is to standardize words; which can be achieved by reducing each word to its base (root or stem. Arabic stemming is not an easy task. Unlike other languages, Arabic language is a highly inflected language, since it uses many inflectional forms. Researchers are divided on the benefit of using stemming in fields of IR, NLP...etc., since in Arabic the morphological variants of a certain word are not always semantically related. The aim of this paper is to design and implement a new Arabic light stemmer (ARS which is not based on Arabic root patterns. Instead, it depends on well defined mathematical rules and several relations between letters. A series of tests were conducted on ARS stemmer to compare its effectiveness with the effectiveness of two other Arabic stemmers. Test shows clearly the effectiveness superiority of ARS compared to effectiveness of these two Arabic stemmers.

  3. Características da demanda por tomografia computadorizada crânio-encefálica motivos e custos dos exames

    Directory of Open Access Journals (Sweden)

    Ana Tereza Ramos de Oliveira

    1992-03-01

    Full Text Available Foram levantadas as 2860 tomografias computadorizadas crânio-encefálicas (TCCE feitas em um dos três serviços da cidade do Salvador, Brasil, sendo: caracterizados o perfil do usuário e a procedência da demanda; analisados os motivos dos exames e os custos com TCCE normais e anormais. Foram constatadas frequências altas de exames normais: (a para o sexo feminino (66,0% e até os 54 anos (73,0%, neste sexo (variação de exames normais entre 65 e 80%; (b para o sexo masculino nos grupos <15, 25-34 e 35-44 anos (64,7%; (c para solicitações efetuadas pelos convênios (65,3%; (d pelos seguintes motivos, para homens e mulheres respectivamente: cefaléias (81,3 e 87,5%; desmaios/tonturas (79,3 e 78,6%; convulsões (67,3 e 70%; retardo do desenvolvimento psicomotor (72,0 e 67,7%; «distúrbios endócrinos» (75,0% em cada sexo. Proporções altas de exames anormais foram observadas pelos seguintes motivos e para homens e mulheres, respectivamente: síndrome demencial (91,7 e 83,3%; acidentes vasculares encefálicos (85,1 e 73,7%; doenças infecciosas (76,5 e 78,6%; suspeitas de tumor (65,8 e 55,4%; e traumatismo crâ-nioencefálico, 63,6% no sexo masculino. No total, os custos com as TCC normais corresponderam a US$ 565,255 e com as anormais, US$ 381,247; para os convênios, os custos com TCC normais foram 2,2 vezes superiores ao INAMPS e 2,8 vezes superiores àqueles da medicina privada.

  4. Important authorship clarification for arXiv:1010.2709

    OpenAIRE

    Yaffe, Yoav

    2010-01-01

    Version 1 of this paper (arXiv:1010.2709v1) was submitted exclusively by Noa Lavi, without prior knowledge, let alone consent, by Yoav Yaffe. Yoav Yaffe is {\\em not} an author of any version of this paper, with the exception of the present clarification.

  5. O fenômeno El Niño Oscilação Sul e a variabilidade interanual da evaporação do tanque Classe A e da umidade relativa do ar em Santa Maria, RS El Niño Southern Oscilation and the interannual variability of Pan evaporation and air relative humidity in Santa Maria, RS, Brazil

    Directory of Open Access Journals (Sweden)

    Nereu Augusto Streck

    2008-08-01

    Full Text Available O objetivo deste trabalho foi associar a variabilidade interanual da evaporação do tanque Classe A e da umidade relativa do ar com o fenômeno El Niño Oscilação Sul (ENOS em Santa Maria, RS. Foram utilizados os dados diários de evaporação do tanque Classe A (ECA, mm dia-1 e umidade relativa média diária do ar (UR, % medidos em Santa Maria, RS. A ECA foi medida de 1973 a 2006 e a UR de 1969 a 2006. Os anos foram classificados em El Niño (EN, La Niña (LN e Neutros (N, considerando o período de 01/07 de um ano até 30/06 do ano seguinte. Os resultados mostraram que a ECA é menor nos anos de EN e maior nos anos de LN. Já a UR foi maior em anos de EN e menor em anos de LN. O efeito do fenômeno ENOS sobre a ECA é maior nos meses de novembro, dezembro, janeiro e maio, enquanto que sobre a UR os meses de maior influência do ENOS são outubro, novembro, dezembro e maio.The objective of this study was to associate the interannual variability of Pan evaporation and air relative humidity with the El Niño Southern Oscilation (ENSO phenomenon in Santa Maria, RS, Brazil. Daily data records of Pan evaporation (PAN, mm day-1 and mean daily relative humidity (RH, % measured in Santa Maria, RS, were used. PAN was measured from 1973 to 2006 and RH was measured from 1969 to 2006. Years were grouped into El Niño (EN years, La Niña (LN years, and Neutral (N years, from July 1st of the year to June 30th of the following year. Results showed that PAN is lower in EN years and greater in LN years. On the other hand, RH was greater in EN years and lower in LN years. The effect of ENSO on PAN is greater in November, December, January, and May, whereas RH is affected by ENSO in October, November, December and May.

  6. CARCINOMA BRONQUÍOLO-ALVEOLAR: ASPECTOS NA TOMOGRAFIA COMPUTADORIZADA DE ALTA RESOLUÇÃO Bronchioloalveolar carcinoma: aspects in high-resolution computed tomography

    Directory of Open Access Journals (Sweden)

    Luiza Beatriz Melo Moreira

    2002-01-01

    Full Text Available O carcinoma bronquíolo-alveolar é um tipo de carcinoma broncogênico de crescimento insidioso, que surge nas paredes das vias aéreas distais e se dissemina utilizando o septo alveolar como um estroma, preservando a arquitetura pulmonar. Neste trabalho foram analisadas as tomografias computadorizadas de alta resolução de 17 pacientes com carcinoma bronquíolo-alveolar. Ao contrário do relatado na literatura, foram observados predomínio no sexo masculino (71% e maior freqüência da associação das formas de consolidação e multinodular (53% em relação à forma nodular solitária (12%, multinodular (12% e de consolidação (23%. Os aspectos mais encontrados foram: áreas de consolidação (76%, broncograma aéreo (71%, áreas de baixa atenuação provavelmente devidas à presença de muco (60%, espessamento de septos interlobulares, opacidades em vidro fosco e nódulos confluentes (54% cada, e pavimentação em mosaico (36%. Os nódulos cavitados, a atelectasia, o sinal do halo e o aspecto de "árvore em brotamento" foram observados em apenas um caso cada.Bronchioloalveolar carcinoma is a bronchogenic carcinoma that presents an insidious growth, arises from the walls of the distal air spaces and spreads using the alveolar septa as a stroma, preserving the lung architecture. In this work we analyze the high-resolution computed tomography of 17 patients with bronchioloalveolar carcinoma. Conversely to the data presented in the literature, male preponderance (71% and a higher frequency of association between multinodular and consolidation patterns (53% in comparison to single nodular (12%, multinodular (12% and consolidation (23% patterns were observed. The most common findings were: consolidation areas (76%, air bronchogram (71%, low attenuation areas (60%, thickening of interlobular septa, ground-glass attenuation and confluent nodules (54% each, and crazy paving pattern (36%. Cavitated nodules, atelectasis, halo sign and "tree in bud

  7. Evapotranspiração máxima da cultura de pimentão em estufa plástica em função da radiação solar, da temperatura, da umidade relativa e do déficit de saturação do ar Maximum evapotranspiration of sweet pepper in plastic greenhouse as a function of solar radiation, temperature, relative humidity and water vapor pressure deficit of the air

    Directory of Open Access Journals (Sweden)

    Genei Antonio Dalmago

    2006-06-01

    Full Text Available Um experimento foi conduzido para avaliar a relação da evapotranspiração máxima (ETm da cultura de pimentão por unidade de índice de área foliar (ETmf com a radiação solar global incidente (Rg e e saldo de radiação (Rn e, externos à estufa, e com a temperatura (t am, umidade relativa (URm e déficit de saturação (D do ar no interior da estufa. A ETm foi determinada por lisimetria. Apenas a temperatura e a umidade relativa do ar foram registradas e as demais variáveis foram estimadas. O Rn e apresentou o maior efeito isolado, seguido pelo D e pela URm. A temperatura do ar às 15 horas e a temperatura máxima diária foram as variáveis pontuais de maior associação com a ETmf. A Rg e melhorou sua relação quando analisada em diferentes faixas de t am. Os resultados confirmaram o Rn e e o D como as variáveis meteorológicas de maior efeito preditivo da evapotranspiração das culturas em estufas plásticas no outono, porém com graus diferenciados de ajuste para o pimentão em relação às outras culturas.An experiment was carried out to study the relationship between sweet pepper maximum evapotranspiration (ETm per unit leaf area index (ETmf and incident solar radiation (Rg e and net radiation (Rn e outside greenhouse, and with air temperature (t am, air relative humidity (URm and water vapor pressure deficit (D inside a greenhouse. ETm was measured by lysimeters. Temperature and relative humidity were registered whereas Rg e and Rn e were estimated. The Rn e was the variable with laRg e st effect on ETmf determination, followed by D and URm. The air temperature at 15:00 and the daily maximum temperature were variables of laRg e r association with ETmf among the variables with punctual time observations. Rg e improved its relationship with ETmf when was analyzed with different t am ranges. The results confirmed Rn e and D as the meteorological variables of highest relationship with evapotranspiration in plastic greenhouse

  8. Protocolo para controle de eficácia terapêutica em disfagia orofaríngea neurogênica (PROCEDON) Efficacy control protocol in oropharyngeal dysphagia

    OpenAIRE

    Roberta Gonçalves da Silva; Adriana Gomes Jorge; Fernanda Matias Peres; Paula Cristina Cola; Ana Rita Gatto; André Augusto Spadotto

    2010-01-01

    OBJETIVO: apresentar uma proposta para o controle de eficácia terapêutica em disfagia orofaríngea neurogênica. MÉTODOS: o protocolo foi proposto em concordância com a literatura atual e aplicado em um indivíduo pós-acidente vascular encefálico (AVE) isquêmico à direita, comprovado por tomografia computadorizada, com disfagia orofaríngea grave crônica, gênero masculino, 66 anos, apresentando aspiração laringotraqueal e em uso de sonda nasoentérica exclusiva pré-fonoterapia. Para controle da ef...

  9. Dose profile in computed tomography chest scan; Perfil de dose em varredura de torax em tomografia computadorizada

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, Bruno B., E-mail: bbo@cdtn.b [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil). Pos-graduacao em Ciencias e Tecnologia das Radiacoes, Minerais e Materiais; Mourao, Arnaldo P. [Centro Federal de Educacao Tecnologica de Minas Gerais (CEFET/MG), Belo Horizonte, MG (Brazil); Alonso, Thessa C.; Silva, Teogenes A. da [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil)

    2010-07-01

    For the optimization of the patient dose in computed tomography (CT), the Brazilian legislation only established the diagnostic reference levels (DRL's) in terms of Multiple Scan Average Dose (MSAD) in a typical adult as a parameter of quality control of CT scanners. Conformity to the DRL's can be verified by measuring the dose distribution in CT scans and MSAD determination. An analysis of the quality of CT scans of the metropolitan region of Belo Horizonte is necessary by conducting pertinent tests to the study that are presented in the ANVISA (National Agency of Sanitary Vigilance) Guide. The purpose of this study is to investigate, in a chest scan, the variation of dose in CT. To measure the dose profile are used lithium fluoride thermoluminescent dosimeters (TLD-100 Rod) distributed in cylinders positioned in peripheral and central regions of a phantom of polymethylmethacrylate (PMMA). The data obtained allow us to observe the variation of the dose profile inside the phantom. The peripheral region shows higher dose values than the central region. The longitudinal variation can be observed and the maximum dose was recorded at the edges of the phantom (41,58{+-}5,10) mGy at the midpoint of the longitudinal axis. The results will contribute to disseminate the proper procedure and optimize the dosimetry and the tests of quality control in CT, as well as make a critical analysis of the DRL's. (author)

  10. Análise fluido-dinâmica do escoamento em ensaio de permeabilidade ao ar de argamassas preparadas com cimento Portland de alto-forno Fluid-dynamic analysis of the flow in air permeability measurement of mortars prepared with blast-slag furnace Portland cement

    Directory of Open Access Journals (Sweden)

    V. M. Pereira

    2008-06-01

    Full Text Available O estudo dos fenômenos fluido-dinâmicos de escoamento em meios porosos tem sido de grande interesse por diversas áreas das ciências, de forma a se avaliar não só a permeabilidade do material, mas também analisar o comportamento do fluido permeante quando no interior destes materiais. Tratando-se de compósitos à base de cimento, a mensuração da permeabilidade torna-se fundamental para que sua durabilidade possa ser estimada, pois é a permeabilidade que controla a taxa de ingresso e movimentação de agentes deletérios no interior destes materiais. Dessa forma, diversas metodologias e equacionamentos matemáticos têm sido utilizados para prever a permeabilidade de materiais à base de cimento. No entanto, várias discrepâncias e disparidades nos resultados têm sido encontradas. Dentre as metodologias empregadas para mensurar a permeabilidade de meios porosos, encontra-se a desenvolvida por Thenoz, a qual tem demonstrado bons resultados em materiais à base de cimento. Dessa forma, este trabalho visa, por meio de ensaio de permeabilidade ao ar, realizado de acordo com a metodologia de Thenoz, avaliar o comportamento fluido-dinâmico do ar durante o ensaio de permeabilidade em argamassas. Para isto, foram utilizadas argamassas preparadas com dois tipos de cimento Portland (CP II E - 32 e CP III - 32, duas relações água/cimento (0,5 e 0,6 e ensaiadas em idades de 14 e 28 dias. Por meio dos resultados obtidos foi possível observar que durante o escoamento a compressibilidade do ar pode ser ignorada e o regime de escoamento pode ser considerado como laminar, demonstrando que a metodologia proposta por Thenoz e o equacionamento matemático empregado pode resultar em coeficientes de permeabilidade ao ar confiáveis, pois fenômenos e considerações que poderiam influenciar neste tipo de escoamento podem ser negligenciados.Fluid-dynamic phenomena study in porous media flow has been of great interest for diverse areas of sciences

  11. PREVALÊNCIA DE DOENÇAS INFECCIOSAS EM REBANHO DE SUÍNOS CRIADOS AO AR LIVRE NA REGIÃO SUDOESTE DO PARANÁ, BRASIL PREVALENCE OF INFECTIOUS DISEASES IN A PIG BREEDING HERD RAISED OUTDOORS IN THE SOUTH-WESTERN REGION OF PARANÁ, BRAZIL

    Directory of Open Access Journals (Sweden)

    Laerte Francisco Filippsen

    2001-04-01

    Full Text Available O presente trabalho objetivou determinar a prevalência de doenças infecciosas em rebanho de suínos criados ao ar livre na região sudoeste do Paraná, no período de outubro de 1996 a junho de 1999. Foram examinados um total de 969 animais. Todas as ocorrências de enfermidades observadas nos animais foram registradas. Os animais mortos no período, além de um leitão por lote, sacrificado aos 28 dias pós-desmame, foram necropsiados. Amostras de sangue foram coletadas para realização de exames sorológicos para Aujeszky, parvovirose, leptospirose e brucelose. Foram coletadas amostras de fezes dos leitões com diarréia para realização de exames bacteriológicos. A principal causa de mortalidade em leitões lactentes criados ao ar livre foi o esmagamento. A prevalência de doenças infecciosas não foi elevada. A ocorrência mais freqüente foi diarréia em leitões lactentes. O índice de pneumonia no rebanho de suínos criados ao ar livre foi baixo. Não houve ocorrência de doenças infecciosas da reprodução.The aim of this work was to determine the prevalence of infectious diseases in an outdoor pig herd in the South-western region of Paraná, Brazil, from October 1996 to June 1999. A total of 969 animals were examined. All infections observed were registered. All animals found dead within the period of study and one piglet of each litter sacrified on the 28th post weaning day were autopsied. Blood samples were collected for Aujeszky, parvovirus, leptospirosis and brucellosis serological tests. Faecal samples from piglets with diarrhoea were taken for bacteriological tests. Crushing was the main cause of outdoor suckling piglets mortality. The prevalence of infectious diseases was not high. The most frequent occurrence in suckling piglets was diarrhoea. The pneumonia index in the herd raised outdoors was low. There was no occurrence of reproductive infectious diseases.

  12. Gliossarcoma de tronco cerebral em paciente pediátrico: relato de caso

    Directory of Open Access Journals (Sweden)

    Moreira Roger Klein

    2004-01-01

    Full Text Available Os autores relatam o caso de um paciente branco, de quatro anos de idade, com comprometimento neurológico progressivo. Tomografia computadorizada do crânio e ressonância magnética evidenciaram lesão expansiva no tronco cerebral. Subseqüentemente, foi feito diagnóstico histopatológico de gliossarcoma. Trata-se de um tumor raro do sistema nervoso central que, na grande maioria dos casos, acomete pacientes acima dos 40 anos de idade e tem localização supratentorial. Há poucos casos relatados de gliossarcomas em crianças, sobretudo na região infratentorial. Dados epidemiológicos, assim como achados mais freqüentes na tomografia computadorizada e ressonância magnética, são discutidos.

  13. Tomografia computadorizada do cranio no diagnostico dos meningiomas: registro de 16 casos

    Directory of Open Access Journals (Sweden)

    James Pitagoras de Mattos

    1983-03-01

    Full Text Available Os autores se referem à importância do emprego da tomografia computadorizada do crânio para o preciso diagnóstico dos meningiomas. Constam da experiência 16 casos, comprovados cirúrgica e histologicamente. A média de idade foi de 52,1 anos, sendo 10 pacientes do sexo feminino e 6 do masculino. Quanto à localização, 5 eram da cavidade orbitrária e/ou asa do esfenóide, 3 parasagitais, 3 da foice, 2 supra-selares, 2 de convexidade e 1 do tentório. Concluem tratar-se de exame de grande positividade (95-98%, praticamente inócuo e que permite, na atualidade, o diagnóstico precoce conduzindo, consequentemente, a melhores resultados terapêuticos.

  14. Histiocitoma fibroso benigno profundo: achados na tomografia computadorizada e histologia Deep benign fibrous histiocytoma: computed tomography and histology findings

    Directory of Open Access Journals (Sweden)

    Luciano Farage

    2005-04-01

    Full Text Available Apresentamos imagens de tomografia computadorizada de um paciente de 83 anos de idade com histiocitoma fibroso benigno profundo, na face lateral da perna esquerda, com evolução de longa data. À tomografia computadorizada observamos massa bem delimitada, ovalada, e que apresentava intenso realce periférico com uso do meio de contraste iodado. Este é um tumor de partes moles pouco freqüente e com raros relatos dos seus aspectos de imagem.We present the computed tomography images of an 83-year-old male patient with a deep benign fibrous histiocytoma at the lateral aspect of the left leg. Computed tomography images showed a well-defined mass with marked peripheral enhancement by iodinated contrast medium. Only few reports of this rare soft tissue tumor can be found in the literature.

  15. Comportamento do arsênio em perfis de solos do Sítio Ilha de Terra de Caxiuanã-Pará Arsenic behavior in soil profiles on the Sítio Ilha de Terra from Caxiuanã-Pará

    OpenAIRE

    Vanda Porpino Lemos; Marcondes Lima da Costa; Robson da Silva Gurjão; Dirse Clara Kern; Cleide Samara Tavares Mescouto; Wivian Thais dos Santos Lima; Taynara Lima Valentim

    2009-01-01

    Concentrações de arsênio em perfis de solos com terra preta arqueológica (TPA) e solos de área adjacente (AD) do Sítio Ilha de Terra, Caxiuanã, no Estado do Pará, região Amazônica, podem dar informações sobre as atividades antropogênicas dos habitantes dessa região. Análises químicas e mineralógicas foram realizadas nas amostras desses perfis. Os dados obtidos mostram que as concentrações do Fe e As aumentam com a profundidade dos perfis de solos, enquanto que as concentrações de matéria orgâ...

  16. OCORRÊNCIA E DURAÇÃO DAS TEMPERATURAS MÍNIMAS DIÁRIAS DO AR PREJUDICIAIS À FECUNDAÇÃO DAS FLORES DO ARROZ EM SANTA MARIA, RS: .II - ESTIMATIVA DO NÚMERO DIÁRIO DE HORAS COM TEMPERATURAS BAIXAS

    Directory of Open Access Journals (Sweden)

    Valduino Estefanel

    1991-12-01

    Full Text Available O presente trabalho objetivou testar os modelos analíticos utilizados por ANGELOCCI et al (1979, HELDWEIN (1983 e os propostos com ajustes para o verão de Santa Maria (Santa Maria, I, II e III para estimar o número diário de horas com temperatura do ar ≤ 10, 11, 12, 13, 14, 15, 16 e 17,0°C, para os meses de dezembro, Janeiro, fevereiro e março para Santa Maria, RS. A comparação entre os valores obtidos diretamente dos termogramas e os estimados por cinco modelos analíticos (ANGELOCCI et al, 1979; HELDWEIN,1983; Santa Maria I, II e III foi feita em função dos valores médios diários de horas dos dias com temperaturas baixas, coeficientes de determinação, linear e angular da equação de 1° grau entre os valores reais e os estimados. Verifica-se que é possível estimar, com precisão satisfatória, o número diário de horas com temperatura do ar ≤ 17, 16, 15, 14, 13 e 12,0°C, utilizando os modelos analíticos de ANGELOCCI et al (1979 e o Santa Maria III.

  17. Modelagem de um condicionador de ar de alta precisão para uso em processamento agrícola Modeling of a high precision air conditioner for use in agricultural processing

    Directory of Open Access Journals (Sweden)

    Mauri Fortes

    2006-08-01

    Full Text Available Apresenta-se neste trabalho, estudo detalhado sobre a modelagem de um condicionador de ar com controle acurado de temperatura e umidade relativa. Desenvolveu-se um programa de computador que permite predizer o comportamento do sistema sob diferentes condições psicrométricas e de vazão do ar de entrada. O modelo global físico-matemático inclui equações de balanço de massa e de energia para três diferentes volumes de controle que compõem o condicionador. Modelaram-se os processos de mistura, evaporação (ou condensação simultânea de uma superfície d'água e de uma gota e o aquecimento de corrente de ar, separadamente. Propõem-se expressões semi-empíricas simples para os coeficientes de transferência de calor e massa inerentes ao processo de evaporação sobre uma superfície d'água e um modelo simplificado para o sistema de spray. Construiu-se um condicionador de ar no qual foram feitos testes experimentais para o ajuste das constantes que aparecem nas expressões para os coeficientes de transferência. Os dados obtidos validaram o modelo global, com precisão aceitável para projetos de engenharia.In this work, a detailed procedure for the analysis of an accurately controlled air conditioner is presented. A computer program, that allows predicting the behavior of the system under different psychrometric conditions and different input air mass flow rates, was developed. The global physical-mathematical model includes mass and energy conservation equations for three different control volumes that compose the conditioner. Thus, the processes of mixture of air, simultaneous evaporation (or condensation from a water surface and from a drop, and the air-stream heating are modeled separately. Simple semi-empiric expressions for heat and mass coefficients inherent to the evaporation process on a water surface are proposed as well a simplified model for the spray system. Experimental tests made on an air-conditioner allowed to obtain

  18. Estudo do metabolismo da glicose na tuberculose pulmonar ativa utilizando a tomografia por emissão de pósitrons (18F-FDG PET Evaluation of glucose metabolism in active lung tuberculosis by positron-emission tomography (18F-FDG PET

    Directory of Open Access Journals (Sweden)

    SIDNEY BOMBARDA

    2002-09-01

    Full Text Available Os métodos de imagem utilizados na avaliação da tuberculose pulmonar incluem a radiografia e a tomografia computadorizada do tórax. As imagens obtidas pelos métodos de medicina nuclear permitem estudos funcionais e metabólicos dos órgãos de interesse, através do uso de radiofármacos específicos. Alterações do metabolismo da glicose podem ser detectadas pela tomografia por emissão de pósitrons (PET utilizando-se o 18F-fluorodesoxiglicose (18F-FDG. Essas alterações estão presentes nas doenças neoplásicas, inflamatórias e infecciosas. A tuberculose é uma doença granulomatosa causada pelo Mycobacterium tuberculosis, que se utiliza de glicose como fonte de energia. Objetivo: O estudo do metabolismo da glicose na tuberculose pulmonar através da PET e sua comparação com a tomografia computadorizada de tórax. Material e métodos: Foram avaliados 20 pacientes portadores de tuberculose pulmonar. Todos foram submetidos à PET e à tomografia computadorizada de tórax, em até 30 dias após o início do tratamento. Resultados: Todos os pacientes apresentaram captação positiva do 18F-FDG na PET. Na tomografia computadorizada do tórax, todos os pacientes apresentaram sinais compatíveis com atividade de tuberculose. A sensibilidade dos dois métodos foi de 100%. Houve concordância entre os achados do 18F-FDG PET e da tomografia computadorizada (K = 0,27 e p Current methods to evaluate lung tuberculosis include chest radiography and computed tomography. Nuclear medicine imaging techniques are performed after administration of specific radiopharmaceuticals that accumulate in the organs of interest. Alterations of glucose metabolism can be observed by positron-emission tomography, using 18F-fluorodeoxyglucose (18F-FDG PET. These findings are present in the neoplasms, but also in inflammatory and infectious diseases. Tuberculosis is a granulomatous disease caused by Mycobacterium tuberculosis , that uses glucose as an energy source

  19. Nutrição do cafeeiro arábica em função da densidade de plantas e da fertilização com NPK Coffee nutrition as a function of plant density and NPK fertilization

    Directory of Open Access Journals (Sweden)

    Luiz Carlos Prezotti

    2004-01-01

    Full Text Available Embora aumente a produtividade por área, o adensamento reduz a produção por planta, eleva sua eficiência de recuperação de nutrientes, o que contribui para a redução da quantidade de fertilizantes a ser aplicada por planta. O objetivo deste trabalho foi avaliar a resposta do cafeeiro arábica à aplicação de N (100, 300, 500 e 700 kg.ha-1 de N, P (0, 60, 120 e 180 kg.ha-1 de P2O5 e K (100, 300, 500 e 700 kg.ha-1 de K2O, cultivados em diferentes densidades de plantio (3.333, 5.000, 10.000 e 20.000 plantas por hectare. Com base em informações obtidas em cinco produções, não foram observadas diferenças significativas de produtividade em função da densidade de plantas. A resposta em produtividade do café arábica às doses de N, P e K foi variável nos diversos espaçamentos, com maior freqüência de resultados positivos a N e P e menos expressivos para K. Os teores foliares de N e P foram pouco influenciados pelas doses de N e P2O5. Os teores foliares de K foram fortemente influenciados pelas doses de K2O. Cafeeiros submetidos ao sistema de cultivo adensado apresentaram maiores teores foliares de P e K, quando comparados àqueles cultivados em espaçamento mais largo. Os solos sob cultivo adensado, quando comparados a solos sob cultivos mais largos, apresentaram variações em suas características químicas, sendo mais evidente a redução do teor de H + Al.Although increasing in productivity, high-density tree planting provides reduction of the production per plant, increases the efficiency of recovery of nutrients by plants, and can contributes to the reduction of the amount of fertilizers to be applied per plant. Due to evaluate the answer of coffee tree plants (Coffea arabica L. to N (100, 300, 500 e 700 kg.ha-1 of N; P (0, 60, 120 and 180 kg.ha-1 of P2O5 and K (100, 300, 500 and 700 kg.ha-1 of K2O application, on work was carried out in a coffee cultivated at four densities (3,333; 5,000; 10,000 and 20,000 plants

  20. Geological Dating by 40 Ar - 39 Ar method

    International Nuclear Information System (INIS)

    The isotope 40 K is radioactive, it decays to 40 Ar stable. The number of 40 Ar atoms produced from 40 K, permits to calculate the date of rocks and minerals. This dating technique is named 'Conventional K-Ar Dating Method'. The 40 Ar - 39 Ar dating method permits to calculate the age of rocks and minerals eliminating the limitation of the K-Ar method by calculating potassium and argon concentrations in a single measurement of the ratio of argon isotopes. In this work, the irradiation of the sample with fast neutrons in the nuclear reactor was established. 39 Ar is obtained from the induced reaction 39 K (n,p) 39 Ar. Thus the ration of 40 Ar -39 Ar allows to obtain the date of rocks and minerals. This ratio was measured in a mass spectrometer. If the measurement of argon concentration in the sample is carried out at different increasing temperature values, it is possible to get information of paleotemperatures. The number of atoms 39 Ar is a function of the number 39 K atoms, irradiation time, neutrons flux, its energy E and the capture cross section σ of 39 K. These parameters are calculate indirectly by obtaining the so called 'J value ' by using a standard mineral with known age (HD-BI y Biot-133), this mineral is irradiated together with the unknown age sample. The values of 'J' obtained are in the interval of 2.85 a 3.03 (x 10-3)J/h. Rocks from 'Tres Virgenes' were dated by the method described in this work, showing an agreement with previous values of different authors. The age of this rocks are from Cenozoico era, mainly in the miocene period. (Author)

  1. Tomografia por emissão de pósitrons com 18F fluordesoxiglicose como exame não invasivo para o diagnóstico de sarcomas primários de artéria pulmonar 18F-fluorodeoxyglucose positron emission tomography as a noninvasive method for the diagnosis of primary pulmonary artery sarcoma

    Directory of Open Access Journals (Sweden)

    Olívia Meira Dias

    2011-12-01

    Full Text Available Os sarcomas de artéria pulmonar são tumores raros e de difícil diagnóstico, simulando frequentemente o tromboembolismo pulmonar crônico. Relatamos dois casos de pacientes do sexo feminino com quadro clínico de dispneia e massas pulmonares associadas a falhas de enchimento na artéria pulmonar em angiotomografia de tórax. A tomografia por emissão de pósitrons com 18F fluordesoxiglicose mostrou hipercaptação das respectivas lesões. O sarcoma de artéria pulmonar foi confirmado posteriormente por exame anatomopatológico. Ressaltamos a importância do uso desse tipo de tomografia como exame não invasivo no auxílio diagnóstico desses tumoresPulmonary artery sarcomas are rare, difficult-to-diagnose tumors that frequently mimic chronic pulmonary thromboembolism. We report the cases of two female patients with clinical signs of dyspnea and lung masses associated with pulmonary artery filling defects on chest CT angiography. We performed 18F-fluorodeoxyglucose positron emission tomography, which revealed increased radiotracer uptake in those lesions. Pulmonary artery sarcoma was subsequently confirmed by anatomopathological examination. We emphasize the importance of this type of tomography as a noninvasive method for the diagnosis of these tumors

  2. Behavior of Eucalyptus grandis and E. cloeziana seedlings grown in arsenic-contaminated soil Comportamento de mudas de E. grandis E. eucalyptus cloeziana cultivadas em solo contaminado por arsênio

    Directory of Open Access Journals (Sweden)

    Roseli Freire Melo

    2010-06-01

    Full Text Available Arsenic has been considered the most poisonous inorganic soil pollutant to living creatures. For this reason, the interest in phytoremediation species has been increasing in the last years. Particularly for the State of Minas Gerais, where areas of former mining activities are prone to the occurrence of acid drainage, the demand is great for suitable species to be used in the revegetation and "cleaning" of As-polluted areas. This study was carried out to evaluate the potential of seedlings of Eucalyptus grandis (Hill Maiden and E. cloeziana F. Muell, for phytoremediation of As-polluted soils. Soil samples were incubated for a period of 15 days with different As (Na2HAsO4 doses (0, 50, 100, 200, and 400 mg dm-3. After 30 days of exposure the basal leaves of E. cloeziana plants exhibited purple spots with interveinal chlorosis, followed by necrosis and death of the apical bud at the 400 mg dm-3 dose. Increasing As doses in the soil reduced root and shoot dry matter, plant height and diameter in both species, although the reduction was more pronounced in E. cloeziana plants. In both species, As concentrations were highest in the root system; the highest root concentration was found in E. cloeziana plants (305.7 mg kg-1 resulting from a dose of 400 mg dm-3. The highest As accumulation was observed in E. grandis plants, which was confirmed as a species with potential for As phytoextraction, tending to accumulate As in the root system and stem.O arsênio (As tem sido considerado o poluente inorgânico de solo mais tóxico para os seres vivos, razão pela qual o interesse por espécies indicadoras e fitorremediadoras tem aumentado nos últimos anos. Particularmente para o Estado de Minas Gerais, que apresenta áreas remanescentes de atividade mineradora sujeitas à ocorrência de drenagem ácida, existe grande demanda por espécies com potencial para serem utilizadas na revegetação e "limpeza" de substratos contaminados por esse metaloide. Este

  3. 40Ar/39Ar age calibration against counted annuallayers

    DEFF Research Database (Denmark)

    Storey, Michael; Stecher, Ole

    2008-01-01

    The 40Ar/39Ar method, based on the decay of the naturally occurring radioactive isotope 40K, is capable of producing ages with precision better than ± 0.1 %. However, accuracy is limited to no better than 1 % mainly due to the relatively large uncertainty in the 40K decay constants. One approach...

  4. Efeito dos incêndios florestais na qualidade do ar

    OpenAIRE

    Miranda, Ana Isabel

    1998-01-01

    Os incêndios florestais podem ser considerados como um processo de combustão natural em grande escala, que consome diversas espécies vegetais numa área geográfica específica Consequentemente, consistem numa fonte potencial de elevadas quantidades de poluentes para a atmosfera, sendo indispensável conhecer o seu impacto na qualidade do ar. O objectivo principal deste trabalho consiste no estudo do efeito das emissões dos incêndios florestais na qualidade do ar. Para tal, foram d...

  5. Flutuação populacional do bicho-mineiro em cultivares de café arábica resistentes à ferrugem Fluctuation of leaf miner population in resistant arabica coffee cultivars to leaf rust

    Directory of Open Access Journals (Sweden)

    Celso Henrique Costa Conceição

    2005-01-01

    Full Text Available A intensidade de infestação pelo bicho-mineiro, Leucoptera coffeella (Guérin-Méneville (Lepidoptera: Lyonetiidae foi investigada nas cultivares Obatã IAC 1669-20 e Tupi IAC 1669-33, com resistência à ferrugem das folhas do cafeeiro, Hemileia vastatrix Berk. et Br., e Ouro Verde Amarelo IAC 4397, suscetível à doença, em ensaios de campo, localizados em Campinas (SP, Brasil. A incidência de ferrugem e a ocorrência de inimigos naturais da praga, assim como o enfolhamento das plantas, foram também observados nas três cultivares. As curvas de flutuação populacional obtidas para Obatã IAC 1669-20 e Tupi IAC 1669-33 revelaram maior incidência do bicho-mineiro entre abril e novembro. Já na cultivar Ouro Verde Amarelo IAC 4397, observaram-se dois picos de infestação, sendo o primeiro em abril-maio e o segundo em agosto-setembro. No entanto, a elevada percentagem de folhas minadas nas cultivares Tupi IAC 1669-33 e Obatã IAC 1669-20 em relação à Ouro Verde Amarelo IAC 4397 não é evidência de maior suscetibilidade à praga, mas sim devido à maior retenção foliar dessas cultivares, em conseqüência da resistência à ferrugem das folhas observada em ambas. De maneira oposta, na cultivar Ouro Verde Amarelo IAC 4397, os sintomas de ataque do bicho-mineiro ocorreram em menor nível especialmente devido a maior queda de folhas. Com base nas diferenças observadas entre as cultivares, sugere-se a adoção de estratégias distintas de manejo da praga.The intensity of infestation of leaf-miner, Leucoptera coffeella (Guérin-Méneville was investigated in coffee cultivars Obatã IAC 1669-20 and Tupi IAC 1669-33, both resistant to the leaf rust agent, Hemileia vastatrix Berk. et Br., and Ouro Verde Amarelo IAC 4397, susceptible to this coffee disease, at field assays in Campinas, SP, Brazil. The incidence of coffee rust and presence of natural enemies, as well as the plant leafiness, were also observed. In Obatã IAC 1669-20 and Tupi

  6. Dessecação da aveia-preta (Avena strigosa Schreb com herbicida de contato, em presença ou não de assistência de ar junto à barra do pulverizador, em diferentes volumes de calda Black-oats (Avena strigosa Schreb control with contact burndown herbicide applied at different carrier volumes, with and without air assistance at sleeve boom sprayer

    Directory of Open Access Journals (Sweden)

    Luiz C. Garcia

    2004-12-01

    Full Text Available A tecnologia de aplicação dos produtos fitossanitários na agricultura pode ser aprimorada mediante a redução dos desperdícios. Com o objetivo de contribuir com tal avanço tecnológico, avaliou-se a eficácia de um herbicida com ação de contato, aplicado em pós-emergência com pulverizadores sem e com assistência de ar junto à barra, em diferentes volumes de calda. O experimento foi instalado no município de Ponta Grossa - PR, com a dessecação de aveia-preta (Avena strigosa Schreb implantada em sistema de plantio direto sob a palha. Empregou-se a mistura herbicida formulada (SC de dicloreto de paraquate (400 g ha-1 + diuron (200 g ha-1. O delineamento experimental utilizado foi o de blocos casualizados (DBC, em esquema fatorial 2 (pulverizador sem e com assistência de ar x 5 (volumes de calda: 0; 100; 200; 300 e 400 L ha-1, com quatro repetições. A avaliação do efeito da dessecação se deu por meio da escala proposta pela Asociación Latinoamericana de Malezas (ALAM. A interação entre os fatores foi significativa, obtendo-se suficiência na dessecação a partir de 200 e 100 L ha-1, sem e com assistência de ar na barra, respectivamente.Agricultural pesticide application technology is largely improved by reduction of waste and losses. With such objective, an experiment was conducted in order to evaluate the efficacy of a post-emergence contact herbicide applied with and without air-assisted sleeve boom in different spray volumes. The experiment was carried out in Ponta Grossa county, in a no-till black oats cover crop (Avena strigosa Schreb. The formulated mixture (SC of paraquat and diuron at 400 + 200 g a.i ha-1 was applied with a sleeve boom sprayer, with and without air-assistance and five spray volumes: 0; 100; 200; 300 and 400 L ha-1. Treatments were placed in a 2 x 5 factorial arrangement in a randomized complete block design with four replications. Herbicide efficacy was evaluated by the ALAM rating system. Efficacy

  7. Determinação espectrofotométrica do arsênio em solo da cidade de Santana-AP usando o método do dietilditiocarbamato de prata (SDDC modificado Arsenic spectrophotometric determination in soil of the Santana-AP city using the silver diethyldithiocarbamate (SDDC modified method

    Directory of Open Access Journals (Sweden)

    Simone de Fátima Pinheiro Pereira

    2009-01-01

    Full Text Available Várias toneladas de rejeito de manganês contendo arsênio, gerado por uma empresa de mineração, foram utilizadas como aterro de ruas da cidade de Santana-AP. A possibilidade de exposição das pessoas residentes nessas localidades levou ao estudo de quantificação de arsênio total nos solos. Após a digestão, os teores de arsênio foram quantificados por espectrofotometria de absorção molecular usando um sistema automático de geração de hidretos (HG-MAS, diciclohexilamina/CHCl3 como solvente do dietilditiocarbamato de prata (SDDC e KBH4 como redutor. O método apresentou bons resultados com sensibilidade (ε de 1,10 10(4 L.mol-1.cm-1, estabilidade de 2,96% e outras vantagens em relação ao método oficial. O método foi aplicado em amostras de referência de solo com recuperação de 98,82 % (N=10. As análises de solos mostraram que do total de amostras analisadas 94,74 % apresentaram concentração de arsênio acima do valor editado pela CETESB para solo residencial (50 mg.kg-1 com valor médio de 682,96 mg.kg-1, variando de 48,08 mg.kg-1 a 1.713,00 mg.kg-1 que comprova a contaminação do solo pelo arsênio.Several tons of manganese residues containing arsenic, generated by a mining company, were used as streets landfill in Santana-Ap city. The possibility of exposure of people living in these villages has led to the study of quantification of total arsenic in the soil. After digestion, the levels of arsenic were quantified by molecular absorption spectrophotometry using a hydrides generation automatic system (HG-MAS, dicyclohexilamine/CHCl3 as silver diethyldithiocarbamate (SDDC solvent and KBH4 as reducer. The method presented good results with sensitivity (ε of 1.10 10(4 l.mol-1.cm-1, stability of 2.96 % and other advantages in relation to the official method. The method was applied to the soil standard samples with recoveries of the 98.82 % (n=10. The soil analysis showed that 94.74 % samples showed arsenic concentrations

  8. Trauma dos ossos temporais e suas complicações: aspectos na tomografia computadorizada Temporal bone trauma and complications: computed tomography findings

    Directory of Open Access Journals (Sweden)

    Ana Maria Doffémond Costa

    2013-04-01

    Full Text Available A maioria das fraturas dos ossos temporais resulta de traumas cranianos bruscos, de alta energia, estando muitas vezes relacionadas a outras fraturas cranianas ou a politraumatismo. As fraturas e os deslocamentos da cadeia ossicular, na orelha média, representam umas das principais complicações das injúrias nos ossos temporais e, por isso, serão abordadas de maneira mais profunda neste artigo. Os outros tipos de injúrias englobam as fraturas labirínticas, fístula dural, paralisia facial e extensão da linha de fratura ao canal carotídeo. A tomografia computadorizada tem papel fundamental na avaliação inicial dos pacientes politraumatizados, pois é capaz de identificar injúrias em importantes estruturas que podem causar graves complicações, como perda auditiva de condução ou neurossensorial, tonturas e disfunções do equilíbrio, fístulas perilinfáticas, paralisia do nervo facial, lesões vasculares, entre outras.Most temporal bone fractures result from high-energy blunt head trauma, and are frequently related to other skull fractures or to polytrauma. Fractures and displacements of ossicular chain in the middle ear represent some of the main complications of temporal bone injury, and hence they will be more deeply approached in the present article. Other types of injuries include labyrinthine fractures, dural fistula, facial nerve paralysis and extension into the carotid canal. Computed tomography plays a fundamental role in the initial evaluation of polytrauma patients, as it can help to identify important structural injuries that may lead to severe complications such as sensorineural hearing loss, conductive hearing loss, dizziness and balance dysfunction, perilymphatic fistulas, facial nerve paralysis, vascular injury and others.

  9. Regional Suppression of <em>Bactrocera> Fruit Flies (Diptera: Tephritidae in the Pacific through Biological Control and Prospects for Future Introductions into Other Areas of the World

    Directory of Open Access Journals (Sweden)

    Roger I. Vargas

    2012-08-01

    Full Text Available <em>Bactrocera> fruit fly species are economically important throughout the Pacific. The USDA, ARS U.S. Pacific Basin Agricultural Research Center has been a world leader in promoting biological control of <em>Bactrocera> spp. that includes classical, augmentative, conservation and IPM approaches. In Hawaii, establishment of <em>Bactrocera> <em>cucurbitae> (Coquillett in 1895 resulted in the introduction of the most successful parasitoid, <em>Psyttalia> <em>fletcheri> (Silvestri; similarly, establishment of <em>Bactrocera> <em>dorsalis> (Hendel in 1945 resulted in the introduction of 32 natural enemies of which <em>Fopius> <em>arisanus> (Sonan, <em>Diachasmimorpha> <em>longicaudata> (Ashmead and <em>Fopius> <em>vandenboschi> (Fullaway were most successful. Hawaii has also been a source of parasitoids for fruit fly control throughout the Pacific region including Australia, Pacific Island Nations, Central and South America, not only for <em>Bactrocera> spp. but also for <em>Ceratitis> and <em>Anastrepha> spp. Most recently, in 2002, <em>F.> <em>arisanus> was introduced into French Polynesia where <em>B.> <em>dorsalis> had invaded in 1996. Establishment of <em>D.> <em>longicaudata> into the new world has been important to augmentative biological control releases against <em>Anastrepha> spp. With the rapid expansion of airline travel and global trade there has been an alarming spread of <em>Bactrocera> spp. into new areas of the world (<em>i.e.>, South America and Africa. Results of studies in Hawaii and French Polynesia, support parasitoid introductions into South America and Africa, where <em>B.> <em>carambolae> and <em>B.> <em>invadens>, respectively, have become established. In addition, <em>P.> <em>fletcheri> is a candidate for biological control of <em>B.> <em>cucurbitae> in Africa. We review past and more

  10. Análise de dentição mista: tomografia versus predição e medida radiográfica Mixed-dentition analysis: tomography versus radiographic prediction and measurement

    Directory of Open Access Journals (Sweden)

    Letícia Guilherme Felício

    2010-10-01

    Full Text Available OBJETIVO: o objetivo dos autores desse estudo foi comparar o método de análise de dentição mista que utiliza tomografia computadorizada de feixe cônico para avaliar os diâmetros dos dentes intraósseos com os métodos de Moyers, Tanaka-Johnston e radiografias oblíquas em 45º. MÉTODOS: foram realizadas medidas, na arcada inferior, dos diâmetros mesiodistais dos incisivos permanentes irrompidos, nos modelos de gesso com auxílio de paquímetro digital e estimativa do tamanho de pré-molares e caninos permanentes ainda não irrompidos utilizando-se a tabela de Moyers e a fórmula de predição de Tanaka-Johnston. Nas radiografias oblíquas em 45º, caninos e pré-molares foram medidos utilizando-se o mesmo instrumento. Nas tomografias, as mesmas unidades dentárias foram aferidas por meio de ferramentas do programa Dolphin. RESULTADOS: a análise estatística revelou elevada concordância entre o método tomográfico e o radiográfico, e baixa concordância entre o tomográfico e os demais avaliados. CONCLUSÃO: a tomografia computadorizada de feixe cônico mostrou-se confiável para análise da dentição mista e apresenta algumas vantagens em relação aos métodos comparados: a observação e mensuração dos dentes intraósseos individualmente, com a possibilidade, contudo, de visualizá-los sob diferentes perspectivas e sem superposição de estruturas anatômicas.OBJECTIVE: The aim of this study was to evaluate the method for mixed-dentition analysis using Cone-Beam Computed Tomography for assessing the diameter of intra-osseous teeth and compare the results with those obtained by Moyers, Tanaka-Johnston, and 45-degree oblique radiographs. METHODS: Measurements of mesial-distal diameters of erupted lower permanent incisors were made on plaster cast models by using a digital calliper, whereas assessment of the size of non-erupted permanent pre-molars and canines was performed by using Moyer's table and Tanaka-Johnston's prediction

  11. Análise de carcinomas epidermóides por meio de radiografia panorâmica e tomografia computadorizada Analysis of squamous cell carcinomas by means of panoramic radiography and computed tomography

    Directory of Open Access Journals (Sweden)

    Amanda Cáceres PEREIRA

    2001-12-01

    Full Text Available Este trabalho teve como objetivo correlacionar aspectos radiográficos como, localização e extensão do tumor, infiltração óssea e de tecidos moles e destruição das corticais, obtidos nas radiografias panorâmicas com os encontrados nas tomografias computadorizadas (TCs. Os aspectos radiográficos de 48 pacientes com diagnóstico histopatológico de carcinomas epidermóides, localizados em várias regiões do complexo buco-maxilo-facial, foram analisados por 4 radiologistas. As radiografias panorâmicas e as tomografias computadorizadas foram realizadas nos hospitais e clínicas da Universidade de Iowa (EUA, FUNDECTO - USP e Hospital Universitário da Universidade de São Paulo (SP, Brasil. Como resultados, obtivemos a grande limitação da radiografia panorâmica em determinar a localização e extensão do tumor, com delimitações bastante imprecisas da lesão. Já as TCs ofereceram resultados mais direcionados como: invasão do tumor em direção a estruturas moles adjacentes, extensão da destruição óssea, bem como a profundidade da lesão, que foram confirmados com os achados cirúrgicos. Concluímos que a tomografia computadorizada demonstrou ser uma técnica bastante sensível na detecção do comprometimento ósseo e do envolvimento de tecidos moles, proporcionando, assim, o auxílio no diagnóstico e no planejamento do tratamento. No entanto, a radiografia panorâmica foi muito pouco sensível e eficaz, por mostrar apenas margens imprecisas e pouco nítidas da lesão, não avaliando o envolvimento de tecidos moles.The purpose of this work was to compare radiographic findings, such as localization and extension of tumors toward the bone and soft tissues, in panoramic radiography and computed tomography (CT. Four radiologists assessed the radiographic findings of 48 patients with the histopathological diagnosis of squamous cell carcinoma in different sites of the maxillofacial region. Panoramic radiographs and computed

  12. Teor e capacidade máxima de adsorção de arsênio em Latossolos brasileiros Content and maximum capacity of arsenic adsorption in Brazilian Oxisols

    Directory of Open Access Journals (Sweden)

    Mari Lucia Campos

    2007-12-01

    Full Text Available A alta toxicidade do As aos animais e humanos e a possibilidade de existência de grande número de áreas contaminadas tornam imprescindível o conhecimento do teor semitotal em solos ditos não-contaminados e dos processos de adsorção do As em solos de carga variável. O objetivo deste trabalho foi determinar o teor e a capacidade máxima de adsorção de As (CMADS AS em Latossolos. O teor total foi determinado pelo método USEPA 3051A, e a CMADS As, com auxílio de isotermas de Langmuir com base nos valores de adsorção obtidos em dose de As (0, 90, 190, 380, 760 e 1.150 µmol L-1 (relação solo:solução final = 1:100, a pH 5,5 e força iônica de 15 mmol L-1. Os 17 Latossolos apresentaram teor médio total de As de 5,92 mg kg-1 e CMADS As média de 2.013 mg kg-1. O teor de argila e os óxidos de Fe e Al apresentaram influência positiva na CMADS As.In view of the toxicity of As for man and animals and the possibility of existence of a great number of contaminated areas it is imperative to know the total As content in soils considered uncontaminated and about As sorption processes in soils of variable charge. The objective of this work was to determine the total content and maximum capacity of As adsorption (CMADS As in Oxisols. The total content was determined by the USEPA 3051A method. The cmADS As was determined by the Langmuir Isotherms using six solution concentrations (0, 0.09, 0.19, 0.38, 0.76, 1.15 mmol L-1 (1:100 soil: solution ratio, pH values 5.5 and ionic strength 15 mmol L-1. In the 17 Oxisols the average total As content was 5.92 mg kg-1 and mean cmADS As was 2.013 mg kg-1. Clay, and Fe and Al oxides content influenced cmADSs positively.

  13. Influência da temperatura do ar de secagem e da concentração de agente carreador sobre as propriedades físico-químicas do suco de açaí em pó Influence of drying air temperature and carrier agent concentration on the physicochemical properties of açai juice powder

    Directory of Open Access Journals (Sweden)

    Renata Valeriano Tonon

    2009-06-01

    Full Text Available A influência da temperatura do ar de secagem e da concentração de agente carreador sobre as propriedades físico-químicas do suco de açaí em pó produzido por spray drying foi avaliada. O processo foi realizado em um mini spray dryer de bancada e maltodextrina 10DE foi utilizada como agente carreador. A temperatura do ar de secagem variou de 138 a 202 °C e a concentração de maltodextrina variou de 10 a 30%. As características analisadas foram: umidade, higroscopicidade, retenção de antocianinas, cor, distribuição do tamanho de partículas e morfologia. O aumento da temperatura resultou em partículas maiores, menos úmidas, mais higroscópicas e com menor retenção de antocianinas, além de provocar uma diminuição do parâmetro de cor L* e do ângulo de tom H*. O aumento na concentração de maltodextrina resultou em partículas maiores e menos higroscópicas, com maior luminosidade (L*, menores valores de C* e maiores valores de H*. Em relação à morfologia, o aumento da temperatura levou à formação de uma maior quantidade de partículas com superfície lisa, fato atribuído à maior transferência de calor e, consequentemente, à formação mais rápida de uma membrana ao redor da gota atomizada.The objective of this work was to study the influence of inlet air temperature and maltodextrin concentration on the physicochemical properties of açai juice powder produced by spray drying. The process was carried out in a mini spray dryer and the maltodextrin 10DE was used as carrier agent. Inlet air temperature varied from 138 to 202 °C and maltodextrin concentration varied from 10 to 30%. The characteristics analyzed were: moisture content, hygroscopicity, anthocyanin retention, color, particle size distribution, and morphology. The increase in the temperature resulted in particles with larger size, less moisture content, more hygroscopy and with lower anthocyanin retention, besides promoting a reduction in the color

  14. 40Ar-39Ar geochronology and thermochronology: principles and potential

    International Nuclear Information System (INIS)

    Geochronology based on radiogenic isotopes has become an invaluable tool in earth sciences. Several radioactive parent-daughter systems of varying half-lives such as Rb-Sr, Sm-Nd, K-Ar have been traditionally used by researchers for determining the timing of geological and planetary processes. 40Ar-39Ar dating, a variant of the K-Ar system, is a well-established and versatile method of determining the eruptive ages of volcanic rocks and the ∼150-500 deg C thermal histories of a variety of more slowly cooled igneous and metamorphic rocks. This technique has been the most popular tool for dating felsic and intermediate volcanic rocks. Recently several new areas of research have been explored, including total-fusion dating of mineral grains from volcanic and sedimentary samples, mapping of argon isotopic gradients in crystals, and selective dating of fabric-defining minerals in poly deformed specimens

  15. Tomografia computadorizada sem contraste intravenoso no abdome agudo: quando e por que usar When and why use unenhanced computed tomography in patients with acute abdomen

    OpenAIRE

    Edison de Oliveira Freire Filho; Paulo Eduardo Marinho de Jesus; Giuseppe D'Ippolito; Jacob Szejnfeld

    2006-01-01

    A tomografia computadorizada sem contraste intravenoso tem sido freqüentemente proposta na avaliação inicial de pacientes com suspeita de abdome agudo, ocupando o espaço de outros métodos diagnósticos. Os autores apresentam uma revisão bibliográfica dos principais aspectos e eficácia da tomografia computadorizada sem contraste intravenoso no diagnóstico de apendicite aguda, cólica nefrética, diverticulite, pancreatite aguda, apendicite epiplóica, pneumoperitônio e obstrução intestinal. Discut...

  16. Evaluation of two semi-analytical techniques in air quality applications Avaliação de duas técnicas semi-analíticas em aplicações na qualidade do ar

    Directory of Open Access Journals (Sweden)

    Jonas C. Carvalho

    2007-04-01

    Full Text Available In this article an evaluation of two semi-analytical techniques is carried out, considering the quality and accuracy of these techniques in reproducing the ground-level concentration values of passive pollutant released from low and high sources. The first technique is an Eulerian model based on the solution of the advection-diffusion equation by the Laplace transform technique. The second is a Lagrangian model based on solution of the Langevin equation through the Picard Iterative Method. Turbulence parameters are calculated according to a parameterization capable of generating continuous values in all stability conditions and in all heights of the planetary boundary layer. Numerical simulations and comparisons show a good agreement between predicted and observed concentrations values. Comparisons between the two proposed techniques reveal that Lagrangian model generated more accurate results, but Eulerian model demands a lesser computational time.Neste artigo é realizada uma avaliação de duas técnicas semi-analíticas, considerando a qualidade e a exatidão destas técnicas em reproduzir valores de concentração ao nível da superfície de poluentes passivos emitidos a partir de fontes baixas e altas. A primeira técnica é um modelo Euleriano baseado na solução da equação advecção-difusão através da técnica de transformada de Laplace. A segunda é um modelo Lagrangiano baseado na solução da equação de Langevin através do Método Iterativo de Picard. Parâmetros da turbulência são calculados de acordo com uma parametrização capaz de gerar valores contínuos em todas as condições de estabilidade e em todas as alturas na camada limite planetária. Simulações numéricas e comparações mostram uma boa concordância entre valores de concentração previstos e observados. Comparações entre as duas técnicas revelam que o modelo Lagrangiano gera resultados mais precisos, mas o modelo Euleriano exige um menor tempo

  17. Influência da adição da goma arábica em filmes isolados de polímero acrílico: estudo das propriedades de intumescimento e de permeabilidade Influence of arabic gum in acrylic polymer isolated films: study of swelling properties and permeability

    Directory of Open Access Journals (Sweden)

    Victor Gustavo Santos Gabas

    2003-12-01

    Full Text Available Goma arábica associada ao polímero acrílico Eudragit RS30D® na formação de filmes isolados foram obtidos e investigados como material potencialmente adequado à liberação modificada de fármacos. Foram preparadas dispersões aquosas de 4% (p/v e o citrato de trietila (20% massa polímero acrílico foi usado como plastificante. Dispersões foram vertidas em placa de Nylon revestida com Teflon® e colocadas em estufa a 60 ºC. A determinação do índice de intumescimento (Ii% em fluidos de simulação gástrica (FSG e intestinal (FSI, além da permeabilidade ao vapor d'água (TVA foram avaliadas. As dispersões propostas apresentaram habilidades filmogênicas. O polissacarídeo favoreceu, proporcionalmente à sua concentração, o grau de hidratação e a permeabilidade ao vapor d'água dos filmes formados. Estas particularidades observadas sugerem que os filmes constituídos por estas associações garantem acessibilidade com maior intensidade, quando comparado ao polimetacrilato individualmente, condição essa indispensável para uma biodegradação efetiva, em especial às regiões distais do trato gastrintestinal.Arabic gum combined with polymeric acrylic Eudragit RS30D® in isolated films for film coating, were obtained and investigated as potential material adapted for drug delivery systems. They were prepared aqueous dispersions of 4% (p/v, the triethyl citrate (20% w/w of the methacrylate polymer it was used with plasticizer. Sample of dispersions were poured over plate of Nylon covered with Teflon and placed in an air circulated oven at 60 ºC. Determination of the swelling index (Is% in fluids of gastric (SGF or intestinal simulation or intestinal (SIF, and the permeability to the water vapour (TVA were investigated. An increase in the amount of added polysaccharide favored the degree of hydration/swelling and permeability of the formed films. These observed particularities suggest that the films constituted by these

  18. Estudo comparativo do diagnóstico de câncer pulmonar entre tomografia computadorizada e broncoscopia Comparative study between computed tomography and bronchoscopy in the diagnosis of lung cancer

    Directory of Open Access Journals (Sweden)

    Christopher Oliveira

    2010-08-01

    Full Text Available OBJETIVO: Analisar a tomografia computadorizada e a broncoscopia no diagnóstico do câncer pulmonar e verificar a eficácia destas técnicas perante a presença desta doença. Os parâmetros idade, gênero, hábitos tabágicos, tipos histológicos, estadiamento e terapêutica foram, igualmente, analisados. MATERIAIS E MÉTODOS: Foram analisados 70 pacientes do Serviço de Pneumologia do Hospital Distrital da Figueira da Foz, Coimbra, Portugal, que realizaram ambas as técnicas em estudo, tendo-se confirmado ou não a presença de câncer pulmonar. RESULTADOS: Diagnosticaram-se 37 tumores pulmonares, 23 casos no gênero masculino e 14 no feminino. Histologicamente, 40,54% eram adenocarcinomas, seguido do carcinoma escamoso (32,43% dos casos e do carcinoma de pequenas células (18,92%. O estadiamento mostrou 6,70% no estádio IB, 23,30% no estádio IIIA comparativamente ao IIIB com 36,70%, encontrando-se 33,30% dos doentes no estádio IV. A quimioterapia isolada foi efetuada em 75,7% dos doentes. A sensibilidade da broncoscopia foi de 83,8%, a especificidade, de 81,8%, e a precisão, de 82,8%. A sensibilidade da tomografia computadorizada foi de 81,1%, a especificidade, de 63,6%, e a precisão, de 72,8%. CONCLUSÃO: Os resultados da broncoscopia confirmaram a sua importância no diagnóstico do câncer pulmonar, pela dependência deste no exame anatomopatológico do tecido ou células, obtido por várias técnicas de biópsia. A tomografia computadorizada apresentou boa sensibilidade, de 81,1%, contudo, a sua especificidade, de apenas 63,6%, resulta do número de falso-positivos (36,4%.OBJECTIVE: To analyze the role of computed tomography and bronchoscopy in the diagnosis of lung cancer, evaluating the effectiveness of these techniques in the presence of this disease. Parameters such as age, gender, smoking habits, histological types, staging and treatment were also analyzed. MATERIALS AND METHODS: The sample of the present study included 70

  19. Análise por tomografia computadorizada do enxerto autógeno na cirurgia de "sinus lift" Computed tomography evaluation of autogenous graft in sinus lift surgery

    Directory of Open Access Journals (Sweden)

    Sérgio Aron Ajzen

    2005-02-01

    Full Text Available OBJETIVO: Quantificar a formação óssea nos enxertos com e sem plasma rico em plaquetas, obtido pelos métodos de centrifugação e aférese, comparando os três tipos de enxertos realizados por meio de análise tomográfica. MATERIAIS E MÉTODOS: Este estudo prospectivo, duplo cego, utilizou uma amostra composta de 34 pacientes adultos, de ambos os sexos, com idade média de 48 anos e 8 meses, portadores de pneumatização unilateral ou bilateral dos seios maxilares, que necessitavam de enxertos ósseos, com a finalidade de melhorar as condições locais para a colocação dos implantes dentários. Todos os pacientes realizaram tomografia computadorizada antes da cirurgia. Foram operados 53 seios maxilares, divididos em três grupos: enxerto de plasma rico em plaquetas obtido pelos métodos de aférese, centrifugação e enxerto apenas de osso autógeno. Após seis meses do procedimento cirúrgico foram realizados novos exames de imagem. RESULTADOS: Pela avaliação tomográfica, houve crescimento em altura e em largura nos três grupos quando foram comparados os momentos inicial e final, entretanto, não houve diferença estatística para a altura e para a largura. CONCLUSÃO: Evidências clínicas demonstram a eficácia dos enxertos autógenos, principalmente os associados a fatores indutores de crescimento ósseo, como o plasma rico em plaquetas, recuperando o arcabouço maxilofacial, necessário para a reconstrução protética e funcional por meio de implantes dentários.OBJECTIVE: To quantify bone formation within autogenous bone grafts and autogenous bone grafts in combination with platelet-rich plasma obtained either from aphaeresis or centrifugation using computed tomography. MATERIALS AND METHODS: This prospective, double-blind study was conducted in 34 male and female adult patients (mean age of 28 years and 8 months, with either unilateral or bilateral pneumatization of the maxillary sinuses, requiring bone graft for dental

  20. Definição do nível da junção ureterovesical pela tomografia computadorizada Definition of ureterovesical junction level by computed tomography

    Directory of Open Access Journals (Sweden)

    Edison de Oliveira Freire Filho

    2006-12-01

    Full Text Available OBJETIVO: Definir o nível da implantação ureteral na bexiga através da tomografia computadorizada. MATERIAIS E MÉTODOS: Através de tomografia computadorizada da pelve com contraste endovenoso de 46 pacientes (31 homens e 15 mulheres com idade entre 18 e 45 anos, com pelo menos um dos ureteres contrastado pelo contraste excretado, medimos as distâncias do meato ureteral até o teto acetabular e a borda superior da sínfise púbica, além do volume da bexiga. Utilizamos o teste t de Student para avaliar se houve diferenças estatísticas entre grupos. RESULTADOS: O nível da implantação ureteral na bexiga foi, em média, 10,6 ± 8,1 mm abaixo do teto acetabular e, em média, 29,7 ± 9,5 mm acima da borda superior da sínfise púbica. Nos pacientes com volume de repleção vesical menor que 200 ml e maior ou igual a 200 ml os níveis da implantação ureteral na bexiga foram, em média, 11,6 ± 7,3 mm e 10,2 ± 8,4 mm abaixo do teto acetabular (p = 0,61 e, em média, 28,3 ± 7,3 mm e 30,3 ± 10,2 mm acima da borda superior da sínfise púbica (p = 0,52, respectivamente, e nos pacientes do sexo masculino e feminino foram, em média, 11,8 ± 8,0 mm e 8,3 ± 8,0 mm abaixo do teto acetabular (p = 0,17 e, em média, 27,7 ± 9,2 mm e 33,9 ± 8,8 mm acima da borda superior da sínfise púbica (p = 0,34, respectivamente. CONCLUSÃO: Calcificações localizadas abaixo de 3 cm do teto acetabular e abaixo de 1,5 cm acima da borda superior da sínfise púbica provavelmente não representam cálculos ureterais. O grau de repleção vesical e o sexo não interferem significativamente na posição do meato ureteral.OBJECTIVE: To define, by means of computed tomography, the level of ureteral implantation into de bladder. MATERIALS AND METHODS: We have measured the distances from the ureteral meatus to the acetabulum, and to the superior margin of the pubic symphysis, as well as the bladder volume, using contrast enhanced computed tomography of the pelvis

  1. Exposição ao mercúrio e ao arsênio em Estados da Amazônia: síntese dos estudos do Instituto Evandro Chagas/FUNASA Exposure to mercury and arsenic in Amazon States: a summary of studies by the Evandro Chagas Institute/FUNASA

    Directory of Open Access Journals (Sweden)

    Elisabeth C. de Oliveira Santos

    2003-06-01

    Full Text Available Este artigo é uma revisão das pesquisas da Seção de Meio Ambiente do Instituto Evandro Chagas/FUNASA sobre exposição ao mercúrio (Hg no vale do rio Tapajós e Estado do Acre, e exposição ao arsênio (As através de resíduos da exploração de manganês (Mn realizada pela ICOMI deixados no Porto de Santana-AP. Em relação ao mercúrio, têm sido pesquisadas populações sob risco através da via respiratória ou alimentar. No primeiro caso, os trabalhadores de casas de compra e venda de ouro têm apresentado teores mais elevados de Hg em urina do que os garimpeiros estudados. No segundo caso, as populações ribeirinhas têm mostrado níveis diferenciados de exposição (Hg em cabelo. Comunidades ribeirinhas situadas em áreas não afetadas pelo mercúrio da garimpagem e com hábitos alimentares semelhantes às de área de risco têm sido avaliadas, visando a construção de parâmetros de normalidade regional. São também pesquisados os teores de Hg em materiais ambientais e na biota aquática. Os estudos de saúde humana e ambiente na cidade de Santana-AP objetivaram avaliar as fontes e possíveis vias de exposição da população da comunidade do Elesbão ao arsênio. Verificou-se a existência de fonte de risco através dos rejeitos de Mn, porém os níveis de As na água consumida pela população mostraram-se dentro dos parâmetros de normalidade. As médias encontradas em sangue e cabelo coincidem com médias de normalidade referidas na literatura, em populações não expostas, e as associações entre variáveis epidemiológicas, avaliação clínico-laboratorial e os teores de arsênio não mostraram significância estatística.This article is a review of the studies carried out by Environmental Section of the Evandro Chagas Institute/FUNASA on mercury (Hg exposure in the Tapajós river basin, and arsenic exposure (As due to residues of the manganese (Mn exploration, performed by ICOMI and left at the port of Santana

  2. Ars Poetica : [luuletused] / Mats Traat

    Index Scriptorium Estoniae

    Traat, Mats, 1936-

    2008-01-01

    Sisu: Ars poetica ; Veepeegel ; Kontrollõed ; Mandariiniriik ; Nikolai Siamashvili (1888-1911) ; Kolmekümne kolmas aasta ; Kiri linast 1966 ; Italmaz Nuriyev ; Rudolf Rimmelile mõeldes ; Gennadi Aigi

  3. Pulsed discharge production Ar* metastables

    Science.gov (United States)

    Han, Jiande; Heaven, Michael C.; Emmons, Daniel; Perram, Glen P.; Weeks, David E.; Bailey, William F.

    2016-03-01

    The production of relatively high densities of Ar* metastables (>1012 cm-3) in Ar/He mixtures, at total pressures close to 1 atm, is essential for the efficient operation of an optically pumped Ar* laser. We have used emission spectroscopy and diode laser absorption spectroscopy measurements to observe the production and decay of Ar* in a parallel plate pulsed discharge. With discharge pulses of 1 μs duration we find that metastable production is dominated by processes occurring within the first 100 ns of the gas break-down. Application of multiple, closely spaced discharge pulses yields insights concerning conditions that favor metastable production. This information has been combined with time-resolved measurements of voltage and current. The experimental results and preliminary modeling of the discharge kinetics are presented.

  4. Free-hand placement of high thoracic pedicle screws with the aid of fluoroscopy: evaluation of positioning by CT scans in a four-year consecutive series Colocação de parafusos pediculares na coluna torácica alta utilizando fluoroscopia: avaliação do posicionamento dos parafusos por tomografia computadorizada em uma série de casos durante quatro anos

    Directory of Open Access Journals (Sweden)

    Bruno Perocco Braga

    2010-06-01

    Full Text Available OBJECTIVE: To evaluate the feasibility, safety and accuracy of pedicle screw placement in the upper thoracic spine using the free-hand technique with the aid of fluoroscopy; to analyze the methods used to verify correct screw positioning intra and postoperatively. METHOD: All patients with instability of the cervicothoracic or upper thoracic spine and at least one screw placed in the segment T1-T6 as part of a posterior construct entered the study. Only C-arm intraoperative fluoroscopy was used to guide screw placement. RESULTS: We obtained excellent positioning in 98.07% of the screws. CT scans precisely demonstrated pedicle wall and anterolateral body violations. There was no hardware failure, no neurological or vascular injury and no loss of alignment during the follow-up period. CONCLUSION: Pedicle screws can be safely placed in the upper thoracic spine when strict technical principles are followed. Only a CT scan can precisely demonstrate vertebral body and medial pedicle cortical violations.OBJETIVO: Avaliar a factibilidade, segurança e eficácia da colocação de parafusos pediculares na coluna torácia alta utilizando apenas a fluoroscopia; analisar os métodos intra e pós-operatórios de verficação do posicionamento de parafusos. MÉTODO: Todos os pacientes com instabilidade da coluna cervico-torácica ou torácica alta e pelo menos um parafuso colocado no segmento T1-T6 foram incluídos no estudo. Apenas fluoroscopia intra-operatória foi utilizada para guiar a colocação dos parafusos. RESULTADOS: Obtivemos excelente posicionamento em 98,07% dos parafusos. TC axial mostrou precisamente violações pediculares e da parede anterolateral do corpo vertebral. Não houve falência do instrumental, lesões neurológicas ou vasculares, ou perda do alinhamento sagital no período de seguimento. CONCLUSÃO: Os parafusos pediculares podem ser colocados com segurança na coluna torácica alta desde que técnicas operatórias precisas sejam

  5. Acurácia da mensuração do enfisema pulmonar na tomografia computadorizada: pontos importantes Accuracy of measurement of pulmonary emphysema with computed tomography: relevant points

    OpenAIRE

    Bruno Hochhegger; Edson Marchiori; Klaus L. Irion; Hugo Oliveira

    2010-01-01

    Para garantir a confiabilidade dos dados de quantificação computadorizada do enfisema pulmonar (densitovolumetria pulmonar) na tomografia computadorizada, alguns aspectos técnicos devem ser considerados. A alteração das densidades na tomografia computadorizada com as mudanças no nível de inspiração e expiração do pulmão, com a espessura de corte da tomografia computadorizada, com o algoritmo de reconstrução e com o tipo de tomógrafo dificulta as comparações tomográficas nos estudos de acompan...

  6. Produção do girassol e teor de óleo nos aquênios em função da temperatura do ar, precipitação pluvial e radiação solar Yield of sunflower and oil seed content as a function of air temperature, rainfall and solar radiation

    Directory of Open Access Journals (Sweden)

    Giovani Luiz Thomaz

    2012-08-01

    Full Text Available O presente estudo teve o objetivo de avaliar o efeito da temperatura do ar, precipitação pluvial e radiação solar, ocorridos em cada fase fenológica da cultura do girassol, na produção de aquênios, no teor de óleo dos aquênios e na produção de óleo do girassol. Foram conduzidos dez experimentos em intervalos de 20 dias, com início em 30/07/2007 e término em 28/01/2008. Cada experimento constituiu uma época de semeadura. Para verificar a normalidade dos erros e homogeneidade das variâncias, inicialmente, realizou-se uma análise individual por experimento para, em seguida, realizar análise conjunta. O delineamento experimental utilizado foi o de blocos ao acaso com quatro tratamentos (cultivares e quatro repetições, em cada época de semeadura. Houve interação entre épocas de semeadura e cultivares para todas as variáveis estudadas. Foram feitas análises de correlação entre as variáveis meteorológicas e as de produção do girassol. A produção de aquênios, teor de óleo e produção de óleo nas cultivares de girassol foram mais elevados quando ocorreram temperaturas mais baixas na fase vegetativa, maiores precipitações pluviais na floração e maiores índices de radiação solar na fase vegetativa e de enchimento de aquênios.The objective of this research was to evaluate the effect of air temperature, rainfall and solar radiation occurring during each phonological phase of the sunflower crop, on yield of achenes, on oil content of achenes and on oil yield in sunflower. Ten experiments were carried out at Ponta Grossa, PR, Brazil, with intervals of 20 days, beginning on July 30, 2007 and finishing on January 28, 2008. Each sowing time constituted an experiment. The experiments were arranged in a randomized complete block design, with four treatments (cultivars and four replicates. It was performed the analysis of variance of each experiment separately and, after that, the joint analysis of all experiments

  7. Ar-39-Ar-40 Ages of Two Nakhlites, MIL03346 and Y000593: A Detailed Analysis

    Science.gov (United States)

    Park, Jisun; Garrison, Daniel; Bogard, Donald

    2007-01-01

    Radiometric dating of martian nakhlites by several techniques have given similar ages of approx.1.2-1.4 Ga [e.g. 1, 2]. Unlike the case with shergottites, where the presence of martian atmosphere and inherited radiogenic Ar-40 produce apparent Ar-39-Ar-40 ages older than other radiometric ages, Ar-Ar ages of nakhlites are similar to ages derived by other techniques. However, even in some nakhlites the presence of trapped martian Ar produces some uncertainty in the Ar-Ar age. We present here an analysis of such Ar-Ar ages from the MIL03346 and Y000593 nakhlites.

  8. Tumores neuroendócrinos do pulmão: principais achados radiológicos em uma série de 22 casos com confirmação anatomopatológica

    OpenAIRE

    Marcel Koenigkam Santos; André Rodrigues Façanha Barreto; Francisco Abaeté Chagas Neto; Valdair Francisco Muglia; Jorge Elias Júnior

    2012-01-01

    OBJETIVO: Descrever os principais achados de imagem em uma série de casos de tumores neuroendócrinos primários do pulmão (TNPs), destacando as alterações na tomografia computadorizada. MATERIAIS E MÉTODOS: Exames de 22 pacientes (12 homens, idade média de 60 anos) avaliados nos últimos cinco anos em nosso serviço, com confirmação histopatológica, foram retrospectivamente revistos por dois médicos radiologistas e os achados foram descritos em consenso, focando as alterações tomográficas. RESUL...

  9. İran bal arıları (Apis mellifera meda)’nın varroa paraziti (Varroa destructor)’ne karşı korunma yeteneğinin değerlendirilmesi

    OpenAIRE

    NAJI KHOEI, Amir

    2012-01-01

    <em>Varroa destructor, em>bal arılarının (<em>Apis melliferaem> L.) en önemli parazitlerinden biridir. Bu araştırmada İran bal arılarının (<em>Apis melliferaem> <em>meda>) <em>Varroa destructorem>'e karşı direnç özelliklerini araştırmak amacıyla, İran'ın Doğu Azerbaycan ilinin 5 farklı ilçesinden materyal olarak 60 bal arısı kolonisi ile Tebriz Üniversitesi Ziraat Fakültesi’nde deneme kurulmuştur. Çalışmada; tıma...

  10. Estudo de Adequações em um Aeroporto Regional para Alcançar a Eficiência Energética de Forma Renovável

    Directory of Open Access Journals (Sweden)

    Artur Rech da Rosa

    2016-04-01

    Full Text Available A sustentabilidade ambiental trata da utilização do meio ambiente, dando oportunidade a ele de se regenerar, ou encontrando meios de substituir a ocupação ambiental por meios renováveis. Nesse contexto, o Aeroporto Regional de Caxias do Sul, que é um empreendimento prestador de serviços de transporte à região da Serra Gaúcha, pode atuar conforme o conceito de desenvolvimento sustentável, desde que ocorra a integração dos critérios ambientais na prática econômica. Nesse contexto, a fotogeração se mostra como uma alternativa para suprir sua demanda energética tornando-o sustentável do ponto de vista deste recurso. Neste trabalho, são determinados a demanda do aeroporto para este tipo de energia, o dimensionamento do sistema fotovoltaico e uma análise da viabilidade econômica do mesmo. A implementação deste sistema pode economizar ao aeroporto 420.248,73 R$/ano e pode gerar o equivalente a R$ 235.653,74/ano em créditos de energia, sendo viável economicamente. Este empreendimento, além de sustentar uma imagem de green airport, pode gerar empregos para especialistas na área e incentivar e propagar a ideia de utilização de energias renováveis

  11. Avaliação da reprodutibilidade da tomografia computadorizada no estadiamento da pancreatite aguda Reproducibility in the assessment of acute pancreatitis with computed tomography

    Directory of Open Access Journals (Sweden)

    Edison de Oliveira Freire Filho

    2007-12-01

    Full Text Available OBJETIVO: Medir a reprodutibilidade da tomografia computadorizada sem e com contraste na avaliação da gravidade da pancreatite aguda. MATERIAIS E MÉTODOS: Cinqüenta e um exames de tomografia computadorizada abdominal sem e com contraste de pacientes com pancreatite aguda foram analisados por dois radiologistas (observadores 1 e 2. Calculamos o índice morfológico pela tomografia computadorizada sem e com contraste, separadamente, e o índice de gravidade da tomografia computadorizada para pancreatite aguda. Medimos a reprodutibilidade intra- e interobservador da tomografia computadorizada através do índice kappa (kapa. RESULTADOS: Para a concordância interobservador obtivemos kapa de 0,666, 0,705, 0,648, 0,547 e 0,631 para índice morfológico sem e com contraste, presença de necrose pancreática, extensão da necrose pancreática e índice de gravidade da tomografia computadorizada, respectivamente. Para a concordância intra-observador dos observadores 1 e 2 obtivemos, respectivamente, kapa de 0,796 e 0,732 para o índice morfológico sem contraste; 0,725 e 0,802 para o índice morfológico com contraste; 0,674 e 0,849 para a presença de necrose pancreática; 0,606 e 0,770 para a extensão da necrose pancreática; e 0,801 e 0,687 para o índice de gravidade da tomografia computadorizada. CONCLUSÃO: O estadiamento da pancreatite aguda pela tomografia computadorizada por meio do índice morfológico e do índice de gravidade da tomografia computadorizada é um método bastante reprodutível. O não-uso do contraste não afeta a reprodutibilidade da tomografia computadorizada para o cálculo do índice morfológico.OBJECTIVE: To evaluate the reproducibility of unenhanced and contrast-enhanced computed tomography in the assessment of patients with acute pancreatitis. MATERIALS AND METHODS: Fifty-one unenhanced and contrast-enhanced abdominal computed tomography studies of patients with acute pancreatitis were blindly reviewed by two

  12. Carbono orgânico e elementar em partículas em suspensão em habitações

    OpenAIRE

    Pinho, Isabel Cristina Correia de

    2011-01-01

    As concentrações de partículas em suspensão na atmosfera (PM10) e o seu conteúdo em carbono foram determinadas em amostras recolhidas em quatro locais distintos do concelho de Aveiro. Na recolha das amostras foram utilizados dois amostradores, de baixo caudal um para o ar interior e outro para o ar exterior, em simultâneo, com tempos de amostragem de 48 horas. As concentrações de PM10 foram determinadas por gravimetria, enquanto que o material carbonoso foi determinado ...

  13. Quando a fase de equilíbrio pode ser suprimida nos exames de tomografia computadorizada de abdome? What is the real role of the equilibrium phase in abdominal computed tomography?

    Directory of Open Access Journals (Sweden)

    Priscila Silveira Salvadori

    2013-04-01

    Full Text Available OBJETIVO: Avaliar a necessidade de realização da fase de equilíbrio nos exames de tomografia computadorizada de abdome. MATERIAIS E MÉTODOS: Realizou-se estudo retrospectivo, transversal e observacional, avaliando 219 exames consecutivos de tomografia computadorizada de abdome com contraste intravenoso, realizados num período de três meses, com diversas indicações clínicas. Para cada exame foram emitidos dois pareceres, um avaliando o exame sem a fase de equilíbrio (primeira análise e o outro avaliando todas as fases em conjunto (segunda análise. Ao final de cada avaliação, foi estabelecido se houve mudança nos diagnósticos principais e secundários, entre a primeira e a segunda análise. Foi utilizada a extensão do teste exato de Fisher para avaliar a modificação dos diagnósticos principais (p 0,999. Com relação aos diagnósticos secundários, cinco exames (2,3% foram modificados. CONCLUSÃO: Para indicações clínicas como estadiamento tumoral, abdome agudo e pesquisa de coleção abdominal, a fase de equilíbrio não acrescenta contribuição diagnóstica expressiva, podendo ser suprimida dos protocolos de exame.OBJECTIVE: To evaluate the role of the equilibrium phase in abdominal computed tomography. MATERIALS AND METHODS: A retrospective, cross-sectional, observational study reviewed 219 consecutive contrast-enhanced abdominal computed tomography images acquired in a three-month period, for different clinical indications. For each study, two reports were issued - one based on the initial analysis of non-contrast-enhanced, arterial and portal phases only (first analysis, and a second reading of these phases added to the equilibrium phase (second analysis. At the end of both readings, differences between primary and secondary diagnoses were pointed out and recorded, in order to measure the impact of suppressing the equilibrium phase on the clinical outcome for each of the patients. The extension of the exact Fisher

  14. Relação entre área e volume da mastoide em adultos brasileiros

    OpenAIRE

    Marco Antônio Rios Lima; Luciano Farage; Maria Cristina Lancia Cury; Fayez Bahmad Júnior

    2013-01-01

    As medidas de área e volume da mastoide por tomografia computadorizada não foram previamente descritas em adultos brasileiros. O conhecimento dessas medidas é muito importante para o entendimento da fisiologia da orelha média e seus estados patológicos, refletindo diretamente na pneumatização mastoídea. OBJETIVO: Verificar a existência de relação entre a área e o volume da mastoide. MÉTODO: Estudo de coorte contemporânea com corte transversal, no qual 28 pacientes foram submetidos à tomografi...

  15. Processamento por ajuste de campo em acústica submarina e aplicações

    OpenAIRE

    C. Soares; Jesus, S.M.

    2004-01-01

    A acústica submarina encontra aplicação em variados problemas tais como detecçãao activa ou passiva e localização de navios e submarinos, comunicações acústicas, tomografia acústica, procura de objectos enterrados e monitorização remota de fenomenos naturais, entre outros. Parte destas aplicações tornaram-se possíveis graças aos avanços tecnológicos da última década, que trouxeram um aumento significativo da capacidade computacional disponível.

  16. Analysis list: AR [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available AR Blood,Breast,Prostate + hg19 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/target/AR.1.tsv http://dbar...chive.biosciencedbc.jp/kyushu-u/hg19/target/AR.5.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/tar...get/AR.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/colo/AR.Blood.tsv,http://dbar...chive.biosciencedbc.jp/kyushu-u/hg19/colo/AR.Breast.tsv,http://dbarchive.biosc...iencedbc.jp/kyushu-u/hg19/colo/AR.Prostate.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/colo/Blood.gml,http://dbar

  17. Analysis list: Ar [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Ar Gonad,Kidney,Prostate + mm9 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/targe...t/Ar.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Ar.5.tsv http://dbarchive.biosciencedbc.jp/...kyushu-u/mm9/target/Ar.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Ar.Gonad.tsv,http://dbarchive.bioscien...cedbc.jp/kyushu-u/mm9/colo/Ar.Kidney.tsv,http://dbarchive.bioscienced...bc.jp/kyushu-u/mm9/colo/Ar.Prostate.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Gonad.gml,http://dbarchive.bioscien

  18. Proposta para padronização do relatório de tomografia computadorizada nos aneurismas da aorta abdominal A proposal for standardizing computed tomography reports on abdominal aortic aneurysms

    Directory of Open Access Journals (Sweden)

    Fabiola Goda Torlai

    2006-08-01

    Full Text Available OBJETIVO: Propor um modelo de padronização de relatório para aneurisma da aorta abdominal na tomografia computadorizada. MATERIAIS E MÉTODOS: Foram realizadas, no período de abril a outubro de 2004, entrevistas com integrantes da Disciplina de Cirurgia Vascular da nossa instituição, para elaboração de um modelo de padronização de relatório de tomografia computadorizada para o estudo do aneurisma da aorta abdominal. A partir deste modelo foi elaborado um questionário, enviado a nove outros cirurgiões, todos com experiência em cirurgia da aorta abdominal. O índice de resposta aos questionários foi de 55,5% (5/9. RESULTADOS: Os parâmetros de interesse citados mais freqüentemente para a avaliação dos aneurismas de aorta abdominal foram: diâmetro máximo do colo proximal, extensão do colo proximal até a artéria renal mais baixa, forma do colo proximal, diâmetro máximo do aneurisma e diâmetro das artérias ilíacas comuns. Estes dados permitiram elaborar uma proposta de modelo para padronização de relatório na tomografia computadorizada. CONCLUSÃO: Um modelo para a análise tomográfica padronizada do aneurisma de aorta abdominal permite atender às necessidades dos cirurgiões vasculares para acompanhar a evolução e planejar o tratamento destes pacientes.OBJECTIVE: To propose a model to standardize computed tomography reports on abdominal aortic aneurysms. MATERIALS AND METHODS: Interviews were carried out with members of Vascular Surgery Division of our institution, in the period between April and October 2004, aiming at developing a standardized model of computed tomography reports on abdominal aortic aneurysms. Based on this model, a questionnaire was elaborated and sent to other nine surgeons, all of them experienced in the field of abdominal aortic surgery. The questionnaires response rate was 55.5% (5/9. RESULTS: The most frequently mentioned parameters of interest for evaluation of abdominal aortic aneurysms

  19. 40Ar/39Ar dating of Daqingshan thrust

    Institute of Scientific and Technical Information of China (English)

    LIU Zhenghong; XU Zhongyuan; YANG Zhensheng

    2003-01-01

    The Daqingshan thrust system, to the south of the Shiguai Mesozoic basin, is a complex system of top-to- the-north thrusting tectonic sheets. The thrust system has a complicated evolution due to multi-stage thrusting. In order to date the thrusting events, syntectonic muscovite and biotite grains are respectively analyzed with normal 40Ar/39Ar dating and laser 40Ar/39Ar dating, which yield 2 isochron ages, i.e. 193.74 ± 3.88 Ma and 121.6 ± 1.6 Ma. These ages suggest that faults within the Daqingshan thrust system formed during 2 stages of thrusting, one the early Indosinian and the other the late Yanshanian. The isotopic dating is consistent with field geological relations. Indosinan deformation is evidenced by top-to-the-north thrusting, with the occurrence of a series of large-scale east-west trending thrust faults and folds, while the Yanshanian thrusting is characterized by top-to-the-NNW thrusting. It is superposed on and modifies early Indosinian thrust faults.

  20. Fibrose pulmonar idiopática simultânea a enfisema em pacientes tabagistas Idiopathic pulmonary fibrosis and emphysema in smokers

    OpenAIRE

    Denise Rossato Silva; Marcelo Basso Gazzana; Sérgio Saldanha Menna Barreto; Marli Maria Knorst

    2008-01-01

    OBJETIVO: Descrever os achados clínicos e funcionais de pacientes com enfisema em lobos superiores e fibrose pulmonar idiopática (FPI) em lobos inferiores, recentemente descrita na literatura. MÉTODOS: Um grupo de 11 pacientes com a presença simultânea de enfisema e FPI foi identificado retrospectivamente. Todos os pacientes realizaram tomografia computadorizada de tórax com alta resolução e provas de função pulmonar. RESULTADOS: Entre os 11 pacientes identificados, havia 8 homens e 3 mulhere...

  1. Radiodensidade hepática de cães hígidos por tomografia computadorizada helicoidal Hepatic radiodensity in healthy dogs by helical computed tomography

    Directory of Open Access Journals (Sweden)

    Lorena Adão Vescovi Séllos Costa

    2010-04-01

    Full Text Available Os objetivos do presente estudo são obter valores médios de radiodensidade do parênquima hepático de cães normais e descrever a adaptação na espécie canina de uma técnica de mensuração da densidade tomográfica já utilizada em humanos. Para a realização do estudo, foram adquiridos exames tomográficos do fígado de oito cães hígidos adultos jovens, sem distinção de sexo ou raça. Após a realização do exame, foram obtidos valores médios de radiodensidade de três regiões de interesse (ROIs do parênquima hepático em três diferentes níveis de corte. Além disso, foi realizada a análise de uma região de interesse do parênquima esplênico em três diferentes níveis de corte para uma avaliação comparativa entre os órgãos. Observou-se, no grupo avaliado, um valor médio de atenuação HU de 59,58±3,34 unidades Hounsfield (HU. A diferença de densidade entre o parênquima hepático e o esplênico foi, em média, de 4,69±7,77HU. No presente estudo, o exame de tomografia computadorizada demonstrou ser uma técnica com alta sensibilidade para estimar a radiodensidade do parênquima hepático. O estabelecimento de valores de normalidade e a padronização de uma metodologia de avaliação permitem melhor caracterização de alterações na radiodensidade pelo exame tomográfico, auxiliando no estabelecimento de um diagnóstico e minimizando a necessidade de exames invasivos.The objectives of the study reported here were to obtain medium values of hepatic parenchyma radiodensity in healthy dogs, and also describe the adaptation in canine specie of a tomographic density measurement technique, which has already been used in humans. For the accomplishment of this study tomographic exams were realized in eight young dogs without sex or breed definition. After the exams, the liver's degree of HU attenuation was determined through a mean value of three selected regions of interest (ROI in hepatic parenchyma obtained in three

  2. Carcinoma espinocelular do conduto auditivo externo: estudo por tomografia computadorizada de seis casos Squamous cell carcinoma of the external auditory canal: computed tomography findings in six cases

    Directory of Open Access Journals (Sweden)

    Fábio Mota Gonzalez

    2005-06-01

    Full Text Available OBJETIVO: Analisar a importância da avaliação tomográfica da extensão profunda dos carcinomas espinocelulares do conduto auditivo externo. MATERIAIS E MÉTODOS: Foram realizados exames tomográficos com cortes axiais e coronais com janelas para partes moles e óssea em seis pacientes com carcinoma espinocelular do conduto auditivo externo, com idade variando entre 55 e 71 anos, internados no Hospital Heliópolis, no período entre maio de 1995 e dezembro de 2003. RESULTADOS: Dos seis pacientes, todos apresentavam aumento de partes moles no conduto auditivo externo, cinco (83,3% tinham erosão óssea e invasão da orelha média, quatro (66,7% possuíam comprometimento da mastóide e da glândula parótida, três (50% apresentavam invasão da articulação temporomandibular, dois (33,3% tinham invasão da fossa média, do canal carotídeo e linfonodomegalia júgulo-carotídea alta ipisilateral. CONCLUSÃO: A avaliação da extensão tumoral profunda fornecida pela tomografia computadorizada é importante no estadiamento clínico, possibilitando um planejamento terapêutico mais eficaz.OBJECTIVE: To evaluate the role of computed tomography in the assessment of deep extension of squamous cell carcinoma of the external auditory canal. MATERIALS AND METHODS: In the period between May 1995 and December 2003 six patients with squamous cell carcinoma of the external auditory canal were submitted to computed tomography scan at "Hospital Heliópolis", São Paulo, SP, Brazil, including axial and coronal slices with soft tissue and bone algorithms. RESULTS: Thickening of the soft tissue of the external auditory canal was seen in all patients, bone erosion and invasion of the middle ear in five (83.3%, invasion of the mastoid and parotid gland in four (66.7%, invasion of the temporomandibular joint in three (50%, and invasion of the middle cranial fossa, carotid canal and cervical lymph node enlargement in two (33.3% patients. CONCLUSION: Assessment of

  3. 40Ar/39Ar geochronology at the Instituto de Geociências, USP: instrumentation, analytical procedures, and calibration

    Directory of Open Access Journals (Sweden)

    PAULO M. VASCONCELOS

    2002-06-01

    Full Text Available Laser heating 40Ar/39Ar geochronology provides high analytical precision and accuracy, mum-scale spatial resolution, and statistically significant data sets for the study of geological and planetary processes. A newly commissioned 40Ar/39Ar laboratory at CPGeo/USP, São Paulo, Brazil, equips the Brazilian scientific community with a new powerful tool applicable to the study of geological and cosmochemical processes. Detailed information about laboratory layout, environmental conditions, and instrumentation provides the necessary parameters for the evaluation of the CPGeo/USP 40Ar/39Ar suitability to a diverse range of applications. Details about analytical procedures, including mineral separation, irradiation at the IPEN/CNEN reactor at USP, and mass spectrometric analysis enable potential researchers to design the necessary sampling and sample preparation program suitable to the objectives of their study. Finally, the results of calibration tests using Ca and K salts and glasses, international mineral standards, and in-house mineral standards show that the accuracy and precision obtained at the 40Ar/39Ar laboratory at CPGeo/USP are comparable to results obtained in the most respected laboratories internationally. The extensive calibration and standardization procedures undertaken ensure that the results of analytical studies carried out in our laboratories will gain immediate international credibility, enabling Brazilian students and scientists to conduct forefront research in earth and planetary sciences.A geocronologia de 40Ar/39Ar por aquecimento a laser permite alta precisão e acurácia analítica, tem resolução espacial em escala micrométrica, e fornece um número de dados estatisticamente significantes para o estudo de processos geológicos e planetários. Um recém construído laboratório de 40Ar/39Ar no CPGeo/USP, São Paulo, Brazil, mune a sociedade científica brasileira com uma técnica eficaz aplicável aos estudos geol

  4. "Ars Electronica 2009" / Raivo Kelomees

    Index Scriptorium Estoniae

    Kelomees, Raivo, 1960-

    2009-01-01

    30. "Ars Electronica" festival "Human Nature" ("Inimese loomus") Linzis. Osaka ülikooli professori Hiroshi Ishiguro mehaanilis-digitaalsest nukust. Hübriidkunsti kategoorias peapreemia saanud Eduardo Kaci inimtaimest. Konverentsidest. Näitusest "See this Sound", mis oli pühendatud helile kujutavas kunstis

  5. AR DOC: Augmented reality documentaries

    DEFF Research Database (Denmark)

    Vistisen, Peter

    2014-01-01

    Augmented Reality Documentaries (AR DOC) er et ’lille’ Shareplay projekt (ansøgte midler augmented reality cross media løsninger, til at skabe engagerende publikumsformidling...... indenfor oplevelsesindustrien. Projektet har genereret ny viden omkring, hvordan fysisk og digital formidling kan understøttes via Augmented Reality som formidlingsformat....

  6. Aspectos da tomografia computadorizada craniana na neurocisticercose na infância

    Directory of Open Access Journals (Sweden)

    Marilisa M. Guerreiro

    1989-06-01

    Full Text Available Os autores relatam aspectos tomográficos da neurocisticercose na infância a propósito da análise de 27 exames em 18 pacientes, que foram distribuídos em três grupos segundo o quadru clínico e os achados tomográficos. O grupo 1 foi caracterizado basicamente por epilepsias e calcificações. O grupo 2 caracterizou-se por hipertensão intracraniana e diversos aspectos tomográficos: edema, cistos e nódulos em três pacientes; hidrocefalia e calcificações em dois pacientes e normal em um paciente. O grupo 3 consistiu clinicamente de epilepsia e cefaléia, com vários padrões tomográficos. Os resultados são discutidos à luz da literatura disponível.

  7. Doença cística medular do rim: relato de um caso diagnosticado por ultra-sonografia e tomografia computadorizada Medullary cystic disease of the kidney: report of a case diagnosed by ultrasonography and computed tomography examinations

    Directory of Open Access Journals (Sweden)

    Tarcísio Nunes Carvalho

    2003-12-01

    Full Text Available Doença cística medular, nefronofitíase juvenil familiar ou complexo de doença cística medular referem-se a um grupo de doenças similares cuja lesão básica é uma progressiva atrofia tubular renal com esclerose glomerular e formação cística medular. É importante causa de insuficiência renal em pacientes adolescentes. Estudos de imagem têm papel principal no diagnóstico desta enfermidade, com cistos caracteristicamente individualizados na medula renal e junção córtico-medular e tamanho renal normal ou reduzido. Neste artigo demonstramos os achados de imagem da doença cística medular renal em uma adolescente com quadro clínico característico, por meio de ultra-sonografia e tomografia computadorizada.The terms medullary cystic disease, juvenile nephronophthisis or medullary cystic disease complex refer to a group of similar diseases in which the basic pathological abnormality is progressive renal tubular atrophy with secondary glomerular sclerosis and medullary cystic formation. Medullary cystic disease is an important cause of renal failure in adolescent patients. Imaging methods play a primary role in the diagnosis of these diseases. Cysts are characteristically seen in the renal medulla and corticomedullary junction whereas kidneys may be of normal to small size. In this article we present the ultrasonography and computed tomography findings of a female adolescent patient with characteristic clinical picture of medullary cystic disease.

  8. Evaluation of the absorbed dose in odontological computerized tomography; Avaliacao da dose absorvida em tomografia computadorizada odontologica

    Energy Technology Data Exchange (ETDEWEB)

    Legnani, Adriano; Schelin, Hugo R.; Rocha, Anna Silvia P.S. da, E-mail: schelin@utfpr.edu.b, E-mail: anna@utfpr.edu.b [Universidade Tecnologica Federal do Parana (UTFPR), Curitiba, PR (Brazil); Khoury, Helen J., E-mail: khoury@ufpe.b [Universidade Federal de Pernambuco (UFPE), Recife, PE (Brazil)

    2011-10-26

    This paper evaluated the absorbed dose at the surface entry known as 'cone beam computed tomography' (CBCT) in odontological computerized tomography. Examination were simulated with CBCT for measurements of dose. A phantom were filled with water, becoming scatter object of radiation. Thermoluminescent dosemeters were positioned on points correspondent to eyes and salivary glands

  9. Quality control and dosimetry in computed tomography units; Controle de qualidade e dosimetria em equipamentos de tomografia computadorizada

    Energy Technology Data Exchange (ETDEWEB)

    Pina, Diana Rodrigues de; Ribeiro, Sergio Marrone [UNESP, Botucatu, SP (Brazil). Faculdade de Medicina], e-mail: drpina@fmb.unesp.br; Duarte, Sergio Barbosa [Centro Brasileiro e Pesquisas Fisicas (CBPF), Rio de Janeiro, RJ (Brazil); Netto, Thomaz Ghilardi [Universidade de Sao Paulo (USP), Ribeirao Preto, SP (Brazil). Hospital das Clinicas. Centro de Ciencias das Imagens e Fisica Medica; Morceli, Jose [UNESP, Botucatu, SP (Brazil). Faculdade de Medicina. Secao de Diagnostico por Imagem; Carbi, Eros Duarte Ortigoso; Costa Neto, Andre; Souza, Rafael Toledo Fernandes de [UNESP, Botucatu, SP (Brazil). Inst. de Biociencias

    2009-05-15

    Objective: Evaluation of equipment conditions and dosimetry in computed tomography services utilizing protocols for head, abdomen, and lumbar spine in adult patients (in three different units) and pediatric patients up to 18 months of age (in one of the units evaluated). Materials and methods: Computed tomography dose index and multiple-scan average dose were estimated in studies of adult patients with three different units. Additionally, entrance surface doses as well as absorbed dose were estimated in head studies for both adult and pediatric patients in a single computed tomography unit. Results: Mechanical quality control tests were performed, demonstrating that computed tomography units comply with the equipment-use specifications established by the current standards. Dosimetry results have demonstrated that the multiplescan average dose values were in excess of up to 109.0% the reference levels, presenting considerable variation amongst the computed tomography units evaluated in the present study. Absorbed doses obtained with pediatric protocols are lower than those with adult patients, presenting a reduction of up to 51.0% in the thyroid gland. Conclusion: The present study has analyzed the operational conditions of three computed tomography units, establishing which parameters should be set for the deployment of a quality control program in the institutions where this study was developed. (author)

  10. Bone densitometry in healthy cats by quantitative computed tomography; Densitometria ossea em gatos higidos por tomografia computadorizada quantitativa

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, D.C. [Universidade Federal do Parana - Curitiba, PR (Brazil); Costa, L.A.V.S.; Teixeira, M.W.; Costa, F.S. [Universidade Federal Rural de Pernambuco - Recife, PE (Brazil); Cardoso, M.J.L. [Universidade Estadual do Norte do Parana - Campus Luiz Meneghel - Bandeirantes, PR (Brazil)

    2012-06-15

    The radiodensity of the trabecular bone of the lumbar vertebrae in 16 healthy adult cats was studied using quantitative computed tomography (QCT). The average radiodensity of the trabecular bone of the second lumbar vertebra was 436.1 +- 42.1 Hounsfield units. However, there was a nonhomogeneous radiodensity distribution of the vertebral body. (author)

  11. Cholesteatoma: computed tomography and radiography in a dog; Colesteatoma: tomografia computadorizada e radiografia em cao com otite cronica

    Energy Technology Data Exchange (ETDEWEB)

    Belotta, Alexandra Frey; Babicsak, Viviam Rocco; Mamprim, Maria Jaqueline; Vulcano, Luiz Carlos, E-mail: a_fbelotta@yahoo.com.br [Universidade Estadual Paulista Julio de Mesquita Filho (FMVZ/UNESP), Botucatu, SP (Brazil). Faculdade de Medicina Veterinaria e Zootecnia . Dept. de Reproducao Animal e Radiologia Veterinaria; Arruda, Vanesa Kutz de; Amorim, Rogerio Martins [Universidade Estadual Paulista Julio de Mesquita Filho (FMVZ/UNESP), Botucatu, SP (Brazil). Faculdade de Medicina Veterinaria e Zootecnia. Dept. de Clinica Veterinaria

    2012-07-01

    Cholesteatoma, a rare and/or misdiagnosed disease, results of a serious complication in dogs with chronic otitis. This article describes a case of a dachshund sent to the veterinary hospital presenting signs of cognitive dysfunction associated to peripheral neuropathy of the facial nerve on the right side. At radiography, an enlargement and thickness of the contours associated with loss of anatomical definition of the right tympanic bulla compared to the left was seen. At tomography, this enlargement and thickness were seen with better definition, besides the fulfilling by hyperdense calcified content, bullae osteolysis and temporal bone sclerosis at the same side. (author)

  12. Development of conditions radiation in computed tomography - CT; Desenvolvimento das condicoes de radiacao em tomografia computadorizada - TC

    Energy Technology Data Exchange (ETDEWEB)

    Cardoso, Ricardo de Souza; Peixoto, Jose Guilherme Pereira, E-mail: ricardo@ird.gov.br [Instituto de Radioprotecao e Dosimetria (IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil). Lab. Nacional de Metrologia das Radiacoes Ionizantes

    2015-07-01

    The LNMRI is implementing the TC qualities, used in chambers calibration used in hospitals and clinics. Preliminary studies results showed a variation for RQT 9 Quality of 1,350 x 107 and 1,343 x 107 Gy/C within 1.61 and 1.70% expanded uncertainties evaluated. (author)

  13. Qualidade de maçãs ‘Gala’ armazenadas em atmosfera controlada dinâmica e estática com renovação do ar Quality of ‘Gala’ apples stored in dynamic and static controlled atmosphere with air renovation

    Directory of Open Access Journals (Sweden)

    Auri Brackmann

    2005-04-01

    Full Text Available Este experimento teve como objetivo avaliar o efeito da remoção periódica da atmosfera das câmaras de atmosfera controlada com ar e nova instalação, bem como o uso da atmosfera dinâmica, sobre a manutenção da qualidade da maçã 'Gala'. Os tratamentos utilizados foram: (1 controle (sem renovação; (2 renovação da atmosfera diariamente durante o resfriamento dos frutos; (3 renovação da atmosfera diariamente durante o resfriamento e mensalmente no período de armazenamento em atmosfera controlada; (4 renovação da atmosfera mensalmente; (5 50µL L-1 de etileno no interior da câmara; e (6 atmosfera dinâmica (injeção diária de N2 para remoção do CO2. Após oito meses de armazenamento, o tratamento com renovação da atmosfera diariamente durante o resfriamento e mensalmente no período de armazenamento em atmosfera controlada proporcionou frutos com maior firmeza de polpa. Nenhuma das técnicas avaliadas permitiu manter os níveis de etileno nas câmaras de armazenamento abaixo de 5µL L-1. Provavelmente, a absorção do etileno proporciona um benefício igual ou maior com um menor custo, pois a renovação da atmosfera implica altos custos na aquisição de nitrogênio.This experiment was carried out aiming to evaluate the effect of periodical removal of the atmosphere of controlled atmosphere chambers with fresh air and the use of dynamic atmosphere on quality of 'Gala' apples. Evaluated treatments were: (1 control (without air renovation; (2 daily atmosphere renovation during fruit cooling; (3 daily atmosphere renovation during cooling and monthly during controlled atmosphere storage of fruits; (4 monthly atmosphere renovation; (5 50µL L-1 ethylene inside chamber; and (6 dynamic atmosphere (N2 injection to remove CO2. After eight months of storage, daily atmosphere renovation during cooling and monthly during controlled atmosphere storage maintained fruit firmness. None of the evaluated techniques allowed ethylene levels

  14. Comportamento do arsênio em perfis de solos do Sítio Ilha de Terra de Caxiuanã-Pará Arsenic behavior in soil profiles on the Sítio Ilha de Terra from Caxiuanã-Pará

    Directory of Open Access Journals (Sweden)

    Vanda Porpino Lemos

    2009-06-01

    Full Text Available Concentrações de arsênio em perfis de solos com terra preta arqueológica (TPA e solos de área adjacente (AD do Sítio Ilha de Terra, Caxiuanã, no Estado do Pará, região Amazônica, podem dar informações sobre as atividades antropogênicas dos habitantes dessa região. Análises químicas e mineralógicas foram realizadas nas amostras desses perfis. Os dados obtidos mostram que as concentrações do Fe e As aumentam com a profundidade dos perfis de solos, enquanto que as concentrações de matéria orgânica (MO decrescem; as concentrações mais elevadas de Fe e As são observadas no perfil AD. Esses resultados indicam interações entre Fe e As e sugerem que a MO nos solos promove a dissolução da goethita e lixiviação do Fe e As no perfil TPA.Arsenic concentrations in soil profiles with archaeological black earth (ABE and surroundings (SA from the Sítio Ilha de Terra, Caxiuanã, in the State of Pará, Amazon region, may provide information on anthropogenic activity in the Amazonian habitat. The samples of ABE and SA soil profiles were submitted to chemical and mineralogical analysis. The obtained data show that Fe and As concentrations increase with depth while organic matter (OM decreases. The highest concentrations of Fe and As are observed in the SA profile. These results indicate interactions between Fe and As and suggest that OM promotes the dissolution of goethite and leaching of Fe and As in the ABE profile.

  15. Avaliação do ambiente solo-semente por meio da tomografia computadorizada Evaluation of the soil-seed environment through computerized tomography

    Directory of Open Access Journals (Sweden)

    Alcir José Modolo

    2008-04-01

    Full Text Available O condicionamento físico do solo ao redor das sementes reveste-se de grande importância para o bom desenvolvimento inicial da cultura, assegurando uma população sadia de plantas. O adequado contato solo-semente é um pré-requisito para a rápida emergência e o bom estabelecimento da cultura. Neste trabalho, objetivou-se utilizar a tomografia computadorizada de resolução milimétrica para determinação do ambiente solo-semente em sistema de plantio direto, logo após o plantio da cultura da soja. Utilizou-se o esquema de parcelas subdivididas, em que as parcelas constituíram-se de três teores de água do solo, correspondentes a 0,27; 0,31; e 0,36 kg kg-1, e as subparcelas de quatro níveis de carga, aplicadas pela roda compactadora, correspondentes a 0, 50, 90 e 140 N, no delineamento em blocos ao acaso, com quatro repetições. Foram avaliados a densidade média do solo na região da semente e o perfil de densidade média na linha de semeadura. De acordo com os resultados obtidos, pode-se concluir que as cargas aplicadas pela roda compactadora elevaram a densidade do solo no plano vertical da linha de semeadura abaixo da profundidade de semeadura, quando comparadas com as obtidas antes do plantio; a combinação entre cargas aplicadas pela roda compactadora e os teores de água no solo não influenciou a densidade média do solo na região da semente.The physical conditioning of the soil around seeds is of great importance for an adequate initial development of a crop, ensuring a healthy plant population. A suitable soil-seed contact is a prerequisite for a fast crop germination and good establishment. In this study, computerized tomography of millimeter resolution was used to determine the soil-seed environment in a no tillage system, immediately after soybean planting. A split plot design was used, in which the plots consisted of three contents of soil water, corresponding to 0.27; 0,31 and 0.36 kg kg-1, respectively, and the split

  16. Tomografia computadorizada de abdome normal: estudo retrospectivo das angulações dos hilos renais Normal abdominal computed tomography: a retrospective study of renal hila angles

    Directory of Open Access Journals (Sweden)

    Makoto Sakate

    2009-02-01

    Full Text Available OBJETIVO: Obter valores da angulação média dos hilos renais em relação ao plano horizontal, traçado sobre músculos eretores da espinha direito e esquerdo, considerando como parâmetro de referência para as medidas das angulações o centro da coluna vertebral lombar. MATERIAIS E MÉTODOS: Foram analisados 250 exames de tomografia computadorizada de abdomes considerados normais de indivíduos de ambos os sexos, sendo 128 masculinos (idade média de 52,45 ± 17,42 anos e 122 femininos (idade média de 54,39 ± 18,27 anos, totalizando 500 hilos renais estudados. A angulação média de cada hilo renal em relação ao plano horizontal foi obtida, sendo considerados sempre os ângulos agudos. RESULTADOS: O estudo comparativo entre os sexos mostrou que não houve diferença estatisticamente significante em relação aos ângulos agudos dos hilos renais. A análise estatística mostrou, com intervalo de confiança de 95%, para média do ângulo direito os limites de 40,40° e 44,54° e para o hilo renal esquerdo os limites de 39,91° e 43,23°. CONCLUSÃO: Os hilos renais, independentemente do sexo, apresentam angulações semelhantes. Valores angulares maiores terão anomalia de hiper-rotação ou hiper-rotação exagerada e valores menores terão anomalia de rotação incompleta ou rotação invertida.OBJECTIVE: To obtain mean angulation values for renal hila in relation to the horizontal plane traced over the right and left spinal erector muscles, considering the center of the lumbar vertebral spine as a parameter for measuring the renal hila angles. MATERIALS AND METHODS: The authors have analyzed 250 abdominal computed tomography studies of both male and female healthy individuals (128 men with mean age 52.45 ± 17.42 years, and 122 women with mean age 54.39 ± 18.27 years, corresponding to 500 renal hila evaluated. The mean angulation of each hilum in relation to the horizontal plane was obtained taking acute angles into consideration

  17. Aspectos tomográficos da tuberculose pulmonar em pacientes adultos com AIDS

    Directory of Open Access Journals (Sweden)

    Lanamar Aparecida de Almeida

    2011-02-01

    Full Text Available OBJETIVO: Este trabalho tem como finalidade descrever os achados tomográficos da tuberculose pulmonar em pacientes adultos com AIDS atendidos no serviço de radiologia de um hospital de referência em doenças infecciosas, procurar associações desses achados e a contagem de CD4. MATERIAIS E MÉTODOS: Foram estudados 45 pacientes por meio de tomografia computadorizada de tórax durante quatro anos. RESULTADOS: Foram encontrados linfonodomegalia mediastinal e/ou hilar em 31 (68,8% dos casos, derrame pleural em 29 (64,4%, nódulos centrolobulares de distribuição segmentar em 26 (57,7%, consolidação em 24 (53,3%, confluência de micronódulos em 17 (37,7%, nódulos mal definidos com distribuição centrolobular em 16 (35,5%, padrão de "árvore em brotamento" em 13 (28,9%, espessamento de parede brônquica em 12 (26,6%, cavidade de parede espessa em 10 (22,2%, nódulos miliares em 9 (20% e bronquiectasias cilíndricas em 6 (13,3%. Dos 45 pacientes, 35 (77,8% apresentaram CD4 200 cel/mm³. CONCLUSÃO: Concluímos que neste estudo, diversamente do descrito na literatura, linfonodomegalia mediastinal e/ou hilar e consolidação foram significativamente mais frequentes em pacientes com CD4 > 200 cel/mm³. No entanto, linfonodos com centro hipodenso foram mais frequentemente observados em pacientes com severa imunodepressão, ou seja, CD4 < 200 cel/mm³.

  18. Reconstrução do seio maxilar atrófico com enxerto autólogo de crista ilíaca: avaliação por tomografia computadorizada e radiografia panorâmica Autologus crest iliac graft in the reconstruction of resorbed maxillary sinus: evaluation through computed tomography and panoramic radiography

    Directory of Open Access Journals (Sweden)

    André Luíz Zétola

    2002-02-01

    Full Text Available OBJETIVOS: As dificuldades para a utilização de implantes dentários osteointegrados em pacientes portadores de atrofia do seio maxilar justificaram o emprego de enxerto autólogo não vascularizado de crista ilíaca isolado ou associado à hidroxiapatita (HA em 14 pacientes submetidos a 25 procedimentos no Hospital das Nações, Curitiba, Paraná, portadores de atrofia do sinus maxilar. O objetivo foi avaliar comparativamente a precisão da tomografia computadorizada e da radiografia panorâmica, através da quantificação da neoformação óssea nesta estrutura. MÉTODOS: Foram selecionadas pacientes edentados, com altura óssea residual do rebordo gengival ao soalho do seio maxilar menor que 5mm. O enxerto medular de crista ilíaca fragmentada isolado ou misturado com HA foi colocado através da parede lateral no soalho atrófico da cuba maxilar por via submucosa. A avaliação quantitativa e qualitativa foi feita através da radiografia panorâmica e tomografia computadorizada, sendo utilizado na análise estatística a distribuição t de Student (prevalência de 0,05 para análise das variâncias, considerado que a leitura dos laudos radiológicos foi feita por dois especialistas, medindo a distância entre os pontos inferiores e superiores do enxerto no soalho do seio maxilar. RESULTADOS: Tivemos um ganho médio de 14,8mm em todos os procedimentos, com um erro maior que 3mm em 16 procedimentos (64% e incorporação satisfatória do enxerto ósseo suficiente para futuro implante dentário. CONCLUSÕES: A tomografia computadorizada foi o método de escolha na avaliação qualitativa e quantitativa da incorporação de enxerto autólogo não vascularizado em seio maxilar atrófico.BACKGROUND:There are different methods to evaluate bone grafts in the maxillary sinus. Panoramic radiography is the most common one, even though assessment could be difficult. Occasionaly computerized tomography (CTis another option but cost and radiation in

  19. ARS - Helsinki - 2006 / Galina Balashova

    Index Scriptorium Estoniae

    Balashova, Galina

    2006-01-01

    Steven Holli projekteeritud Kiasma muuseumihoonest Helsingis. Kontseptuaalkunsti näitusest ARS 06 "Reaalsustunne" Kiasmas. Eestlastest esineb Mark Raidpere. Vene kunstnikegrupi AEC+F ja vene kunstnike Juri Vassiljevi ning Aleksandr Ponomarjovi töödest näitusel. Ka Gerda Steineri & Jörg Lenzlingeri (Šveits), Martin & Munoz'i (USA, Hispaania), arvutigraafik Charles Sandisoni (SB), videokunstnik Bill Viola (USA) jt. töödest

  20. Ars Industrialis, arsindustrialis.org

    Directory of Open Access Journals (Sweden)

    Frédérique Mingant

    2012-03-01

    Full Text Available The arsindustrialis.org website was created in 2005, when the association Ars Industrialis came into being. The association was founded by a group of philosophers and jurists, on the initiative of philosopher Bernard Stiegler, the former director of the IRCAM (Institut de Recherche et Coordination Acoustique/Musique–Institute of Research and Coordination on Acoustic/Music and the current director of the Department of cultural development at the Centre Georges Pompidou (French National Arts C...

  1. arXiv.org and Physics Education

    Science.gov (United States)

    Ramlo, Susan

    2007-01-01

    The website arXiv.org (pronounced "archive") is a free online resource for full-text articles in the fields of physics, mathematics, computer science, nonlinear science, and quantitative biology that has existed for about 15 years. Available directly at http://www.arXiv.org, this e-print archive is searchable. As of Jan. 3, 2007, arXiv had open…

  2. Earthworm assemblages in an ecotone between forest and arable field and their relations with soil properties Comunidades de minhocas em um ecótono entre floresta e campo arável e suas relações com as propriedades do solo

    Directory of Open Access Journals (Sweden)

    Josef Zeithaml

    2009-08-01

    Full Text Available The objective of this work was to assess the effects of a forest-field ecotone on earthworm assemblages. Five sites (blocks differing in the type of crop rotation used in the field were studied in Central Bohemia, Czech Republic. In each block, sampling was carried out in seven parallel rows perpendicular to a transect from a forest (oak or oak-pine to the centre of a field, both in spring and autumn 2001-2003. Individual rows were located in the forest (5 m from the edge, in the forest edge, and in the field (at 5, 10, 25, 50 and 100 m distances from the forest edge. The density and biomass of earthworms were lowest in the forest, increased markedly in the forest edge, decreased again at 5 or 10 m distance from the forest edge and then continuously increased along the distance to the field boundary. The highest number of species was found in the forest edge and in the field boundary. Individual species differed in their distribution along the transect. Both density and biomass of earthworms were correlated with distance from forest edge, soil organic matter content, soil porosity, and water infiltration rate.O objetivo deste trabalho foi avaliar os efeitos de um ecótono entre floresta e campo arável sobre comunidades de minhocas. Cinco locais (blocos com diferentes tipos de rotação de culturas utilizados no campo foram estudados na Boêmia Central, República Tcheca. Em cada bloco, amostragens foram feitas em sete linhas paralelas perpendiculares a um transecto de floresta (carvalho ou carvalho e pinheiro, em direção ao centro de um campo, na primavera e no outono de 2001-2003. Linhas individuais foram marcadas na floresta (a 5 m da borda, na borda da floresta e no campo (a 5, 10, 25, 50 e 100 m da borda da floresta. A densidade e biomassa das minhocas foi menor na floresta, aumentou marcadamente na borda da floresta, decaiu novamente a 5 ou 10 m de distância da borda da floresta e aumentou continuamente com a distância até o limite do

  3. Exigências nutricionais da grápia ao fósforo e enxofre em Argissolo Vermelho distrófico arênico: efeito da adubação no crescimento Nutritional demand of grápia to phophorus and sulfur in paleaudalf soil: fertilization effects on growth

    Directory of Open Access Journals (Sweden)

    Evandro Luiz Missio

    2004-08-01

    Full Text Available A grápia (Apuleia leiocarpa Vog. Macbride é uma espécie de grande interesse madeireiro, encontrando-se, atualmente, bastante dizimada devido à exploração extrativista, sem haver reposição através de reflorestamento. O objetivo deste trabalho foi determinar os níveis ótimos de adubação de fósforo e enxofre no crescimento de plantas jovens de grápia. As plantas foram cultivadas em vasos contendo 3,5kg de solo Argissolo Vermelho distrófico arênico, sob condições de casa de vegetação não climatizada. O delineamento experimental foi o inteiramente casualizado com seis repetições. Foram avaliados 16 tratamentos em esquema bifatorial completo (4x4, representados pela combinação de quatro doses de P (0, 60, 120 e 180mg kg-1 e quatro de enxofre (0, 10, 20 e 30mg kg-1. A análise do crescimento das plantas foi realizada mensalmente através da altura da planta, diâmetro do caule e número de folhas remanescentes. Aos 130 dias após a emergência das plantas, avaliaram-se ainda o número de folhas caídas, matéria seca das folhas, caule, raízes e total da planta e a relação entre a matéria seca das raízes e da parte aérea. A produção de matéria seca total das plantas jovens de grápia respondeu positivamente à adubação conjunta de P e S, com dose de máxima eficiência técnica estimada de, respectivamente, 204 e 16mg kg-1 de solo. A adubação fosfatada na dose igual ou acima de 120mg kg-1 de solo induziu o aparecimento de clorose foliar típica da deficiência de Fe. A alta disponibilidade de P no solo favoreceu o crescimento da parte aérea em detrimento das raízes.Grápia (Apuleia leiocarpa Vog. Macbride is an important native forest species that has been in extinction process. The aim of this study was to determine the optimum levels of phosphorus and sulfur fertilization on the initial growth of grápia. Grápia plants were cultivated in pots containing 3.5kg of a Paleudalf soil, under unclimatized glasshouse

  4. Contribuição da tomografia de coerência óptica de 820 nm na distrofia granular corneana: relato de caso Contribution of 820 nm optical coherence tomography in granular corneal dystrophy: case report

    Directory of Open Access Journals (Sweden)

    Beatriz de Abreu Fiuza Gomes

    2008-10-01

    Full Text Available O objetivo deste trabalho é correlacionar os dados clínicos de um caso de distrofia granular com o exame de tomografia de coerência óptica (OCT de 820 nm de modo a determinar o nível intra-estromal dos depósitos corneanos. É relatado um caso de distrofia granular em paciente de 38 anos do sexo masculino. Foi realizado exame oftalmológico completo e OCT para documentação do caso. O aparelho utilizado foi o Stratus OCT III, originalmente desenvolvido para avaliação do segmento posterior. A acuidade visual corrigida foi de 20/50 em ambos os olhos. À biomicroscopia, foram observadas opacidades em "floco de neve" em diferentes níveis do estroma corneano bilateral e de forma simétrica. A avaliação pelo OCT revelou múltiplos pontos hiperreflectivos nas camadas superficiais e profundas do estroma. Foi possível acessar a anatomia morfológica da córnea através de cortes seriados realizados pelo Stratus OCT III e confirmar a profundidade dos depósitos corneanos.The purpose of this case report is to correlate clinical features of granular dystrophy using 820 nm optical coherence tomography (OCT in order to determine the depth of intrastromal corneal deposits. We report a case of a 38-year-old man with granular dystrophy. After complete ophthalmologic examination the patient was submitted to OCT, using the Stratus OCT III, originally proposed for studying disorders of the posterior segment. Best-corrected visual acuity was 20/50 in both eyes. Biomicroscopy revealed bilateral "snowflake"opacities in different levels of the stromal layer. OCT disclosed multiple hiperreflective dots in anterior and deeper stromal layers. It was possible to assess the morphology of the cornea and to determine the depth of the corneal deposits with serial cross-sectional OCT scans using the Stratus OCT III.

  5. Occurrences of Excess 40Ar in Hydrothermal Tourmaline:Interpretations from 40Ar-39Ar Dating Results by Stepwise Heating

    Institute of Scientific and Technical Information of China (English)

    QIU Huaning; PU Zhiping; DAI Tongmo

    2007-01-01

    The occurrences of excess 40Ar within a hydrothermal tourmaline is discussed in term of the analysis data of syngenetic muscovite and tourmaline from the Lushui hydrothermal tin-tungsten deposit in western Yunnan, China, using the 40Ar-39Ar stepwise heating technique. About 80% excess 40Ar was released in the last step when the tourmaline was fused, corresponding to a release of only ~3% 39Ar (K), which indicates that most excess 40Ar was held in the mineral lattice rather than in the channels parallel to the Z-axis. This suggests that the excess 40Ar was incorporated during crystallization and not diffused into the tourmaline during the post-crystallization history.

  6. A Refined Astronomically Calibrated 40Ar/39Ar Age for Fish Canyon Sanidine

    DEFF Research Database (Denmark)

    Rivera, Tiffany; Storey, Michael; Zeeden, Christian;

    2011-01-01

    , but more precise (±0.10%) than, the previous 40Ar/39Ar age determined by intercalibration with astronomically tuned tephras from the Melilla Basin (Morocco). Using this proposed age for FCs, combined with measurements using the A1Ts as the neutron fluence monitor, a weighted mean Bishop Tuff 40Ar/39Ar...

  7. Estudo da morfologia macular após a remoção da membrana epirretiniana idiopática utilizando a tomografia de coerência óptica (OCT: um estudo piloto Study on macular morphology after removal of the idiopathic epiretinal membrane using the optical coherence tomography (OCT: a pilot study

    Directory of Open Access Journals (Sweden)

    Janaína Jamile Ferreira Saraceno

    2007-12-01

    Full Text Available OBJETIVO: Descrever a relação entre os resultados visuais e a morfologia macular através da tomografia de coerência óptica (OCT em pacientes submetidos à remoção da membrana epirretiniana idiopática. MÉTODOS: Dez olhos de 10 pacientes com diagnóstico de membrana epirretiniana idiopática foram incluídos neste estudo. Todos os olhos foram submetidos à vitrectomia posterior via pars plana pelo mesmo cirurgião, durante o período de fevereiro de 2002 a março de 2004. A acuidade visual corrigida usando a tabela de Snellen, bem como a retinografia, a angiofluoresceinografia, a biomicroscopia de fundo e a tomografia de coerência óptica pré e pós-operatórios foram obtidos de todos os pacientes em todas as visitas. No estudo da tomografia de coerência óptica foram avaliadas três características em cada imagem: presença de depressão foveal, presença de edema macular cistóide e média da espessura central macular. RESULTADOS: A idade média dos pacientes foi de 63,3 anos (57 a 78. Cinco pacientes eram do sexo masculino e 5, do sexo feminino. A acuidade visual pré-operatória variou de 20/80 a conta dedos a 1 metro. A acuidade visual melhorou pelo menos duas linhas de visão em 8 olhos (80% e a metamorfopsia melhorou também na mesma proporção (80%. Quatro pacientes não apresentavam metamorfopsia com a tabela de Amsler, e os demais apresentavam melhora parcial. À tomografia de coerência óptica todos os olhos mantiveram o aumento da espessura central, variando de 232 a 605 µ (média= 351,9 µ. Três olhos mantiveram o edema macular cistóide. Quatro olhos apresentaram acuidade visual final melhor ou igual a 20/30. Neste grupo a média de espessura central foi de 277 µ (265 a 285 µ. A recuperação do contorno foveal foi observada em dois destes olhos. Nos quatro pacientes não havia edema macular cistóide residual. CONCLUSÃO: A tomografia de coerência óptica é uma ferramenta capaz de avaliar as altera

  8. A tomografia de córnea e segmento anterior na propedêutica do exame complementar na avaliação de ectasia

    Directory of Open Access Journals (Sweden)

    Bruno de Freitas Valbon

    2013-02-01

    Full Text Available Descrevemos a importância da tomografia de córnea e segmento anterior na propedêutica do exame complementar na avaliação de ectasia. Esta descrição da interpretação clínica dos índices da tomografia de córnea e segmento anterior (Pentacam - Oculus, Wetzlar, Germany neste relato de caso, demonstra a relevância de uma nova tecnologia na avaliação da córnea e segmento anterior na suspeita de ceratocone. O diagnóstico de ceratocone foi excluído pela análise dos índices tomográficos de ectasia. Detectou-se assimetria entre os lados nasal e temporal por meio da avaliação do mapa de profundidade de câmara anterior. No exame biomicroscópico sob midríase foi constatado subluxação do cristalino, sendo assim devemos estar atentos não somente aos índices tomográficos corneanos na avaliação do exame complementar e sim analisarmos outros dados importantes oferecidos pela tomografia de córnea e segmento anterior.

  9. Ars Memorativa, Ars Oblivionis in Middle English Religious Plays

    Directory of Open Access Journals (Sweden)

    Ciobanu Estella Antoaneta

    2015-12-01

    Full Text Available This paper investigates the multi-layered violence of religious representation in the late medieval York biblical plays, with a focus on the Supper at Emmaus. I read Emmaus (Y40, a play which commemorates the Crucifixion and openly encourages strong anti-Judaism, alongside scenes in an early predecessor pageant, The Crucifixion (Y35, within their contemporary devotional and mnemonic practices, i.e. the confessional Book of Margery Kempe and Thomas Bradwardine’s tract on ars memorativa. Emmaus in particular demonstrates how a fundamentally violent ars memorativa, the legacy of ancient rhetoric to the Middle Ages, also underpins the instruction of the laity in the basics of Christian faith, here with the aid of highly musical prosody and repetition, and thereby hones a biased, intolerant and violence-inured Christian collective memory. To study the York play’s position relative to late medieval mnemonic practices, I frame my analysis within memory studies, enriched with the more specific insights offered by social-psychological, neurobiological and cognitivist studies of memory.

  10. Tomografia por emissão de pósitrons (PET no tórax: resultados preliminares de uma experiência brasileira Thoracic positron emission tomography: preliminary results of a Brazilian experiment

    Directory of Open Access Journals (Sweden)

    MÁRIO TERRA FILHO

    2000-08-01

    Full Text Available Novos métodos não invasivos estão sendo desenvolvidos para a detecção de neoplasias malignas pulmonares. Dentre estes destaca-se a tomografia por emissão de pósitrons (PET, que utiliza como radiotraçador a deoxi-2-D glicose marcada com fluor-18 (FDG. Objetivo: Avaliar os resultados do FDG-PET, realizado em câmara híbrida com circuito de coincidência em pacientes portadores de doenças pleuropulmonares infecciosas ou tumorais. Material e Métodos: Foram avaliados 15 pacientes divididos em: grupo I – 5 portadores de tuberculose pulmonar, e grupo II – 10 pacientes com possíveis neoplasias pleuropulmonares. Após a administração endovenosa de 185MBq de FDG as aquisições foram feitas em câmara de cintilação ADAC Vertex Plus de duas cabeças. Resultados: No grupo I todos os exames foram positivos. No grupo II, após o estabelecimento diagnóstico por toracotomia em nove e mediastinoscopia em um, observaram-se: dois adenocarcinomas, dois granulomas, um hamartoma, um mesotelioma, uma atelectasia redonda, um carcinoma indiferenciado de pequenas células, um carcinoma indiferenciado de grandes células, uma antracose. Os exames foram positivos em seis pacientes (cinco neoplasias malignas e em um caso de granuloma e negativos nos outros quatro. Conclusão: O FDG-PET realizado através de câmara híbrida produz imagens de boa qualidade que permitem a identificação de processos infecciosos em atividade. O FDG-PET associado ao quadro clínico/radiológico pode diferenciar as neoplasias pulmonares malignas das benignas.New non-invasive methods have been developed to detect lung malignancies. One of them is positron emission tomography (PET using 18F 2-deoxy-D-glucose (FDG as a radiotracer. Objective: Evaluate the FDG-PET results performed through a hybrid coincidence–gamma camera in patients with pleuropulmonary infectious diseases or lung tumors. Material and methods: Fifteen patients were evaluated, and divided into: group I – five

  11. PF-AR upgrading project

    CERN Document Server

    Kasuga, T

    2002-01-01

    The upgrading project of the dedicated pulse X-ray source PF-AR has been completed by the end of the 2001 fiscal year. Machine commissioning exclusively using the injector linac was successfully accomplished in the beginning of January 2002. After fine tuning of the machine and cleaning of the vacuum system with the beams from the middle of January to the middle of March, routine operation for users has begun in April. The historical details, commissioning and results of the project are reported. (author)

  12. Avaliação da concordância interobservadores na análise da polipose nasossinusal por meio da tomografia computadorizada Evaluation of the concordance between observers in sinunasal polyposis through computed tomographic analysis

    Directory of Open Access Journals (Sweden)

    Elaine A. Mendes

    2004-08-01

    Full Text Available Polipose nasossinusal (PNS é uma entidade de etiologia controversa, caracterizada por uma condição inflamatória da superfície mucosa das fossas nasais e seios paranasais, bilateralmente. A queixa principal do paciente consiste na obstrução nasal e, ao exame físico, observam-se freqüentemente massas polipóides ocupando as cavidades nasais em extensões variáveis. Além da rinoscopia anterior e da endoscopia nasal, o uso da tomografia computadorizada (TC torna-se necessário para avaliação das fossas nasais e da presença ou não do acometimento dos seios paranasais por essas massas, bem como a sua extensão. Este trabalho tem como objetivo avaliar a concordância interobservadores, por meio da análise da tomografia computadorizada, de 32 casos de PNS. FORMA DE ESTUDO: Clínico prospectivo. CASUÍSTICA E MÉTODOS: Foram avaliadas 32 TC de pacientes portadores PNS por dois observadores experientes, separadamente, em relação à presença ou não de 3 sinais tomográficos sugestivos dessa doença: (1 alargamento infundibular do complexo ostiomeatal, (2 abaulamento lateral da lâmina papirácea e (3 apagamento do trabeculado ósseo etmoidal. RESULTADOS: Observou-se Qui-quadrado não significante para o primeiro e segundo sinais (p=0,7055 e p=0,2057 e significante para o terceiro (p=0,0040. Contudo, o coeficiente de correlação de Kendall entre os dois observadores foi significante para os três sinais tomográficos acima citados (pSinonasal polyposis (SNP is a condition with a controversial aethiology, known by bilaterally inflammatory mucous membranes of nasal and paranasal sinuses. The major patient's complaint is nasal obstruction, and polypoid masses in different sizes can be found during nasal cavity examination. Beyond anterior rhinoscophy and nasal endoscopy, screening sinus computed tomography (SSCT is necessary to measure the size and the extent of the polyps into nasal cavities and paranasal sinuses. The purpose of this

  13. Densidade de um planossolo sob sistemas de cultivo avaliada por meio da tomografia computadorizada de raios gama Bulk density of an alfisol under cultivation systems in a long-term experiment evaluated with gamma ray computed tomography

    Directory of Open Access Journals (Sweden)

    Adilson Luís Bamberg

    2009-10-01

    Full Text Available A sustentabilidade do arroz (Oryza sativa L. irrigado em solos de várzea está alicerçada na utilização da rotação e sucessão de culturas, fundamentais para o controle do arroz-vermelho e preto. Os reflexos sobre os atributos dos solos de várzea merecem estudos em especial sobre a compactação do solo. O objetivo deste trabalho foi identificar camadas compactadas em Planossolo submetido a diferentes sistemas de cultivo e preparo, avaliando-se a densidade do solo (Ds pela Tomografia Computadorizada de Raios Gama (TC. A análise foi realizada em um experimento de longa duração, conduzido de 1985 a 2004, na Estação Experimental da Embrapa Clima Temperado, Capão do Leão, RS, num delineamento experimental em blocos ao acaso, com sete tratamentos, cada um com quatro repetições (T1 - um ano de arroz com preparo convencional do solo seguido de dois anos de pousio; T2 - cultivo contínuo de arroz com preparo convencional do solo; T4 - rotação de arroz e soja (Glycine max L. com preparo convencional do solo; T5 - rotação de arroz, soja e milho (Zea maiz L. em preparo convencional do solo; T6 - plantio direto de arroz no verão em sucessão do azevém (Lolium multiflorum L. no inverno; T7 - rotação de arroz sob plantio direto e soja sob preparo convencional do solo; T8 - testemunha: solo sem cultivo. A Tomografia Computadorizada de Raios Gama permitiu detectar que o plantio direto de arroz no verão em sucessão do azevém no inverno não resultou na formação de camadas compactadas; a utilização de dois anos de pousio, no sistema de produção de arroz irrigado, não foi suficiente para evitar a formação de uma camada superficial compactada; e a rotação de arroz, soja e milho com preparo convencional do solo apresentou duas camadas compactadas (0,0 a 1,5 cm e 11 a 14 cm, indicando que essas podem limitar a produção agrícola nesse sistema de produção em Planossolos.The sustainability of irrigated rice (Oryza sativa L. in

  14. Avaliação da reprodutibilidade das medidas da camada de fibras nervosas retiniana e da cabeça do nervo óptico pela tomografia de coerência óptica

    Directory of Open Access Journals (Sweden)

    Ricardo Rau

    2012-10-01

    Full Text Available OBJETIVO: Determinar a reprodutibilidade da espessura da camada de fibras nervosas da retina peripapilar e dos parâmetros da cabeça do nervo óptico em olhos normais, utilizando a tomografia de coerência óptica de domínio espectral (SD-OCT. MÉTODOS: Trinta e quatro olhos de 34 indivíduos saudáveis foram incluídos no estudo. O protocolo do cubo do disco óptico 200x200 do OCT Cirrus foi utilizado para gerar 3 imagens de cada olho para avaliar a reprodutibilidade. O coeficiente de correlação intraclasse (ICC foi calculado para as medidas da espessura da camada de fibras nervosas da retina e da cabeça do nervo óptico. RESULTADOS: A correlação foi excelente para todas as medidas da espessura da camada de fibras nervosas da retina (ICC entre 0,87 e 0,98. O mesmo ocorreu com os parâmetros da cabeça do nervo óptico que, com exceção da razão E/D vertical (ICC 0,56, apresentou ICC entre 0,83 e 0,99. CONCLUSÃO: As medidas de espessura da camada de fibras nervosas da retina peripapilar e os parâmetros da cabeça no nervo óptico demonstraram uma excelente reprodutibilidade com o OCT Cirrus, indicando que este aparelho poderá ser uma ferramenta útil no estudo do glaucoma. Este estudo apresenta algumas limitações, como o pequeno número de casos avaliados, sendo necessários maiores estudos para corroborar nossos achados.

  15. 40Ar/39Ar dating of the Late Cretaceous

    International Nuclear Information System (INIS)

    As part of the wider European GTS Next project, I propose new constraints on the ages of the Late Cretaceous, derived from a multitude of geochronological techniques, and successful stratigraphic interpretations from Canada and Japan. In the Western Canada Sedimentary Basin, we propose a new constraint on the age of the K/Pg boundary in the Red Deer River section (Alberta, Canada). We were able to cyclo-stratigraphically tune sediments in a non-marine, fluvial environment utilising high-resolution proxy records suggesting a 11-12 precession related cyclicity. Assuming the 40Ar/39Ar method is inter-calibrated with the cyclo-stratigraphy, the apparent age for C29r suggests that the K/Pg boundary falls between eccentricity maxima and minima, yielding an age of the C29r between 65.89 ± 0.08 and 66.30 ± 0.08 Ma. Assuming that the bundle containing the coal horizon represents a precession cycle, the K/Pg boundary is within the analytical uncertainty of the youngest zircon population achieving a revised age for the K/Pg boundary as 65.75 ± 0.06 Ma. The Campanian - Maastrichtian boundary is preserved in the sedimentary succession of the Horseshoe Canyon Formation and has been placed 8 m below Coal nr. 10. Cyclo-stratigraphic studies show that the formation of these depositional sequences (alternations) of all scales are influenced directly by sea-level changes due to precession but more dominated by eccentricity cycles proved in the cyclo-stratigraphic framework and is mainly controlled by sand horizons, which have been related by auto-cyclicity in a dynamic sedimentary setting. Our work shows that the Campanian - Maastrichtian boundary in the Western Canada Sedimentary Basin coincides with 2.5 eccentricity cycles above the youngest zircon age population at the bottom of the section and 4.9 Myr before the Cretaceous - Palaeogene boundary (K/Pg), and thus corresponds to an absolute age of 70.65 ± 0.09 Ma producing an 1.4 Myr younger age than recent published ages

  16. Ars discendi, ars docendi : programme Pascal

    OpenAIRE

    Goyet, Thérèse

    2016-01-01

    Le latin de l’intitulé, c’est pour le plaisir, mais on peut lui donner quelques autres justifications. Ars évoque tout à la fois le savoir‑faire, le talent, la compétence professionnelle, le goût de la solution élégante. La parataxe permet le va-et-vient entre le thème et le prédicat (sujet et attribut). On interprétera au choix : savoir étudier, c’est savoir enseigner. Ou : pour apprendre, il faut enseigner ; ou : l’enseignement consiste en étude ; et d’autres variations communes sur une vér...

  17. The effects of retrograde reactions and of diffusion on 39Ar-40Ar ages of micas

    DEFF Research Database (Denmark)

    Allaz, Julien; Engi, Martin; Berger, Alfons;

    2011-01-01

    Effects of metamorphic reactions occurring during decompression were explored to understand their influence on 39Ar-40Ar ages of micas. Monometamorphic metasediments from the Lepontine Alps (Switzerland) were studied. Collected samples reached lower amphibolite facies during the Barrovian....... XRD-data indicated that some mineral separates prepared for Ar-Ar stepwise heating analysis were monomineralic, whereas others were composed of two white micas (muscovite with paragonite or margarite), or biotite and chlorite. In monomineralic samples 37Ar/39Ar and 38Ar/39Ar (proportional to Ca....../K and Cl/K ratios) did not change and the resulting ages can be interpreted unambiguously. In mineral separates containing two white micas, Ca/K and Cl/K ratios were variable, reflecting non-simultaneous laboratory degassing of the two heterochemical Ar-reservoirs. These ratios were used to identify each...

  18. Degeneração hepatolenticular: avaliação crítica dos critérios diagnósticos em 95 casos

    Directory of Open Access Journals (Sweden)

    Egberto Reis Barbosa

    1985-09-01

    Full Text Available O presente estudo teve como objetivo a análise crítica dos critérios diagnósticos na degeneração hepatolenticular (DHL. Foram estudados 95 casos de DHL, com enfoque na caracterização clínica e laboratorial da doença. No aspecto clínico foram analisadas a variabilidade quanto ao modo de instalação da moléstia e a freqüência do anel de Kayser-Fleischer (K-F. Em relação aos exames complementares foram analisados os níveis de ceruloplasmina, cobre sérico, cobre urinário e aminoacidúria, o estudo radiológico e cintilográfico do esqueleto, a tomografia computadorizada de crânio e a biópsia hepática. Em 54,4% dos casos o quadro clínico inicial foi neurológico, em 31,1% hepático, em 14,4% psiquiátrico, em 7,8% ostearticular, em 2,2% oftalmológico (anel de K-F, em 1,1% hematológico (anemia hemolítica e em 1,1% cardíaco. O anel de K-F estava presente em 84 dos 92 casos em que foi pesquisado (91,3%. Quanto aos resultados laboratoriais, hipoceruloplasminemia foi assinalada em 98,8% dos casos avaliados, hiperaminoacidúria em 94,7%, hipocupremia em 87,0%, hipercuprúria em 78,2%, osteoporose em 79,4%, alterações cintilográficas das articulações em 65,2%, e a tomografia de crânio, realizada em 11 casos, mostrava, em 2, áreas hipoatenuantes nos gânglios da base. Discute-se a importância dos exames complementares acima citados e do anel de K-F como elementos para a caracterização da DHL.

  19. Ars grammatica de Dionisio Tracio

    Directory of Open Access Journals (Sweden)

    Beltrán Jorge Enrique

    2003-06-01

    Full Text Available

    Ars Grammatica de Dionisio Tracio (170-90 a. C fue la primera gramática griega que se escribió. Su contenido y método fueron modelos que siguieron las gramáticas escolares posteriores. La versión española que se presenta ahora responde a la necesidad que se tenía en nuestro medio de una traducción completa de este texto. Finalmente, se acompaña la traducción de una introducción y de abundantes notas, en un intento por hacerla comprensible para el hablante del español, no necesariamente conocedor de la lengua griega.

  20. 40Ar/39Ar Interlaboratory Calibration into the Holocene.

    Science.gov (United States)

    Heizler, M. T.; Jicha, B.; Koppers, A. A. P.; Miggins, D. P.

    2015-12-01

    Advances in 40Ar/39Ar analytical precision for very young rocks requires collaborative efforts amongst argon geochronology labs to demonstrate age reproducibility commensurate with high precision. NM Tech (NMT), the University of Wisconsin (UW) and Oregon State University (OSU) have each dated Quaternary flux monitor standard AC-2 sanidine (~1.185 Ma), a blind sanidine described as being 50-100 ka (BS) and sanidine from the Qixiangshan (QIX) flow (~10 ka), Changbaishan volcano, China. The samples were irradiated in a single package with FC-2 sanidine (28.201 Ma) as the flux monitor and the irradiated material was distributed amongst the labs. Heizler was present during analysis at both OSU and UW and Jicha attended OSU during analysis. Physical presence was key towards gaining understanding of individual protocols and prompted valuable discussions. Analyses were carried out on single crystals using total fusion and/or step heating approaches. Age agreement was achieved within 2s uncertainty that ranged between (0.03-0.3%, 0.13-0.37% and 1.8-2.6%) for AC-2, BS and QIX, respectively. Each lab found AC-2 to vary somewhat beyond a normal distribution and to yield an age relative to FC-2 of ~1.185 Ma that is ~1.3% (~5-10 sigma) lower than some published estimates. A key cause of the variation between this study and previous results may be variable gas pressure equilibration times between extraction line and mass spectrometer coupled with variable choices to estimate time zero by other laboratories. The majority of our efforts concentrated on the QIX sanidine where prior data obtained by our labs revealed a factor of two spread in age (~11 and 23 ka) based on experiments carried out by total fusion and bulk incremental heating. By conducting single crystal age spectrum analysis we were able to mitigate effects of melt inclusion hosted excess argon and xenocrystic contamination towards obtaining analytical agreement with apparent ages near 10 ka. However, philosophical

  1. Prevalência de achados pulmonares em 55 pacientes com neoplasias esofagianas Prevalence of lung abnormalities in 55 patients with esophageal cancer

    OpenAIRE

    Tiago Alves de Brito Zan; Fabrício Corrêa de França; Marcos Pontes Muniz; José Antônio Cordeiro; Aldenis Albenese Borim; Patrícia Maluf Cury

    2005-01-01

    OBJETIVO: Identificar alterações pulmonares em pacientes com neoplasia esofágica. Comparar os dados obtidos, além de mostrar sua relação com o tabagismo. MATERIAIS E MÉTODOS: Estudo transversal tipo série de casos. Foram analisados prontuários e exames de imagem (tomografias computadorizadas e radiografias) de 55 pacientes com câncer de esôfago, diagnosticados entre 1998 e 2001, no Hospital de Base de São José do Rio Preto. Comparou-se a freqüência dos tumores encontrados e outras alterações ...

  2. Disgenesia do corpo caloso e más-formações associadas: achados de tomografia computadorizada e ressonância magnética Dysgenesis of the corpus callosum and associated malformations: computed tomography and magnetic resonance imaging findings

    Directory of Open Access Journals (Sweden)

    Cristiano Montandon

    2003-10-01

    Full Text Available O termo disgenesia do corpo caloso refere-se a uma má-formação deste com origem na embriogênese do telencéfalo. O relato analisa os achados de tomografia computadorizada e ressonância magnética em 11 pacientes com disgenesia calosa e em um caso de corpo caloso normal com lipoma associado. Esta pode ser distinguida em três grupos: agenesia total (três casos, agenesia parcial (seis casos e hipoplasia (dois casos. Anomalias associadas foram observadas em nove casos, incluindo má-formação de Chiari tipo II (um caso, esquizencefalia (um caso, cisto inter-hemisférico (dois casos, heterotopia nodular (um caso, cisto de Dandy-Walker (um caso e lipoma do corpo caloso (quatro casos. Este artigo demonstra um espectro destes distúrbios, auxiliando na sua interpretação diagnóstica.Callosal dysgenesis is a malformation of the corpus callosum with origins in the embryogenesis of the telencephalon. We reviewed the computed tomography and magnetic resonance imaging findings of 11 patients with callosal dysgenesis and one patient with normal corpus callosum associated with a lipoma. The patients were divided into three distinct groups: total agenesis (three patients, partial agenesis (six patients and hypoplasia (two patients. Associated abnormalities were observed in nine patients, including Chiari II malformation (one patient, schizencephaly (one patient, interhemispheric cyst (two patients, Dandy-Walker cyst (one patient, nodular heterotopy (one patient and lipoma of the corpus callosum (four patients. This paper presents a review that may contribute to the diagnosis of these disorders.

  3. Dose optimization in adult patients exams in a computerized tomography service; Otimizacao de dose em exames de pacientes adultos em um servico de tomografia computadorizada

    Energy Technology Data Exchange (ETDEWEB)

    Pimentel, Juliana; Finatto, Jerusa D.; Silva, Ana Maria Marques da, E-mail: ana.marques@pucrs.br [Pontificia Universidade Catolica do Rio Grande do Sul (PUCRS), Porto Alegre, RS (Brazil); Froner, Ana Paula P. [CDI Tomografia e Ressonancia Magnetica, Porto Alegre, RS (Brazil)

    2013-08-15

    This paper presents a study of dose optimization in computed tomography X-ray of skull, chest and abdomen of adult patients, performed in a diagnostic imaging service in a large hospital. Images of a simulated dose phantom were acquired and the kVp, mAs, pitch, thickness and CTDI{sub vol} were collected directly from the equipment. Using the PACS system, regions of interest were delineated, where the mean and standard deviation of CT numbers for each protocol were been calculated. The optimization took into account the maintenance of the CT number and noise from images acquired with clinical protocols. It was observed that the protocols used in the service, in general, exhibit a low dose, despite the great variability among the different professional shifts. In examinations of the chest, skull and abdomen, changes in the values of mAs and pitch were suggested, allowing dose reductions (60%, 17% and 19%, respectively), without compromising the image diagnostic quality. (author)

  4. Preliminary tests in skull pediatric phantom for dosimetry in computerized tomography; Testes preliminares em um simulador pediatrico de cranio para dosimetria em tomografia computadorizada

    Energy Technology Data Exchange (ETDEWEB)

    Martins, Elaine Wirney; Potiens, Maria da Penha de A., E-mail: elainewirney@uso.br, E-mail: mppalbu@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2014-07-01

    Computed tomography (CT) is one of the techniques in the field of radiology with striking technological advance in recent years. One reason for this was the increased number of channels associated with the increased power of the X-ray tube. These conditions allowed the equipment high speed in the acquisition of the cuts, reducing the patient exposure time essential characteristic for the increase of its use in pediatric patients. In this context, were developed a new pediatric skull simulator to analyze the results of measurements performed in laboratory and clinic beams with the objective of creation and use of diagnostic reference levels observing risks stochastic effects and assessing the reduction of absorbed doses in patients undergoing growing. Preliminary tests performed in clinical beams showed C{sub w} values: 2.525 ± 0.212 mGy for the developed simulator quoted and 3.362 ± 0.282 mGy for a simulator developed by IPEN called standard, both being between uncertainty values of 8.4% and 14.4% suggested by TRS number 457.

  5. Relação entre área e volume da mastoide em adultos brasileiros

    Directory of Open Access Journals (Sweden)

    Marco Antônio Rios Lima

    2013-08-01

    Full Text Available As medidas de área e volume da mastoide por tomografia computadorizada não foram previamente descritas em adultos brasileiros. O conhecimento dessas medidas é muito importante para o entendimento da fisiologia da orelha média e seus estados patológicos, refletindo diretamente na pneumatização mastoídea. OBJETIVO: Verificar a existência de relação entre a área e o volume da mastoide. MÉTODO: Estudo de coorte contemporânea com corte transversal, no qual 28 pacientes foram submetidos à tomografia de mastoides. Foram reconstruídas as medidas de área e volume das mastoides por cortes seriados usando o software Image Pro Plus. RESULTADOS: Os volumes das mastoides variaram de 5,5 até 72,4 cm³. As áreas variaram de 43,9 até 525,2 cm². A área da mastoide foi uma função linear do volume. CONCLUSÃO: As medidas de área e volume da mastoide em adultos brasileiros seguem uma correlação linear, concordando com estudos realizados em outros países. As médias de área e volume encontradas foram superiores às previamente publicadas, ao contrário da média da relação área/volume, que foi inferior. Futuros estudos, com número maior de indivíduos, poderão esclarecer se a população brasileira tem ou não maiores médias de área e volume da mastoide em relação a outras populações específicas.

  6. Efeito da rega com injecção de ar na humidade do solo, dis­ponibilidade de azoto nítrico, condutividade eléctrica e pro­dutividade da alface cultivada em estufa plástica Effects of irrigation with injection of air in soil moisture, nitrate avail­ability, electrical conductivity and lettuce productivity grown in plastic greenhouse

    Directory of Open Access Journals (Sweden)

    C.R. Pivetta

    2010-01-01

    Full Text Available Este trabalho teve como objectivo veri­ficar se a injecção de ar junto a água de rega gota-a-gota enterrada, afecta a humi­dade do solo, a disponibilidade de azoto nítrico, a condutividade eléctrica e o cres­cimento e produtividade da alface. Para tal realizou-se um ensaio com a alface variedade “Mention” cultivada em estufa plástica e localizada na Herdade Experi­mental da Mitra-ICAAM, da Universida­de de Évora -Portugal. Utilizou-se o deli­neamento experimental blocos ao acaso com quatro repetições, com os tratamen­tos: rega com injecção de ar (CAR, e rega sem injecção de ar (SAR. O ar foi introdu­zido na água de rega por meio de um injector “Mazzei”. O teor de humidade na camada superficial (0-0,05 m foi seme­lhante para os dois tratamentos, alcançan­do valores em torno de zero. Em termos de concentração de azoto nítrico (NO 3- os valores observados na camada 0,10­0,20 m, aos 35 e 47 dias após a transplan­tação, foram mais elevados no tratamento CAR. Aos 47 dias após a transplantação, os níveis médios de NO3-foram de 95,33 e 67,94 ppm nos tratamentos CAR e SAR, respectivamente. A densidade radical no tratamento CAR na camada de 0-0,10 m do solo foi 34 % superior em relação ao SAR. A produção comercial não foi afectada pelo tratamento. A falta de resposta da cultura ao acréscimo de azoto nítrico e da densidade radical pode estar relacionada com o curto ciclo da cultura e/ou com o elevado teor de azoto presente no solo, ou ainda com a profundidade que os goteja­dores foram instalados e não com a fun­cionalidade do injector de ar.The objective of the present study was to evaluate the effect of the air injection through subsurface drip irrigation (oxyga­tion in soil moisture, availability of nitro­gen oxide, and electrical conductivity, plant growth and yield of lettuce, variety "Men­tion", cultivated in plastic greenhouse. The experiment was carried out at the Mitra-ICAM, an Experimental

  7. Complicações respiratórias em pacientes com paralisia cerebral submetidos à anestesia geral Complicaciones respiratorias en pacientes con parálisis cerebral sometidos a la anestesia general Respiratory complications in patients with cerebral palsy undergoing general anesthesia

    OpenAIRE

    Sérgio Silva de Mello; Ronaldo Soares Marques; Renato Ângelo Saraiva

    2007-01-01

    JUSTIFICATIVA E OBJETIVOS: Anestesia em pacientes com paralisia cerebral (PC) pode representar um desafio para o anestesiologista. Este estudo prospectivo teve como objetivo determinar a prevalência e o risco de complicações respiratórias em crianças com PC submetidas à anestesia geral inalatória (AGI) para tomografia computadorizada (TC). MÉTODO: Participaram do estudo pacientes com idades entre 1 e 17 anos, estado físico ASA I a III, submetidos a AGI com sevoflurano e máscara laríngea para ...

  8. Computerized tomography findings in Fahr's syndrome Achados da tomografia computadorizada na síndrome de Fahr

    Directory of Open Access Journals (Sweden)

    Andréia V. Faria

    2004-09-01

    Full Text Available We analyzed computerized tomography (CT findings in six patients with Fahr's syndrome. They presented calcifications in basal ganglia, dentate nucleus, subcortical region and semioval center, due to alteration in calcium metabolism or due to senile relative hypoxemic state. The image pattern was not strictly related with etiology, although some differences in dystrophic senile calcifications (the only one present in semioval center and absent in subcortical region. CT is an easy exam, has maximum sensitivity and allows diagnosis, contributing to early treatment of many etiologies of Fahr's syndrome.Analisamos os achados de tomografia computadorizada (TC de seis pacientes com síndrome de Fahr. Eles apresentaram calcificações nos gânglios da base, núcleo denteado, região subcortical e centro semi-oval, devidas a distúrbios no metabolismo do cálcio ou a estado de hipóxia relativa, por senilidade. O padrão de imagem não apresenta relação clara com a etiologia, apesar de algumas diferenças no caso das calcificações distróficas senis (as únicas presentes nos centros semi-ovais e ausentes na região subcortical. TC é um exame de fácil realização, máxima sensibilidade e permite o diagnóstico, contribuindo para o tratamento precoce de muitas das etiologias da síndrome de Fahr.

  9. 244-AR Vault Interim Stabilization Project Plan

    International Nuclear Information System (INIS)

    The 244-AR Vault Facility, constructed between 1966 and 1968, was designed to provide lag storage and treatment for the Plutonium-Uranium Extraction Facility (PUREX) tank farm sludges. Tank farm personnel transferred the waste from the 244-AR Vault Facility to B Plant for recovery of cesium and strontium. B Plant personnel then transferred the treatment residuals back to the tank farms for storage of the sludge and liquids. The last process operations, which transferred waste supporting the cesium/strontium recovery mission, occurred in April 1978. After the final transfer in 1978, the 244-AR facility underwent a cleanout. However, 2,271 L (600 gal) of sludge were left in Tank 004AR from an earlier transfer from Tank 241-AX-104. When the cleanout was completed, the facility was placed in a standby status. The sludge had been transferred to Tank 004AR to support Pacific Northwest National Laboratory [PNNL] vitrification work. Documentation of waste transfers suggests that a portion of the sludge may have been moved from Tank 004AR to Tank 002AR in preparation for transfer back to the AX Tank Farm; however, quantities of the sludge that were moved to Tank 002AR from that transfer must be estimated

  10. Study of the symbiotic star AR Pavonis

    Directory of Open Access Journals (Sweden)

    C. Quiroga

    2001-01-01

    Full Text Available We present a study of the optical spectra and linear polarization of the eclipsing binary AR Pavonis. The optical spectra were obtained between 1990 and 1998, and polarimetric data between 1995 and 1998. From spectroscopic variations along the orbital motion we analized the nature of the system. Polarimetric studies indicate that AR Pav has intrinsic polarization.

  11. Remoção dos compostos odoríferos geosmina e 2-metilisoborneol de águas de abastecimento através de processos de aeração em cascata, dessorção por ar e nanofiltração Removal of the odoriferous compounds geosmin and 2-methylisoborneol from drinking water by the processes of cascade aeration, air strippingand nanofiltration

    Directory of Open Access Journals (Sweden)

    Michely Zat

    2011-12-01

    Full Text Available Atividades humanas aceleram o processo natural de eutrofização das águas, favorecendo a floração de algas e cianobactérias. Estes organismos emitem os compostos 2-metilisoborneol (MIB e geosmina, que conferem gosto e odor de mofo e terra à água. A presença destes compostos se estende à água potável uma vez que os processos convencionais de tratamento são insuficientes para removê-los. Esta pesquisa foi realizada com o objetivo de avaliar alternativas de processos de tratamento para a remoção de MIB e geosmina da água. Os processos estudados foram aeração em cascata, dessorção por ar e nanofiltração. Os resultados sugerem a possibilidade de remoção quase total de MIB e geosmina da água através do sistema de nanofiltração, enquanto que os processos baseados em aeração e dessorção foram relativamente ineficientes.Human activities accelerate the natural process of eutrophication, favouring the occurrence of algae and cyanobacterial blooms. These organisms emit the compounds 2-methylisoborneol (MIB and geosmin, which confer earthy and moldy taste and odor to water. The presence of MIB and geosmin is extended to drinking water inasmuch they are not completely removed by the processes used in conventional treatment. This research was conducted to evaluate the capability of alternative treatment processes to remove MIB and geosmin from water. The processes studied were cascade aeration, air stripping, and nanofiltration. The results suggested that MIB and geosmin can be almost completely removed by nanofiltration, while the processes based on aeration and stripping were relatively inefficient.

  12. Evaluation of dosimetric techniques in positrons emission tomography and computerized tomography (PET/CT); Avaliacao de tecnicas dosimetricas em tomografia por emissao de positrons e tomografia computadorizada (PET/CT)

    Energy Technology Data Exchange (ETDEWEB)

    Pinto, Gabriella Montezano

    2014-09-01

    Among diagnostic techniques PET/CT is one of those with the highest dose delivery to the patient as a cause of external exposure to X-rays, and the use of a radiopharmaceutical that results in a high energy gamma emission. The dosimetry of these two components becomes important in order to optimize and justify the technique. Various dosimetric techniques are found in literature without a consensus of the best to use. With the advances in technological and consequent equipment configuration changes, upgrades and variation in methodologies, particularly in computed tomography, a standardization of these techniques is required. Previous studies show that CT is responsible for 70 % of the dose delivered to the patient in PET/CT examinations. Thus, many researchers have been focused on CT dose optimization protocols studies. This work analyzes the doses involved in a PET/CT oncology protocol by using an Alderson female anthropomorphic phantom in a public hospital of Rio de Janeiro city. The dose estimate for PET examination resulting from the use of {sup 18}F - FDG radiopharmaceutical was conducted through dose factors published in ICRP 106; the dose for CT was estimated and compared by calculation of the absorbed doses to patients according to four methods: thermoluminescent dosimetry (TL0100) distributed in critical organs of the Alderson phantom; measurements of CTOI according to AAPM number 96; correction factor for effective diameter SSOE (AAPM Number 204); and simulation by ImPACT program For CT, the results in terms of effective dose presented (TLO, CTOI and ImPACT) ± 5 % maximum variations between methodologies. Considering medium absorbed dose (TLO, SSOE and ImPACT) the results differed in ± 7 % from each other. These findings demonstrate that parameters provided by the manufacturer on the console can be used to have a primary approach of both, absorbed and effective doses to the patient since that a quality assurance program of these parameters are adopted in clinical routine. The organs receiving the highest equivalent doses in PET/CT examinations were bladder (64 mSv) and heart (41 mSv). The eye lens received equivalent dose of 17 mSv, and other radiosensitive organs such as uterus and breast received 17 and 13 mSv, respectively. The effective doses also showed a little variation among methodologies with doses around 20 mSv, demonstrating that this parameter not address the worst case and that the dose analysis for critical organs in a PET/CT examination is necessary. (author)

  13. The Coronae of AR Lac

    CERN Document Server

    Huenemoerder, D P; Drake, J J; Sanz-Forcada, J; Canizares, Claude R.; Drake, Jeremy J.; Huenemoerder, David P.; Sanz-Forcada, Jorge

    2003-01-01

    We observed the coronally active eclipsing binary, AR Lac, with the High Energy Transmission Grating on Chandra for a total of 97 ks, spaced over five orbits, at quadratures and conjunctions. Contemporaneous and simultaneous EUV spectra and photometry were also obtained with the Extreme Ultraviolet Explorer. Significant variability in both X-ray and EUV fluxes were observed, dominated by at least one X-ray flare and one EUV flare. We saw no evidence of primary or secondary eclipses. X-ray flux modulation was largest at high temperature, indicative of flare heating of coronal plasma. Line widths interpreted in terms of Doppler broadening suggest that both binary stellar components are active. From line fluxes obtained from total integrated spectra, we have modeled the emission measure and abundance distributions. A strong maximum was found in the differential emission measure, characterized by peaks at log T = 6.9 and 7.4, together with a weak but significant cooler maximum near log T=6.2, and a moderately str...

  14. Revised error propagation of 40Ar/39Ar data, including covariances

    Science.gov (United States)

    Vermeesch, Pieter

    2015-12-01

    The main advantage of the 40Ar/39Ar method over conventional K-Ar dating is that it does not depend on any absolute abundance or concentration measurements, but only uses the relative ratios between five isotopes of the same element -argon- which can be measured with great precision on a noble gas mass spectrometer. The relative abundances of the argon isotopes are subject to a constant sum constraint, which imposes a covariant structure on the data: the relative amount of any of the five isotopes can always be obtained from that of the other four. Thus, the 40Ar/39Ar method is a classic example of a 'compositional data problem'. In addition to the constant sum constraint, covariances are introduced by a host of other processes, including data acquisition, blank correction, detector calibration, mass fractionation, decay correction, interference correction, atmospheric argon correction, interpolation of the irradiation parameter, and age calculation. The myriad of correlated errors arising during the data reduction are best handled by casting the 40Ar/39Ar data reduction protocol in a matrix form. The completely revised workflow presented in this paper is implemented in a new software platform, Ar-Ar_Redux, which takes raw mass spectrometer data as input and generates accurate 40Ar/39Ar ages and their (co-)variances as output. Ar-Ar_Redux accounts for all sources of analytical uncertainty, including those associated with decay constants and the air ratio. Knowing the covariance matrix of the ages removes the need to consider 'internal' and 'external' uncertainties separately when calculating (weighted) mean ages. Ar-Ar_Redux is built on the same principles as its sibling program in the U-Pb community (U-Pb_Redux), thus improving the intercomparability of the two methods with tangible benefits to the accuracy of the geologic time scale. The program can be downloaded free of charge from

  15. Osteoporose vs. doença de Alzheimer e Parkinson usando a tomografia computorizada quantitativa

    OpenAIRE

    Rodrigues, José Artur Oliveira

    2013-01-01

    Dissertação de mestrado integrado em Engenharia Biomédica A osteoporose é reconhecida como um dos maiores problemas de saúde pública devido à elevada taxa de morbilidade e mortalidade e aos custos associados com a descalcificação dos ossos, originando fraturas ósseas. É uma doença caracterizada por uma densidade mineral óssea diminuída e por uma microdeterioração do tecido ósseo que conduzem a um aumento da fragilidade óssea e a um consequente aumento do risco de fraturas. A...

  16. Efeito da adição de polpa, carboximetilcelulose e goma arábica nas características sensoriais e aceitação de preparados em pó para refresco sabor laranja Effect of adding pulp, carboxymethyl cellulose and arabic gum to sensory characteristics and acceptance of powdered orange-flavored refreshments

    Directory of Open Access Journals (Sweden)

    Valentina de Fátima Caleguer

    2007-06-01

    Full Text Available O trabalho teve como objetivo avaliar o efeito sensorial da adição de polpa, carboximetilcelulose (CMC e goma arábica (fibra nos atributos e aceitação de refrescos de laranja. Utilizou-se uma amostra padrão e outras formuladas com polpa, CMC, fibra e todos os ingredientes. Foram realizadas análises físico-químicas (pH, acidez titulável, sólidos solúveis, vitamina C, cor e turbidez, e as amostras também foram caracterizadas pela técnica de Perfil Livre. Na análise descritiva utilizou-se 14 provadores e, para a avaliação dos resultados foi empregada a Análise Procrustes Generalizada. As amostras caracterizadas como diferentes (padrão, CMC, fibra foram submetidas a teste de aceitação. Os refrescos foram caracterizados e separados com base em atributos de aparência (cor laranja e turbidez, aroma (adocicado e laranja, sabor (doce, laranja e ácido e textura (viscosidade. O padrão e a amostra com polpa, que não foram diferenciadas sensorialmente, apresentaram menor intensidade de cor laranja e turbidez, e foram consideradas menos encorpadas e mais ácidas. As amostras com CMC e fibra se diferenciaram do padrão e apresentaram comportamento intermediário. A formulação com todos os ingredientes apresentou características opostas: maior intensidade de cor e turbidez, mais encorpada e menos ácida. As amostras com CMC e fibra foram mais aceitas que o padrão.The aim of this work was to evaluate the sensory effect of adding pulp, carboxymethyl cellulose (CMC and arabic gum (fiber to characteristics and acceptance of powdered orange flavored soft drinks. A standard sample and another formulated with pulp, CMC, fiber with all the ingredients were used. Physicochemical analyses (pH, titratable acidity, soluble solids, vitamin C, color and turbidity were applied and samples were characterized by Free-Choice Profiling. Fourteen panelists were used in the descriptive analysis and the Generalized Procrustes Analysis was applied to

  17. 40Ar/39Ar ages of lunar impact glasses: Relationships among Ar diffusivity, chemical composition, shape, and size

    CERN Document Server

    Zellner, N E B

    2015-01-01

    Lunar impact glasses, quenched melts produced during cratering events on the Moon, have the potential to provide not only compositional information about both the local and regional geology of the Moon but also information about the impact flux over time. We present in this paper the results of 73 new 40Ar/39Ar analyses of well-characterized, inclusion-free lunar impact glasses and demonstrate that size, shape, chemical composition, fraction of radiogenic 40Ar retained, and cosmic ray exposure (CRE) ages are important for 40Ar/39Ar investigations of these samples. Specifically, analyses of lunar impact glasses from the Apollo 14, 16, and 17 landing sites indicate that retention of radiogenic 40Ar is a strong function of post-formation thermal history in the lunar regolith, size, and chemical composition. Based on the relationships presented in this paper, lunar impact glasses with compositions and sizes sufficient to have retained 90% of their radiogenic Ar during 750 Ma of cosmic ray exposure at time-integra...

  18. 40Ar/39Ar and K-Ar data bearing on the metamorphic and tectonic history of western New England.

    Science.gov (United States)

    Sutter, J.F.; Ratcliffe, N.M.; Mukasa, S.B.

    1985-01-01

    40Ar/39Ar ages of coexisting biotite and hornblende from Proterozoic Y gneisses of the Berkshire and Green Mt massifs, as well as 40Ar/39Ar and K/Ar mineral and whole-rock ages from Palaeozoic metamorphic rocks, suggest that the thermal peaks for the dominant metamorphic recrystallization in western New England occurred 465 + or - 5 m.y. (Taconian). 40Ar/39Ar age data from a poorly-defined terrain along the eastern strip of the area suggests that the area has been retrograded during a metamorphism that peaked at least 376 + or - 5 m.y. (Acadian). Available age and petrological data from western New England indicate the presence of at least three separate metamorphic-structure domains of Taconic age: 1) a small area of relict high-P and low-T metamorphism, 2) a broad area of normal Barrovian metamorphism from chlorite to garnet grade characterized by a gentle metamorphic gradient and, 3) a rather narrow belt of steep-gradient, Barrovian series metamorphic rocks. Areas of maximum metamorphic intensity within the last domain coincide with areas of maximum crustal thickening in the later stage of Taconic orogeny. -L.di H

  19. Biópsia percutânea de lesões ósseas guiada por tomografia computadorizada: taxas de definição diagnóstica e complicações

    Directory of Open Access Journals (Sweden)

    Macello Jose Sampaio Maciel

    2014-10-01

    Full Text Available Objetivo: Determinar taxas de definição diagnóstica e complicações da biópsia percutânea guiada por tomografia computadorizada (TC de lesões ósseas suspeitas de malignidade. Materiais e Métodos: Estudo retrospectivo que incluiu 186 casos de biópsia percutânea guiada por TC de lesões ósseas no período de janeiro de 2010 a dezembro de 2012. Todas as amostras foram obtidas usando agulhas de 8 a 10 gauge. Foram coletados dados demográficos, história de neoplasia maligna prévia, dados relacionados à lesão, ao procedimento e ao resultado histológico. Resultados: A maioria dos pacientes era do sexo feminino (57% e a idade média foi 53,0 ± 16,4 anos. Em 139 casos (74,6% a suspeita diagnóstica era metástase e os tumores primários mais comuns foram de mama (32,1% e próstata (11,8%. Os ossos mais envolvidos foram coluna vertebral (36,0%, bacia (32,8% e ossos longos (18,3%. Houve complicações em apenas três pacientes (1,6%, incluindo uma fratura, um caso de parestesia com comprometimento funcional e uma quebra da agulha necessitando remoção cirúrgica. Amostras de 183 lesões (98,4% foram consideradas adequadas para diagnóstico. Resultados malignos foram mais frequentes nos pacientes com suspeita de lesão secundária e história de neoplasia maligna conhecida (p < 0,001 e nos procedimentos orientados pela PET/CT (p = 0,011. Conclusão: A biópsia percutânea guiada por TC é segura e eficaz no diagnóstico de lesões ósseas suspeitas.

  20. Trabalho em equipa

    OpenAIRE

    Antunes, Andreia Sofia Duarte

    2016-01-01

    O presente relatório de estágio tem como tema principal o trabalho em equipa. Aborda com mais pormenor o subtema dos momentos de reflexão na equipa pedagógica. Ao longo do estudo são vários os conceitos abordados e a interligação entre os mesmos. Pretendo dar a conhecer a temática em questão e conceções que lhe estão naturalmente associadas. Sendo um estudo investigativo são abordados os métodos utilizados ao longo de toda a investigação. Com este relatório pretende-se alcançar qual ...

  1. Effects of shock pressure on 40Ar-39Ar radiometric age determinations

    International Nuclear Information System (INIS)

    The relation of shock to the drop in the 40*Ar/39*Ar ratio seen at high release temperatures in some neutron-irradiated lunar samples is investigated through measurements of the 40*Ar/39*Ar ratio in gas samples released by stepwise heating of rock samples previously subjected to shock, either in the laboratory or in nature. Explosives were used to shock solid pieces and powder of a basalt from a diabase dike in Liberia to calculated pressures of 65, 150 and 270 kbar. These, an unshocked sample of the powder, two naturally shocked samples from the Brent impact crater in Canada, one unshocked sample from near the crater, and appropriate monitors were irradiated. Ar from stepwise heating was analyzed. The unshocked basalt shows a good 40*Ar/39*Ar plateau at age 198 +-9 m.y. in agreement with a previous result of 186 +- 2 m.y. The shocked samples contain varying amounts of implanted atmospheric Ar, the isotopes of which have experienced mass fractionation. This effect is small enough in four samples so that the linearity of their graphs of 39*Ar/40Ar vs 36Ar/40Ar is evidence of a plateau. The ages of these samples are then 201 +- 10, 205 +- 12 and 201 +-9 m.y. It appears that the shock has had little effect on the 40Ar-39Ar age spectrum, although the release patterns of the 39*Ar are shifted downward by the order of 2000C. Shock implantation of Ar was at lower shock pressure, in the presence of less Ar, and into a less porous material than previously demonstrated. The Brent Crater samples do not all show good plateaus, but do indicate an age of 420 m.y. for the crater event and 795 +- 24 m.y. for the rock formation, in agreement with previous results. None of the 40*Ar/39*Ar profiles shows a drop at high temperature, but a possible role of shock implantation of Ar is indicated in the production of this effect. Further experiments are suggested. (author)

  2. Spatial evaluation of Ar-systematics in rocks from the British Channel Islands: a UV laserprobe Ar/Ar study of excess 40Ar

    Science.gov (United States)

    Schwenzer, S. P.; Sherlock, S.; Kelley, S. P.

    2010-12-01

    The Ar-Ar method is a powerful tool for constraining thermal histories of metamorphic and plutonic rocks, most commonly undertaken on potassium rich mineral separates rather than whole rocks. While this approach usually yields reasonable thermal histories, it is rarely as precise as dating volcanics, and such rocks are also frequently contaminated by excess argon, artificially elevating the Ar-Ar ages. Understanding the evolution of excess argon represents a challenge; whilst it is possible to discern the ‘sink’ as the host mineral now contaminated by excess argon, examining the ‘source’ and ‘transport’ mechanism is more challenging. The approach we have taken here is to combine measurements of potassium rich and potassium poor minerals to understand the argon reservoirs and argon transfer between minerals, grain boundaries and fluids. Considering the system as a whole provides a method for understanding the complete history of the rock and thus assessing any interactions which may impact on the interpretation of ages and thermal history [Kelley, 2002, Chem. Geol. 188]. Here we have studied a series of plutonic and metamorphic basement samples from the British Channel Islands with different ages and post-emplacement histories, namely Icart Gneiss, Perelle Quartz Diorite, L’Ancresse Granodiorite, and Bordeaux Diorite. The formation age of Icart Gneiss is ~2000 Ma [D’Lemos et al., 1990, Geol. Soc. Spec. Pub. 51]. Ar-Ar ages of hornblendes and biotites from quartz diorites on Guernsey and Sark range between 606 and 596 Ma [Dallmeyer et al. 1991, J. Geol. Soc. London 148], whilst U-Pb zircon ages are in the range 710 to 613 Ma [Dallmeyer et al. 1991; Samson & D’Lemos 1998, J. Geol. Soc. London 155; Miller et al. 1999, Tectonophysics 132]. Detailed petrograpic (microscope, electron microprobe) investigations established the crystallization and deformation history of the samples, and revealed that post-magmatic alteration is unevenly distributed. This

  3. 40Ar/39Ar ages of lunar impact glasses: Relationships among Ar diffusivity, chemical composition, shape, and size

    Science.gov (United States)

    Zellner, N. E. B.; Delano, J. W.

    2015-07-01

    Lunar impact glasses, which are quenched melts produced during cratering events on the Moon, have the potential to provide not only compositional information about both the local and regional geology of the Moon but also information about the impact flux over time. We present in this paper the results of 73 new 40Ar/39Ar analyses of well-characterized, inclusion-free lunar impact glasses and demonstrate that size, shape, chemical composition, fraction of radiogenic 40Ar retained, and cosmic ray exposure (CRE) ages are important for 40Ar/39Ar investigations of these samples. Specifically, analyses of lunar impact glasses from the Apollo 14, 16, and 17 landing sites indicate that retention of radiogenic 40Ar is a strong function of post-formation thermal history in the lunar regolith, size, and chemical composition. This is because the Ar diffusion coefficient (at a constant temperature) is estimated to decrease by ∼3-4 orders of magnitude with an increasing fraction of non-bridging oxygens, X(NBO), over the compositional range of most lunar impact glasses with compositions from feldspathic to basaltic. Based on these relationships, lunar impact glasses with compositions and sizes sufficient to have retained ∼90% of their radiogenic Ar during 750 Ma of cosmic ray exposure at time-integrated temperatures of up to 290 K have been identified and are likely to have yielded reliable 40Ar/39Ar ages of formation. Additionally, ∼50% of the identified impact glass spheres have formation ages of ⩽500 Ma, while ∼75% of the identified lunar impact glass shards and spheres have ages of formation ⩽2000 Ma. Higher thermal stresses in lunar impact glasses quenched from hyperliquidus temperatures are considered the likely cause of poor survival of impact glass spheres, as well as the decreasing frequency of lunar impact glasses in general with increasing age. The observed age-frequency distribution of lunar impact glasses may reflect two processes: (i) diminished

  4. Paracoccidioidomicose pulmonar: aspectos na tomografia computadorizada de alta resolução High-resolution computed tomography findings in pulmonary paracoccidioidomycosis

    OpenAIRE

    Maria Angélica Soares Muniz; Edson Marchiori; Marcelo Magnago; Luiza Beatriz Melo Moreira; José Guiomar de Almeida Junior

    2002-01-01

    O comprometimento pulmonar na paracoccidioidomicose é muito freqüente, podendo até ser a única manifestação da doença. Neste trabalho são analisados os aspectos encontrados nas tomografias computadorizadas de alta resolução do tórax de 30 pacientes com paracoccidioidomicose confirmada. Por meio desta análise foram determinados os achados mais comuns e suas formas de apresentação e distribuição nos pulmões. Os aspectos mais freqüentemente observados foram: espessamento esparso de septos interl...

  5. CARCINOMA BRONQUÍOLO-ALVEOLAR: ASPECTOS NA TOMOGRAFIA COMPUTADORIZADA DE ALTA RESOLUÇÃO Bronchioloalveolar carcinoma: aspects in high-resolution computed tomography

    OpenAIRE

    Luiza Beatriz Melo Moreira; Edson Marchiori; Alessandro Severo Alves de Melo; Marcelo Magnago; Maria Angélica Soares Muniz; Klaus Irion

    2002-01-01

    O carcinoma bronquíolo-alveolar é um tipo de carcinoma broncogênico de crescimento insidioso, que surge nas paredes das vias aéreas distais e se dissemina utilizando o septo alveolar como um estroma, preservando a arquitetura pulmonar. Neste trabalho foram analisadas as tomografias computadorizadas de alta resolução de 17 pacientes com carcinoma bronquíolo-alveolar. Ao contrário do relatado na literatura, foram observados predomínio no sexo masculino (71%) e maior freqüência da associação das...

  6. arXiv.org and Physics Education

    Science.gov (United States)

    Ramlo, Susan

    2007-09-01

    The website arXiv.org (pronounced archive) is a free online resource for full-text articles in the fields of physics, mathematics, computer science, nonlinear science, and quantitative biology that has existed for about 15 years. Available directly at http://www.arXiv.org, this e-print archive is searchable. As of Jan. 3, 2007, arXiv had open access to 401,226 e-prints in the topic areas. Those who sign up for an ID and password can also sign up for daily submission abstract emails for specific subject classes of arXiv, including physics education, physics and society, and history of physics. Founded and developed by Paul Ginsparg when he was at Los Alamos National Laboratory, arXiv's original name was the LANL preprint archive or xxx.lanl.gov. The location and name changed after Ginsparg moved to the physics department at Cornell University. Today, arXiv is hosted and operated by Cornell University library. Mirror sites for arXiv exist worldwide.2

  7. Instrumentation development for planetary in situ 40Ar/39Ar geochronology

    Science.gov (United States)

    Davidheiser-Kroll, B.; Morgan, L. E.; Munk, M.; Warner, N. H.; Gupta, S.; Slaybaugh, R.; Harkness, P.; Mark, D. F.

    2015-12-01

    The chronology of the Solar System, particularly the timing of formation of extraterrestrial bodies and their features, is a major outstanding problem in planetary science. Although various chronological methods for in situ geochronology have been proposed (e.g. Rb-Sr, K-Ar), and even applied (K-Ar, Farley et al., 2014), the reliability, accuracy, and applicability of the 40Ar/39Ar method makes it by far the most desirable chronometer for dating extraterrestrial bodies. The method however relies on the neutron irradiation of samples, and thus a neutron source. We will discuss the challenges and feasibility of deploying a passive neutron source to planetary surfaces for the in situ application of the 40Ar/39Ar chronometer. Requirements in generating and shielding neutrons, as well as analyzing samples are discussed, along with an exploration of limitations such as mass, power, and cost. Two potential solutions for the in situ extraterrestrial deployment of the 40Ar/39Ar method will be presented. Although this represents a challenging task, developing the technology to apply the 40Ar/39Ar method on planetary surfaces would represent a major advance towards constraining the timescale of solar system formation and evolution.

  8. Ars Baltica-verkoston puheenjohtajuus Suomeen Risto Ruohoselle

    Index Scriptorium Estoniae

    1999-01-01

    1990. a. loodud võrgustiku Ars Baltica sekretariaat (Ars Baltica Contact Point & Communication Center) tuleb Kielist Tallinnasse Eesti kultuuriministeeriumi kuni aastani 2002 (Suur-Karja 23). Ars Baltica (ühendus)

  9. Elective vs non-elective radial artery grafts: comparing midterm results through 64-Slice computed tomography Enxertos de artéria radial eletivos vs emergência: comparando resultados em seguimento a médio prazo

    Directory of Open Access Journals (Sweden)

    Roberto Rocha-e-Silva

    2007-01-01

    em RM de emergência. MÉTODOS: 47 pacientes com lesões críticas (>70% em todas as artérias alvo foram submetidos à RM com ATIE e a AR entre 1996 e 2003. Os pacientes foram agrupados em eletivos (23 pacientes e não eletivos (24 pacientes sendo similares para número de enxertos de ATIE e AR por paciente. Dos 47 pacientes, 5 morreram de complicações não cardíacas e 12 não estavam disponíveis. Portanto, 30 pacientes (71% dos sobreviventes foram estudados com tomografia computadorizada. Um total de 36 ATIE e 64 AR foram analisadas. RESULTADOS: a perviabilidade da AR nos grupos eletivo e não eletivo foram respectivamente 82% (31/38 e 85% (22/26 (p=0,75. A AR teve perviabilidade semelhante para todas as artérias alvo variando de 73% a 100%. Apenas um paciente foi submetido à nova RM e 29 (97% estão livres de angina ou nova re-intervenção. ATIE-DA teve perviabilidade de 92% (11/12 e 100% (10/10 respectivamente nos grupos eletivo e não-eletivo (p=0,37. ATIE-Diagonal-DA seqüencial obteve perviabilidade de 50% (03/06 no grupo eletivo que foi significativamente menor que a perviabilidade de 100% (08/08 do não-eletivo (p=0,02. CONCLUSÃO: A AR pode ser utilizada nos pacientes eletivos e não eletivos com excelentes resultados.

  10. Retinal thickness measurement and evaluation of natural history of the diabetic macular edema through optical coherence tomography Medida da espessura retiniana e avaliação da história natural do edema macular diabético pela tomografia de coerência óptica

    Directory of Open Access Journals (Sweden)

    Rosana Zacarias Hannouche

    2009-08-01

    influence on the center point thickness data, whereas values of visual acuity were significantly correlated with it. CONCLUSION: This study presents the optical coherence tomography applicability in the detection and semiologic evaluation of diabetic macular edema in patients with visual acuity 20/40 or greater, during one year, showing the retinal thickening in the early stages of diabetic retinopathy. Further, it evidenciated the correlation between the increase in foveal thickness and the reduction in visual acuity. Levels of hemoglobin A1c did not influence the center point thickness data. An early detection of clinically significant macular edema leads us to a redefinition of the real meaning of incipient retinopathy and can prevent further significant reduction of vision.OBJETIVOS: 1 Diagnosticar a presença de edema macular diabético em pacientes com retinopatia diabética e acuidade visual igual ou melhor que 20/40, pela realização do exame de tomografia de coerência óptica, medindo a espessura foveal central, ao longo de um ano. 2 Avaliar a história natural do edema, ao longo de um ano, associando a espessura foveal central com a hemoglobina glicosilada (HbA1c e alterações na acuidade visual. 3 Correlacionar os resultados obtidos com o grupo controle. MÉTODOS: Estudo prospectivo de uma amostra de 30 pacientes, com edema macular diabético e acuidade visual melhor ou igual a 20/40. O estudo contou com 30 olhos como grupo controle. Foram feitas medidas da melhor acuidade visual corrigida, dosagem de hemoglobina glicosilada, biomicroscopia com lente de 78 dioptrias, angiofluoresceinografia e tomografia de coerência óptica. Determinou-se, pelo propósito do estudo, a espessura foveal central como principal variável. Além da estatística descritiva, utilizaram-se testes para análise dos resultados: foi testada a homogeneidade de cada variável pelos testes t-Student, Qui-Quadrado e teste de Tukey; para correlacionar variáveis utilizou-se a análise de

  11. CT-guided plexus and splanchnic nerve neurolytic block. Experience in 150 cases and techniques optimization; Il blocco neurolitico del plesso celiaco e dei nervi splancnici con tomografia computerizzata

    Energy Technology Data Exchange (ETDEWEB)

    Marra, V.; Frigerio, A.; Menna, S.; Di Virgilio, M.R. [Ospedale San Giovanni, Turin (Italy). Serv. di Radiologia; Debernardi, F.; Musso, L. [Ospedale San Giovanni, Turin (Italy). Serv. di Anestesia, Rianimazione e Terapia Antalgica

    1999-09-01

    The paper reports the personal experience in computerized tomography guided celiac plexus and splanchnic nerve neurolytic block blocks. [Italian] Scopo del lavoro e' illustrare l'esperienza personale nell'uso della tomografia computerizzata nel trattamento del dolore da neoplasie addominali superiori, rivoluzionando le tecniche di esecuzione, aumentandone la precisione e riducendone notevolmente il rischio di complicanze.

  12. Ars ornata / Kadri Mälk

    Index Scriptorium Estoniae

    Mälk, Kadri, 1958-

    1998-01-01

    V rahvusvaheline ehtekunsti konverents 'Ars ornata Europeana' juuni lõpus Stockholmis. New Yorgis elava kuraatori Charon Kranseni ja prantsuse ehtekunstniku Christophe Burger' juhitud vestlusringidest. 1997. a. Pariisis loodud International Craft Design Association'ist (ICDA).

  13. ARS 01 Helsingi Kiasmas / Tarmo Virki

    Index Scriptorium Estoniae

    Virki, Tarmo

    2001-01-01

    Helsingis Kiasmas avatud rahvusvahelisest kunstinäitusest ARS 01 alapealkirjaga "Avanevaid perspektiive", kus esines oma töödega ka Marko Mäetamm. Näituse raames toimuvast Santiago Sierra kunstiprojektist kodututega

  14. Differential AR algorithm for packet delay prediction

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    Different delay prediction algorithms have been applied in multimedia communication, among which linear prediction is attractive because of its low complexity. AR (auto regressive) algorithm is a traditional one with low computation cost, while NLMS (normalize least mean square) algorithm is more precise. In this paper, referring to ARIMA (auto regression integrated with moving averages) model, a differential AR algorithm (DIAR) is proposed based on the analyses of both AR and NLMS algorithms. The prediction precision of the new algorithm is about 5-10 db higher than that of the AR algorithm without increasing the computation complexity.Compared with NLMS algorithm, its precision slightly improves by 0.1 db on average, but the algorithm complexity reduces more than 90%. Our simulation and tests also demonstrate that this method improves the performance of the average end-to-end delay and packet loss ratio significantly.

  15. "Ars Ornata" Mediterrania / Kadri Mälk

    Index Scriptorium Estoniae

    Mälk, Kadri, 1958-

    1999-01-01

    VI rahvusvaheline ehtekunstinäitus "Ars Ornata" juuni lõpus Barcelonas. Konverentsist, peanäitusest (osalejad Eestist), ehtekunstiõpetust andvast kõrgkoolist Escola Massana'st Barcelonas, õppejõude. Eesti ehtekunsti tulevikust.

  16. Tomografia computadorizada como método auxiliar no diagnóstico e tratamento de lesões intra-ósseas: caso clínico de odontoma composto = Computed tomography as auxiliary method in the diagnostic and treatment of intra-osseos lesions: a case of compound odontoma

    Directory of Open Access Journals (Sweden)

    Paiano, Grasiela Antunes

    2006-01-01

    Full Text Available O advento da tomografia computadorizada (TC possibilita de visualização tridimensional, favorece o diagnóstico e proporcionando um tratamento mais preciso em virtude da localização exata da lesão e análise da proximidade com as estruturas anatômicas vitais relacionadas. Contudo o tratamento de lesões ósseas se torna mais segura, reduzindo o risco de lesão a dentes adjacentes e nervos. O Odontoma é considerado o tumor odontogênico que mais comumente acomete os ossos maxilares. A variante composta deste tumor apresenta a característica de muitas estruturas semelhantes a dentes envolvidas por um halo radiolúcido e grande freqüência na região anterior da maxila, porém o diagnóstico deste tumor nas demais localizações dos maxilares é pouco freqüente. Apresenta normalmente crescimento limitado e expande as corticais ósseas, porém sem tendência à recidiva. O tratamento do odontoma consiste na sua excisão cirúrgica. Os autores pretendem relatar a utilização da TC como método auxiliar no diagnóstico e tratamento de um caso de exérese de um odontoma composto na região anterior da mandíbula

  17. Tomografia computadorizada sem contraste intravenoso no abdome agudo: quando e por que usar When and why use unenhanced computed tomography in patients with acute abdomen

    Directory of Open Access Journals (Sweden)

    Edison de Oliveira Freire Filho

    2006-02-01

    Full Text Available A tomografia computadorizada sem contraste intravenoso tem sido freqüentemente proposta na avaliação inicial de pacientes com suspeita de abdome agudo, ocupando o espaço de outros métodos diagnósticos. Os autores apresentam uma revisão bibliográfica dos principais aspectos e eficácia da tomografia computadorizada sem contraste intravenoso no diagnóstico de apendicite aguda, cólica nefrética, diverticulite, pancreatite aguda, apendicite epiplóica, pneumoperitônio e obstrução intestinal. Discutem quais as vantagens e limitações desta técnica de exame, bem como seus aspectos práticos.The use of unenhanced computed tomography has been frequently recommended for the initial assessment of patients with clinical suspicion of acute abdomen instead of other diagnostic methods. The authors present a review of the literature on the main aspects, advantages, limitations and efficacy of unenhanced computed tomography for the diagnosis of acute appendicitis, renal colic, diverticulitis, acute pancreatitis, primary epiploic appendicitis, pneumoperitoneum and small bowel obstruction. The advantages and limitations of this technique are also discussed.

  18. The mass of $^{32}Ar$ and $^{33}Ar$ for fundamental tests

    CERN Document Server

    Blaum, K; Beck, D; Bollen, G; Herfurth, F; Kellerbauer, A G; Kluge, H J; Sauvan, E; Schwarz, S

    2003-01-01

    Masses of the short-lived radionuclides ^32Ar (T_1/2=98 ms) and ^33Ar (T_1/2=173 ms) have been determined with the Penning trap mass spectrometer ISOLTRAP. Relative uncertainties of 6.0 x 10_-8 (deltam=1.8 keV) and 1.4 x 10_-8 (deltam=0.44 keV), respectively, have been achieved. At present, these new mass data serve as the most stringent test of the quadratic form of the isobaric-multiplet mass equation IMME. Furthermore, the improved accuracy for the mass of ^32Ar yields a better constraint on scalar contributions to the weak interaction. New mass values have also been measured for ^44Ar and ^45Ar, and a 20sigma deviation for ^44Ar from the literature value was found and interpreted.

  19. Ruptura traumática de via aérea em criança: um desafio diagnóstico Traumatic airway disruption in a child: a diagnostic challenge

    OpenAIRE

    Andréa Maria Cordeiro Ventura; Patrícia Freitas Góes; José Pinhata Otoch; José Carlos Fernandes

    2005-01-01

    OBJETIVO: Relatar um caso de ruptura da via aérea em criança vítima de trauma torácico decorrente de queda do tanque de lavar roupas. DESCRIÇÃO: Relato de caso descritivo. O paciente pré-escolar de 34 meses, do sexo masculino foi atendido na unidade de terapia intensiva pediátrica de Hospital Universitário. Foram realizados os seguintes procedimentos: radiografia simples e tomografia de tórax, endoscopia respiratória, toracotomia, antibioticoterapia, ventilação mecânica. A radiografia simples...

  20. Hemorragia adrenal bilateral com trombose da veia renal direita e veia cava inferior em um recém-nascido Bilateral adrenal hemorrhage associated with right renal vein and inferior vena cava thrombosis in a newborn

    Directory of Open Access Journals (Sweden)

    Severino Aires de Araújo Neto

    2003-10-01

    Full Text Available Os autores apresentam um caso de um recém-nascido com um tipo raro de associação de hemorragia adrenal bilateral com trombose de veia renal direita e de veia cava inferior, em que os exames de ultra-sonografia e tomografia computadorizada exerceram papel crucial no estabelecimento do diagnóstico, orientação da conduta e seguimento do paciente.We report a rare case of coexisting bilateral adrenal hemorrhage, right renal vein and inferior vena cava thrombosis in a neonate. Imaging studies played an important role in the diagnosis, management, and follow-up of this patient.

  1. Evapotranspiração máxima da cultura de pimentão em estufa plástica em função da radiação solar, da temperatura, da umidade relativa e do déficit de saturação do ar Maximum evapotranspiration of sweet pepper in plastic greenhouse as a function of solar radiation, temperature, relative humidity and water vapor pressure deficit of the air

    OpenAIRE

    Genei Antonio Dalmago; Arno Bernardo Heldwein; Astor Henrique Nied; Edenir Luis Grimm; Carina Rejane Pivetta

    2006-01-01

    Um experimento foi conduzido para avaliar a relação da evapotranspiração máxima (ETm) da cultura de pimentão por unidade de índice de área foliar (ETmf) com a radiação solar global incidente (Rg e) e saldo de radiação (Rn e), externos à estufa, e com a temperatura (t am), umidade relativa (URm) e déficit de saturação (D) do ar no interior da estufa. A ETm foi determinada por lisimetria. Apenas a temperatura e a umidade relativa do ar foram registradas e as demais variáveis foram estimadas. O ...

  2. 40Ar - 39Ar dating of meteorites and the history of chondrite parent bodies

    International Nuclear Information System (INIS)

    The 40Ar-39Ar analyses of eleven ordinary chondrites and the unique meteorite Pontylyfni are presented. Results of previous 40Ar-39Ar age analyses have shown that the uncertainty in the calculated ages arises principally from the difficulties of interpretation of release patterns obtained from stepped heating experiments. For this reason considerable attention is paid to identifying the causes of complicating features in the age spectra. The ages obtained range from 4.52Ga to a lower limit of 4.38Ga and it is inferred that these date the time of cooling of the chondrites after formation and metamorphism. (author)

  3. Ar-39-Ar-40 Evidence for Early Impact Events on the LL Parent Body

    Science.gov (United States)

    Dixon, E. T.; Bogard, D. D.; Garrison, D. H.; Rubin, A. E.

    2006-01-01

    We determined Ar-39-Ar-40 ages of eight LL chondrites, and one igneous inclusion from an LL chondrite, with the object of understanding the thermal history of the LL-chondrite parent body. The meteorites in this study have a range of petrographic types from LL3.3 to LL6, and shock stages from S1 to S4. These meteorites reveal a range of K-Ar ages from 23.66 to 24.50 Ga, and peak ages from 23.74 to 24.55 Ga. Significantly, three of the eight chondrites (LL4, 5, 6) have K-Ar ages of -4.27 Ga. One of these (MIL99301) preserves an Ar-39-Ar-40 age of 4.23 +/- 0.03 Ga from low-temperature extractions, and an older age of 4.52 +/- 0.08 Ga from the highest temperature extractions. In addition, an igneous-textured impact melt DOM85505,22 has a peak Ar-39-Ar-40 age of >= 4.27 Ga. We interpret these results as evidence for impact events that occurred at about 4.27 Ga on the LL parent body that produced local impact melts, reset the Ar-39-Ar-40 ages of some meteorites, and exhumed (or interred) others, resulting in a range of cooling ages. The somewhat younger peak age of 3.74 Ga from GR095658 (LL3.3) suggests an additional impact event close to timing of impact-reset ages of some other ordinary chondrites between 3.6-3.8 Ga. The results from MIL99301 suggest that some apparently unshocked (Sl) chondrites may have substantially reset Ar-39-Ar-40 ages. A previous petrographic investigation of MIL99301 suggested that reheating to temperatures less than or equal to type 4 petrographic conditions (600C) caused fractures in olivine to anneal, resulting in a low apparent shock stage of S1 (unshocked). The Ar-39-Ar-40 age spectrum of MIL99301 is consistent with this interpretation. Older ages from high-T extractions may date an earlier impact event at 4.52 +/- 0.08 Ga, whereas younger ages from lower-T extractions date a later impact event at 4.23 Ar-39-Ar-40 0.03 Ga that may have caused annealing of feldspar and olivine

  4. Análise estratigráfica e distribuição do arsênio em depósitos sedimentares quaternários da porção sudeste do Quadrilátero Ferrífero, bacia do Ribeirão do Carmo, MG Stratigraphic analysis and distribution of arsenic in quaternary sedimentary deposits of the southeastern portion of the Quadrilátero Ferrífero, basin of the Ribeirão Carmo, MG

    Directory of Open Access Journals (Sweden)

    Adivane Terezinha Costa

    2010-12-01

    Full Text Available A região do QF, em Minas Gerais, tornou-se internacionalmente conhecida pela exploração de ouro no século XVIII. Nesse artigo, serão apresentados valores de referência (background para o arsênio em sedimentos aluviais provenientes de áreas que foram intensamente afetadas pela exploração de ouro no passado, contidas na bacia do ribeirão do Carmo. A análise da sucessão faciológica dos perfis aluviais foi realizada em depósitos sedimentares de planícies de inundação, barrancos de rios (cutbank e terraços aluviais e foi o alicerce para a obtenção do valor de referência do arsênio em depósitos de fácies de canal e de planícies de inundação. A partir do conhecimento do valor de referência obtido pelo método estatístico, com base na confecção de curvas de freqüência acumulada em escala linear, foram gerados mapas geoquímicos no sistema SIG. A obtenção do valor de referência e do mapa geoquímico do arsênio, na bacia do ribeirão do Carmo, com representação das áreas com concentrações anômalas desse elemento, é fundamental para o diagnóstico e planejamento ambiental de um distrito mineiro potencialmente contaminado por arsênio.The Quadrilátero Ferrífero region, in the State of Minas Gerais, became internationally known due to the exploitation of gold in the eighteenth century. In this paper, we will present background values for arsenic in alluvial sediments from areas that were heavily affected by the exploitation of gold in the past, in the Carmo River Basin. The analyses of the facies succession of the alluvial profiles were carried out in the sedimentary deposits of flood plains, cutbank and alluvial terraces; this being the foundation for obtaining the arsenic background in the facies of the channel and flood plains. From the knowledge of the background obtained by the statistical method, and based on the construction of cumulative frequency curves on a linear scale, geochemical maps were generated

  5. 40Ar/39Ar ages in deformed potassium feldspar: evidence of microstructural control on Ar isotope systematics

    Science.gov (United States)

    Reddy, Steven M.; Potts, Graham J.; Kelley, Simon P.

    2001-05-01

    Detailed field and microstructural studies have been combined with high spatial resolution ultraviolet laser 40Ar/39Ar dating of naturally deformed K-feldspar to investigate the direct relationship between deformation-related microstructure and Ar isotope systematics. The sample studied is a ~1,000 Ma Torridonian arkose from Skye, Scotland, that contains detrital feldspars previously metamorphosed at amphibolite-facies conditions ~1,700 Ma. The sample was subsequently deformed ~430 Ma ago during Caledonian orogenesis. The form and distribution of deformation-induced microstructures within three different feldspar clasts has been mapped using atomic number contrast and orientation contrast imaging, at a range of scales, to identify intragrain variations in composition and lattice orientation. These variations have been related to thin section and regional structural data to provide a well-constrained deformation history for the feldspar clasts. One hundred and forty-three in-situ 40Ar/39Ar analyses measured using ultraviolet laser ablation record a range of apparent ages (317-1030 Ma). The K-feldspar showing the least strain records the greatest range of apparent ages from 420-1,030 Ma, with the oldest apparent ages being found close to the centre of the feldspar away from fractures and the detrital grain boundary. The most deformed K-feldspar yields the youngest apparent ages (317-453 Ma) but there is no spatial relationship between apparent age and the detrital grain boundary. Within this feldspar, the oldest apparent ages are recorded from orientation domain boundaries and fracture surfaces where an excess or trapped 40Ar component resides. Orientation contrast images at a similar scale to the Ar analyses illustrate a significant deformation-related microstructural difference between the feldspars and we conclude that deformation plays a significant role in controlling Ar systematics of feldspars at both the inter- and intragrain scales even at relatively low

  6. Características estruturais maculares de olhos de pré-escolares nascidos prematuros: análise por tomografia de coerência óptica e oftalmoscopia binocular indireta

    Directory of Open Access Journals (Sweden)

    Lígia Beatriz Bonotto

    2013-04-01

    Full Text Available OBJETIVO: Comparar a estrutura retiniana da mácula e fóvea entre prematuros com retinopatia da prematuridade (ROP estágios II e III pós-tratamento, com ROP estágios II e III regredida espontaneamente e sem ROP, através de exames de tomografia de coerência óptica (OCT e da oftalmoscopia binocular indireta (OBI. MÉTODOS: Estudo do tipo transversal, observacional e não cego. Foram incluídas crianças prematuras nascidas entre 06/1992 e 06/2006 e examinadas entre 06/2009 e 12/2010; idade gestacional menor ou igual a 32 semanas e peso ao nascer menor ou igual a 1.599 g; com mínimo de três consultas durante o período de seleção; sem retinopatia da prematuridade ou com diagnóstico de ROP estágios II ou III em pelo menos um dos olhos com regressão espontânea ou após tratamento; máximo de seis meses de idade cronológica para o primeiro exame no serviço; idade cronológica mínima de quatro anos no período da reavaliação. Foram excluídas crianças prematuras que não compareceram ou que não tinham condições clínicas para a realização dos exames de reavaliação. Os prematuros foram divididos em três grupos: G1- com ROP pós-tratamento; G2- com ROP pós-regressão espontânea; e G3- sem ROP. Os exames realizados foram OBI e OCT. RESULTADOS: Vinte e quatro prematuros (48 olhos apresentaram os critérios exigidos para a pesquisa, com idade média cronológica entre 5 e 6 anos. À OBI, houve diferença estatística significativa para a presença de alterações na retina dos prematuros do grupo G1. No entanto estas alterações corresponderam às lesões cicatriciais deixadas pelo tratamento da ROP, sem comprometimento visível da região macular. À OCT houve diferença estatística significativa para a maior espessura foveal para os prematuros do grupo G1. Considerando-se o olho esquerdo, não houve diferença estatística significativa relacionada à espessura da fóvea entre G1 e G3. Não houve diferença entre os tr

  7. Calcificações intracranianas maciças em um paciente com lúpus eritematoso sistêmico Massive intracranial calcifications in a patient with systemic lupus erythematosus

    Directory of Open Access Journals (Sweden)

    Emerson L. Gasparetto

    2004-12-01

    Full Text Available O envolvimento do sistema nervoso central em pacientes com lúpus eritematoso sistêmico é freqüentemente relatado. Os exames de tomografia computadorizada e ressonância magnética demonstram achados como atrofia cerebral, infarto cerebral e/ou hemorragia intracraniana. Calcificações intracranianas maciças em pacientes com lúpus eritematoso sistêmico são raras. Os autores apresentam um paciente com lúpus eritematoso sistêmico e crises convulsivas, cuja tomografia computadorizada demonstrou extensas calcificações nos gânglios da base e focos de calcificação nos lobos frontais. A ressonância magnética revelou imagens hiperintensas na seqüência FLAIR e hipointensas em gradiente eco T2* na topografia dos gânglios da base.Central nervous system involvement is frequently reported in patients with systemic lupus erythematosus. Computed tomography and magnetic resonance imaging studies usually show brain atrophy, cerebral infarction and/or intracranial bleeding. Extensive intracranial calcification in patients with systemic lupus erythematosus is rare. We report a case of a patient with systemic lupus erythematosus who presented with seizures and massive basal ganglia calcification and mild calcifications in the frontal lobes, seen on the brain computed tomography scan. Magnetic resonance imaging showed hyperintensity on FLAIR images and hypointense signals on T2* gradient echo images in the basal ganglia.

  8. Polineuropatia periférica arsenical: tratamento com penicilamina. Dosagem de arsênico inorgânico em nervo periférico, sangue e urina Arsenical peripheral polyneuropathy: treatment with penicillamine and determination of the concentrations of inorganic arsenic in peripheral nerve, blood, and urine. A case report

    Directory of Open Access Journals (Sweden)

    Abrão Anghinah

    1974-09-01

    Full Text Available Os autores registram caso de paciente na qual, após intoxicação aguda por arsênico inorgânico, instalou-se quadro de polineuropatia periférica. Foram verificadas altas concentrações de arsênico no nervo periférico estudado (1,48 mg/100 g peso seco, e 0,49 mg/100 g peso fresco e na urina. Antes do tratamento com penicilamina a quantidade de arsênico excretada na urina era de 80,0 micro/100 ml; após 7 dias de tratamento a excreção passou a ser de 150,2 micrograma/100 ml. Estes resultados bioquímicos foram acompanhados de progressiva melhora clínica.Report of a case of acute intoxication by inorganic arsenic with a picture of peripheral polyneuropathy. High concentrations of arsenic were found in the peripheral nerve studied (1.48 mg/100 g fresh tissue; 0,40 mg/100 g dry tissue blood and urine. Before the treatment with penicillamine the urinary concentration of arsenic was 80,0 micrograms/100 ml; 7 days after the onset of treatment the excretion increased to 150.2 micrograms/100 ml. Improvement of the clinical conditions was parallel to these biochemical results.

  9. Multiparametric multidetector computed tomography scanning on suspicion of hyperacute ischemic stroke: validating a standardized protocol Avaliação multiparamétrica por tomografia computadorizada multidetectores na suspeita de isquemia cerebral hiperaguda: validando um protocolo padronizado

    Directory of Open Access Journals (Sweden)

    Felipe Torres Pacheco

    2013-06-01

    Full Text Available Multidetector computed tomography (MDCT scanning has enabled the early diagnosis of hyperacute brain ischemia. We aimed at validating a standardized protocol to read and report MDCT techniques in a series of adult patients. The inter-observer agreement among the trained examiners was tested, and their results were compared with a standard reading. No false positives were observed, and an almost perfect agreement (Kappa>0.81 was documented when the CT angiography (CTA and cerebral perfusion CT (CPCT map data were added to the noncontrast CT (NCCT analysis. The inter-observer agreement was higher for highly trained readers, corroborating the need for specific training to interpret these modern techniques. The authors recommend adding CTA and CPCT to the NCCT analysis in order to clarify the global analysis of structural and hemodynamic brain abnormalities. Our structured report is suitable as a script for the reproducible analysis of the MDCT of patients on suspicion of ischemic stroke.A tomografia computadorizada multidetectores (TCMD permitiu o diagnóstico precoce de isquemia cerebral hiperaguda. O presente estudo objetivou validar a interpretação e a descrição padronizada de um protocolo de TCMD multiparamétrica em uma série de pacientes adultos. A concordância entre os examinadores foi testada, e seus resultados confrontados com uma leitura padrão. Não foram observados resultados falso-positivos, e foi documentado um elevado grau de concordância (Kappa>0,81 quando os dados da angiotomografia (ATC e dos mapas de perfusão cerebral por TC (PCTC foram adicionados à análise da TC sem contraste (TCSC. A concordância interobservador foi superior para os leitores melhor treinados, corroborando a necessidade de formação específica para a interpretação dos exames. Os autores recomendam acrescer a interpretação da ATC e da PCTC à análise da TCSC, visando à análise global das anormalidades cerebrais estruturais e hemodin

  10. ArDroneXT - Ar.Drone 2 eXTension for swarming and service hosting

    OpenAIRE

    Autefage, Vincent; Chaumette, Serge

    2013-01-01

    This is an Operating System Setup Guide. This report explains how to upgrade an Ar.Drone 2 for swarming and services hosting. In other words, it gives the technical information required to easily create a swarm of Ar.Drone 2 sharing a Wi-Fi network. Moreover, it describes the process to install new services and applications on the drone.

  11. 39Ar-40Ar dating of mesosiderites: Evidence for major parent body disruption < 4 Ga ago

    International Nuclear Information System (INIS)

    39Ar-40Ar ages were measured on 17 samples of 14 different mesosiderites and indicate major degassing of Ar by one or more thermal events less than 4.0 Ga ago. Three samples gave release patterns of constant age, whereas the other samples typically showed 200-400 Ma increases in 39Ar-40Ar age with increasing gas extraction temperature. These stepwise releases indicate ages of ∼3.4-3.8 Ga; averaged ages for individual meteorites are 3.45-3.82 Ga. No substantial evidence exists in the temperature releases for 39Ar-40Ar ages older than 4.0 Ga, and the Ar ages appear to be in contradiction to 244Pu fission track ages previously reported for a few mesosiderites. We suggest that metal-silicate mixing occurred ∼4.4 Ga ago, but that a major collisional event disrupted the mesosiderite parent planet 500 degree C, and left them deeply buried to undergo slow cooling

  12. A refined astronomically calibrated 40Ar/39Ar age for Fish Canyon sanidine

    NARCIS (Netherlands)

    Rivera, T.A.; Storey, M.; Zeeden, C.; Hilgen, F.J.; Kuiper, K.

    2011-01-01

    Intercalibration between the astronomical and radio-isotopic dating methods provides a means to improving accuracy and reducing uncertainty of an integrated, multi-chronometer geologic timescale. Here we report a high-precision 40Ar/39Ar age for the FishCanyon sanidine (FCs) neutron fluence monitor,

  13. Modeling Augmented Reality User Interfaces with SSIML/AR

    Directory of Open Access Journals (Sweden)

    Arnd Vitzthum

    2006-06-01

    Full Text Available Augmented Reality (AR technologies open up new possibilities especially for task-focused domains such as assembly and maintenance. However, it can be noticed that there is still a lack of concepts and tools for a structured AR development process and an application specification above the code level. To address this problem we introduce SSIML/AR, a visual modeling language for the abstract specification of AR applications in general and AR user interfaces in particular. With SSIML/AR, three different aspects of AR user interfaces can be described: The user interface structure, the presentation of relevant information depending on the user’s current task and the integration of the user interface with other system components. Code skeletons can be generated automatically from SSIML/AR models. This enables the seamless transition from the design level to the implementation level. In addition, we sketch how SSIML/AR models can be integrated in an overall AR development process.

  14. Modelo de interpretação da tomografia computadorizada de alta resolução do diagnóstico diferencial das doenças intersticiais crônicas High-resolution computed tomography interpretation model for differential diagnosis of chronic interstitial lung diseases

    Directory of Open Access Journals (Sweden)

    C. Isabela S. Silva

    2005-04-01

    Full Text Available O reconhecimento e o diagnóstico diferencial dos diversos padrões da tomografia computadorizada de alta resolução (TCAR são de fundamental importância na avaliação das doenças pulmonares difusas. Existem vários padrões de TCAR descritos na literatura, sendo alguns deles superponíveis. A interpretação desses padrões pode ser uma tarefa difícil, particularmente para residentes e radiologistas não especializados em tórax. Os autores ilustram os achados característicos da TCAR nas doenças pulmonares intersticiais crônicas e propõem um modelo simplificado de interpretação desses achados, baseado no padrão e na distribuição da doença. O algoritmo inclui os seis principais padrões de anormalidade identificados na TCAR: septal, reticular, cístico, nodular, de atenuação em vidro fosco e consolidação parenquimatosa.The recognition and differential diagnosis of the various patterns of abnormality seen on high-resolution computed tomography (HRCT are important in the evaluation of patients with chronic insterstitial lung diseases. Various patterns of abnormality have been described in the literature, which sometimes are overlapped. Distinction between the various patterns can be difficult particularly for residents and radiologists who are not familiarized with these images. The authors illustrate the characteristic patterns of abnormality seen in chronic interstitial lung diseases and propose a simple interpretation algorithm based on the pattern and distribution of the findings. The algorithm includes the six main patterns of abnormality seen on HRCT: septal lines, reticular pattern, cystic pattern, nodular pattern, ground-glass opacities and consolidation.

  15. Accurate and precise 40Ar/39Ar dating by high-resolution, multi-collection, mass spectrometry

    DEFF Research Database (Denmark)

    Storey, Michael; Rivera, Tiffany; Flude, Stephanie

    analog enabling precise measurement of very small 36Ar signals for accurate correction for atmospheric-derived 40Ar; (iii) higher mass resolution allows pseudo resolution of hydrocarbon isobaric interferences from 36Ar through to 40Ar; (iv) multi-collection, allowing more data to be gathered in a fixed...

  16. Neutrino Capture Reactions on $^{40}$Ar

    CERN Document Server

    Suzuki, Toshio

    2012-01-01

    Gamow-Teller (GT) strength in $^{40}$Ar is studied by shell-model calculations with monopole-based universal intearction, which has tensor components of $\\pi$\\rho$-meson exchanges. Calculated GT strength is found to be consistent with the experimental data obtained by recent ($p, n$) reactions. Neutrino capture cross sections on $^{40}$Ar for solar neutrinos from $^{8}$B are found to be enhanced compared with previous calculations. The reaction cross sections for multipoles other than $0^{+}$ and $1^{+}$ are obtained by random-phase approximation (RPA). Their contributions become important for neutrino energies larger than 50 MeV.

  17. Improved Ar(II) transition probabilities

    OpenAIRE

    Danzmann, K.; de Kock, M

    1986-01-01

    Precise Ar(II) branching ratios have been measured on a high current hollow cathode with a 1-m Fourier transform spectrometer. Absolute transition probabilities for 11 Ar(II) lines were calculated from these branching ratios and lifetime measurements published by Mohamed et al. For the prominent 4806 Å line, the present result is Aik = 7.12×107s-1 ±2.8%, which is in excellent agreement with recent literature data derived from pure argon diagnostics, two-wavelength-interferometry, and Hβ-diagn...

  18. AR-扩增实境

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    1、什么是AR-扩增实境?AR-扩增实境(Augmented Reality,简称AR),简单地说,就是把虚拟的物体和现实的场景进行嫁接。这是一种实时地计算摄影机影像的位置及角度并加上相应图像的技术,这种技术的目标是在屏幕上把虚拟世界套在现实世界并进行互动。

  19. Penning ionization : In benzene · Ar and fluorobenzene · Ar van der waals molecules and in collisions of benzene with metastable Ar atoms

    Science.gov (United States)

    Rühl, E.; Bisling, P.; Brutschy, B.; Beckmann, K.; Leisen, O.; Morgner, H.

    1986-08-01

    The photoion efficiency curves of the van der Waals complexes benzene ·Ar (Bz·Ar) and fluorobenzene·Ar (Fb·Ar) exhibit sharp resonances, which correspond to excitation to the Ar 2P 3/24s and 2P 1/24s resonance states. The peaks are redshifted relative to their asymptotic values (Bz·Ar, Δ E = -70 ± 10 meV; Fb·Ar, Δ E = -40 ± 10 meV). These findings are supported by electron spectroscopy studies of the Penning ionization of benzene by state-selected metastable Ar ( 3p 2, 3p 0) atoms. Strong evidence is presented that Penning ionization is the process observed in both cases.

  20. Arsenic exposure assessment of children living in a lead mining area in Southeastern Brazil Avaliação da exposição de crianças ao arsênio em área de mineração de chumbo na Região Sudeste do Brasil

    Directory of Open Access Journals (Sweden)

    Alice Momoyo Sakuma

    2010-02-01

    Full Text Available Environmental contamination by arsenic compounds in the Ribeira River Valley, São Paulo, Brazil has already been observed. Lead mining and refining activities had been carried on since late colonial times and finished recently, at the end of 1995. The source of As in the region is known to be mainly from arsenopirite geological presence in the lead ore. Chronic exposure to arsenic compounds may cause peripheral vascular disorders, hyperpigmentation, hiperkeratosis and cancer of the skin, bladder, lung, liver and other internal organs. The purpose of this study was to assess children exposure to arsenic from environmental sources in the region. Urine samples from children between 7 to 14 years old were collected at the following localities: Cerro Azul (Paraná; urban areas of Ribeira (São Paulo and Adrianópolis (Paraná; Vila Mota neighborhood (rural area of Adrianópolis and Serra neighborhood (Iporanga, São Paulo, identified as groups 1, 2, 3 and 4, respectively. Group 1 was considered as non-exposed control group. Toxicologically relevant forms of As were determined by atomic absorption spectrometry with hydride generation system. The median values of urine arsenic levels obtained in groups 1, 2, 3 and 4 were respectively: 3.60, 6.30, 6.41 e 8.94μg/L.Contaminação ambiental por compostos de arsênio no Vale do Ribeira, São Paulo, Brasil, tem sido já observada. As atividades de mineração e refinamento do chumbo têm ocorrido desde a época colonial e foram encerradas recentemente, no final de 1995. A principal fonte de arsênio na região é arsenopirita que ocorre geologicamente no minério de chumbo. Exposição crônica aos compostos de arsênio podem causar desordens vasculares periféricas, hiperpigmentação, hiperqueratose, além de câncer de pele, bexiga, pulmão, fígado e outros órgãos. O objetivo do presente estudo foi avaliar a exposição de crianças ao arsênio proveniente de fontes ambientais na região. Amostras de

  1. Efeitos da temperatura e da movimentação do ar sobre o isolamento térmico do velo de ovinos em câmara climática Effect of temperature and air velocity on the thermal insulation of the fleece of sheep in climatic chamber

    Directory of Open Access Journals (Sweden)

    Alex Sandro Campos Maia

    2009-01-01

    Full Text Available Foram utilizados dez ovinos da raça Corriedale - cinco machos e cinco fêmeas com pesos entre 52,2 e 87,6 kg - com o objetivo de avaliar o efeito da combinação da movimentação do ar (0 e 5,0 m/s com a temperatura do ar (25, 30 e 40ºC sobre a temperatura retal (T R, ºC, da epiderme (T E, ºC, da superfície do velo (T V, ºC e do interior do velo (T I, ºC e a espessura do velo (E V, cm e suas relações com o isolamento térmico do velo. A presença de vento não teve efeito sobre as variáveis estudadas, o que sugere que fluxo de ar (40ºC o fluxo de calor sensível não foi significativa.Ten Corriedale sheep were evaluated, five males and five females with 52.2 to 87.6 kg of body weight, to evaluate the effect of air velocity (0 and 5 m/s and temperature (25, 30 and 40ºC on rectal temperature (T R, ºC, skin temperature (T E, ºC, fleece surface temperature (T V, ºC, temperature inside the fleece (T I, ºC, and fleece thickness (E V, cm and their relationship with fleece thermal insulation. The results showed that air velocity did not affect the studied traits, suggesting that airflow 40°C, the sensible heat flow was not significant.

  2. Arcabouço de PRP-gel associado a células tronco mesenquimais: uso em lesões condrais em modelo experimental equino

    Directory of Open Access Journals (Sweden)

    Ana Lúcia M. Yamada

    2016-06-01

    Full Text Available Resumo: O plasma rico em plaquetas (PRP é conhecido por apresentar propriedades anabólicas, anti-inflamatórias e capacidade de gelificação. Atualmente o PRP é considerado eficaz na reparação da cartilagem, sendo sua capacidade de formação de gel indicada para o preenchimento de defeitos condrais. O objetivo desse estudo foi analisar o uso do PRP ativado, no formato de arcabouço, como suporte para o implante de células tronco mesenquimais (CTM, no preenchimento e tratamento de lesões condrais induzidas em equinos. Doze equinos foram submetidos a uma cirurgia artroscópica no tempo zero do experimento (T0, onde foi induzida uma lesão condral de 15 mm de diâmetro na tróclea medial femoral dos membros pélvicos direito. As 12 articulações foram divididas em dois grupos distintos com seis articulações cada (GA e GB. As articulações do GA foram submetidas ao tratamento com o implante de CTM em gel de PRP. As articulações de GB foram o grupo controle do experimento. As CTMs foram extraídas do tecido adiposo e o PRP em gel foi obtido por protocolo de dupla centrifugação seguido da adição de trombina liofilizada. Após cinco meses (T150 foi realizada nova artroscopia para avaliação macroscópica do local, coleta de amostras do tecido de reparação para análises de microscopia eletrônica, sendo realizadas imagens ressonância magnética e tomografia computadorizada no local do implante no GA. Observamos que o gel de PRP associado às CTM demonstrou ser adequado no tratamento de defeitos condrais experimentais dos equinos. GA evidenciou um melhor aspecto macroscópico e microscópico do tecido de reparação, sendo que GB mostrou maior desorganização das fibras colágenas. Nas imagens de ressonância magnética e tomografia computadorizada apenas foi relevante o local da lesão condral. O arcabouço de gel de PRP demonstrou ser apropriado no suporte do tratamento com as CTMs, sendo de fácil aplicação e efetivo

  3. Avaliações fenológicas e agronômicas em café arábica cultivado a pleno sol e consorciado com banana 'Prata Anã' Phenological and agronomic evaluations in a coffee crop grown under unshaded and shaded by 'Prata Anã' banana plants

    Directory of Open Access Journals (Sweden)

    José Ricardo Macedo Pezzopane

    2007-01-01

    Full Text Available O trabalho foi realizado em cafeeiros (Coffea arabica L. cv. Icatu Vermelho IAC 4045, cultivados a pleno sol e consorciados com banana 'Prata Anã' (Musa AAB, em Mococa (SP, em Latitude 21º 28' S, Longitude 47º 01' W, altitude 665 m. Entre julho de 2001 e junho de 2004 foi acompanhado o desenvolvimento fenológico dos cultivos, além de se avaliar, o crescimento das plantas em altura e diâmetro da copa. Nas safras de 2002, 2003 e 2004 foram avaliados os parâmetros de produção nos dois sistemas de cultivo, além de sua variabilidade nas parcelas do cultivo consorciado. Nos sistemas de cultivo avaliados, o crescimento vegetativo em altura e diâmetro foi maior no período primavera-verão em relação ao período outono-inverno, não tendo sido encontradas diferenças significativas das taxas de crescimento, de desenvolvimento fenológico e dos índices de produção entre os cultivos. No cultivo consorciado, no ponto próximo às bananeiras observaram-se diferenças em relação aos demais pontos amostrados no crescimento vegetativo e desenvolvimento fenológico para algumas épocas do ano, além de apresentar menor produção por planta.A study was carried out in coffee crop (Coffea arabica L. cv. Icatu Vermelho IAC 4045, unshade and shaded by banana 'Prata Anã' (Musa AAB, in Mococa, São Paulo State, Brazil (Latitude South 21º 28 ', Longitude West 47º 01 ', altitude 665m. Phenological data for the coffee crops were taken, from July, 2001 to June, 2004. The growth of the plants concerning height and diameter was also evaluated. The harvests of 2002, 2003 and, 2004 were appraised by the production parameters, and their variability for different positions in shaded coffee crop. The vegetative growth in height and diameter showed higher activity during the spring-summer period in relation to the autumn-winter period, in both in the cultivation systems evaluated. No significant differences of the growth taxes, of phenological development

  4. Comparative 40Ar/39Ar and K-Ar dating of illite-type clay minerals: A tentative explanation for age identities and differences

    Science.gov (United States)

    Clauer, Norbert; Zwingmann, Horst; Liewig, Nicole; Wendling, Raymond

    2012-10-01

    The 40K/40Ar (K-Ar) and 40Ar/39Ar dating methods are applied here to the same, very small, micrometric illite-type particles that crystallized under low-temperature (samples with a total of fifteen size fractions from advantages, such as the plateaus obtained by incremental step heating of the various size fractions, even if not translatable straight as ages of the illite populations; they allow identification of two generations of authigenic illite that formed at about 200 and 175 Ma, and one detrital generation. However, 40Ar/39Ar dating of clay minerals remains challenging as technical factors, such as the non-standardized encapsulation, may have potential unexpected effects. Both dating methods have their limitations: (1) K-Ar dating requires relatively large samples (ca. 10-20 mg) incurring potential sample homogeneity problems, with two aliquots required for K and Ar analysis for an age determination, also inducing a higher analytical uncertainty; (2) an identified drawback of 40Ar/39Ar dating is Ar recoil and therefore potential loss that occurs during neutronic creation of 39Ar from 39K, mostly in the finer mineral particles. If all the recoiled 39Ar is redistributed into adjacent grains/minerals, the final 40Ar/39Ar age of the analyzed size fraction remains theoretically identical, but it is not systematic in clay-type material. The finest grain sizes (e.g., convenient and straightforward use supported by a standardized and well-controlled technical approach. The present comparison of the two Ar-dating methods as applied to clay material shows that neither method is presently outdated, and that they are even of reciprocal use. Both methods have distinct application fields in clay geochronology and complementary application fields in clay crystallography.

  5. Comparison of ultrasonography, computed tomography and magnetic resonance imaging with intraoperative measurements in the evaluation of abdominal aortic aneurysms Comparação entre ultrassonografia, tomografia computadorizada e ressonância nuclear magnética com medidas intra-operatórias na avaliação dos aneurismas de aorta abdominal

    Directory of Open Access Journals (Sweden)

    Francisco das Chagas de Azevedo

    2005-02-01

    angioresonance provided measurements with no significant differences in the statistic view when compared to the intraoperative measures. CONCLUSIONS: Ultrasonography is a reliable method for the diagnosis and follow-up of the aorta abdominal aneurysms, but insufficient for endovascular surgery planning. The conventional computed tomography can provoke distortion in the length measurements of the aorta dilatation. Helical computed tomography and nuclear magnetic angioresonance provided precise measurements of all the studied parameters, being of great utility for surgical planning.OBJETIVO: Estudar os métodos mais freqüentemente empregados na avaliação dos aneurismas de aorta abdominal - ultrassonografia, tomografia computadorizada convencional, tomografia computadorizada helicoidal e angio-ressonância nuclear magnética - comparando as medidas fornecidas por estes exames radiológicos no pré-operatório com medidas realizadas durante a operação. MÉTODO: Foram incluídos no estudo pacientes portadores de aneurisma da aorta abdominal com indicação de tratamento cirúrgico eletivo por via transperitoneal. O diagnóstico inicial da dilatação aórtica foi feito com ultra-sonografia e, uma vez indicado o tratamento cirúrgico, era então solicitado um outro exame radiológico complementar, já que não é nossa rotina operar esses pacientes com base apenas na ultra-sonografia. Sessenta pacientes foram divididos em 3 grupos de acordo com o exame complementar realizado (tomografia computadorizada convencional, tomografia computadorizada helicoidal ou angio-ressonância nuclear magnética. As ultra-sonografias dos 20 primeiros pacientes foram incluídas em um 4° grupo. Analisamos neste estudo as medidas do colo proximal da aorta, o diâmetro transverso máximo e o comprimento do aneurisma, além do diâmetro transverso das artérias ilíacas comuns conseguidos a partir dos exames radiológicos. As mesmas medidas eram realizadas por ocasião da operação com o auxílio de

  6. Computed tomography image of the mediastinal and axillary lymph nodes in clinically sound Rottweilers Imagem por tomografia computadorizada dos linfonodos axilares e mediastinais de cães rottweilers clinicamente saudáveis

    Directory of Open Access Journals (Sweden)

    Ana Carolina B. Fonseca Pinto

    2013-03-01

    smallest diameter of the axillary and mediastinal lymph nodes not surpassed 7mm and 8mm respectively. Their attenuations were equal or smaller than that of musculature in the post contrast scan.A tomografia computadorizada é uma modalidade diagnóstica que possibilita a avaliação detalhada dos linfonodos e que é capaz de detectar mais precocemente alterações envolvendo estas estruturas, que modalidades de imagem como a radiografia e a ultrassonografia. Tendo em vista a escassez de informações na literatura veterinária esta pesquisa objetivou fornecer informações sobre os aspectos tomográficos normais dos linfonodos axilares e mediastinais em cães. Realizou-se o exame tomográfico de 15 cães adultos, machos e fêmeas, da raça Rottweiler, selecionados como clinicamente normais por meio de anamnese, exame físico, hemograma, perfil bioquímico renal e hepático, eletrocardiograma e exame radiográfico do tórax. Após a injeção intravenosa do contraste iodado hidrossolúvel iônico, realizaram-se cortes tomográficos transversais do tórax com 10mm de espessura e 10mm de incremento em um tomógrafo axial. Os exames tomográficos foram avaliados buscando-se identificar os linfonodos axilares e mediastinais. Quando visibilizados, os linfonodos foram mensurados em seu menor eixo e sua atenuação foi comparada com a da musculatura. Foram calculados a média e desvio padrão da idade, do peso, do comprimento dos animais e do menor eixo dos linfonodos axilares e mediastinais. A média de idade dos animais e o desvio padrão foram de 3,87 anos ±2,03, do peso foi de 41,13kg ± 5,12 e do comprimento dos animais foi de 89,61cm ±2,63. Os linfonodos axilares foram visibilizados em 60% dos animais, a média das mensurações dos menores diâmetros e o desvio padrão foi de 3,58mm ±2,02 com valor mínimo de 1mm e máximo de 7mm. Dos 13 linfonodos observados 61,53% apresentaram-se hipoatenuantes comparativamente a musculatura e 30,77% isoatenuantes. Os linfonodos

  7. Modification of stearic acid in Ar and Ar-O{sub 2} pulsed DC discharges

    Energy Technology Data Exchange (ETDEWEB)

    Bernardelli, E.A.; Souza, T.; Maliska, A.M.; Kleinjohann, K.J.; Bendo, T. [Federal University of Santa Catarina (UFSC), Florianopolis, SC (Brazil); Mafra, M. [Nancy-Universite (France). Institut Jean Lamour; CNRS, Nancy (France); Belmonte, T. [Federal University of Technology from Parana (UTFPR), Curitiba, PR (Brazil)

    2010-07-01

    Stearic acid (C{sub 1}8H{sub 36}O{sub 2}) was treated into Ar and Ar-O{sub 2}(10%) pulsed DC discharge created by a cathode-anode confined system. The samples were placed at the floating potential. The results show that the mass variation of the stearic acid samples after Ar-O{sub 2} plasma exposure is more important than the pure Ar plasma treatments. This comportment demonstrate that the oxygen actives species (O and O{sub 2} in all states) strongly enhance the etching process with regards to A{sup *} species, regardless of their concentration. After treatment by Ar and Ar-O{sub 2} plasma, analyses by X-ray diffraction show a significant structural modification of the samples surface, utilizing Ar-O{sub 2} plasma the modification was more pronounced. The chemical composition evolution shows that the acid function is etched preferentially in the beginning of the treatment (about 5 min) and that after 10 min the carbonic chains seems to be functionalized by oxygen. (author)

  8. Collective dipole response of proton-rich nuclei 32Ar and 34Ar

    International Nuclear Information System (INIS)

    The earlier observation of low-lying dipole strength in neutron rich nuclei and its interpretation with respect to basic nuclear properties (symmetry energy, skin thickness) initiated the investigation of this phenomenon in proton-rich nuclei. Macroscopically this strength could be explained with the resonant dipole oscillation of a proton skin against the isospin-symmetric core. For nuclei like 32Ar the occurrence of pronounced dipole strength is predicted in the low-energy region between 8-10 MeV excitation energy. For the 34Ar the pygmy strength is expected to drop sharply and vanish entirely for the N=Z nucleus 36Ar. The experiment S327 has been performed in August 2008 at the GSI Darmstadt in Cave C using the LAND reaction setup. Fragmentation of a 800 A MeV primary 36Ar beam on a Be target was used to produce the radioactive isotopes 34Ar and 32Ar. After passing the FRS (Fragment Separator) the ions impinged on a Pb target. The dipole response is observed using the Coulomb excitation method in inverse kinematics. The concept and the experimental method will be shown in the context of the underlying physics case in 32,34Ar.

  9. Imagem em tuberculose pulmonar Pulmonary tuberculosis imaging

    Directory of Open Access Journals (Sweden)

    SIDNEY BOMBARDA

    2001-11-01

    Full Text Available A tuberculose é uma doença de alta incidência e prevalência no Brasil. Sinais sugestivos de atividade ou seqüela da tuberculose podem ser obtidos através dos métodos de imagem. Na radiografia de tórax, a tuberculose pulmonar ativa pode manifestar-se sob a forma de consolidações, cavitações, padrões intersticiais (reticulares/retículo-nodulares, linfonodomegalias hilares ou mediastinais e derrame pleural. Imagens compatíveis com doença ativa, como nódulos centrolobulares de distribuição segmentar, cavidades de paredes espessas, espessamento de parede brônquica ou bronquiolar, bronquiectasias e linfonodomegalias, podem ser observadas pela tomografia computadorizada do tórax; cavidades de paredes finas, bronquiectasias de tração e estrias são imagens sugestivas de seqüela da doença, assim como o enfisema e o aspecto em mosaico do parênquima pulmonar. A cintilografia com o citrato de gálio-67 é um método complementar útil na detecção de processos infecciosos, incluindo a tuberculose, especialmente em pacientes imunossuprimidos. Estudos de inalação e perfusão pulmonar são utilizados na avaliação pré-operatória de pacientes com seqüelas de tuberculose ou tuberculose multirresistente. A tomografia por emissão de pósitrons utilizando a deoxiglicose marcada com o flúor-18 permite a detecção do processo inflamatório que ocorre na fase ativa da tuberculose e que pode persistir, em menor intensidade, após o término do tratamento. Métodos de imagem constituem importantes recursos para o diagnóstico e acompanhamento da tuberculose pulmonar.Tuberculosis is a disease of high incidence and prevalence in Brazil. Imaging methods can reveal signs suggestive of tuberculosis activity or sequelae. Chest radiographs can reveal active lung tuberculosis through consolidations, cavitations, interstitial patterns (nodular and reticulo-nodular, mediastinal or hilar lymphadenopathy and pleural effusions. Images compatible

  10. Potassium Isotopic Compositions of NIST Potassium Standards and 40Ar/39Ar Mineral Standards

    Science.gov (United States)

    Morgan, Leah; Tappa, Mike; Ellam, Rob; Mark, Darren; Higgins, John; Simon, Justin I.

    2013-01-01

    Knowledge of the isotopic ratios of standards, spikes, and reference materials is fundamental to the accuracy of many geochronological methods. For example, the 238U/235U ratio relevant to U-Pb geochronology was recently re-determined [1] and shown to differ significantly from the previously accepted value employed during age determinations. These underlying values are fundamental to accurate age calculations in many isotopic systems, and uncertainty in these values can represent a significant (and often unrecognized) portion of the uncertainty budget for determined ages. The potassium isotopic composition of mineral standards, or neutron flux monitors, is a critical, but often overlooked component in the calculation of K-Ar and 40Ar/39Ar ages. It is currently assumed that all terrestrial materials have abundances indistinguishable from that of NIST SRM 985 [2]; this is apparently a reasonable assumption at the 0.25per mille level (1s) [3]. The 40Ar/39Ar method further relies on the assumption that standards and samples (including primary and secondary standards) have indistinguishable 40K/39K values. We will present data establishing the potassium isotopic compositions of NIST isotopic K SRM 985, elemental K SRM 999b, and 40Ar/39Ar biotite mineral standard GA1550 (sample MD-2). Stable isotopic compositions (41K/39K) were measured by the peak shoulder method with high resolution MC-ICP-MS (Thermo Scientific NEPTUNE Plus), using the accepted value of NIST isotopic SRM 985 [2] for fractionation [4] corrections [5]. 40K abundances were measured by TIMS (Thermo Scientific TRITON), using 41K/39K values from ICP-MS measurements (or, for SRM 985, values from [2]) for internal fractionation corrections. Collectively these data represent an important step towards a metrologically traceable calibration of 40K concentrations in primary 40Ar/39Ar mineral standards and improve uncertainties by ca. an order of magnitude in the potassium isotopic compositions of standards.

  11. "Ars Dictaminis" and Modern Rhetorical Practice.

    Science.gov (United States)

    Sewell, Ernestine P.

    Although not all the problems of writing are solved by practice in letter writing, a review of the classical texts on "ars dictaminis"--letter writing--creates a strong argument for its increased use as an exercise in college composition classrooms. By incorporating the lessons of dictamen as a device for achieving rhetorical modes--narration,…

  12. 78 FR 9448 - Arkansas Disaster #AR-00061

    Science.gov (United States)

    2013-02-08

    ... ADMINISTRATION Arkansas Disaster AR-00061 AGENCY: U.S. Small Business Administration. ACTION: Notice SUMMARY: This is a Notice of the Presidential declaration of a major disaster for Public Assistance Only for the... Disaster Assistance, U.S. Small Business Administration, 409 3rd Street SW., Suite 6050, Washington,...

  13. "ARS 01", perspektiivide avamine / Helen Kivisoo

    Index Scriptorium Estoniae

    Kivisoo, Helen

    2001-01-01

    30. IX 2001-20. I 2002 Kiasmas kuuendat korda toimuvast rahvusvahelisest näitusest "ARS", kus Eestist osaleb Marko Mäetamm. Kuraatorid Tuula Arkio, Maaretta Jaukkuri, Patrik Nyberg, Jari-Pekka Vanhala. Teemaks "kolmas ruum". Näituse kajastamisest.

  14. Ionization of Argon n=2 (Ar+9 to Ar+16) by a 'relativistic' laser field

    International Nuclear Information System (INIS)

    The high field photoionization cross sections for the (n=2) shell of argon were measured with pulsed 800 nm radiation (27±5 fs duration) at an intensity of 1.5x1019 W/cm2±1x1019 W/cm2. The pondermotive energy for an electron at these field intensities is approximately 1 MeV. The best agreement with a calculated AC tunneling model was at an intensity of 0.6x1019 W/cm2. The difference between experimental and calculated relative charge state yields is less than an order of magnitude for Ar+9 to Ar+14 and Ar+16

  15. Distrofia em forma-de-borboleta: relato de caso Butterfly-shaped pattern dystrophy: case report

    Directory of Open Access Journals (Sweden)

    David Leonardo Cruvinel Isaac

    2007-02-01

    Full Text Available Os autores apresentam um caso de distrofia macular em forma-de-borboleta, diagnosticado em paciente do sexo masculino, apresentando concomitante atrofia do epitélio pigmentado da retina e perda visual central em um dos olhos. Os achados relatados contrariam conceitos inicialmente disponíveis de curso sempre benigno da doença. A lesão característica e bem delimitada no pólo posterior e a angiofluoresceinografia, permitiram estabelecer o diagnóstico. Descreve-se ainda, pela primeira vez, os achados da distrofia em forma-de-borboleta à tomografia de coerência óptica.The authors present a case of butterfly-shaped pattern dystrophy diagnosed in a male patient, with retinal pigmented epithelium atrophy and central visual acuity decrease in one of the eyes. The evolution of this case was not benign as described in previous reports. A well-defined lesion located in the posterior pole of both eyes associated with fluorescein angiography allowed the diagnosis of this pattern dystrophy. Optical coherence tomography was performed, showing the aspects of the pathology, for the first time.

  16. OCORRÊNCIA E DURAÇÃO DAS TEMPERATURAS MÍNIMAS DIÁRIAS DO AR PREJUDICIAIS À FECUNDAÇÃO DAS FLORES DO ARROZ EM SANTA MARIA. RS. III: PROBABILIDADES DE OCORRÊNCIA DA DURAÇÃO DAS TEMPERATURAS BAIXAS

    Directory of Open Access Journals (Sweden)

    Flávio Miguel Schneider

    1992-04-01

    Full Text Available Utilizando os valores das temperaturas mínimas, máximas e das 21 h, hora local, dos meses de dezembro, janeiro, fevereiro e março registradas na Estação Climatológica Principal de Santa Maria, RS, determinaram-se as probabilidades de ocorrência da duração máxima de horas com temperatura do ar ≤ 10, 11, 12, 13, 14, 15, 16 e 17,0°C e de seqüências de dias consecutivos com no mínimo uma hora de duração com temperatura do ar ≤ 15, 16 e 17,0°C. Essas probabilidades foram obtidas para cada decêndio dos meses estudados. Os resultados evidenciam que o risco de ocorrência de temperaturas prejudiciais à fecundação das flores da cultura do arroz é bem menor no 2° e 3° decêndio do mês de fevereiro. Deve-se, portanto, semear e/ou escolher ciclo de cultivar de arroz que possibilite que a fase de floração ocorra durante o 2° e 3° decêndio do mês de fevereiro.

  17. Acute pleuropulmonary complications detected by computed tomography following myocardial revascularization Cirurgia de revascularização do miocárdio: complicações pleuro-pulmonares agudas caracterizadas por tomografia computadorizada de tórax

    Directory of Open Access Journals (Sweden)

    Francisco S. Vargas

    2002-08-01

    Full Text Available INTRODUCTION: Pleuropulmonary changes are common following coronary artery bypass grafting surgery performed with a saphenous vein graft, with or without an internal mammary artery. The presence of atelectasis or pleural effusions reflects the thoracic trauma. PURPOSE: To define the postoperative incidence of changes in the lung and in the pleural space and to evaluate the influence of the trauma. METHODS: Thirty patients underwent elective coronary artery bypass grafting surgery (8 saphenous vein grafts and 22 saphenous vein grafts and internal mammary artery grafts with pleurotomy. Chest tubes in the left pleural space were used in all internal mammary artery patients. On the second (day 2 and seventh (day 7 postoperative day, patients underwent a computed tomography, and pleural effusions were rated as follows: grade 0 = no fluid to grade 4 = fluid in more than 75% of the hemithorax. Atelectasis was rated as follows: laminar = 1, segmental = 3, and lobar = 10 points. RESULTS: All patients had pleural effusion or atelectasis. Between day 2 and day 7, the number of patients with effusions or atelectasis on the right side decreased (P INTRODUÇÃO: O comprometimento pleuro-pulmonar é freqüente após cirurgia de revascularização do miocárdio independente do uso de veia safena ou de artéria mamária interna. A presença de atelectasias e derrame pleural tem sido atribuída ao trauma torácico. OBJETIVOS: Definir a incidência do comprometimento pleuro-pulmonar observado através de tomografia computadorizada, analisando a influência do trauma no desenvolvimento destas complicações. MÉTODOS: Trinta pacientes foram submetidos a cirurgia eletiva de revascularização do miocárdio (8 safena e 22 também mamária com pleurotomia. Foi drenada a cavidade pleural esquerda de todos os pacientes do grupo mamária. Realizada Tomografia Computadorizada do tórax no 2º e 7º dias pós-op, avaliando-se o derrame pleural (0: sem líquido e 4: derrame

  18. Theoretical prediction on vibrational spectra of [Ar…Ar-H]+

    Institute of Scientific and Technical Information of China (English)

    李巍; 赵新生

    2003-01-01

    Centrosymmetric linear [Ar-H-Ar]+ and asymmetric linear [Ar…Ar-H]+ are two stable configurations of [Ar2H]+. Based on the global potential energy surface of [Ar2H]+ provided by our group recently, we calculated the vibrational spectra of [Ar…Ar-H]+ with total angular momentum J = 0 by time-dependent quantum mechanical method, and the influence of quantum tunneling effect on vibrational spectra was found. With the help of the observation on the eigenstate functions and the modified potential energy surface, assignments were made to the spectra. The strong coupling between the excited bending mode of [Ar-H-Ar]+ and the vibrational states of [Ar…Ar-H]+ was discussed.

  19. Influence of secondary packing on the freezing time of chiken meat in air blast freezing tunnels Influência da embalagem secundária sobre o tempo de congelamento de carne de frango em túneis de circulação de ar forçada

    Directory of Open Access Journals (Sweden)

    Clarice de Ávila Santos

    2008-12-01

    Full Text Available Freezing of poultry cuts in continuous convective air blast tunnels is normally performed with the products protected by Low Density Polyethylene (LDPE as a primary packaging and using Corrugated Cardboard Boxes (CCB as secondary packaging. The objective of this work was to investigate the influence of these secondary packaging on the freezing of poultry cuts in continuous convective air blast tunnels. The study was performed by replacing CCB with Perforated Metal Boxes (PMB in order to remove the packaging thermal resistance. The assays, performed in a industrial plant, demonstrated that CCB used commercially for meat freezing have a high heat transfer resistance. Their replacement with PMB can lead to shorter freezing times and spatially homogeneous freezing. Reductions of up to 45% in the freezing times were observed using PMB. The plateau of the temperature curve, related to the freezing time of free water, was significantly reduced using PMB, which is accepted to lead to better product quality after thawing. As the products were protected by the LDPE films as primary packaging, their appearance were not affected. The results presented in this work indicate that replacing CBB with PMB can be an excellent alternative to reduce freezing time and improve freezing homogeneity in industrial air blast tunnels, which could also be applied to other products.O congelamento de cortes de frango em túneis convectivos é normalmente realizado com o produto envolto por filmes de polietileno de baixa densidade (PEBD, embalagem primária e acondicionado em caixas de papelão (CP, embalagem secundária. O objetivo deste trabalho foi avaliar o efeito da embalagem secundária no congelamento dos cortes de frango. Para isso, compararam-se as curvas de congelamento do produto processado acondicionado em caixas metálicas perfuradas (CMP, que praticamente eliminam a resistência térmica da embalagem secundária, com as curvas de congelamento do produto nas CP

  20. Tomografia computadorizada de alta resolução nas complicações pulmonares pós-transplante de medula óssea: ensaio iconográfico High-resolution computed tomography findings in pulmonary complications after bone marrow transplantation: iconographic essay

    Directory of Open Access Journals (Sweden)

    Emerson L. Gasparetto

    2005-12-01

    Full Text Available O transplante de medula óssea (TMO tem sido utilizado como tratamento de escolha para diversas doenças hematológicas. Entretanto, as complicações pulmonares, que podem ocorrer em até 60% dos pacientes, são o principal motivo de falha no tratamento. As complicações pulmonares pós-TMO podem ser divididas em três fases, de acordo com a imunidade do paciente. Na primeira fase, até 30 dias após o procedimento, predominam as complicações não infecciosas e as pneumonias fúngicas. Na fase precoce, que vai até o 100º dia pós-TMO, as infecções virais, principalmente por citomegalovírus, são mais comuns. Finalmente, na fase tardia pós-TMO, complicações não infecciosas como bronquiolite obliterante com pneumonia em organização e doença do enxerto contra o hospedeiro são mais comumente observadas. Os autores apresentam um ensaio iconográfico, enfatizando os aspectos de tomografia de alta resolução em pacientes com complicações pulmonares pós-TMO.Bone marrow transplantation has been the treatment of choice for many hematologic diseases. However, pulmonary complications, which may occur in up to 60% of the patients, are the main cause of treatment failure and may be divided in three phases according to the patient's immunity. In the first phase, up to 30 days after the procedure, there is a predominance of non-infectious complications and fungal pneumonia. Viral infections, mainly by cytomegalovirus, are common in the second phase (up to 100 days after bone marrow transplantation. Finally, in the late phase after bone marrow transplantation, non-infectious complications as bronchiolitis obliterans organizing pneumonia and graft-versus-host disease are most commonly seen. The authors present a pictorial essay of the high-resolution computed tomography findings in patients with pulmonary complications after bone marrow transplantation.

  1. Planar defects as Ar traps in trioctahedral micas: A mechanism for increased Ar retentivity in phlogopite

    Science.gov (United States)

    Camacho, A.; Lee, J. K. W.; Fitz Gerald, J. D.; Zhao, J.; Abdu, Y. A.; Jenkins, D. M.; Hawthorne, F. C.; Kyser, T. K.; Creaser, R. A.; Armstrong, R.; Heaman, L. W.

    2012-08-01

    The effects of planar defects and composition on Ar mobility in trioctahedral micas have been investigated in samples from a small marble outcrop (∼500 m2) in the Frontenac Terrane, Grenville Province, Ontario. These micas crystallized during amphibolite-facies metamorphism at ∼1170 Ma and experienced a thermal pulse ∼100 Ma later at shallow crustal levels associated with the emplacement of plutons. 87Rb/86Sr ages of the phlogopites range from ∼950 to ∼1050 Ma, consistent with resetting during the later thermal event. The same phlogopites however, give 40Ar/39Ar ages between ∼950 and 1160 Ma, spanning the age range of the two thermal events. This result is intriguing because these micas have undergone the same thermal history and were not deformed after peak metamorphic conditions. In order to understand this phenomenon, the chemical, crystallographical, and microstructural nature of four mica samples has been characterized in detail using a wide range of analytical techniques. The scanning electron microscope (SEM), electron microprobe (EMP), and laser ablation inductively coupled plasma mass spectrometry (LA-ICP-MS) data show that the micas are chemically homogeneous (with the exception of Ba) and similar in composition. The Fourier transform infrared spectroscopy and Mossbauer results show that the M sites for three of the micas are dominated by divalent cations and the Fe3+/(Fe2++Fe3+) ratio for all four phlogopites ranges from 0.10 to 0.25. The stable-isotopic data for calcite indicate that this outcrop was not affected by hydrothermal fluids after peak metamorphism. No correlation between chemical composition and 87Rb/86Sr and 40Ar/39Ar age or between crystal size and 40Ar/39Ar age is observed. The only major difference among all of the micas was revealed through transmitted electron microscope (TEM), which shows that the older 1M micas contain significantly more layer stacking defects, associated with crystallization, than the younger micas. We

  2. Ar-Ar Dating of Martian Meteorite, Dhofar 378: An Early Shock Event?

    Science.gov (United States)

    Park, J.; Bogard, D. D.

    2006-01-01

    Martian meteorite, Dhofar 378 (Dho378) is a basaltic shergottite from Oman, weighing 15 g, and possessing a black fusion crust. Chemical similarities between Dho378 and the Los Angeles 001 shergottite suggests that they might have derived from the same Mars locale. The plagioclase in other shergottites has been converted to maskelenite by shock, but Dho378 apparently experienced even more intense shock heating, estimated at 55-75 GPa. Dho378 feldspar (approximately 43 modal %) melted, partially flowed and vesiculated, and then partially recrystallized. Areas of feldspathic glass are appreciably enriched in K, whereas individual plagioclases show a range in the Or/An ratio of approximately 0.18-0.017. Radiometric dating of martian shergottites indicate variable formation times of 160-475 Myr, whereas cosmic ray exposure (CRE) ages of shergottites indicate most were ejected from Mars within the past few Myr. Most determined Ar-39-Ar-40 ages of shergottites appear older than other radiometric ages because of the presence of large amounts of martian atmosphere or interior Ar-40. Among all types of meteorites and returned lunar rocks, the impact event that initiated the CRE age very rarely reset the Ar-Ar age. This is because a minimum time and temperature is required to facilitate Ar diffusion loss. It is generally assumed that the shock-texture characteristics in martian meteorites were produced by the impact events that ejected the rocks from Mars, although the time of these shock events (as opposed to CRE ages) are not directly dated. Here we report Ar-39-Ar-40 dating of Dho378 plagioclase. We suggest that the determined age dates the intense shock heating event this meteorite experienced, but that it was not the impact that initiated the CRE age.

  3. Effects of Sorafenib on <em>C>-Terminally Truncated Androgen Receptor Variants in Human Prostate Cancer Cells

    Directory of Open Access Journals (Sweden)

    Mark Schrader

    2012-09-01

    Full Text Available Recent evidence suggests that the development of castration resistant prostate cancer (CRPCa is commonly associated with an aberrant, ligand-independent activation of the androgen receptor (AR. A putative mechanism allowing prostate cancer (PCa cells to grow under low levels of androgens, is the expression of constitutively active, <em>C>-terminally truncated AR lacking the AR-ligand binding domain (LBD. Due to the absence of a LBD, these receptors, termed ARΔLBD, are unable to respond to any form of anti-hormonal therapies. In this study we demonstrate that the multikinase inhibitor sorafenib inhibits AR as well as ARΔLBD-signalling in CRPCa cells. This inhibition was paralleled by proteasomal degradation of the AR- and ARΔLBD-molecules. In line with these observations, maximal antiproliferative effects of sorafenib were achieved in AR and ARΔLBD-positive PCa cells. The present findings warrant further investigations on sorafenib as an option for the treatment of advanced AR-positive PCa.

  4. Criação intensiva de suínos em confinamento ou ao ar livre: estudo meta-analítico do desempenho zootécnico nas fases de crescimento e terminação e avaliação de carcaça e carne no Longissimus dorsi Intensive pig production in confinement or outdoor systems: a meta-analytical study of the production performance in the growing and finishing phases and carcass and meat evaluation from the Longissimus dorsi

    Directory of Open Access Journals (Sweden)

    Alice Bogoni Demori

    2012-07-01

    Full Text Available Uma meta-análise foi realizada para avaliar o desempenho e a qualidade de carcaça e carne de suínos em função do sistema de alojamento nas fases de crescimento/terminação. Foram selecionadas publicações indexadas com resultados de experimentos comparando variáveis de desempenho e de pós-abate de suínos alojados em sistemas intensivos convencionais ou ao ar livre. A base de dados contemplou 27 artigos publicados entre 1997 e 2009. Ao total, foram considerados 2.985 animais e 701 médias na análise de dados. A meta-análise foi realizada através de duas análises sequenciais: gráfica e de variância-covariância. O sistema de criação de suínos ao ar livre aumentou em 9% (P0,05 pelo sistema de alojamento dos suínos. Concluiu-se que o sistema de criação influencia no desempenho dos suínos, mas não interfere nas características de carcaça e carne estudadas.A meta-analysis was carried out to study performance and characteristics of carcass and meat in pigs in function of housing system during the growing/finishing period. Indexed publications with results of experiments comparing performance and post-slaughter variables of pigs housed in outdoor or conventional intensive systems were selected. In total, 2.985 animals and 701 averages were considered in the data analysis. Meta-analysis followed two sequential analyses: graphic and variance. The outdoor productive system increased in 9% (P0.05 by the housing system. It is concluded that the housing system influences the pig performance, but does not interfere in characteristics of carcass and meat.

  5. Ar/39Ar age spectrum analysis of detrital microclines from the southern San Joaquin Basin, California

    International Nuclear Information System (INIS)

    Detrital microcline grains from sedimentary strata preserve a record of thermal evolution in the temperature range approx.= 1000 to 2000C which can be revealed by 40Ar/39Ar age spectrum analysis. Microcline separates from deep drill hole intersections with Eocene to Miocene sediments in the Basin and Tejon Blocks of the southern San Joaquin Valley, California, analysed by the age spectrum approach show radiogenic 40Ar (40Ar*) gradients that record both the slow cooling of the uplifting sediment source approx.= 65 Ma ago, and a recent thermal event. This information, in conjunction with the observation of fission track annealing in the coexisting apatites, allows estimation of the temperature-time conditions of this thermal event at about 1400C for approx.= 200 ka. Present and paleotemperature data is in accord with heating related to several kilometers of Pleistocene sediment deposition. Heat flow calculations suggest that this recent subsidence has depressed the thermal gradient from about 300C km-1 to the present apparent gradient of 240C km-1. 40Ar/39Ar analysis of detrital microcline crystals yields thermochronological information in the temperature-time range of petroleum maturation and provides this technique with potential as both a useful exploration tool and as a means of probing the fundamental geodynamic processes of basin evolution. (orig.)

  6. Ar-Ar Dating on the Metallogenesis of the Dongchuang Gold Deposit in the Xiaoqinling Area

    Institute of Scientific and Technical Information of China (English)

    李强之; 陈衍景; 钟增球; 李文良; 李绍如; 郭晓东; 金宝义

    2002-01-01

    The Dongchuang gold deposit in the Xiaoqinling area is an orogenic-type lode gold deposit. It is one ofthe few superlarge (>100 t Au) deposits in China. Although it has been argued that it was formed in the Mesozoic,related isotopic age data have not been reported in previous studies. Based on detailed geological study, the authors havecarried out isotopic dating on various metallogenic generations. The ore-forming process of the Dongchuang golddeposit consists of four stages: coarse-grained pyrite-bearing quartz veins (stageⅠ), fine-grained pyrite-quartz veinlets(stage Ⅱ), multi-sulfides (stage Ⅲ) and carbonate-quartz veinlets (stage Ⅳ). Ar-Ar dating on mineral separates of stagesⅠ, Ⅱ and Ⅲ yields plateau ages of 142.9±2.9 Ma, 132.2±2.6 Ma and 128.3±6.2 Ma, respectively. Sericite separates fromstage Ⅱ assemblage also yield an Ar-Ar isochron age of 132.6±2.7 Ma, similar to the Ar-Ar plateau age. These resultssuggest that the Dongchuang gold deposit was mainly formed during 143-128 Ma, coinciding with the authors'geological observations and previous hypothesis. This ore formation is coeval with the regional-tectonic transition fromcollisional compression to extension, strongly showing that the decompression-geothermal increase regime duringcompression-to-extension transition is the most conducive geodynamic environment to orogenic-type goldmineralization.

  7. Acurácia da mensuração do enfisema pulmonar na tomografia computadorizada: pontos importantes Accuracy of measurement of pulmonary emphysema with computed tomography: relevant points

    Directory of Open Access Journals (Sweden)

    Bruno Hochhegger

    2010-08-01

    Full Text Available Para garantir a confiabilidade dos dados de quantificação computadorizada do enfisema pulmonar (densitovolumetria pulmonar na tomografia computadorizada, alguns aspectos técnicos devem ser considerados. A alteração das densidades na tomografia computadorizada com as mudanças no nível de inspiração e expiração do pulmão, com a espessura de corte da tomografia computadorizada, com o algoritmo de reconstrução e com o tipo de tomógrafo dificulta as comparações tomográficas nos estudos de acompanhamento do enfisema pulmonar. No entanto, a densitovolumetria pulmonar substituiu a avaliação visual e compete com as provas de função pulmonar como método para medir o enfisema pulmonar. Esta revisão discute as variáveis técnicas que alteram a aferição do enfisema na tomografia computadorizada e sua influência nas medições de enfisema.Some technical aspects should be taken into consideration in order to guarantee the reliability of the assessment of pulmonary emphysema with lung computed tomography densitometry. Changes in lung density associated with variations in lungs inspiratory and expiratory levels, computed tomography slice thickness, reconstruction algorithm and type of computed tomography apparatus make tomographic comparisons more difficult in follow up studies of pulmonary emphysema. Nevertheless, quantitative computed tomography has replaced the visual assessment competing with pulmonary function tests as a sensitive method to measure pulmonary emphysema. The present review discusses technical variables of lung computed tomography and their influence on measurements of pulmonary emphysema.

  8. Influência das condições de operação em spray dryer piloto sobre a umidade e a atividade de água do leite em pó integral

    OpenAIRE

    Ítalo Tuler Perrone; Moisés Simeão; Paulo Henrique Rodrigues Júnior; Rodrigo Stephani; Antonio Fernandes de Carvalho

    2013-01-01

    O objetivo desse trabalho foi determinar a influência das condições de operação em spray dryer piloto sobre a umidade e a atividade de água do leite em pó integral. Foram empregados seis tratamentos nos quais se variou a temperatura do ar de entrada, a vazão de ar na câmara e a vazão de produto. O tratamento com menor temperatura do ar de entrada, menor vazão de ar e menor temperatura do ar de saída neste experimento possibilitaram que o leite em pó integral tivesse atividade de água média su...

  9. Correlação entre hipótese diagnóstica e laudo de tomografia axial computadorizada craniana Correlation between diagnostic hypothesis and result of cranial computed axial tomography

    Directory of Open Access Journals (Sweden)

    Edison Matos Nóvak

    2001-09-01

    Full Text Available Para avaliar a utilização da tomografia axial computadorizada craniana (TC em nosso meio, analisamos as solicitações de 367 exames consecutivos no período compreendido entre 07/1995 e 07/1996. Houve ampla variação da faixa etária, com média de 31,7 ± 22,9 anos. As especialidades que mais solicitaram o exame foram: Neurologia (36,2%, Pronto Atendimento (17,4%, Neuropediatria (16,9% e Clínica Médica (5,9%. As indicações mais frequentes para o exame foram: convulsão (30%, cefaléia (26,2%, déficit motor (20,2% e redução do nível de consciência (16,9%. As "hipóteses" aventadas com maior frequência foram: afastar lesão estrutural (9,0%, acidente vascular não discriminado (8,2% e neurocisticercose (8,2%. O laudo da TC foi normal em 50,4% dos exames. Os laudos anormais mais frequentes foram: hidrocefalia (5,4%, acidente vascular isquêmico (5,4% e neoplasia (3,5%. As maiores taxas de achados normais foram encontradas nas "hipóteses" de cefaléia (94,4%, convulsão (71,4% e afastar lesão estrutural (66,7%. Os maiores índices de acerto entre hipótese e laudo foram encontrados nas situações de "afastar lesões estruturais" (66,7%, hidrocefalia (50%, acidente vascular cerebral isquêmico (50% e hematoma (50%. Concluimos que a utilização de um recurso auxiliar de diagnóstico como a TC cumpre melhor ainda a sua função se o requisitante do exame preencher com clareza e detalhamento o pedido do exame.The use of computed axial tomography (CT in the investigation of neurologic disorders is attractive for his disponibility in the health services. However, the indications of the exam and the correlation with the clinical features has not been frequently studied. We study correlation between the requests of CT and the findings reported by the radiologist, in 367 exams performed from 07/1995 to 07/ 1996. The mean age was 31.7 ± 22.9 years. The CT were requested in decrescent order of frequency by the Services of Neurology (36

  10. A natural laboratory for 40Ar/39Ar geochronology: ICDP cores from Lake Van, Turkey

    Science.gov (United States)

    Engelhardt, Jonathan; Sudo, Masafumi; Oberhänsli, Roland

    2015-04-01

    Pore water samples from ICDP Paleovan cores indicate a limited pore water exchange within Quaternary lake sediments. The core's volcaniclastic sections bear unaltered K-rich ternary feldspar and fresh to altered glass shards of predominantly rhyolitic composition. Whereas applying the 40Ar/39Ar method on feldspars resulted in ages timing a late-stage crystallization, glass shards had the potential to date the eruption. Volcanic glass is prone to modifications such as hydrous alteration (palagonitization) and devitrification (Cerling et al., 1985). These modifications affect the glass' chemistry and challenge the application of the 40Ar/39Ar method. Gaining precise radiometric ages from two phases has the potential to strengthen a climate-stratigraphic age-model (Stockhecke et al., 2014), and to significantly increase the temporal resolution on the deposition of the lake sediments. Vice versa the core's previous age model has the ability to question the reliability of 40Ar/39Ar eruption ages derived from ternary feldspars and glass shards. Multi- and single-grain total fusion on alkali feldspars from six volcaniclastic deposits resulted in Pleistocene ages that are in good agreement with the predicted age model. Feldspar phenocrysts from three ashes in the core's youngest section yielded consistent isochron ages that are significantly older than the model's prediction. Several distinct stratigraphic and paleomagnetic time markers of similar stratigraphic positions contradict to the older radiometric dates (Stockhecke et al., 2014). Partial resorption features of inherited feldspar domains and the involvement of excess 40Ar indicate incomplete degassing of older domains. To evaluate the magmatic history of the different domains EMPA mappings of trace elements that could be interpreted as Ar diffusion couples are currently conducted. Geochronology on Paleovan cores offers unique opportunities to monitor the effect of alteration on the Ar-systematics of volcanic glass

  11. Estudo da transferência das cloraminas da água para o ar duma piscina coberta

    OpenAIRE

    Barbosa, Albino António da Silva

    2009-01-01

    Mestrado em Engenharia Química A qualidade do ar em ambientes de piscinas cobertas, bem como seus efeitos no sistema respiratório humano, tem vindo a ser estudada por diversos autores. Estes concluíram, por exemplo, que a exposição prolongada à tricloramina é causa de asma ocupacional entre funcionários de piscinas, e muito provavelmente causa de asma entre frequentadores assíduos. O cloro combinado ou as cloraminas assim como outros subprodutos da desinfecção resultam da reacção entre ...

  12. Dicty_cDB: FC-AR02 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR02 (Link to dictyBase) - - - Contig-U15981-1 FC-AR02P (Li...nk to Original site) FC-AR02F 518 FC-AR02Z 247 FC-AR02P 764 - - Show FC-AR02 Library FC (Link to library) Clone ID FC-AR...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR02Q.Seq.d/ Representative seq. ID FC-AR...02P (Link to Original site) Representative DNA sequence >FC-AR02 (FC-AR02Q) /CSM/FC/FC-AR/FC-AR...logy vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR02 (FC-AR02Q) /CSM/FC/FC-AR/FC-AR

  13. Cartografar é traçar um plano comum

    Directory of Open Access Journals (Sweden)

    Virgínia Kastrup

    2013-08-01

    Full Text Available A pesquisa de campo sobre produção da subjetividade enfrenta o problema de construir conhecimento envolvendo pesquisadores e pesquisados, com territórios e semióticas singulares. Surgem questões relativas ao protagonismo dos participantes e a como traçar com eles um plano comum, garantindo o caráter participativo da pesquisa. No contexto do método da cartografia, o artigo tem como objetivo tratar do tema do comum num duplo aspecto. Num primeiro, discute o acesso ao plano comum. Com base em Gilles Deleuze e Felix Guattari, tal plano não é dito homogêneo nem reúne atores que manteriam entre si relações de identidade, mas opera comunicação entre singularidades, sendo pré-individual e coletivo. Num segundo aspecto, aponta que, enquanto pesquisa-intervenção, a cartografia se compromete com a criação de um mundo comum e heterogêneo. O artigo mostra que o traçado do comum tem como diretriz metodológica a tranversalidade e examina os procedimentos de participação, inclusão e tradução.

  14. On concentration of $^{42}$Ar in the Earth's atmosphere

    CERN Document Server

    Barabash, A S

    2016-01-01

    Data from the DBA liquid argon ionization chamber experiment have been used to obtain an estimate on the concentration of $^{42}$Ar in the Earth's atmosphere, $6.8^{+1.7}_{-3.2}\\cdot10^{-21}$ atoms of $^{42}$Ar per atom of $^{40}$Ar corresponding to the $^{42}$Ar activity of $1.2^{+0.3}_{-0.5}$ $\\mu$Bq per cubic meter of air.

  15. High-spin yrast levels of 38Ar

    NARCIS (Netherlands)

    Aarts, H.J.M.; Engelbertink, G.A.P.; Eggenhuisen, H.H.; Ekström, L.P.

    1979-01-01

    High-spin states of 38Ar have been studied with the 35Cl(α, pγ)38Ar reaction at Eα = 18 MeV and with the 24Mg(16O, 2pγ)38Ar reaction at E(16O) = 38 and 45 MeV. The 38Ar level scheme is obtained with the former reaction from a proton-γ coincidence measurement. Gamma-gamma coincidence, γ-ray angular d

  16. Growth Rate Estimates of Supergene Manganese Nodule by 40Ar/39Ar Isotopic Dating

    Institute of Scientific and Technical Information of China (English)

    Li Jianwei; Vasconcelos P M

    2004-01-01

    Increasing world-class, high-grade, and metals-enriched supergene manganese ore deposits have been discovered in the last two decades, making them more and more economically important. However, data on the timing and duration of their formation are sparse, mainly due to the difficulties extracting datable minerals suited to traditional radiometric dating methods. Hollandite, cryptomelane, coronadite, todorokite, and manjiroite are common manganese oxide minerals in supergene environments. These minerals host potassium of variable amounts from 0.1 wt% to 5.0 wt% in their structural sites. This geochemical property provides possibility to date supergene manganese ores by using K-Ar and 40Ar/39Ar methods. In this study, we perform 40Ar/39Ar dating on a 7.1-cm-thick botryoidal manganese nodule from an ancient weathering profile at Mount Tabor, central Queensland, Australia. Laser microprobe incremental analyses of distinct growth bands, from the inner core through the intermediate bands to the outermost crusts of the nodule, have yielded high quality 40Ar/39Ar ages at 27.3 Ma, 20.9 Ma, 19.2 Ma, and 16.1 Ma, respectively. The age results permit preliminary estimates on the average growth rates of the nodule varying from 4.7×10-3 mm/ka to 7.6×10-3 mm/ka to 9.0×10-3 mm/ka, from the core to the rim. Results of this study are of significance in our understanding of the mode, mechanism, process, and climatic conditions in the formation of supergene manganese ore deposits.

  17. Escala Diagnóstica Adaptativa Operacionalizada de Autorrelato - EDAO-AR: Evidências de Validade

    Directory of Open Access Journals (Sweden)

    Elisa Medici Pizao Yoshida

    2013-04-01

    Full Text Available A Escala Diagnóstica Adaptativa Operacionalizada-Revisada (EDAO-R fornece medida da eficácia adaptativa, entendida como o grau de sucesso obtido no enfrentamento das vicissitudes da vida. Sua avaliação baseia-se em material de entrevista clínica. O estudo teve por objetivo obter evidências de validade da versão de autorrelato da EDAO-R, ou EDAO-AR. Foram desenvolvidos itens para avaliar a adequação da adaptação de dois setores da personalidade: Afetivo-Relacional (A-R e Produtividade (Pr. A amostra foi composta por 237 pacientes ambulatoriais e acompanhantes. Houve evidências de validade baseada na estrutura interna (consistência interna, análise fatorial, análise de agrupamentos e validade baseada em variáveis externas (relação entre EDAO-AR e Escala de Avaliação de Sintomas-40/EAS-40. Os resultados apontaram boa consistência interna e três dimensões para ambos os setores: foco na situação problema, foco na relação interpessoal e foco no eu. Obteve-se, conforme esperado, correlações negativas entre a EDAO-AR e EAS-40. Foram feitas sugestões para a segunda versão da escala.

  18. Padronização de um método para mensuração das tábuas ósseas vestibular e lingual dos maxilares na Tomografia Computadorizada de Feixe Cônico (Cone Beam Methodology standardization for measuring buccal and lingual alveolar bone plates using Cone Beam Computed Tomography

    Directory of Open Access Journals (Sweden)

    Marcos Cezar Ferreira

    2010-02-01

    Full Text Available INTRODUÇÃO: a espessura das tábuas ósseas que recobrem os dentes por vestibular e lingual constitui um dos fatores limitantes da movimentação dentária. O avanço tecnológico em Imaginologia permitiu avaliar detalhadamente essas regiões anatômicas por meio da utilização da tomografia computadorizada de feixe cônico (TCFC. OBJETIVO: descrever e padronizar, pormenorizadamente, um método para mensuração das tábuas ósseas vestibular e lingual dos maxilares nas imagens de tomografia computadorizada de feixe cônico. METODOLOGIA: a padronização digital da posição da imagem da face deve constituir o primeiro passo antes da seleção dos cortes de TCFC. Dois cortes axiais de cada maxilar foram empregados para a mensuração da espessura do osso alveolar vestibular e lingual. Utilizou-se como referência a junção cemento-esmalte dos primeiros molares permanentes, tanto na arcada superior quanto na inferior. RESULTADOS: cortes axiais paralelos ao plano palatino foram indicados para avaliação quantitativa do osso alveolar na maxila. Na arcada inferior, os cortes axiais devem ser paralelos ao plano oclusal funcional. CONCLUSÃO: o método descrito apresenta reprodutibilidade para utilização em pesquisas, assim como para a avaliação clínica das repercussões periodontais da movimentação dentária, ao permitir a comparação de imagens pré e pós-tratamento.INTRODUCTION: The thickness of the buccal and lingual bone plates constitutes one of the limiting factors of the orthodontic movement. The imaging technology has permitted the evaluation of this anatomical region, by means of cone beam computed tomography. PURPOSE: To describe and standardize, in details, a method for measuring the buccal and lingual bone plate thickness in CBCT images. METHODOLOGY: Digital standardization of face image should constitute the first step before the selection of CBCT slices. Two axial sections of each jaw were used for measuring the thickness

  19. Arsénico en el agua de bebida: un problema de salud pública Arsênio na água de beber: um problema de saúde pública

    Directory of Open Access Journals (Sweden)

    Alexandra Galetovic Carabantes

    2003-12-01

    Full Text Available La presencia de arsénico en el ambiente es un problema de salud pública debido a que se trata de un evento de alta frecuencia que ha sido detectado en países como Argentina, Brasil, Chile, China, India, México y Taiwán, entre otros. El arsénico fue clasificado por la International Agency for Research on Cancer (IARC, como un agente carcinogénico para humanos con base en estudios epidemiológicos que relacionan la ingestión de arsénico en el agua de bebida y cáncer en la piel y estudios ocupacionales que relacionan la exposición al arsénico y cáncer de pulmón. La Organización Mundial de la Salud (OMS recomienda um valor orientador para agua de bebida de 10 mg As/L. Por su parte la Environmental Protection Agency (EPA, considerando estimativas de riesgo realizadas utilizando modelos estadísticos basados en observaciones en humanos y extrapolando los datos para concentraciones inferiores a 50 µg/L, reducirá el valor guía para arsénico en el agua de bebida de 50 µg/L para 10 µg/L. La utilización de biomarcadores permite el desarrollo de la epidemiología molecular que promete ser una herramienta que ayudará a detectar efectos tempranos en poblaciones expuestas, permitiendo la prevención de efectos nocivos considerando las características genéticas de las poblaciones.A presença de arsênio no ambiente é um problema de saúde pública por ser um evento de alta freqüência detectado em países como Argentina, Brasil, Chile, China, Índia, México e Taiwan, entre outros. O arsênio foi classificado pela Agência Internacional de Pesquisa sobre Câncer (IARC, como um agente carcinogênico para humanos com base em estudos epidemiológicos que relacionam a ingestão de arsênico na água para consumo humano e câncer na pele e estudos ocupacionais que relacionam a exposição ao arsênico e câncer no pulmão.A Organização Mundial da Saúde (OMS recomenda um valor orientador para água de beber de 10 mg As/L, enquanto que a

  20. Antarlides: A New Type of Androgen Receptor (AR) Antagonist that Overcomes Resistance to AR-Targeted Therapy.

    Science.gov (United States)

    Saito, Shun; Fujimaki, Takahiro; Panbangred, Watanalai; Igarashi, Yasuhiro; Imoto, Masaya

    2016-02-18

    Prostate cancer is treated with androgen receptor (AR) antagonists but most patients experience disease progression after long-term treatment with these compounds. Therefore, new AR antagonists are required for patient follow-up treatment. In the course of screening for a new AR antagonist, we isolated the novel compounds antarlides A-E (1-5) from Streptomyces sp. BB47. Antarlides are mutually isomeric with respect to the double bond and have a 22-membered-ring macrocyclic structure. The full stereostructure of 1 was established by chemical modifications, including methanolysis, the Trost method, acetonide formation, and the PGME method. 1-5 inhibited the binding of androgen to ARs in vitro. In addition, 2 inhibited the transcriptional activity of not only wild-type AR but also mutant ARs, which are seen in patients with acquired resistance to clinically used AR antagonists. Therefore, antarlides are a potent new generation of AR antagonists that overcome resistance.

  1. Tracking fluid action in Little Sark Pluton (Channel Islands, UK): a UV laserprobe Ar/Ar study of excess 40Ar

    Science.gov (United States)

    Schwenzer, S. P.; Schwanethal, J.; Tindle, A. G.; Kelley, S. P.; Sherlock, S. C.

    2011-12-01

    Little Sark pluton (Channel Islands, UK) is a weakly to moderately deformed pluton of quartz diorite composition. Zircon from Little Sark has been dated as 611.4(+2.1/-1.3) Ma [Miller et al. 1991, Tectonophysics, 312], whereas titanite has an age of 606.2±0.6 Ma. Hornblende yields an Ar-Ar age of 606.4±3.4 Ma [Dallmeyer et al., 1991, J. Geol. Soc. London 148]. The rocks show evidence for post-magmatic hydrous alteration including chloritisation of biotite, and sericite formation in feldspar. We investigated the alteration in order to understand its influence on the Ar-Ar system. Detailed petrographic investigations of two samples indicate different deformation levels - S1, (less deformed), and S2 (more deformed). The feldspar is andesine to oligoclase in composition, but contains K-rich areas with patchy and sometimes cleavage guided sericitization. Mafic minerals include hornblende and biotite (the latter partially chloritized). Ar-Ar investigations were carried out using high spatial resolution UV laser ablation gas release in combination with a Nu instruments Noblesse gas mass spectrometer using spots of 80 to 140 μm diameter. Mafic minerals in S1 have highly variable 38Ar/39Ar and 37Ar/39Ar ratios and unusually high atmospheric contents for such old samples, possibly reflecting the presence of fluid inclusions associated with the sericite, particularly in the feldspar. The apparent ages in their entirety range from 429 to 668 Ma. Hornblende yields homogeneous apparent ages, whereas the younger and older ages are measured in both micas and feldspars, whose apparent ages range from 245-670 Ma. The modal age for feldspar is around 400-450 Ma, but this may not have geological meaning. Sample S2 shows many of the same features as S1. Mafic minerals span a slightly smaller age range and feldspars display apparent ages of ~245-645 Ma with a mode around 480 Ma. The alteration of both samples appears to have been accompanied by the introduction of 40Ar-rich fluids

  2. Computed tomography of the adrenals in patients with tuberculosis; Emprego da tomografia computadorizada na deteccao de alteracoes das adrenais em doentes com tuberculose

    Energy Technology Data Exchange (ETDEWEB)

    Yamashita, Seizo; Machado, Jussara Marcondes; Morceli, Jose [UNESP, Botucatu, SP (Brazil). Faculdade de Medicina. Dept. de Doencas Tropicais e Diagnostico por Imagem]. E-mail: seizo_eid@uol.com.br

    2004-06-01

    We evaluated the adrenals of individuals without tuberculosis (group 1 - G1) and with tuberculosis (group 2 - G2) using computed tomography. The antero-posterior length, the thickness, and the longitudinal length of the adrenals were compared in G1 and G2. The duration of the disease, the occurrence of morphologic abnormalities in G2, the distribution according to sex, age and skin color were also studied. There was difference in the antero-posterior length and thickness of right adrenal between G1 and G2. A higher prevalence of white skin male individuals was observed in G2. There was no association between duration of the disease and the occurrence of morphologic abnormalities in G2. A higher occurrence of adrenal enlargement was observed in G2. The main computed tomography findings in patients with tuberculosis were enlargement of the adrenal without calcification, enlargement of the adrenal with punctiform calcifications, and residual calcification of the adrenal. (author)

  3. Determination of the initial energy in computerized tomography with proton beams; Determinacao da energia inicial em tomografia computadorizada com feixe de protons

    Energy Technology Data Exchange (ETDEWEB)

    Rocha, Rodrigo Luis da

    2007-07-01

    In earliest works devoted to proton computed tomography it was shown that the advantage of pCT image reconstruction appears when the energy is close to the Bragg peak region, since the proton passes the object. This effect provided by the Bragg peak makes the computerized tomography with protons possible. However, when decreasing the initial proton energy, with the increase of the irradiation dose, there are two effects that work simultaneously in opposite ways. First, the energy loss of a proton in an object becomes bigger at small initial energy. At the same time decreasing of the proton energy results in the increase of the energy straggling, requiring a larger number of protons. In this work the radiation dose dependence on the proton initial energy was studied using analytical formulas and computer simulations. The investigation determined that the radiation dose practically does not depend on the initial energy, except in the energy region very close to the minimum energy necessary to pass the object. (author)

  4. Method of evaluation of diagnostics reference levels in computerized tomography; Metodo de avaliacao de niveis de referencia de radiodiagnostico em tomografia computadorizada

    Energy Technology Data Exchange (ETDEWEB)

    Vega, Walter Flores

    1999-04-01

    Computerized tomography is a complex technique with several selectable exposition parameters delivering high doses to the patient. In this work it was developed a simple methodology to evaluate diagnostic reference levels in computerized tomography, using the concept of Multiple Scan Average Dose (MSAD), recently adopted by the Health Ministry. For evaluation of the MSAD, a dose distribution was obtained through a measured dose profile on the axial axis of a water phantom with thermoluminescence dosemeters, TLD-100, for different exam technique. The MSAD was evaluated hrough two distinct methods. First, it was evaluated by the integration of the dose profile of a single slice and, second, obtained by the integration on central slice of the profile of several slices. The latter is in of accordance with the ionization chamber method, suggesting to be the most practical method of dose evaluation to be applied in the diagnostic reference level assessment routine for CT, using TLDs. (author)

  5. Computed tomography of mast cell tumors in dogs: assessment before and after chemotherapy; Tomografia computadorizada de mastocitomas em caes: avaliacao pre e pos-tratamento quimioterapico

    Energy Technology Data Exchange (ETDEWEB)

    Lorigados, Carla A.B.; Matera, Julia Maria; Pinto, Ana Carolina B.C.F.; Macedo, Thais R., E-mail: clorigados@usp.br [Universidade de Sao Paulo (FMVZ/USP), SP (Brazil). Fac. de Medicina Veterinaria e Zootecnia. Dept. de Cirurgia; Coppi, Antonio A.; Ladd, Fernando V.L. [Universidade de Sao Paulo (LSSCA/USP), SP (Brazil). Fac. de Medicina Veterinaria e Zootecnia. Lab. de Estereologia Estocastica e Anatomia Quimica; Souza, Vanessa A.F. de [Faculdades Metropolitanas Unidas (FMU), Sao Paulo, SP (Brazil). Curso de Medicina Veterinaria

    2013-11-15

    Nineteen dogs with mast cell tumors treated with chemotherapy were evaluated by computed tomography (CT). Were evaluated aspects related to contours, attenuation, postcontrast enhancement and presence of cleavage with adjacent structures. The RECIST criteria and volumetric measurement of lesions were performed to assess the response to treatment. The mast cell tumors presented a homogeneous or heterogeneous attenuation, presented more frequently a well delineated and regular contours and moderate enhancement after intravenous administration of the iodinated contrast media. The methods RECIST and volumetric measurements showed an excellent agreement to the classification of therapeutic response, providing a good parameter of the response to treatment. The CT examination proved to be useful in the delimitation of the tumor and an important tool for planning of surgical margins. (author)

  6. Wavelets in quantification of liver tumors in contrasted computed tomography images; Wavelets na quantificacao de tumores de figado em exames contrastados de tomografia computadorizada

    Energy Technology Data Exchange (ETDEWEB)

    Rodrigues, Bruna T.; Alvarez, Matheus; Souza, Rafael T.F.; Miranda, Jose R.A., E-mail: matheus@ibb.unesp.br [Universidade Estadual Paulista Julio de Mesquita Filho (UNESP), Botucatu, SP (Brazil). Instituto de Biociencias. Departamento de Fisica e Biofisica; Romeiro, Fernando G. [Universidade Estadual Paulista Julio de Mesquita Filho (UNESP), Botucatu, SP (Brazil). Fac de Mediciana. Departamento de Clinica Medica; Pina, Diana R. de; Trindade, Andre Petean [Universidade Estadual Paulista Julio de Mesquita Filho (UNESP), Botucatu, SP (Brazil). Fac. de Medicina. Departamento de Doencas Tropicais e Diagnostico por Imagem

    2012-12-15

    This paper presents an original methodology of liver tumors segmentation, based on wavelet transform. A virtual phantom was constructed with the same mean and standard deviation of the intensity of gray presented by the measured liver tissue. The optimized algorithm had a sensitivity ranging from 0.81 to 0.83, with a specificity of 0.95 for differentiation of hepatic tumors from normal tissues. We obtained a 96% agreement between the pixels segmented by an experienced radiologist and the algorithm presented here. According to the results shown in this work, the algorithm is optimal for the beginning of the tests for quantification of liver tumors in retrospective surveys. (author)

  7. Automatic 2D segmentation of airways in thorax computed tomography images; Segmentacao automatica 2D de vias aereas em imagens de tomografia computadorizada do torax

    Energy Technology Data Exchange (ETDEWEB)

    Cavalcante, Tarique da Silveira; Cortez, Paulo Cesar; Almeida, Thomaz Maia de, E-mail: tarique@lesc.ufc.br [Universidade Federal do Ceara (UFC), Fortaleza, CE (Brazil). Dept. de Engenharia de Teleinformatica; Felix, John Hebert da Silva [Universidade da Integracao Internacional da Lusofonia Afro-Brasileira (UNILAB), Redencao, CE (Brazil). Departamento de Energias; Holanda, Marcelo Alcantara [Universidade Federal do Ceara (UFC), Fortaleza, CE (Brazil). Fac. de Medicina

    2013-07-01

    Introduction: much of the world population is affected by pulmonary diseases, such as the bronchial asthma, bronchitis and bronchiectasis. The bronchial diagnosis is based on the airways state. In this sense, the automatic segmentation of the airways in Computed Tomography (CT) scans is a critical step in the aid to diagnosis of these diseases. Methods: this paper evaluates algorithms for airway automatic segmentation, using Neural Network Multilayer Perceptron (MLP) and Lung Densities Analysis (LDA) for detecting airways, along with Region Growing (RG), Active Contour Method (ACM) Balloon and Topology Adaptive to segment them. Results: we obtained results in three stages: comparative analysis of the detection algorithms MLP and LDA, with a gold standard acquired by three physicians with expertise in CT imaging of the chest; comparative analysis of segmentation algorithms ACM Balloon, ACM Topology Adaptive, MLP and RG; and evaluation of possible combinations between segmentation and detection algorithms, resulting in the complete method for automatic segmentation of the airways in 2D. Conclusion: the low incidence of false negative and the significant reduction of false positive, results in similarity coefficient and sensitivity exceeding 91% and 87% respectively, for a combination of algorithms with satisfactory segmentation quality. (author)

  8. Comparative study of dose descriptor in pediatric computed tomography exams; Estudo comparativo de descritor de dose em exames pediatricos de tomografia computadorizada

    Energy Technology Data Exchange (ETDEWEB)

    Finatto, Jerusa Dalbosco; Silva, Ana Maria Marques da, E-mail: jerusa.finatto@acad.pucrs.br, E-mail: ana.marques@pucrs.br [Pontificia Universidade Catolica do Rio Grande do Sul (PUCRS), Porto Alegre, RS (Brazil); Froner, Ana Paula Pastre; Pimentel, Juliana, E-mail: ana.froner@pucrs.br, E-mail: juliana.pimentel@pucrs.br [Hospital Sao Lucas (HSL/PUCRS), Porto Alegre, RS (Brazil)

    2014-07-01

    This work aims to investigate the dose descriptor, volumetric Computed Tomography Dose Index (CTDI), a pediatric patients sample undergoing to skull CT, comparing the results with the diagnostic reference levels of the literature. Were collected volumetric CTDI values of all skull CT exams performed retrospectively in children of 0-10 years of age in a period of 12 months in a large hospital size. Patients, in a total of 103, were divided into four groups, where the criterion of separation used was age, trying to use the same division used in international references dose descriptors. In all acquisitions we used the pediatric protocol and the Automatic Exposure Control (AEC) available on the equipment. The CDTI values, with and without the use of AEC for pediatric studies, were compared. There was a reduction of approximately 100% in the absorbed dose value due to the use of the AEC. From the data collected and analyzed in this work, it is concluded that the use of dose reduction systems is relevant, such as the Care Dose, to maintain volumetric CTDI values within the reference levels. Also it is important the observation of range of children age to the appropriate choice of parameters used in the test protocol. The values obtained are according to the diagnostic reference levels from the literature.

  9. Stratus optical coherence tomography findings in patients with retinopathy of prematurity Tomografia de coerência óptica em pacientes com retinopatia da prematuridade

    OpenAIRE

    Aline do Lago; Lícia Matieli; Michele Gomes; Natalia Tamie Baba; Michel Eid Farah; Rubens Belfort Junior; Nilva Simeren Bueno Moraes

    2007-01-01

    PURPOSE: To describe morphological features of the macula in patients with retinopathy of prematurity. METHODS: Twelve premature babies with retinopathy of prematurity grades I, II and III underwent dilated fundus examination and optical coherence tomography evaluation. RESULTS: In all thirteen eyes of the twelve premature patients optical coherence tomography revealed a condensed retinal pigmented epithelial layer in the macular-foveal area shown by increased reflectivity. In these eyes the ...

  10. Computed tomography findings in patients less than 20 years old with lymphoma; Aspectos da tomografia computadorizada no linfoma em pacientes abaixo de 20 anos de idade

    Energy Technology Data Exchange (ETDEWEB)

    Borba, Adriana Moreira Viana [Pontificia Universidade Catolica do Rio de Janeiro (PUC-RJ), Rio de Janeiro, RJ (Brazil). Escola de Medicina; Monteiro, Alexandra Maria Vieira; Lucena, Stella Beatriz Goncalves de [Universidade do Estado do Rio de Janeiro (UERJ), RJ (Brazil). Faculdade de Ciencias Medicas; Lima, Claudio Marcio Amaral de Oliveira; Ribeiro, Erica Barreiros [Hospital Naval Marcilio Dias, Rio de Janeiro, RJ (Brazil)]. E-mail: cmaol@br.inter.net; Skinner, Luis Flavio [Universidade do Estado do Rio de Janeiro (UERJ), RJ (Brazil). Faculdade de Ciencias Medicas. Hospital Universitario Pedro Ernesto (HUPE)

    2007-03-15

    Objective: To describe the general findings of lymphoma and their histological patterns in patients less than 20 years old. Materials And Methods: Twenty-two cases (16 male and 6 female, mean age 11.5 years) from the digital archive of computed tomography at the Cancer Control Center of Hospital Universitario Pedro Ernesto - Universidade do Estado do Rio de Janeiro, Rio de Janeiro, RJ, Brazil, were retrospectively analyzed in the period between March 2003 and July 2005. Of these 22 cases, 12 were Hodgkin's and 10 were non-Hodgkin's. Results: Overall, mediastinal lymphadenomegaly was the most frequent finding (59%), with predominance in the Hodgkin's subgroup (75%), followed by hepatosplenomegaly (50%) and cervical and retroperitoneal lymphadenomegaly (27.3%). The Hodgkin's subgroup presented a prevalence of lymphadenopathy, in many lymph node chains, followed by hepatosplenomegaly (50%). One case was found with unilateral tonsillar mass, pulmonary ground-glass opacities, and renal nodules. In the non-Hodgkin's subgroup, the disease was predominantly extranodal, characterized by hepatosplenomegaly (50%), thickening of the intestinal wall (40%), pleural effusion (30%), pulmonary nodule (20%), ascites (10%), pericardial effusion (10%) and mixed bone lesions (10%). Conclusion: Computed tomography is an extremely useful method for detection, staging and follow-up of lymphomas, with alert findings like mediastinal lymphadenopathy, hepatosplenomegaly, unilateral tonsillar mass and thickening of intestinal wall. (author)

  11. Crazy-paving: correlation between high resolution computed tomography and anatomopathological findings; Pavimentacao em mosaico: correlacao da tomografia computadorizada de alta resolucao com a anatomopatologia

    Energy Technology Data Exchange (ETDEWEB)

    Marchiori, Edson; Vabo, Karen Amaral do; Damato, Simone Duarte [Universidade Federal Fluminense, Niteroi, RJ (Brazil). Dept. de Radiologia; Kavakama, Jorge [Hospital das Clinicas, Sao Paulo, SP (Brazil). Instituto do Coracao. Servico de Radiologia; Capelozzi, Vera Lucia [Sao Paulo Univ., SP (Brazil). Dept. de Patologia

    2000-06-01

    In this paper we present the high resolution computed tomography findings of various diseases which show a 'crazy-paving' pattern on CT. Cases of alveolar proteinosis, bronchoalveolar carcinoma, lipoid pneumonia and pneumocistosis are illustrated and correlated with the anatomopathological findings. (author)

  12. Planosol soil sample size for computerized tomography measurement of physical parameters; Tamanho de amostras para a determinacao de parametros fisicos em Planossolo por tomografia computadorizada

    Energy Technology Data Exchange (ETDEWEB)

    Pedrotti, Alceu [Sergipe Univ., Sao Cristovao, SE (Brazil). Dept. de Engenharia Agronomica]. E-mail: apedroti@ufs.br; Pauletto, Antonio [Universidade Federal de Pelotas, RS (Brazil). Faculdade de Agronomia Eliseu Maciel. Dept. de Solos; Crestana, Silvio; Cruvinel, Paulo Estevao; Vaz, Carlos Manoel Pedro; Naime, Joao de Mendonca; Silva, Alvaro Macedo da [Empresa Brasileira de Pesquisa Agropecuaria, Sao Carlos, SP (Brazil). Instrumentacao Agropecuaria

    2003-12-01

    Computerized tomography (CT) is an important tool in Soil Science for noninvasive measurement of density and water content of soil samples. This work aims to describe the aspects of sample size adequacy for Planosol (Albaqualf) and to evaluate procedures for statistical analysis, using a CT scanner with a {sup 241} Am source. Density errors attributed to the equipment are 0.051 and 0.046 Mg m{sup -3} for horizons A and B, respectively. The theoretical value for sample thickness for the Planosol, using this equipment, is 4.0 cm for the horizons A and B. The ideal thickness of samples is approximately 6.0 cm, being smaller for samples of the horizon B in relation to A. Alternatives for the improvement of the efficiency analysis and the reliability of the results obtained by CT are also discussed, and indicate good precision and adaptability of the application of this technology in Planosol (Albaqualf) studies. (author)

  13. Dosimetry for computed tomography using Fricke gel dosimetry and magnetic resonance imaging; Dosimetria em tomografia computadorizada empregando dosimetro Fricke gel e a tecnica de imageamento por ressonancia magnetica

    Energy Technology Data Exchange (ETDEWEB)

    Capeleti, Felipe Favaro; Campos, Leticia L., E-mail: felipe@gmpbrasil.com.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2014-04-15

    In this work it was determined a new method for the determination of absorbed doses in Computed Tomography (CT) examinations using Fricke gel dosimetry developed at IPEN. Absorbed doses were determined by different methods of analysis, such as optical absorption spectrometry, ionization chambers and magnetic resonance imaging. Lower limit of sensitivity of the Fricke gel solution, the solution repeatability signal Fricke gel and CT equipment, detection sensitivity, among other tests were performed. Different equipment of computed tomography with multiple detectors were used. The Fricke gel solution showed better repeatability than ±5.5% using the technique of optical absorption spectrophotometry and computed tomography equipment showed repeatability better than ±0.2%. The Fricke gel solution features an easy and relatively quick preparation, but it is necessary to be careful not to contaminate and lose the solution. With the results, it was confirmed the application of this type of dosimetry for computed tomography equipment. (author)

  14. Dose estimation in CT exams of the abdomen based on values of DLP; Estimativa da dose em exames de tomografia de abdome com base nos valores de DLP

    Energy Technology Data Exchange (ETDEWEB)

    Kikuti, C.F.; Medeiros, R.B.; Salvadori, P.S.; Costa, D.M.C; D' lppolito, G., E-mail: kikuticf@gmail.com, E-mail: rbitelli2011@gmail.com [Universidade Federal de Sao Paulo (UNIFESP), SP (Brazil). Coordenadoria de Fisica e Higiene das Radiacoes. Departamento de Diagnostico por Imagem

    2013-10-01

    One of the challenges of multidetector computerized tomography is to minimize the risk of ionizing radiation using optimized protocols since higher doses are necessary to obtain high image quality. It was also noted that, due to the geometry in image acquisition using MDCT becomes necessary to estimate dose values consistent with the hypothesis clinically and with the specificities of the tomographic equipment. The aim of this study was to estimate the doses in abdomen exams from the data recorded on the MDCT console and dimensions obtained from DICOM images of patients undergoing different clinical protocols. Were collected, from the image DICOM of 101 exams, values of the dose length product (DLP) provided by Philips Health Care - Brilliance 64 equipment console, in order to relate them with the dose values obtained by means of thermoluminescent dosimeters ( TLD ) of CasSo{sub 4}:Mn placed on the surface of a cylindrical simulator abdomen acrylic manufactured under the technical - operational conditions for a typical abdomen exam. From the data obtained, it was possible to find a factor of 1.16 ( 5 % ) indicating that the DLP values Brilliance 64 console underestimate the doses and this should be used with correction factor to estimate the total dose of the patient. (author)

  15. Study of radiation conditions for obtaining standard beam computed tomography; Estudo das condicoes de radiacao para obtencao do feixe padrao em tomografia computadorizada

    Energy Technology Data Exchange (ETDEWEB)

    Andrade, Lucio das Chagas de; Peixoto, Jose Guilherme Pereira, E-mail: lucio-andrade@hotmail.com [Instituto de Radioprotecao e Dosimetria (IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil)

    2015-07-01

    In Brazil there is a need to expand the traceability for the calibration of cameras used in dosimetry in CT. Thus, in order to promote the expansion of the radiation conditions RQT, LNMRI disseminate this greatness. These radiation conditions may be characterized in terms of tension in the X-ray tube (PPV), the first half-value layer (1{sup st} HVL) and homogeneity coefficient (CH). The LNMRI achieved satisfactory results within the international specifications suggested by IEC 61267 and TRS 457. (author)

  16. Attainment of dosimetric pediatrics grandeur to computed tomography examinations of the abdomen; Obtencao das grandezas dosimetricas em exames de tomografia computadorizada pediatricas do abdomen

    Energy Technology Data Exchange (ETDEWEB)

    Jormada, Tiago S., E-mail: tsj@cdtn.br [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil). Curso de pos-graduacao em Ciencias e Tecnologia das Radiacoes, Minerais e Materiais; Silva, Teogenes A., E-mail: silvata@cdtn.br [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil)

    2013-10-01

    Currently, 10% of all computerized tomography exams (CT) are made in pediatric patients. In developed countries, the practice of obtaining the dosimetric quantities (weighted index dose C{sub w}, index air kerma volumetric C{sub vol} product kerma-length P{sub KL},{sub CT}) and effective dose (E) in pediatric CT scans is common. In Brazil, data like these are practically nonexistent. The goal of this work is to obtain the dosimetric quantities and the dose effective in pediatric CT scans, and study its application in the optimization process. The study took place in a thermographs' Toshiba Asteion Single-Slice and a GE Brightsped's multi-slice where measurements were made with type pencil ionization chamber and a trunk's phantom of PMMA with diameter of 16 cm. In single-slice CT scanner, the results obtained for the C{sub vol}, P{sub KL},{sub CT} and E were 18.73 mGy, 15.61 mGy and 6.87 mSv mGy.cm 343.51, respectively, whereas in multi-slice CT scanner the results were 18.81 mGy, 20.07 mGy, 441.64 mGy.cm and 8,83 mSv. There was no significant difference between the values of C{sub w} obtained already in the values of the Cvol, P{sub KL},{sub CT} and E dose the differences between the results were quite significant. Comparing the C{sub w} and P{sub KL},{sub CT} and with the values recommended by UCRP 87 (25 mGy for C{sub vol} and 360 mGy.cm for P{sub KL},{sub CT} in pediatric CT scans of the abdomen), the two scanners were below reference levels for C{sub w} and not require an start on process of optimization. (author)

  17. Bronchial asthma: correlation of high resolution computerized tomography findings with clinical data; Asma bronquica: correlacao de achados em tomografia computadorizada de alta resolucao com dados clinicos

    Energy Technology Data Exchange (ETDEWEB)

    Mogami, Roberto [Universidade do Estado, Rio de Janeiro, RJ (Brazil). Servico de Radiologia; Marchiori, Edson [Universidade Federal Fluminense, Niteroi, RJ (Brazil). Dept. de Radiologia; Kirk, Kennedy; Capone, Domenico [Universidade do Estado, Rio de Janeiro, RJ (Brazil). Servico de Pneumologia; Daltro, Pedro [Instituto Fernandes Figueira, Rio de Janeiro, RJ (Brazil). Servico de Radiologia

    1999-04-01

    In this work we did a sectional study of 31 asthmatic patients with several levels of disease severity, which were submitted to high resolution computed tomography of the thorax and spirometry, between the months of July, 1995 and August, 1997. The tomographic findings were correlated with the clinical classification of the patients and the most frequent tomographic findings were bronchial wall thickening, bronchial dilatation, air trapping, centrilobular opacities, cicatricial linear shadows, mucoid impaction, emphysema and atelectasis. In asthmatic patients of long duration we observed small airway disease and irreversible lesions as the predominant findings. In smoking patients there was no high frequency of emphysema. (author)

  18. Dicty_cDB: FC-AR12 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR12 (Link to dictyBase) - - - Contig-U15450-1 FC-AR12E (Li...nk to Original site) - - - - - - FC-AR12E 643 Show FC-AR12 Library FC (Link to library) Clone ID FC-AR12 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR12Q.Seq.d/ Representative seq. ID FC-AR...12E (Link to Original site) Representative DNA sequence >FC-AR12 (FC-AR12Q) /CSM/FC/FC-AR/FC-AR12Q.Seq....cid sequence KMSAKAATKNATKVAVKAPEATTPVETKKSKKDNVMRGLRIEKLVLNICVGESGDRLVRA AKVLEQLTGQTPVYSKARYTVRSFNIRRNEQIAA

  19. Dicty_cDB: FC-AR03 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR03 (Link to dictyBase) - - - Contig-U14922-1 FC-AR03E (Li...nk to Original site) - - - - - - FC-AR03E 619 Show FC-AR03 Library FC (Link to library) Clone ID FC-AR03 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR03Q.Seq.d/ Representative seq. ID FC-AR...03E (Link to Original site) Representative DNA sequence >FC-AR03 (FC-AR03Q) /CSM/FC/FC-AR/FC-AR03Q.Seq....MGELTSAGLSFSSCEIPVRQDIANGYQRLTEVENNIRQGMEDLSNNEQG YFEEGIRDYLRAISSVKELLNDRLDALMSMQNNERNVAAKKEKAAKTTGAKAANMQKEVD DAVRKLTEATTEYEKISASAR

  20. The thermal history of the Lhasa Block, South Tibetan Plateau based on FTD and Ar-Ar dating

    CERN Document Server

    Yang, T F; Lo Chong Huah; Chung, S L; Tien, R L; Xu, R; Deng, W

    1999-01-01

    Twelve basement samples were collected from South Tibet Plateau for FTD and Ar-Ar analysis to demonstrate their uplifting history since Cenozoic era. The preliminary results from different minerals with different closure temperatures, including apatite and zircon for fission-track dating, and K-feldspar, biotite for Ar-Ar dating, show that at least four stages of thermal history can be recognized in the studied area.

  1. A test of the 40Ar/39Ar age spectrum technique on some terrestrial materials

    Science.gov (United States)

    Lanphere, M.A.; Brent, Dalrymple G.

    1971-01-01

    40Ar/39Ar age spectra were determined for 10 terrestrial rock and mineral samples whose geologic history is known from independent evidence. The spectra for six mineral and whole rock samples, including biotite, feldspar, hornblende, muscovite, and granodiorite, that have experienced post-crystallization heating did not reveal the age of crystallization in any obvious way. Minima in the spectra, however, give reasonable maximum ages for reheating and high-temperature maxima can be interpreted as minimum crystallization ages. High-temperature ages of microcline and albite that have not been reheated are approximately 10% younger than the known crystallization age. Apparently there are no domains in these feldspars that have retained radiogenic 40Ar quantitatively. Spectra from two diabase samples that contain significant quantities of excess argon might mistakenly be interpreted as spectra from reheated samples and do not give the age of emplacement. The 40Ar/39Ar age spectrum technique may be a potentially valuable tool for the study of geologic areas with complex histories, but the interpretation of age spectra from terrestrial samples seems to be more difficult than suggested by some previous studies. ?? 1971.

  2. Evaluation of apical deviation in root canals instrumented with K3 and ProTaper systems Avaliação do desvio apical em canais instrumentados pelos sistemas K3 e ProTaper

    Directory of Open Access Journals (Sweden)

    Mariana Diniz Bisi dos Santos

    2006-12-01

    Full Text Available OBJECTIVES: this study evaluated the apical deviation of curved root canals instrumented with K3 and ProTaper systems. MATERIAL AND METHODS: twenty root canals of human maxillary and mandibular first molars were employed, which were divided into 2 groups: group A (10 teeth was instrumented with the K3 system, and group B (10 teeth with the ProTaper system. Evaluation of deviation was performed by double radiographic exposure. Radiographs were achieved before and after instrumentation, with 0.3-second, thus allowing superimposition of images. Three-dimensional computerized tomograph was performed in 3 specimens in each group, as an additional means to evaluate the apical deviation. RESULTS: were evaluated by the parametric test Student-Newman-Keuls at 5%, which did not reveal significance between groups concerning the apical deviation. The results of computerized tomograph images demonstrated that the larger deviation of the root canal occurred at the distolingual area for both systems. CONCLUSIONS: both techniques produced a mild apical deviation. Computerized microtomography was shown to be accurate for experimental endodontics studies.OBJETIVOS: avaliar o desvio apical de canais radiculares curvos instrumentados pelos sistemas K3 e ProTaper. MATERIAIS E MÉTODOS: foram utilizados 20 canais radiculares de primeiros molares superiores e inferiores humanos, os quais foram divididos em 2 grupos, o grupo A (10 dentes foi instrumentado pelo sistema K3 e o grupo B (10 dentes com o sistema ProTaper, a forma de avaliação do desvio foi a dupla exposição radiográfica. As tomadas radiográficas foram feitas antes e após a instrumentação, com um tempo de 0,3 segundos em cada exposição, ocorrendo assim, sobreposição das imagens. Em 3 espécimes, de cada grupo, foi realizada a tomografia computadorizada tridimensional, como forma adicional de avaliar o desvio apical . Os resultados obtidos foram avaliados pelo teste paramétrico Student

  3. O uso de politetrafluoroetileno expandido em tireoplastia tipo I

    Directory of Open Access Journals (Sweden)

    Mello-Filho Francisco Veríssimo de

    2003-01-01

    Full Text Available A paralisia unilateral de prega vocal (PUPV em abdução é uma alteração que produz grande desconforto ao paciente, principalmente pelos distúrbios fonatórios causados. Atualmente dispomos de uma variedade de métodos para seu tratamento. OBJETIVO: Verificar a eficiência, vantagens e desvantagens do uso da fita de politetrafluoretileno expandido (PTFE-e, na medialização de prega vocal (PV paralisada, em abdução. FORMA DE ESTUDO: Coorte Longitudinal. MATERIAL E MÉTODOS: Foram estudados quatro pacientes com diagnóstico clínico-laringoscópico de disfonia por PPVU, em abdução há pelo menos um ano. Os pacientes foram submetidos a avaliação fonoaudiológica e a tireoplastia tipo I para medialização da PV com fita de PTFE-e. Durante o seguimento pós-operatório procedeu-se videolaringoscopia, tomografia computadorizada e fonoterapia. RESULTADOS: Todos os pacientes estão satisfeitos com a qualidade vocal, apresentam medialização estável da PV com a fonocirurgia e bons resultados à avaliação fonoaudiológica. Um paciente apresentou extrusão intra-operatória da fita de PTFE-e, sendo feito um segundo procedimento, sem complicações, seis meses depois. CONCLUSÃO: Na opinião dos autores a fita de PTFE-e se presta com eficiência ao tratamento da PUPV, sem apresentar riscos importantes.

  4. Sistema automatizado para aquisição de dados de umidade relativa do ar Automated system for relative humidity data acquisition

    OpenAIRE

    Késia O. da Silva; Sergio O. Moraes; Jarbas H. de Miranda; Anderson M. Palmieri

    2007-01-01

    Devido à importância do ambiente na produção animal e vegetal e, portanto, controle ambiental adequado, o trabalho propõe como objetivo a construção de um sistema de aquisição automatizada de dados de umidade relativa do ar, utilizando-se de microcontrolador de dimensões reduzidas e de baixo custo. A calibração do sensor de umidade relativa foi realizada em três etapas de simulação desenvolvidas em laboratório: caixas perfuradas, dessecador sem tampa contendo sílica-gel em seu fundo e psicrom...

  5. Ar + NO microwave plasmas for Escherichia coli sterilization

    Energy Technology Data Exchange (ETDEWEB)

    Hueso, Jose L; Rico, Victor J; Cotrino, Jose; Gonzalez-Elipe, Agustin R [Instituto de Ciencia de Materiales de Sevilla, Centro Mixto CSIC-Universidad de Sevilla, Centro de Investigaciones Cientificas Isla de la Cartuja, Avda. Americo Vespucio 49, 41092 Sevilla (Spain); Frias, Jose E [Instituto de BioquImica Vegetal y FotosIntesis (IBVF-CSIC). Centro de Investigaciones CientIficas Isla de la Cartuja. Avda Americo Vespucio, 49, 41092 Sevilla (Spain)], E-mail: jhueso@icmse.csic.es

    2008-05-07

    Ar + NO microwave discharges are used for sterilization and the results are compared with additional experiments with Ar, O{sub 2} and N{sub 2}-O{sub 2} plasma mixtures. The NO{sup *} species produced in the Ar-NO mixtures remain up to long distances from the source, thus improving the sterilization efficiency of the process. E. coli individuals exposed to the Ar + NO plasma undergo morphological damage and cell lysis. Combined effects of etching (by O{sup *} and Ar{sup *} species) and UV radiation (from deactivation of NO{sup *} species) are responsible for the higher activity found for this plasma mixture. (fast track communication)

  6. Argon defect complexes in low energy Ar irradiated molybdenum

    Energy Technology Data Exchange (ETDEWEB)

    van Veen, A.; Buters, W.T.M.; van der Kolk, G.J.; Caspers, L.M. (Interuniversitair Reactor Instituut, Delft (Netherlands)); Armstrong, T.R. (Victoria Univ., Wellington (New Zealand). Dept. of Physics)

    1982-03-15

    Thermal desorption spectrometry has been used to study the defects created in Mo irradiated along the <110> direction with Ar ions ranging in energy from 0.1 to 2 keV. In addition to monitoring the release of the implanted Ar, additional information has been obtained by decoration of the defects with low energy helium and subsequent monitoring of the helium release. The studies show evidence that the Ar can be trapped in both substitutional sites and in a configuration in which the Ar is associated with vacancies (ArVsub(n), n >= 2). Most of the Ar implanted at high energy is released at approx. equal to 1500 K by thermal vacancy assisted diffusion. Argon trapped closer to the surface is released at lower temperatures via at least three different surface related release mechanisms. Additional results are presented on the interaction of self interstitial atoms (introduced by 100 eV Xe bombardment) with the Ar defects. Substitutional Ar is found to convert to interstitial Ar which seems to be mobile at room temperature. The Ar-vacancy complexes are found to be reduced to substitutional Ar. The results of atomistic calculations of the release mechanisms will also be presented.

  7. MEIS1 functions as a potential AR negative regulator

    Energy Technology Data Exchange (ETDEWEB)

    Cui, Liang [Department of Urology, Chinese PLA Medical School/Chinese PLA General Hospital, Beijing 100853 (China); Department of Urology, Civil Aviation General Hospital/Civil Aviation Medical College of Peking University, Beijing 100123 (China); Li, Mingyang [Department of Gastroenterology, Nan Lou Division, Chinese PLA Medical School/Chinese PLA General Hospital, Beijing 100853 (China); Feng, Fan [Department of Pharmacy, General Hospital of Shenyang Military Command, Shenyang 110016 (China); Yang, Yutao [Beijing Institute for Neuroscience, Capital Medical University, Beijing 100069 (China); Hang, Xingyi [National Scientific Data Sharing Platform for Population and Health, Beijing 100730 (China); Cui, Jiajun, E-mail: cuijn@ucmail.uc.edu [Department of Cancer and Cell Biology, University of Cincinnati College of Medicine, Cincinnati, OH 45267 (United States); Gao, Jiangping, E-mail: jpgao@163.com [Department of Urology, Chinese PLA Medical School/Chinese PLA General Hospital, Beijing 100853 (China)

    2014-10-15

    The androgen receptor (AR) plays critical roles in human prostate carcinoma progression and transformation. However, the activation of AR is regulated by co-regulators. MEIS1 protein, the homeodomain transcription factor, exhibited a decreased level in poor-prognosis prostate tumors. In this study, we investigated a potential interaction between MEIS1 and AR. We found that overexpression of MEIS1 inhibited the AR transcriptional activity and reduced the expression of AR target gene. A potential protein–protein interaction between AR and MEIS1 was identified by the immunoprecipitation and GST pull-down assays. Furthermore, MEIS1 modulated AR cytoplasm/nucleus translocation and the recruitment to androgen response element in prostate specific antigen (PSA) gene promoter sequences. In addition, MEIS1 promoted the recruitment of NCoR and SMRT in the presence of R1881. Finally, MEIS1 inhibited the proliferation and anchor-independent growth of LNCaP cells. Taken together, our data suggests that MEIS1 functions as a novel AR co-repressor. - Highlights: • A potential interaction was identified between MEIS1 and AR signaling. • Overexpression of MEIS1 reduced the expression of AR target gene. • MEIS1 modulated AR cytoplasm/nucleus translocation. • MEIS1 inhibited the proliferation and anchor-independent growth of LNCaP cells.

  8. Efeito da temperatura e velocidade do ar sobre a taxa de secagem da madeira de Pinus elliottii Engelm.

    Directory of Open Access Journals (Sweden)

    Elio José Santini

    2010-08-01

    Full Text Available Para avaliar o efeito da temperatura e velocidade do ar sobre a taxa de secagem, peças de madeira de Pinus elliottii de 25 x 125 x 750 mm foram submetidas à secagem em estufa semi-industrial de convecção forçada. O processo foi conduzido para duas temperaturas e duas velocidades de ar e controlado por meio de um sistema computadorizado. Os resultados mostraram que a taxa de secagem tem uma relação diretamente proporcional com a temperatura, velocidade do ar e umidade da madeira. Por meio da análise de regressão múltipla detectou-se efeito estatisticamente significativo da temperatura e da velocidade do ar sobre a taxa e o tempo de secagem, com um nível de confiança de 99%. Como a importância da velocidade do ar na secagem decresce com a diminuição do teor de umidade, sugere-se, por razões de economia, mais investigações acerca das relações entre as duas variáveis durante o período de taxa de secagem decrescente.

  9. Argon in hornblende, biotite and muscovite in geologic cooling - Ar-40/Ar-39-investigations

    International Nuclear Information System (INIS)

    The results of the Ar-40/Ar-39 studies are discussed under the aspect of whether the age data of the minerals indicate a cooling process. The author hopes that isotope dating of minerals with different closing temperatures will describe the temperature/time history of an area in the temperature range of 600 to 2000C. The findings are analyzed under three aspects: How much do they contribute to the initial methodological question, what do they contribute to the regional geology of the areas investigated, and in what respects do they extent the present knowledge of the geochronological analysis, i.e. its techniques and interpretation. (orig.)

  10. Ar-Ar Dating of Martian Chassignites, NWA2737 and Chassigny, and Nakhlite MIL03346

    Science.gov (United States)

    Bogard, D. D.; Garrison, D. H.

    2006-01-01

    Until recently only three nakhlites and one chassignite had been identified among martian meteorites. These four exhibit very similar radiometric ages and cosmic ray exposure (CRE) ages, indicating that they may have derived from a common location on Mars and were ejected into space by a single impact. This situation is quite different from that of martian shergottites, which exhibit a range of radiometric ages and CRE ages (1). Recently, several new nakhlites and a new martian dunite (NWA2737) have been recognized. Here we report our results of Ar-39-Ar-40 dating for the MIL03346 nakhlite and the NWA2737 "chassignite", along with new results on Chassigny.

  11. CT interpretation of craniofacial anomalies: a comparative analysis by undergraduate dental students Interpretação de anomalias craniofaciais em TC: análise comparativa por alunos de graduação em Odontologia

    Directory of Open Access Journals (Sweden)

    Bruno Felipe Gaia

    2005-03-01

    Full Text Available The aim of this study was to evaluate the accuracy and reproducibility of computed tomography (CT image interpretation made in axial slices (2D-CT and 3D reconstructed images (3D-CT of patients with craniofacial anomalies. The analyses were made by undergraduate dental students, and compared with the diagnoses considered upon surgical intervention. Computed tomography of 43 patients were analyzed independently by three calibrated examiners (undergraduate students with, respectively, one, two, and three semesters of experience in craniofacial CT training and interpretation. The analysis of 2D-CT and 3D-CT images were performed at distinct times using an independent workstation associated with a specific computer graphics software for volumetric images. The analysis of inter-examiner agreement and of the agreement between observers and the gold standard was performed using the Kappa test. The accuracy evaluation presented a progressively higher value for examiners with progressively broader experience in 2D-CT and 3D-CT image interpretation. 3D-CT analyses allowed a higher inter-examiner agreement (1 - 0.896 than 2D-CT analyses (1 - 0.614. 3D-CT was considered more precise and accurate than 2D-CT for all students' evaluations. The reproducibility and accuracy varied according to the experience in CT interpretation, and the most experienced student achieved results closer to the gold standard.O propósito desta pesquisa foi avaliar a habilidade de alunos de graduação na análise de pacientes portadores de anomalias craniofaciais usando imagens de tomografia computadorizada (TC em cortes axiais (2D-TC e em terceira dimensão (3D-TC. A análise foi realizada por alunos de graduação em Odontologia, em comparação com o diagnóstico efetuado no ato operatório. Tomografias computadorizadas de 43 pacientes foram analisadas, independentemente, por três alunos de graduação previamente calibrados, com respectivamente um, dois e três semestres de

  12. SUMER-IRIS Observations of AR11875

    Science.gov (United States)

    Schmit, Donald; Innes, Davina

    2014-05-01

    We present results of the first joint observing campaign of IRIS and SOHO/SUMER. While the IRIS datasets provide information on the chromosphere and transition region, SUMER provides complementary diagnostics on the corona. On 2013-10-24, we observed an active region, AR11875, and the surrounding plage for approximately 4 hours using rapid-cadence observing programs. These datasets include spectra from a small C -class flare which occurs in conjunction with an Ellerman-bomb type event. Our analysis focusses on how the high spatial resolution and slit jaw imaging capabilities of IRIS shed light on the unresolved structure of transient events in the SUMER catalog.

  13. Larva migrans visceral: forma mista de apresentação em adulto - aspectos clínicos e laboratoriais

    Directory of Open Access Journals (Sweden)

    LA. Costa Barra

    1996-08-01

    Full Text Available Relatamos o caso de um paciente do sexo mascidino, dezoito anos de idade, procedente de Xapuri no Estado do Acre (Brasil, com história de episódios repetidos de meningoencefalites (três num ano, acompanhadas no local de origem. Em nosso serviço, no Instituto de Infectologia Emílio Ribas, obsewamos um quadro de poliartralgias, alterações radiológicas e broncoscópicas pulmonares e sinais neurológicos de irritação tneníngea e de comprometimento do tronco-encefãlico (com tomografia axial de crânio e exames liquóricos normais, acompanhando-se de eosinofilia periférica e títulos sorológicos elevados para Toxocara canis (EIISA. Consubstanciada a hipótese diagnostica de toxocaríase (larva migrans visceral - IMV, procedeu-se ao tratamento com tiabendazol, ocorrendo remissão clínica e laboratorial completa. Um mês após, ocorreu novo episódio de cefaléia acompanhada por rigidez de nuca (que remitiu em três dias com dexametasona e, a partir daí, não mais obsewamos quaisquer alterações clínicas ou laboratoriais em cerca de três anos e meio de acompanhamento ambulatorial.

  14. Insuficiência respiratória aguda causada por pneumonia em organização secundária à terapia antineoplásica para linfoma não Hodgkin

    OpenAIRE

    Adriell Ramalho Santana; Fábio Ferreira Amorim; Paulo Henrique Alves Soares; Edmilson Bastos de Moura; Marcelo Oliveira Maia

    2012-01-01

    Doenças difusas do parênquima pulmonar pertencem a um grupo de doenças de evolução geralmente subaguda ou crônica, mas que podem determinar insuficiência respiratória aguda. Paciente masculino, 37 anos, em terapia para linfoma não Hodgkin, admitido com tosse seca, febre, dispneia e insuficiência respiratória aguda hipoxêmica. Iniciadas ventilação mecânica e antibioticoterapia, porém houve evolução desfavorável. Tomografia computadorizada de tórax mostrava opacidades pulmonares em "vidro fosco...

  15. Dicty_cDB: FC-AR10 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR10 (Link to dictyBase) - - - Contig-U15065-1 FC-AR10P (Li...nk to Original site) FC-AR10F 417 FC-AR10Z 438 FC-AR10P 855 - - Show FC-AR10 Library FC (Link to library) Clone ID FC-AR...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR10Q.Seq.d/ Representative seq. ID FC-AR...10P (Link to Original site) Representative DNA sequence >FC-AR10 (FC-AR10Q) /CSM/FC/FC-AR/FC-AR...DILSYI*k*kk*k*kpi*i*i*ik Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR10 (FC-AR

  16. Dicty_cDB: FC-AR05 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR05 (Link to dictyBase) - G24049 DDB0188590 Contig-U15127-1 FC-AR...05Z (Link to Original site) - - FC-AR05Z 510 - - - - Show FC-AR05 Library FC (Link to library) Clone ID FC-AR...7-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR05Q.Se...q.d/ Representative seq. ID FC-AR05Z (Link to Original site) Representative DNA sequence >FC-AR05 (FC-AR05Q) /CSM/FC/FC-AR/FC-AR...C-AS24Q) /CSM/FC/FC-AS/FC-AS24Q.Seq.d/ 381 e-105 FC-AR05 (FC-AR05Q) /CSM/FC/FC-AR/FC-AR05Q.Seq.d/ 381 e-105

  17. Dicty_cDB: FC-AR16 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR16 (Link to dictyBase) - - - Contig-U15457-1 FC-AR16E (Li...nk to Original site) - - - - - - FC-AR16E 387 Show FC-AR16 Library FC (Link to library) Clone ID FC-AR16 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR16Q.Seq.d/ Representative seq. ID FC-AR...16E (Link to Original site) Representative DNA sequence >FC-AR16 (FC-AR16Q) /CSM/FC/FC-AR/FC-AR16Q.Seq....26 0.0 VFG822 (VFG822Q) /CSM/VF/VFG8-A/VFG822Q.Seq.d/ 726 0.0 FC-AR16 (FC-AR16Q) /CSM/FC/FC-AR/FC-AR16Q.Seq.

  18. Dicty_cDB: FC-AR17 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR17 (Link to dictyBase) - - - Contig-U15982-1 FC-AR17P (Li...nk to Original site) FC-AR17F 264 FC-AR17Z 543 FC-AR17P 807 - - Show FC-AR17 Library FC (Link to library) Clone ID FC-AR...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR17Q.Seq.d/ Representative seq. ID FC-AR...17P (Link to Original site) Representative DNA sequence >FC-AR17 (FC-AR17Q) /CSM/FC/FC-AR/FC-AR...gy vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR17 (FC-AR

  19. Dicty_cDB: FC-AR01 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR01 (Link to dictyBase) - - - Contig-U15659-1 FC-AR01Z (Li...nk to Original site) - - FC-AR01Z 467 - - - - Show FC-AR01 Library FC (Link to library) Clone ID FC-AR01 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR01Q.Seq.d/ Representative seq. ID FC-AR...01Z (Link to Original site) Representative DNA sequence >FC-AR01 (FC-AR01Q) /CSM/FC/FC-AR/FC-AR01Q.Seq....es producing significant alignments: (bits) Value FC-AR01 (FC-AR01Q) /CSM/FC/FC-AR/FC-AR01Q.Seq.d/ 910 0.0 S

  20. Dicty_cDB: FC-AR23 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR23 (Link to dictyBase) - - - Contig-U15115-1 FC-AR23Z (Li...nk to Original site) - - FC-AR23Z 557 - - - - Show FC-AR23 Library FC (Link to library) Clone ID FC-AR23 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR23Q.Seq.d/ Representative seq. ID FC-AR...23Z (Link to Original site) Representative DNA sequence >FC-AR23 (FC-AR23Q) /CSM/FC/FC-AR/FC-AR23Q.Seq....vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR23 (FC-AR23Q) /CSM/FC/FC-AR/FC-AR

  1. The role of mitochondrial fusion and StAR phosphorylation in the regulation of StAR activity and steroidogenesis.

    Science.gov (United States)

    Castillo, Ana F; Orlando, Ulises; Helfenberger, Katia E; Poderoso, Cecilia; Podesta, Ernesto J

    2015-06-15

    The steroidogenic acute regulatory (StAR) protein regulates the rate-limiting step in steroidogenesis, i.e. the delivery of cholesterol from the outer (OMM) to the inner (IMM) mitochondrial membrane. StAR is a 37-kDa protein with an N-terminal mitochondrial targeting sequence that is cleaved off during mitochondrial import to yield 30-kDa intramitochondrial StAR. StAR acts exclusively on the OMM and its activity is proportional to how long it remains on the OMM. However, the precise fashion and the molecular mechanism in which StAR remains on the OMM have not been elucidated yet. In this work we will discuss the role of mitochondrial fusion and StAR phosphorylation by the extracellular signal-regulated kinases 1/2 (ERK1/2) as part of the mechanism that regulates StAR retention on the OMM and activity.

  2. Pneumonia lipídica - aspectos na tomografia computadorizada: relato de caso Lipoid pneumonia: computed tomography findings - a case report

    OpenAIRE

    Janos Farias; Erick Malheiro Leoncio Martins; Aline Serfaty Pozes; Suzane Mansur Fialho; Edson Marchiori

    2004-01-01

    Os autores relatam um caso de pneumonia lipídica em um paciente de 80 anos de idade, que iniciou o quadro com dispnéia em repouso. Havia história de constipação crônica, com uso freqüente de laxativos oleosos. O paciente apresentava diminuição do nível de consciência e os familiares relatavam tosse e engasgos freqüentes, durante o uso do medicamento. As radiografias de tórax demonstravam consolidação localizada no segmento posterior do lobo superior do pulmão direito, além de opacidades mal d...

  3. Length determination of zygomatic implants using tridimensional computed tomography Determinação do comprimento de fixações zigomáticas a partir de tomografia computadorizada tridimensional

    Directory of Open Access Journals (Sweden)

    Luciana Ribeiro Koser

    2006-12-01

    Full Text Available Considering the potential of tridimensional computed tomography (3D-CT as a predictor of real bone dimensions, nine dried human skulls with maxillary edentulism were evaluated using images obtained by 3D-CT, prior to the installation of zygomatic implants, in order to obtain the measurements of the implants. In the analysis of correlation between the two 3D-CT examiners, a 75% agreement was found, and no correlation was found between them and the surgical measurement. The worst result was the surgical one, possibly because an inaccurate probe was used. Based on the obtained data, we concluded that the probe used is inaccurate, suggesting that the surgical probe be changed in its measurement scale. Agreement between surgeon and radiologist could possibly be obtained by using insertion guides, since what might have possibly caused the discrepancy in the results is the fact that the 3D-CT examiners and the surgeon used different implant insertion points. It is also possible that a larger sample might produce a more accurate evaluation, thus improving the results.Considerando-se o potencial da tomografia computadorizada tridimensional (TC-3D como preditor de dimensões ósseas reais e avaliando-se nove crânios humanos secos com edentulismo maxilar, foi feito um estudo utilizando-se o recurso das imagens obtidas por TC-3D, previamente à execução da técnica de fixação zigomática, para mensurar o comprimento de tais fixações. Na avaliação da concordância interexaminador da TC-3D, houve uma boa correlação entre o primeiro e segundo (75%, e ausência de correlação entre estes e a medida cirúrgica. Contextualizando, o pior resultado foi o cirúrgico, possivelmente pelo fato de utilizar uma sonda imprecisa. Diante dos dados obtidos, concluiu-se que a sonda utilizada é imprecisa, sugerindo uma mudança na mesma quanto ao seu escalonamento e que medidas para aproximar as linguagens do cirurgião e do radiologista talvez fossem conseguidas

  4. AVALIAÇÃO DA QUALIDADE DO AR INTERIOR DO HOSPITAL UNIVERSITÁRIO PEDRO ERNESTO

    Directory of Open Access Journals (Sweden)

    Eduardo Delfino Sodré

    2014-12-01

    Full Text Available DOI: 10.12957/sustinere.2014.14126A “Síndrome do Edifício Doente” é um termo utilizado para definir a má qualidade do ar de ambientes interiores e tem sido de preocupação crescente da comunidade científica. A avaliação da qualidade do ar, nos locais amostrados no HUPE, fundamentada na resolução n° 9 de 2003 da Agência Nacional de Vigilância Sanitária, teve como objetivos conhecer e informar para que a Comissão de Controle de Infecção Hospitalar avalie a interação deste fator com as infecções nosocomiais e decida pela necessidade, ou não, de medidas corretivas e contribuir para o conhecimento e desenvolvimento de técnicas e controle da poluição “Indoor”. As amostras foram coletadas com um amostrador de ar tipo impactador linear, de um estágio (MERCK e a interpretação dos resultados utilizou dois critérios contidos na norma vigente: o valor máximo aceitável (VMA de fungos em ambientes internos (750UFC/m3 e o limite aceitável entre a contaminação interna e externa (I/E ≤ 1,5. Entre os sessenta ambientes avaliados nos três primeiros pavimentos do HUPE 20% do total encontravam-se em desacordo com relação ao número de UFC/m3 e 16,6% em relação à relação I/E. Conclui-se que 28% dos setores avaliados do 1° pavimento do HUPE e 26% dos contidos no 2° pavimento não estão tendo a renovação de ar desejada, propiciando o acúmulo de fungos.

  5. Behavior of argon gas release from manganese oxide minerals as revealed by 40Ar/39Ar laser incremental heating analysis

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    Manganese oxides in association with paleo- weathering may provide significant insights into the multiple factors affecting the formation and evolution of weathering profiles, such as temperature, precipitation, and biodiversity. Laser probe step-heating analysis of supergene hollandite and cryptomelane samples collected from central Queensland, Australia, yield well-defined plateaus andconsistent isochron ages, confirming the feasibility dating very-fined supergene manganese oxides by 40Ar/39Ar technique. Two distinct structural sites hostingAr isotopes can be identified in light of their degassing behaviors obtained byincremental heating analyses. The first site, releasing its gas fraction at thelaser power 0.2-0.4 W, yields primarily 40Aratm, 38Aratm, and 36Aratm (atmospheric Ar isotopes). The second sites yield predominantly 40Ar* (radiogenic 40Ar),39ArK, and 38ArK (nucleogenic components), at ~0.5-1.0 W. There is no significant Ar gas released at the laser power higher than 1.0 W, indicating the breakdown of the tunnel sites hosting the radiogenic and nucleogenic components. The excellent match between the degassing behaviors of 40Ar*, 39ArK, and 38ArK suggests that these isotopes occupy the same crystallographic sites and that 39ArK lossfrom the tunnel site by recoil during neutron irradiation and/or bake-out procedure preceding isotopic analysis does not occur. Present investigation supports that neither the overwhelming atmospheric 40Ar nor the very-fined nature of the supergene manganese oxides poses problems in extracting meaningful weathering geochronological information by analyzing supergene manganese oxides minerals.

  6. New high-precision 40Ar/39Ar ages on Oligocene volcanic rocks of northwestern Kenya

    Science.gov (United States)

    Brown, Francis H.; Jicha, Brian R.

    2016-02-01

    New, high-precision 40Ar/39Ar ages from volcanic rocks in northwestern Kenya are provided for some areas of exposure in this remote area. We report seven 40Ar/39Ar ages generated from single crystal total fusion experiments on alkali feldspar separated from volcanic rocks in the Mogila, Songot, and Lokwanamur Ranges and the Gatome valley. A rhyolite from the lower part of the sequence in the Mogila Range yielded ages of 32.31 ± 0.06 Ma and 32.33 ± 0.07 Ma, and a rhyolite near the top of that sequence yielded 31.67 ± 0.04 Ma. A single sample from the Songot Range yielded an age of 32.49 ± 0.07 Ma, slightly older than the rocks collected from Mogila. In both ranges the early Oligocene rhyolites are underlain by basalts, as is also the case in the Labur Range. Ages of 25.95 ± 0.03 Ma, 25.91 ± 0.04 Ma, and 27.15 ± 0.03 Ma were measured on alkali feldspar from rhyolites from the Lokwanamur Range, and the nearby Gatome valley. All of these rocks are part of an episode of widespread volcanism in northwestern Kenya in the mid-to late Oligocene that is not currently known from the Ethiopian Rift Valley.

  7. Entre desafios e possibilidades: estratégias para ensinar a cuidar em enfermagem do adolescente com câncer Entre desafíos y posibilidades: estrategias para enseñar a cuidar en enfermería del adolescente con cáncer Between challenges and possibilities: strategies for teaching care nursing for adolescents with cancer

    Directory of Open Access Journals (Sweden)

    Sônia Regina de Souza

    2007-09-01

    Full Text Available Trata-se de um relato de experiência, que tem como objetivo apresentar reflexões acerca das experiências vivenciadas junto aos alunos do Curso de Graduação em Enfermagem da Escola de Enfermagem Alfredo Pinto da Universidade Federal do Estado do Rio de Janeiro (UNIRIO. No cotidiano da prática de ensino, os alunos se deparam com adolescentes acometidos pelos distúrbios onco-hematológicos. Constatou-se que, para os estudantes, era um desafio aprender a cuidar do adolescente em um momento de adoecimento pelo câncer, doença que traz importantes significados no imaginário social. Como estratégia para a aprendizagem, optou-se por uma atividade denominada oficina de idéias, a qual possibilitava aos alunos que expressassem seus sentimentos, idéias (pré concebidas e expectativas acerca do cuidar do adolescente com câncer. Como resultados, evidenciou-se um singular momento de reflexão/sensibilização que resulta em um preparo e um reconhecimento das peculiaridades desse grupo e atitude de aproximação para o cuidar no espaço hospitalar.Se trata de un relato de experiencia, que tiene como objetivo presentar reflexiones sobre las experiencias vividas junto a los alumnos del Curso de Graduación en Enfermería de la Universidad Federal do Estado de Rio de Janeiro (UNIRIO. En el cotidiano de la práctica de enseñanza, los alumnos se deparan con adolescentes acometidos por los disturbios oncológicos-hematológicos. Se constató que para los alumnos el desafío era aprender a cuidar al adolescente en el momento del cáncer. Como estrategia para el aprendizaje, se optó por una actividad denominada Oficina de Ideas. Esta posibilitó que los alumnos expresasen sus sentimientos y expectativas de como cuidar al adolescente con cáncer. Como resultado se evidenció un singular momento de reflexión que resulta en un reconocimiento de las peculiaridades de este grupo y actitudes de aproximación para el cuidar en el espacio hospitalario.This is

  8. Escore de cálcio na avaliação da aterosclerose em pacientes com HIV/AIDS

    Directory of Open Access Journals (Sweden)

    Verônica Soares Monteiro

    2011-11-01

    Full Text Available FUNDAMENTO: A terapia antirretroviral aumentou drasticamente a expectativa de vida em pacientes com HIV/AIDS, embora a aterosclerose esteja associada a uma terapia de longo prazo. OBJETIVO: Investigar a prevalência de aterosclerose em pacientes com AIDS submetidos à terapia antirretroviral e a influência de tratamentos de diferentes regimes e durações. MÉTODOS: Pacientes com HIV/AIDS foram abordados durante consultas de rotina. Aqueles que estiveram em terapia antirretroviral por, pelo menos, dois anos tiveram o sangue coletado para análise do perfil lipídico e da glicemia em jejum e foram submetidos à tomografia computadorizada cardíaca para quantificação do escore de cálcio dentro de seis dias, no máximo. A aterosclerose foi definida como escore de cálcio maior que zero (CAC > 0. Fatores de risco tradicionais, síndrome metabólica e o escore de Framingham foram analisados. RESULTADOS: Cinquenta e três pacientes realizaram tomografia computadorizada cardíaca: 50,94% eram do sexo masculino, com idade média de 43,4 anos; 20% tinham hipertensão; 3,77% tinham diabetes; 67,92% tinham hipercolesterolemia; 37,74% tinham hipertrigliceridemia; 47,17% tinham HDL baixo; 24,53% atenderam aos critérios para síndrome metabólica; 96,23% foram classificados no escore de Framingham como "baixo risco"; e 18,87% eram tabagistas. A duração média do tratamento antirretroviral foi de 58,98 meses. A aterosclerose coronária ocorreu em 11 pacientes (20,75%. A duração da terapia antirretroviral não se relacionou à aterosclerose (p = 0,41, e não houve diferenças significativas entre os diferentes esquemas antirretrovirais (p = 0,71. Entre os fatores de risco tradicionais, o tabagismo (OR = 27,20; p = 0,023 e a idade (OR = 20,59; p = 0,033 foram significativos na presença de aterosclerose. Havia tendência para uma associação positiva da aterosclerose com a hipercolesterolemia (OR = 8,30; p = 0,0668. CONCLUSÃO: Os fatores associados

  9. Androgen Receptor-Mediated Growth Suppression of HPr-1AR and PC3-Lenti-AR Prostate Epithelial Cells.

    Directory of Open Access Journals (Sweden)

    Young-Chae Kim

    Full Text Available The androgen receptor (AR mediates the developmental, physiologic, and pathologic effects of androgens including 5α-dihydrotestosterone (DHT. However, the mechanisms whereby AR regulates growth suppression and differentiation of luminal epithelial cells in the prostate gland and proliferation of malignant versions of these cells are not well understood, though they are central to prostate development, homeostasis, and neoplasia. Here, we identify androgen-responsive genes that restrain cell cycle progression and proliferation of human prostate epithelial cell lines (HPr-1AR and PC3-Lenti-AR, and we investigate the mechanisms through which AR regulates their expression. DHT inhibited proliferation of HPr-1AR and PC3-Lenti-AR, and cell cycle analysis revealed a prolonged G1 interval. In the cell cycle, the G1/S-phase transition is initiated by the activity of cyclin D and cyclin-dependent kinase (CDK complexes, which relieve growth suppression. In HPr-1AR, cyclin D1/2 and CDK4/6 mRNAs were androgen-repressed, whereas CDK inhibitor, CDKN1A, mRNA was androgen-induced. The regulation of these transcripts was AR-dependent, and involved multiple mechanisms. Similar AR-mediated down-regulation of CDK4/6 mRNAs and up-regulation of CDKN1A mRNA occurred in PC3-Lenti-AR. Further, CDK4/6 overexpression suppressed DHT-inhibited cell cycle progression and proliferation of HPr-1AR and PC3-Lenti-AR, whereas CDKN1A overexpression induced cell cycle arrest. We therefore propose that AR-mediated growth suppression of HPr-1AR involves cyclin D1 mRNA decay, transcriptional repression of cyclin D2 and CDK4/6, and transcriptional activation of CDKN1A, which serve to decrease CDK4/6 activity. AR-mediated inhibition of PC3-Lenti-AR proliferation occurs through a similar mechanism, albeit without down-regulation of cyclin D. Our findings provide insight into AR-mediated regulation of prostate epithelial cell proliferation.

  10. Dentascan CT of mandibular incisive canal. Radiological anatomy and therapeutic implications; Tomografia computerizzata con Dentascan del canale incisivo mandibolare. Anatomia radiologica e implicazioni terapeutiche

    Energy Technology Data Exchange (ETDEWEB)

    Calgaro, A.; Bison, L.; Bellis, G.B.; Pozzi Mucelli, R. [Trieste Univ., Trieste (Italy). Ist. di radiologia

    1999-11-01

    The main purpose of this paper is to stress the importance of CT depiction of the mandibular incisive canal. This anatomical structure contains a major neurovascular bundle and is thus very important in the planning of mandibular implants in the canine-incisive area. The importance of careful assessment of the mandibular canal course before implantology is now widely recognized. The same holds true for the canine-incisive region in the jaw, to detect the incisive canal if present and prevent any complications from its accidental damage. CT with a dedicated software showed the incisive canal in a large number of patients, which calls for precise reporting of its presence, course, and relationships with teeth. [Italian] Scopo di questo lavoro e' sottolineare l'importanza di rilevare e segnalare la visibilita' con Tomografia Computerizzata del canale incisivo mandibolare, struttura anatomica al cui interno decorre un fascio vasculo nervoso e percio' di rilevante importanza in previsione di intervento implantologico nella regione mesiale della mandibola. In previsione di seduta implantologica appare fondamentale l'attenta valutazione non solo del decorso del canale mandibolare ma anche della regione canino-incisiva della mandibola per la possibile esistenza del canale incisivo al fine di evitare eventuali complicanze derivanti dal suo accidentale danneggiamento. Il riscontro di tale struttura con TC con programma dedicato e apparso tutt'altro che trascurabile e percio' risulta di primaria importanza segnalarne presenza, decorso ed eventuali rapporti con gli elementi dentari.

  11. Identification and analysis of ARS function of six plant MARs

    Institute of Scientific and Technical Information of China (English)

    LI Hong; YANG Yutao; ZHANG Kewei; ZHENG Chengchao

    2004-01-01

    Six plant MARs isolated from tobacco and Arabdiposis were investigated for their ARS activity in yeast.The results showed that among the six plant MARs, only TM1 and AM4 had strong ARS activity which was almost the same as that of ARS from yeast chromosome. In order to further identify the core region of the two MARs for the ARS activity, a series of subclones were created by PCR strategy,and the corresponding subclones were designated as TM1-1,TM1-2, TM1-3, AM4-1, AM4-2 and AM4-3, respectively. Our studies revealed that TM1-3 and AM4-3 not only had higher ARS activity, but also displayed higher transformation frequency, plasmid stability and growth rate compared to their intact MARs, TM1 and AM4. These data present an important clue for further elucidating the relationship between MAR and ARS.

  12. Arsenic phytoextraction and hyperaccumulation by fern species Fitoextração e hiperacumulação de arsênio por espécies de samambaias

    Directory of Open Access Journals (Sweden)

    Maria Isidoria Silva Gonzaga

    2006-02-01

    Full Text Available Arsenic (As is an ubiquitous trace metalloid found in all environmental media. Its presence at elevated concentrations in soils derives from both anthropogenic and natural inputs. Arsenic is a toxic and carcinogenic element, which has caused severe environmental and health problem worldwide. Technologies currently available for the remediation of arsenic-contaminated sites are expensive, environmentally disruptive, and potentially hazardous to workers. Phytoextraction, a strategy of phytoremediation, uses plants to clean up contaminated soils and has been successfully applied to arsenic contaminated soils. It has the advantage of being cost-effective and environmentally friendly. A major step towards the development of phytoextraction of arsenic-impacted soils is the discovery of the arsenic hyper accumulation in ferns, first in Pteris vittata, which presented an extraordinary capacity to accumulate 2.3% arsenic in its biomass. Another fern, Pityrogramma calomelanos was found to exhibit the same hyperaccumulating characteristics. After that, screening experiments have revealed that the Pteris genus is really unique in that many species have the potential to be used in phytoextraction of arsenic. In general, these plants seem to have both constitutive and adaptive mechanisms for accumulating or tolerating high arsenic concentration. In the past few years, much work has been done to understand and improve the hyperaccumulating capability of these amazing plants. In particular, the field of molecular biology seems to hold the key for the future of the phytoremediation.O arsênio e um metalóide traço encontrado basicamente em todos os ambientes. Elevadas concentrações de arsênio no solo podem acontecer naturalmente devido ao intemperismo de rochas ricas em arsênio, como também de atividades antropogênicas. O arsênio é um elemento tóxico e cancerígeno. Em muitas partes do mundo, a contaminação pelo arsênio tem causado problemas

  13. Caso 1/2013: homem de 69 anos com dor súbita em dorso e membro inferior direito e choque

    Directory of Open Access Journals (Sweden)

    Carlos Vinícius Abreu do Espirito Santo

    2013-02-01

    Full Text Available MSM, homem, 69 anos, procurou atendimento médico por dor em dorso esquerdo e membro inferior direito. A radiografia de tórax revelou alargamento do mediastino. Estava em observação quando apresentou rebaixamento da consciência e choque. Foi observado enfisema subcutâneo em hemitórax esquerdo e abolição do murmúrio vesicular em base do mesmo pulmão. Foi feita a intubação orotraqueal e realizada drenagem de hemitórax esquerdo, com saída de líquido serossanguinolento. O ecocardiograma revelou ventrículo esquerdo (D/S: 44/29 mm; septo 12 mm; parede posterior 13 mm; discreta dilatação em raiz da aorta, presença de lâmina de dissecção e hematoma periaórtico. As valvas e pericárdio eram normais. O paciente foi transferido para o InCor. O exame físico (21 out 2004: 10h45 revelou paciente sedado, com intubação orotraqueal, com palidez cutânea, frequência cardíaca 90 bpm, pressão arterial 130 x 80 mmHg, drenagem torácica sanguinolenta do dreno tórax. Eletrocardiograma - frequência 90 bpm, ritmo sinusal, baixa voltagem no plano frontal e diminuição de voltagem em derivações esquerdas (fig. 1. A tomografia revelou enfisema subcutâneo bilateral, aorta torácica com contornos imprecisos na sua porção descendente (da artéria subclávia até porção média, colapso do pulmão esquerdo e grande coleção de características hemáticas em mesmo hemitórax e no mediastino médio e posterior. Pequeno pneumotórax à direita; pequeno derrame pleural à direita com alterações do parênquima subjacente. A análise do coração foi prejudicada pela presença do hemotórax. Durante a realização de tomografia apresentou ausência de pulsos, midríase, com assistolia, sem resposta às manobras de ressuscitação e faleceu (21 out 2011; 15h.

  14. What to teach to patients with heart failure and why: the role of nurses in heart failure clinics ¿Qué enseñar a los pacientes con insuficiencia cardiaca y por qué?: el papel de los enfermeros en clínicas de insuficiencia cardíaca O que ensinar aos pacientes com insuficiência cardíaca e por quê: o papel dos enfermeiros em clínicas de insuficiência cardíaca

    Directory of Open Access Journals (Sweden)

    Eneida Rejane Rabelo

    2007-02-01

    ón para el manejo de la enfermedad y el desarrollo de la capacidad de autoayuda. En este artículo revisaremos en detalle aspectos de la educación para pacientes con insuficiencia cardiaca dada por enfermeros.O principal objetivo do tratamento da insuficiência cardíaca (IC consiste em alcançar e manter a estabilidade clínica dos pacientes. Vários estudos demonstram que programas multidisciplinares para educação sistemática sobre a doença são estratégias positivas para estes pacientes. Enfermeiros engajados em clínicas de IC desempenham papel fundamental no processo de educação e acompanhamento dos pacientes. Os objetivos deste processo são ensinar, reforçar, melhorar e avaliar constantemente as habilidades dos pacientes para o autocuidado, que incluem a monitorização do peso, a restrição de sódio e de líquidos, a realização de atividade física, o uso regular das medicações, a monitorização de sinais e de sintomas de piora da doença e o contato precoce com a equipe assistencial. Desta forma, a educação para o entendimento da IC, e o desenvolvimento de habilidades para o autocuidado, são considerados chaves para melhorar a adesão, evitar crises de descompensação e conseqüentemente manter a estabilidade clínica dos pacientes. Neste artigo nos revisamos detalhadamente os aspectos envolvidos no processo de educação dispensados aos pacientes por enfermeiros no contexto das clínicas de IC.

  15. Achados tomográficos em 1000 pacientes consecutivos com antecedentes de crises epilépticas

    Directory of Open Access Journals (Sweden)

    Trentin Ana Paula

    2002-01-01

    Full Text Available Analizamos retrospectivamente as tomografias computadorizadas (TC de crânio de 1000 pacientes consecutivos, com história clínica de crises epilépticas classificadas do ponto de vista clínico em generalizadas (CG e parciais (CP. Nossos resultados mostraram a presença de CG em 70,7% dos pacientes, sendo 57,1% do sexo masculino e 42,9% do sexo feminino e, CP em 29,3%, sendo 60,0% do sexo maculino e 40,0% do sexo femninino. As faixas etárias de maior incidência foram entre 0 a 10 (31,0% e 11 a 20 (21,8% anos nos pacientes com CG e 0 a 10 (24,5%, 21 a 30 (16,7% e 31 a 40 anos (18,4% nos pacientes com CP. Os resultados tomográficos no grupo com CG foram: normais (48,8% e alterados em 51,2%, sendo esses achados definidos como calcificações/cisticercose (14,0%, neurocisticercose/cistos (9,6% hidrocefalia (4,4%, infarto (4,2%, indefinido (4,0%, tumor (2,5% entre outros (12,5,%. Nos pacientes com CP os exames tomográficos foram normais em 37,4%, alterados em 62,7%, tendo os diagnósticos de neurocisticercose/cistos (12,2%, calcificações/cisticercose (11,2%, tumor (10,5%, indefinido (8,1%, infarto (5,4%, hidrocefalia (3,7% e outros (11,6%. Salientamos a importância da TC em pacientes com epilepsia, particularmente para o diagnóstico de neurocisticercose.

  16. Métodos de análise da composição corporal em adultos obesos

    Directory of Open Access Journals (Sweden)

    Rávila Graziany Machado de Souza

    2014-10-01

    Full Text Available Os métodos de avaliação da composição corporal em obesos têm sido amplamente discutidos, uma vez que nesses indivíduos a avaliação é dificultada devido às limitações dos equipamentos e características dos métodos utilizados. Esta sessão temática tem o objetivo de esclarecer as características, vantagens e limitações dos métodos de avaliação da composição corporal em adultos obesos. A quantificação de gordura corporal e mas-sa livre de gordura, assim como a avaliação da perda de massa muscular e de massa óssea em obesos são temas de grande interesse científico, uma vez que são utilizados para diagnosticar a obesidade osteosarcopênica. A avaliação da composição corporal de obesos pelo modelo de múltiplos compartimentos é padrão-ouro na prática científica. Por outro lado, o método de absorciometria radiológica de feixe duplo é considerado o padrão de referência em pesquisas e na prática clínica. Estudos indicam que a ressonância magnética e a tomografia computadorizada, em alguns casos, são fortemente correlacionadas com a absorciometria radiológica de feixe duplo. Os demais métodos apresentam limitações em avaliar a composição corporal, bem como suas modificações durante a redução ponderal em indivíduos obesos.

  17. Plasma AR and abiraterone-resistant prostate cancer.

    Science.gov (United States)

    Romanel, Alessandro; Gasi Tandefelt, Delila; Conteduca, Vincenza; Jayaram, Anuradha; Casiraghi, Nicola; Wetterskog, Daniel; Salvi, Samanta; Amadori, Dino; Zafeiriou, Zafeiris; Rescigno, Pasquale; Bianchini, Diletta; Gurioli, Giorgia; Casadio, Valentina; Carreira, Suzanne; Goodall, Jane; Wingate, Anna; Ferraldeschi, Roberta; Tunariu, Nina; Flohr, Penny; De Giorgi, Ugo; de Bono, Johann S; Demichelis, Francesca; Attard, Gerhardt

    2015-11-01

    Androgen receptor (AR) gene aberrations are rare in prostate cancer before primary hormone treatment but emerge with castration resistance. To determine AR gene status using a minimally invasive assay that could have broad clinical utility, we developed a targeted next-generation sequencing approach amenable to plasma DNA, covering all AR coding bases and genomic regions that are highly informative in prostate cancer. We sequenced 274 plasma samples from 97 castration-resistant prostate cancer patients treated with abiraterone at two institutions. We controlled for normal DNA in patients' circulation and detected a sufficiently high tumor DNA fraction to quantify AR copy number state in 217 samples (80 patients). Detection of AR copy number gain and point mutations in plasma were inversely correlated, supported further by the enrichment of nonsynonymous versus synonymous mutations in AR copy number normal as opposed to AR gain samples. Whereas AR copy number was unchanged from before treatment to progression and no mutant AR alleles showed signal for acquired gain, we observed emergence of T878A or L702H AR amino acid changes in 13% of tumors at progression on abiraterone. Patients with AR gain or T878A or L702H before abiraterone (45%) were 4.9 and 7.8 times less likely to have a ≥50 or ≥90% decline in prostate-specific antigen (PSA), respectively, and had a significantly worse overall [hazard ratio (HR), 7.33; 95% confidence interval (CI), 3.51 to 15.34; P = 1.3 × 10(-9)) and progression-free (HR, 3.73; 95% CI, 2.17 to 6.41; P = 5.6 × 10(-7)) survival. Evaluation of plasma AR by next-generation sequencing could identify cancers with primary resistance to abiraterone.

  18. Solo de um gato preto em clarinetas de neve: autobiografias de Érico Veríssimo em ponto e contraponto

    OpenAIRE

    Eva Paulino Bueno

    2011-01-01

    No início do segundo volume de suas memórias, <em style="mso-bidi-font-style: normal;">Solo de clarinetaem>, Érico Veríssimo está relatando suas angústicas e incertezas antes de começar a escrever <em style="mso-bidi-font-style: normal;">O arquipélagoem>, a última parte da sua...

  19. Practical reactor production of {sup 41}Ar from argon clathrate

    Energy Technology Data Exchange (ETDEWEB)

    Mercer, J.R. E-mail: jmercer@pharmacy.ualberta.ca; Duke, M.J.M.; McQuarrie, S.A

    2000-06-01

    The radionuclide {sup 41}Ar has many ideal properties as a gas flow tracer. However, the modest cross-section of {sup 40}Ar for thermal neutron activation makes preparation of suitable activities of {sup 41}Ar technically difficult particularly for low flux reactors. Argon can however be trapped in a molecular complex called a clathrate that can then be irradiated. We prepared argon clathrate and explored its irradiation and stability characteristics. Argon clathrate can be used to provide gigabecquerel quantities of {sup 41}Ar even with low power reactors.

  20. A poética da tradução em Walter Benjamin e Haroldo de Campos

    Directory of Open Access Journals (Sweden)

    Luciene Guimarães de Oliveira

    2005-04-01

    Full Text Available Este ensaio visa traçar um paralelo entre a poética da tradução de Walter Benjamin, em “A Tarefa do Tradutor”, e a de Haroldo de Campos, poeta, tradutor, e crítico brasileiro em sua teoria da tradução.

  1. Reference Gene Selection in the Desert Plant <em>Eremosparton songoricuem>m>

    Directory of Open Access Journals (Sweden)

    Dao-Yuan Zhang

    2012-06-01

    Full Text Available <em>Eremosparton songoricum em>(Litv. Vass. (<em>E. songoricumem> is a rare and extremely drought-tolerant desert plant that holds promise as a model organism for the identification of genes associated with water deficit stress. Here, we cloned and evaluated the expression of eight candidate reference genes using quantitative real-time reverse transcriptase polymerase chain reactions. The expression of these candidate reference genes was analyzed in a diverse set of 20 samples including various <em>E. songoricumem> plant tissues exposed to multiple environmental stresses. GeNorm analysis indicated that expression stability varied between the reference genes in the different experimental conditions, but the two most stable reference genes were sufficient for normalization in most conditions.<em> EsEFem> and <em>Esα-TUB> were sufficient for various stress conditions, <em>EsEF> and <em>EsACT> were suitable for samples of differing germination stages, and <em>EsGAPDH>and <em>Es>UBQ em>were most stable across multiple adult tissue samples. The <em>Es18Sem> gene was unsuitable as a reference gene in our analysis. In addition, the expression level of the drought-stress related transcription factor <em>EsDREB2em>> em>verified the utility of<em> E. songoricumem> reference genes and indicated that no single gene was adequate for normalization on its own. This is the first systematic report on the selection of reference genes in <em>E. songoricumem>, and these data will facilitate future work on gene expression in this species.

  2. Anormalidades de fluxo sangüíneo cerebral em indivíduos dependentes de cocaína Cerebral blood flow abnormalities in cocaine dependent subjects

    OpenAIRE

    Sergio Nicastri; Buchpiguel, Carlos A.; Andrade, Arthur G.

    2000-01-01

    INTRODUÇÃO: Nos últimos anos, tem havido relatos de anormalidades do fluxo sanguíneo cerebral em indivíduos com o abuso de cocaína, detectadas por meio de tomografia computadorizada por emissão de fóton único (SPECT). Esse padrão anormal de perfusão cerebral tem sido associado a prejuízos cognitivos mas não a alterações observáveis por meio de exames de neuroimagem estrutural. Um problema envolvendo a maioria dos trabalhos publicados sobre esse tema é a inclusão de um grande número de usuário...

  3. Reação granulomatosa do tipo corpo estranho simulando tumor de parede torácica em cicatriz de toracotomia prévia

    Directory of Open Access Journals (Sweden)

    MACEDO NETO AMARÍLIO VIEIRA DE

    2000-01-01

    Full Text Available Paciente apresentando tumoração indolor, de crescimento lento, em local correspondente à cicatriz de toracotomia para correção de coarctação de aorta realizada 15 anos antes. Tomografia computadorizada de tórax mostrou lesões tumorais de contornos relativamente bem definidos e osteólise dos arcos costais adjacentes. Realizada ressecção e reconstrução de parede torácica. O anatomopatológico demonstrou reação de histiócitos granulares e reação granulomatosa de corpo estranho a material necro-hemorrágico. Este é um evento raro na prática médica, tendo-se realizado revisão da literatura pertinente.

  4. Ar-39 - Ar-40 Evidence for an Approximately 4.26 Ga Impact Heating Event on the LL Parent Body

    Science.gov (United States)

    Dixon, E. T.; Bogard, D. D.; Rubin, A. E.

    2003-01-01

    Miller Range 99301 is a type 6, unbrecciated LL chondrite. MIL 99301 is of interest because some compositional and petrographic features suggest it experienced rather high shock grades, whereas other features suggest it is relatively unshocked. Inconsistent shock indicators could be explained if MIL 99301 was shocked but then partly annealed by heat produced by impacts on the parent body. The hypothesis that MIL 99301 experienced high temperature metamorphism (type 6) followed by a later shock event that heated, but did not melt, the constituent feldspar can be evaluated using (39)Ar-(40)Ar chronology. This is because (39)Ar-(40)Ar ages of shocked ordinary chondrites are generally <4.2 Ga, whereas (39)Ar-(40)Ar ages of unshocked meteorites are generally older, and between 4.52 - 4.38 Ga.

  5. Gunshot wounds to the head. Correlations between CT and clinical findings, neurosurgical treatment and long-term sequels; Traumi cranio-encefalici da proiettile: correlazione tra tomografia computerizzata, clinica, trattamento neurochirurgico e sequele a distanza

    Energy Technology Data Exchange (ETDEWEB)

    Salzano, A.; Nocera, V. [Ospedale S. Giovanni di Dio, Frattamaggiore, NA (Italy). Servizio di Radiologia; De Rosa, A.; Nunziata, A. [Ospedale Loreto Mare, Neaples (Italy). Servizio di Radiologia; Rossi, E.; Brunese, L. [Universita' degli Studi Federico II, Neaples (Italy). Ist. di Scienze Radiologiche; Tuccillo, M. [Azienda Ospedaliera di Rilievo Nazionale A. Cardarelli, Neaples (Italy). Servizio di Radiologia; Grassi, R. [Seconda Universita' degli Studi, Neaples (Italy). Ist. di Radiologia

    2000-03-01

    With the aim of demonstrating the usefulness of computerised tomography (CT) findings in the planning of brain neurosurgery in gunshot victims, for prompt and successful treatment, 30 patients with brain gunshot wounds were examined with CT over 5 years. The mortality rate of firearm wounds of the skull base was 34% higher than that of the hemisphere; this is due to carotid hemorrhage and midbrain damage. Such traumas require emergency radiological diagnosis and neurosurgical treatment because of their severity and early irreversible complications. Complex operations and skilled surgeons may prevent disabling postoperative sequels. CT findings are indispensable and must be correctly interpreted. The radiologist and the neurosurgeon must collaborate closely and both must consider several diagnostic factors affecting surgical planning. [Italian] Scopo dello studio e' stato quello di dimostrare l'utilita' della semeiologia della tomografia computerizzata in relazione con la pianificazione dell'intervento neochirurgico, al fine di attuare con tempestivita' interventi chirurgici soddisfacenti e meno lesivi. Lo studio comprende 30 casi di lesioni cranio-encefaliche da arma da fuoco esaminate con tomografia computerizzata nel periodo di 5 anni. Materiali e metodi utilizzati sono analiticamente descritti. L'esperienza dimostra che nelle lesioni da arma da fuoco del basicranio si nota una mortalita' del 34% superiore rispetto a quelle piu' craniali come quelle emisferiche in relazione a emorragie carotidee e lesioni tronco-mesencefaliche. Tali traumi esigono diagnosi radiologica e terapia neurochirurgica d'urgenza per la gravita' e le precoci complicanze irreversibili. Cio' richiede interventi complessi e manualita' esperte e rapide al fine di evitare sequele postoperatorie invalidanti. La corretta e indispensabile interpretazione dei segni radiologici della tomografia computerizzata deve avvenire in stretta

  6. Espondilite tuberculosa em adolescente Tuberculous spondylitis in teenager

    Directory of Open Access Journals (Sweden)

    Marta Maciel Lyra Cabral

    2005-06-01

    Full Text Available Relata-se o caso de uma adolescente com tuberculose osteoarticular em coluna lombossacral, uma localização incomum. O seu diagnóstico permanece um desafio por apresentar sintomas gerais inespecíficos e lesões ósseas que podem ser confundidas com outras afecções. A doença é degenerativa e de prognóstico reservado. São discutidos aspectos clínicos, laboratoriais e de imagem, incluindo tomografia computadorizada e ressonância magnética. A reação em cadeia da polimerase, usando o marcador IS 6110 para M. tuberculosis, foi positiva, sugerindo fortemente a presença do patógeno. Este ensaio é particularmente indicado quando se exige um diagnóstico de tuberculose rápido e sensível.This article presents a case report of osteoarticular tuberculosis affecting lumbar sacral column non-typical attack. The diagnosis remains a medical challenge because the symptoms and bone lesions are not specific and can be mislead with other morbidity such as inflammatory, circulatory, metabolic, traumatic, congenital and tumoral diseases. The disease is degenerative and the prognosis not satisfactory. Besides the clinical aspects and laboratory, imaging results, including computed tomography and magnetic ressonance, are discussed. A PCR system targeting the IS 6110 of M. tuberculosis was positive, strongly suggesting the presence of this pathogen. This assay would be particularly indicated when quick and sensitive diagnosis of tuberculosis is required.

  7. Reactivation episodes of the romeral fault system in the northwestern part of central andes, colombia, through 39ar-40ar and k-ar results

    OpenAIRE

    VINASCO VALLEJO, CESAR JAVIER; Cordani, Umberto

    2013-01-01

    Direct dating of reactivation of the San Jerónimo Fault (SJF), easternmost limit of the Romeral fault system (RFS), is presented through 39Ar-40Ar and K-Ar results in neo-formed micas and mylonitic bands of strongly hidrothermalized gabbros. Published cooling and crystallization ages from sin-tectonic magmatic rocks exposed in the western fl ank of the Central Cordillera have suggest that tectonic evolution of the paleo-fault system began since Triassic and Lower Jurassic before the installat...

  8. Ab Initio Potential Curve for ArH+%ArH+势能曲线的从头计算

    Institute of Scientific and Technical Information of China (English)

    王胜龙; 屈军艳; 郭锐; 赵新生

    2001-01-01

    The molecular parameters of ArH+ have been calculated with different quantum chemistry methods and basis sets.Based on the data from QCISD/Aug cc pVTZ ab initio calculation for different configurations of ArH+ and the experimental data,an accurate potential curve for ArH+ has been constructed.The molecular properties,such as dissociation energy,equilibrium bond length,and vibrational energy levels,can be accurately reproduced.

  9. 40Ar/39Ar Age of the Lathrop Wells Volcanic Center, Yucca Mountain, Nevada.

    Science.gov (United States)

    Turrin, B D; Champion, D; Fleck, R J

    1991-08-01

    Paleomagnetic and (40)Ar/(39)Ar analyses from the Lathrop Wells volcanic center, Nevada, indicate that two eruptive events have occurred there. The ages (136 +/- 8 and 141 +/- 9 thousand years ago) for these two events are analytically indistinguishable. The small angular difference (4.7 degrees ) between the paleomagnetic directions from these two events suggests they differ in age by only about 100 years. These ages are consistent with the chronology of the surficial geological units in the Yucca Mountain area. These results contradict earlier interpretations of the cinder-cone geomorphology and soil-profile data that suggest that at least five temporally discrete eruptive events occurred at Lathrop Wells approximately 20,000 years ago. PMID:17772371

  10. 40Ar-39Ar age of carbonatite-alkaline magmatism in Sung Valley, Maghalaya, India

    Indian Academy of Sciences (India)

    Jyotiranjan S Ray; Kanchan Pande

    2001-09-01

    40Ar-39Ar analyses of one alkali pyroxenite whole rock and two phlogopite separates of calcite carbonatites from the Sung Valley carbonatite-alkaline complex, which is believed to be a part of the Rajmahal-Bengal-Sylhet (RBS) ood basalt province, yielded indistinguishable plateau ages of 108.8 ± 2.0 Ma, 106:4 ± 1.3 Ma and 107.5 ± 1.4 Ma, respectively. The weighted mean of these ages, 107.2 ± 0.8 Ma, is the time of emplacement of this complex. This implies that Sung Valley complex and probably other such complexes in the Assam-Meghalaya Plateau postdate the main ood basalt event (i.e., the eruption of tholeiites) in the RBS province by ∼10 Ma.

  11. Acoustic resonance spectroscopy (ARS): ARS300 operations manual, software version 2.01

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-07-25

    Acoustic Resonance Spectroscopy (ARS) is a nondestructive evaluation technology developed at the Los Alamos National Laboratory. The ARS technique is a fast, safe, and nonintrusive technique that is particularly useful when a large number of objects need to be tested. Any physical object, whether solid, hollow, or fluid filled, has many modes of vibration. These modes of vibration, commonly referred to as the natural resonant modes or resonant frequencies, are determined by the object`s shape, size, and physical properties, such as elastic moduli, speed of sound, and density. If the object is mechanically excited at frequencies corresponding to its characteristic natural vibrational modes, a resonance effect can be observed when small excitation energies produce large amplitude vibrations in the object. At other excitation frequencies, i.e., vibrational response of the object is minimal.

  12. 40Ar/39Ar dating and paleo-magnetism of traps from Ethiopia, Deccan and Siberia

    International Nuclear Information System (INIS)

    Recent studies have shown that major flood basalt provinces have been emplaced as short events (∼ 1 Myr), more or less synchronous with climatic crises and mass extinctions. We present new geochronologic (40Ar/39Ar) and magneto-stratigraphic results for the Ethiopian traps, one of the last remaining flood basalts for which little of such data were available. The ages obtained in a 2000 m thick section are indistinguishable. Moreover, magneto-stratigraphy reveals a simple 3-chron reverse-normal-reverse sequence. Although magnetic chrons cannot be yet unambiguously identified, there is more likelihood for the normal sub-chron in the main basaltic pile to correspond to 11N, supporting a brief duration (less than 1.5 Ma). The Ethiopian traps erupted near 30 Ma at or near the time of the cold and dry climate, major Antarctic ice sheet advance, and the largest sea-level drop in the Tertiary. Bhandari et al. (GRL, 1995) have discovered inter-traps sediments with a triple iridium anomaly in a series of seven basaltic lava flows in the Kutch area of the North Western Deccan traps of India. Plagioclases from three flows above the iridium bearing sediments yield 39Ar/40Ar plateau ages near 65.0 Ma: these flows have unambiguously reversed magnetic polarity interpreted as chron 29R. As a preliminary summary, evidence of the KTB asteroid impact is confirmed in the Deccan traps, showing that they are coeval events in a general sense (in a Ma long window) though clearly with vastly different time constants. This is compatible with paleontologic evidence of two scales of extinctions, one quasi-instantaneous and the other on the order of 105 to 106 yrs. Clearly, the impact cannot have caused trap eruptions. On the other hand, the exact age and significance of the lower flows more altered remains to be analyzed further as they pertained to the much debated question of duration of Deccan trap volcanism. (author)

  13. 40 Ar/ 39 Ar radiometric dating to constrain the volcanic stratigraphy: The Mt. Etna methodological case.

    OpenAIRE

    De Beni, E.; Istituto Nazionale di Geofisica e Vulcanologia, Sezione Catania, Catania, Italia; Groppelli, G.; Istituto per la Dinamica dei Processi Ambientali–Sezione di Milano, Consiglio Nazionale delle Ricerche, via Mangiagalli 34, 20133 Milano, Italy

    2010-01-01

    Although ~50 radiometric age analyses have been performed on Etna, and there are many historical references, these are not enough to temporally constrain the geo- logical evolution of the volcano. In particular, a new stratigraphic framework based on lithostratigraphic and unconformity-bounded units has pointed out the presence of some stratigraphic uncertainty that can be resolved only with radiometric dating. For this reason, a dating project applying the 40 Ar/ ...

  14. Spatial autocorrelation method using AR model; Kukan jiko sokanho eno AR model no tekiyo

    Energy Technology Data Exchange (ETDEWEB)

    Yamamoto, H.; Obuchi, T.; Saito, T. [Iwate University, Iwate (Japan). Faculty of Engineering

    1996-05-01

    Examination was made about the applicability of the AR model to the spatial autocorrelation (SAC) method, which analyzes the surface wave phase velocity in a microtremor, for the estimation of the underground structure. In this examination, microtremor data recorded in Morioka City, Iwate Prefecture, was used. In the SAC method, a spatial autocorrelation function with the frequency as a variable is determined from microtremor data observed by circular arrays. Then, the Bessel function is adapted to the spatial autocorrelation coefficient with the distance between seismographs as a variable for the determination of the phase velocity. The result of the AR model application in this study and the results of the conventional BPF and FFT method were compared. It was then found that the phase velocities obtained by the BPF and FFT methods were more dispersed than the same obtained by the AR model. The dispersion in the BPF method is attributed to the bandwidth used in the band-pass filter and, in the FFT method, to the impact of the bandwidth on the smoothing of the cross spectrum. 2 refs., 7 figs.

  15. Dicty_cDB: FC-AR21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR21 (Link to dictyBase) - - - Contig-U16455-1 FC-AR21Z (Li...nk to Original site) - - FC-AR21Z 528 - - - - Show FC-AR21 Library FC (Link to library) Clone ID FC-AR21 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR21Q.Seq.d/ Representative seq. ID FC-AR...21Z (Link to Original site) Representative DNA sequence >FC-AR21 (FC-AR21Q) /CSM/FC/FC-AR/FC-AR21Q.Seq....omology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR21 (FC-AR

  16. RECONSTRUCTION OF AR DEPTH PROFILES FROM PIXE MEASUREMENTS

    NARCIS (Netherlands)

    OSIPOWICZ, T; LIEW, SC; LOH, KK; ORLIC, [No Value; TANG, SM; WEBER, T

    1994-01-01

    We report on the application of an iterative maximum likelihood algorithm [1] to the reconstruction of depth profiles from PIXE measurements. PIXE spectra of 450 and 800 keV Ar implanted Al samples were taken at 1.5 and 1.3 MeV He+ energy and at angles ranging from 18 to 83-degrees. The measured Ar

  17. Experimental introduction of excess Ar40 into a granitic melt

    Science.gov (United States)

    Fyfe, W.S.; Lanphere, M.A.; Dalrymple, G.B.

    1969-01-01

    Samples of a Precambrian granite were melted in sealed capsules to produce a radiogenic Ar40 atmosphere over the melt. The amount of Ar40 incorporated in the quenched charge was then determined. Under these experimental conditions the amount of argon dissolved in the quenched melt was appreciable and could be an important source of error in potassiumargon dating. ?? 1969 Springer-Verlag.

  18. In Vitro Activity of AR-709 against Streptococcus pneumoniae▿

    OpenAIRE

    Jansen, W.T.M.; Verel, A.; Verhoef, J.; Milatovic, D.

    2008-01-01

    We investigated the in vitro activity of AR-709, a novel diaminopyrimidine antibiotic currently in development for treatment of community-acquired upper and lower respiratory tract infections, against 151 Streptococcus pneumoniae strains from various European countries. AR-709 showed excellent activity against both drug-susceptible and multidrug-resistant pneumococci.

  19. Aspects of What Makes or Breaks a Museum AR Experience

    DEFF Research Database (Denmark)

    Madsen, Claus B.; Madsen, Jacob Boesen; Morrison, Ann

    2012-01-01

    The paper critically evaluates central aspects of an iPad AR application developed for a museum context. The application is designed for children aged 8 to 12 and mixes AR and mini-game elements to convey dramatized historical events. The game has been deployed for roughly 3 months and the findin...

  20. Synthesis, Crystal Structure and Luminescent Property of Cd (II Complex with <em>N-Benzenesulphonyl-L>-leucine

    Directory of Open Access Journals (Sweden)

    Xishi Tai

    2012-09-01

    Full Text Available A new trinuclear Cd (II complex [Cd3(L6(2,2-bipyridine3] [L =<em> Nem>-phenylsulfonyl-L>-leucinato] has been synthesized and characterized by elemental analysis, IR and X-ray single crystal diffraction analysis. The results show that the complex belongs to the orthorhombic, space group<em> Pem>212121 with<em> aem> = 16.877(3 Å, <em>b> em>= 22.875(5 Å, <em>c em>= 29.495(6 Å, <em>α> em>= <emem>= <emem>= 90°, <em>V> em>= 11387(4 Å3, <em>Z> em>= 4, <em>Dc>= 1.416 μg·m−3, <emem>= 0.737 mm−1, <em>F> em>(000 = 4992, and final <em>R>1 = 0.0390, <em>ωR>2 = 0.0989. The complex comprises two seven-coordinated Cd (II atoms, with a N2O5 distorted pengonal bipyramidal coordination environment and a six-coordinated Cd (II atom, with a N2O4 distorted octahedral coordination environment. The molecules form one dimensional chain structure by the interaction of bridged carboxylato groups, hydrogen bonds and p-p interaction of 2,2-bipyridine. The luminescent properties of the Cd (II complex and <em>N-Benzenesulphonyl-L>-leucine in solid and in CH3OH solution also have been investigated.

  1. Ar-40/Ar-39 age constraints for the Jaramillo Normal Subchron and the Matuyama-Brunhes geomagnetic boundary

    Science.gov (United States)

    Izett, Glen A.; Obradovich, John D.

    1994-02-01

    Our mid-Pleistocene Ar-40/Ar-39 age recalibration of the geomagnetic polarity timescale is nearly in accord with the oxygen isotope, climate record calibration of the astronomical timescale proposed by Johnson (1982) and Shackleton et al. (1990). Ar-40/Ar-39 ages of a normally magnetized rhyolite dome in the Valles caldera, northern Mexico, yielded a weighted-mean age of 1.004 +/- 0.019 Ma. A K-Ar age of 0.909 +/- 0.019 Ma for this rock by Doell and Dalrymple (1966) was the linchpin for the recognition and calibration of the Jaramillo Normal Subchron (JNS). Other Ar-40/Ar-39 ages from the Valles caldera and Ar-40/Ar-39 ages of Ivory Coast tektites indicate that the JNS began at about 1.11 Ma and ended before 0.92 Ma, probably near 0.97 Ma. The Matuyama-Brunhes boundary occurred between 0.79 Ma and 0.76 Ma on the basis of Ar-40/Ar-39 sanidine ages from (1) three reversely magnetized rhyolite domes of the Valles caldera (0.793 +/- 0.018 Ma, 0.794 +/- 0.007 Ma, and 0.812 +/- 0.023 Ma) and pumice (0.789 +/- 0.006 Ma) from the reversely magnetized Oldest Toba Tuff of Sumatra and (2) pumice (0.764 +/- 0.005 Ma and 0.757 +/- 0.009 Ma) from the lower and upper units of the normally magnetized Bishop Tuff. The age of the boundary may be close to 0.77 Ma as deduced from rates of sedimentation in ancient Lake Bonneville, Utah.

  2. Touch interface for markless AR based on Kinect

    Science.gov (United States)

    Hsieh, Ching-Tang; Kuo, Tai-Ku; Wang, Hui-Chun; Wu, Yeh-Kuang; Chang, Liung-Chun

    2014-01-01

    We develop an augmented reality (AR) environment with hidden-marker via touch interface using Kinect device, and then also set up a touch painting game with the AR environment. This environment is similar to that of the touch screen interface which allows user to paint picture on a tabletop with his fingers, and it is designed with depth image information from Kinect device setting up above a tabletop. We incorporate support vector machine (SVM) to classify painted pictures which correspond to the inner data and call out its AR into the tabletop in color images information from Kinect device. Because users can utilize this similar touch interface to control AR, we achieve a marker-less AR and interactive environment.

  3. AR Sco: A White Dwarf Synchronar

    CERN Document Server

    Katz, J I

    2016-01-01

    The emission of the white dwarf-M dwarf binary AR Sco is driven by the rapid synchronization of its white dwarf, rather than by accretion. This requires a comparatively large magnetic field $\\sim 100$ gauss at the M dwarf and $\\sim 10^8$ gauss on the white dwarf, larger than the fields of most intermediate polars but within the range of fields of known magnetic white dwarfs. The spindown power is dissipated in the atmosphere of the M dwarf by magnetic reconnection, accelerating particles that produce the observed synchrotron radiation. The displacement of the optical maximum from conjunction may be explained either by dissipation in a bow wave as the white dwarf's magnetic field sweeps past the M dwarf or by a misaligned white dwarf's rotation axis and oblique magnetic moment. In the latter case the rotation axis precesses with a period of decades, predicting a drift in the orbital phase of maximum. Binaries whose emission is powered by synchronization may be termed synchronars, in analogy to magnetars.

  4. MICOBIOTA ASSOCIADA À MADEIRA SERRADA DE Eucalyptus grandis HILL EX MAIDEN DURANTE A SECAGEM AO AR LIVRE

    Directory of Open Access Journals (Sweden)

    Paulo Fernando Trugilho

    2006-02-01

    Full Text Available O objetivo principal deste trabalho foi o de acompanhar a secagem ao ar livre da madeira serrada de Eucalyptus grandis conduzida na região de Lavras, MG e identificar a micobiota associada à madeira em diversas fases da secagem. As tábuas foram cortadas de oito toras de 3,0 m de comprimento, oriundas de três árvores, com 27 anos de idade, plantadas em área experimental da UFLA. Dos resultados, pôde-se concluir que a secagem da madeira de Eucalyptus grandis ao ar livre, iniciada em janeiro, consumiu 158 dias até atingir umidade próxima a 12,5%. A curva de secagem foi representada por uma equação logarítmica com coeficiente de determinação (R2 igual a 98,3%. Os fungos causadores de bolores superficiais e de manchas tiveram maior ocorrência no início da secagem. As mais altas freqüências de fungos, verificadas no início da secagem, foram observadas para Penicillium spp. e Pestalotiopsis sp. O fungo Lentinus lepideus ocorreu com maior freqüência no final da secagem.

  5. On Full Disclosure and Transparent Data Flow from 40Ar/39Ar Geochronology Measurements to Data Reduction to Online Repositories

    Science.gov (United States)

    Koppers, A. A. P.

    2015-12-01

    Arguably 40Ar/39Ar geochronology is one of the most versatile techniques available to Earth scientists today for the dating of rocks and minerals and determining the rates of geological processes on Earth and in our solar system. Over the last four decades large quantities of high (and lower) quality 40Ar/39Ar data have been produced using many different generations of mass spectrometry instrumentation. This wealth of data is only as useful as its description and availability of metadata allows. Many online data sets or compilations available in the science literature only carry the resulting product, an age and a related uncertainty in millions of years, for example. These data points are far from desirable as these don't allow recalculation against modern-day age standards, decay constants and other parameters essential in 40Ar/39Ar geochronology. Over time these data will become less useful to the research community and eventually these will be put by the wayside. In this presentation I will emphasize the need for full disclosure of all data and metadata involved in 40Ar/39Ar geochronology. I will give examples of how a complex data flow can be kept transparent from sample preparation to measurement to data reduction and eventually the uploading into online data repositories. Without the full disclosure of our data and a transparent data flow, it is evident that we cannot live up to one of the governing doctrines in the sciences, namely reproducibility of our scientific experiments and findings.

  6. 40Ar/39Ar ages of adularia from the Golden Cross, Neavesville, and Komata epithermal deposits, Hauraki Goldfield, New Zealand

    International Nuclear Information System (INIS)

    New 40Ar/39Ar ages of adularia from three epithermal vein deposits in the Hauraki Goldfield constrain when these deposits formed. Adularia from veins at Neavesville has 40Ar/39Ar plateau and isochron ages of 6.89 ± 0.02 and 6.86 ± 0.02 Ma, respectively, similar to the 40Ar/39Ar plateau and isochron ages of adularia from veins at Golden Cross of 6.96 ± 0.04 and 6.93 ± 0.03 Ma, respectively. In contrast, Komata mineralisation formed at 5.99 ± 0.02 to 6.07 ± 0.03 Ma, based on the 40Ar/39Ar isochron and plateau ages of the adularia in these veins, similar to the previously reported 6.0 Ma age of mineralisation at Waihi/Favona. These preliminary data suggest that mineralisation in the Hauraki Goldfields occurred episodically. (author). 19 refs., 3 figs., 1 tab

  7. Dicty_cDB: FC-AR11 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR11 (Link to dictyBase) - - - Contig-U14938-1 FC-AR11E (Li...nk to Original site) - - - - - - FC-AR11E 918 Show FC-AR11 Library FC (Link to library) Clone ID FC-AR11 (Li... 8.0 %: cytoskeletal 4.0 %: vacuolar 4.0 %: mitochondrial 4.0 %: endoplasmic reticulum >> prediction for FC-AR.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR11Q.Seq.d/ Representative seq. ID FC-AR...11E (Link to Original site) Representative DNA sequence >FC-AR11 (FC-AR11Q) /CSM/FC/FC-AR/FC-AR11Q.Seq.

  8. Dicty_cDB: FC-AR19 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR19 (Link to dictyBase) - - - Contig-U16521-1 FC-AR19Z (Li...nk to Original site) - - FC-AR19Z 565 - - - - Show FC-AR19 Library FC (Link to library) Clone ID FC-AR19 (Li... 4.0 %: vacuolar 4.0 %: mitochondrial >> prediction for FC-AR19 is .../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR19Q.Seq.d/ Representative seq. ID FC-AR...19Z (Link to Original site) Representative DNA sequence >FC-AR19 (FC-AR19Q) /CSM/FC/FC-AR/FC-AR19Q.Seq.

  9. Dicty_cDB: FC-AR15 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR15 (Link to dictyBase) - - - Contig-U16022-1 FC-AR15E (Li...nk to Original site) - - - - - - FC-AR15E 390 Show FC-AR15 Library FC (Link to library) Clone ID FC-AR15 (Li..., including cell wall 4.0 %: vacuolar 4.0 %: mitochondrial >> prediction for FC-AR15 is cyt 5' .../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR15Q.Seq.d/ Representative seq. ID FC-AR...15E (Link to Original site) Representative DNA sequence >FC-AR15 (FC-AR15Q) /CSM/FC/FC-AR/FC-AR15Q.Seq.

  10. Dicty_cDB: FC-AR07 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR07 (Link to dictyBase) - - - Contig-U16276-1 FC-AR07Z (Li...nk to Original site) - - FC-AR07Z 604 - - - - Show FC-AR07 Library FC (Link to library) Clone ID FC-AR07 (Li...a: 0.00 m3b: 0.00 m_ : 1.00 48.0 %: cytoplasmic 36.0 %: nuclear 8.0 %: cytoskeletal 8.0 %: mitochondrial >> prediction for FC-AR.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR07Q.Seq.d/ Representative seq. ID FC-AR...07Z (Link to Original site) Representative DNA sequence >FC-AR07 (FC-AR07Q) /CSM/FC/FC-AR/FC-AR07Q.Seq.

  11. Dicty_cDB: FC-AR24 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR24 (Link to dictyBase) - G24050 DDB0191443 Contig-U16141-1 FC-AR...24E (Link to Original site) - - - - - - FC-AR24E 785 Show FC-AR24 Library FC (Link to library) Clone ID FC-AR...sicles of secretory system 4.0 %: cytoskeletal 4.0 %: vacuolar >> prediction for FC-AR...1-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR24Q.Se...q.d/ Representative seq. ID FC-AR24E (Link to Original site) Representative DNA sequence >FC-AR24 (FC-AR24Q) /CSM/FC/FC-AR/FC-AR

  12. Dicty_cDB: FC-AR13 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR13 (Link to dictyBase) - - - Contig-U16456-1 FC-AR13Z (Li...nk to Original site) - - FC-AR13Z 550 - - - - Show FC-AR13 Library FC (Link to library) Clone ID FC-AR13 (Li... 8.0 %: mitochondrial 4.0 %: extracellular, including cell wall >> prediction for FC-AR13 is nuc 5' e.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR13Q.Seq.d/ Representative seq. ID FC-AR...13Z (Link to Original site) Representative DNA sequence >FC-AR13 (FC-AR13Q) /CSM/FC/FC-AR/FC-AR13Q.Seq.

  13. ``Smoking From The Same Pipe": Developement of an 40Ar/39Ar Datting Intercalibration PIpette System (Invited)

    Science.gov (United States)

    Turrin, B. D.; Swisher, C. C.; Deino, A.; Hemming, S. R.; Hodges, K.; Renne, P. R.

    2010-12-01

    The precision and accuracy of Ar isotope ratio measurements is one of the main limiting factors in the uncertainties of an 40Ar/39Ar age. Currently, it is relatively common to measure Ar isotopic ratios to a precision of 1-2‰ or better on an intralaboratory basis. This level of analytical precision equates to a comparable level of precision (1-3‰) in the calculated age, depending on the extent of atmospheric Ar contamination, importance of nucleogenic interference corrections, and other factors. However, it has become clear that improving the precision of mass spectrometry is not the only bottleneck towards improving the accuracy and precision of 40Ar/39Ar dating in general. Rather, the most urgent issue is interlaboratory reproducibility. This became obvious in a recent EARTHTIME initiative undertaken to intercalibrate two commonly used 40Ar/39Ar standards [the Fish Canyon sanidine (FCs) and the Alder Creek sanidine (ACs)]. This effort revealed variations amongst laboratories (at the 1-2% level), an order of magnitude greater than the internal analytical precisions. To address these issues, we have proposed (to NSF) to construct two identical pipette systems loaded to identical starting pressures and with identical isotopic compositions. One pipette system will travel between participating 40Ar/39Ar labs and the second system will not travel and serve as the “Master” system to test for any fractionation or undocumented depletion of the traveling pipette system. In order to ensure delivery of uniform amounts of homogenous gas, the pipette system will be computer-controlled with preprogrammed routines and lockouts to prevent compromising the reservoirs. The pipette systems will deliver three gas samples with different isotopic ratios at two different pressures/concentrations. One pipette bulb will be of atmospheric isotopic composition, and the other two pipette bulbs will have 40Ar*/39ArK ratios corresponding to co-irradiated ACs and FCs fixed by their

  14. 40Ar/39Ar geochronology and exhumation of mylonitized metamorphic complex in Changle-Nanao ductile shear zone

    Institute of Scientific and Technical Information of China (English)

    王志洪; 卢华复

    1997-01-01

    New 40Ar/39Ar plateau ages from rocks of Changle-Nanao ductile shear zone are 107.9 Ma(Mus), 108.2 Ma(Bi), 107. 1 Ma(Bi), 109. 2 Ma(Hb) and 117. 9 Ma(Bi) respectively, which are concordant with their isochron ages and record the formation age of the ductile shear zone. The similarity and apparent overlap of the cooling ages with respective closure temperatures of 5 minerals document initial rapid uplift during 107-118 Ma following the collision between the Min-Tai microcontinent and the Min-Zhe Mesozoic volcanic arc. The 40Ar/39Ar plateau ages, K-Ar date of K-feldspar and other geochronologic information suggest that the exhumation rate of the ductile shear zone is about 0.18-1.12 mm/a in the range of 107-70 Ma, which is mainly influenced by tectonic extension.

  15. New 40Ar/39Ar dates of adularia from epithermal deposits in the Hauraki Goldfield, New Zealand

    International Nuclear Information System (INIS)

    New 40Ar/39Ar dates of vein and wall rock adularia from seven epithermal deposits and one porphyry copper prospect help constrain the ages of mineralisation in the Hauraki Goldfield. Vein adularia from the Paritu region yielded a single 40Ar/39Ar plateau date of 16.315 ± 0.066 Ma. Five 40Ar/39Ar plateau dates of three samples of vein adularia from the Opitonui deposit overlap within error to yield a preferred age of 13.149 ± 0.016 Ma. Two samples of vein adularia from the Night Reef at the Broken Hills deposit yield exceptionally flat 40Ar/39Ar plateaus, and all date overlap within error to provide an age of 7.121 ± 0.010 Ma. Two 40Ar/39Ar plateau dates of one sample of vein adularia from the Wharekirauponga deposit overlap within error to provide an age of 6.318 ± 0.061 Ma. Four 40Ar/39Ar plateau dates of three samples of vein adularia from the Maratoto deposit overlap within error to provide an age of 6.411 ± 0.022 Ma. Two samples of adularia from altered wall rock at the Sovereign deposit yield three 40Ar/39Ar plateau dates that range from 6.547 ± 0.021 Ma to 6.806 ± 0.028 Ma. This suggest that mineralisation formed around 6.6 Ma, but the results are complicated because the adularia contains minor illite that post-dates adularia formation. Results from the Karangahake deposit are complex. Two samples of vein adularia yield three 40Ar/39Ar plateau dates that range from 6.116 ± 0.116 Ma to 6.901 ± 0.101 Ma, wheras one sample of wall rock adularia that contains minor late illite yields two 40Ar/39Ar plateau dates that overlap within error to provide a date of 5.734 ± 0.041. The range of dates indicates that more work is necessary to understand the history of mineralisation at this deposit. Two samples of vein adularia from the Tui deposit yield four 40Ar/39Ar plateau dates that overlap within error to provide an age of 5.714 ± 0.017 Ma. These results confirm previous work that indicates that the ages of epithermal deposit young southward in the Hauraki

  16. Recombination measurements at low energies with Ar16+ and Ar18+ ions in a dense, cold electron target

    International Nuclear Information System (INIS)

    Recombination of multiply charged ions with electrons at very low relative energies has become a major topic of interest, due to the observation of rates which are enhanced beyond the expectations for radiative recombination. We present results for Ar16+ and Ar18+ ions from systematic measurements along the argon isonuclear sequence using a high density cold electron beam target (ne = 7 x 109 cm-3) at the UNILAC of GSI. The transverse and longitudinal temperatures of the electron beam were determined from DR resonance features observed with metastable Ar16+ (23S) ions. The rate at Erel = 0 for radiative recombination of completely stripped Ar18+ calculated with electron beam temperatures kTparallel = 0.002 eV, kTperpendicular = 0.2 eV amounts to α = 10-9 cm3 s-1. This is exceeded by nearly a factor of 10 by the rate measured in experiments with Ar18+ ions

  17. Evaluation of the IPCC Models (AR4 and AR5) in the Precipitation Simulation in the Northeast of Brazil

    Science.gov (United States)

    Alves, José; Vasconcelos Junior, Francisco; Chaves, Rosane; Silva, Emerson; Servain, Jacques; Costa, Alexandre; Sombra, Sérgio; Barbosa, Augusto; Dos Santos, Antonio

    2016-04-01

    With the simulations of the models used in the latest reports from the Intergovernmental Panel on Climate Change (IPCC), comparative studies are necessary between observations and the so-called historical run (C20) and future projections of the AR4 (A2) and AR5 (RCP8.5) experiments, in order to assess whether the AR5 models had a better performance in the representation of physical processes. This article compares the sensitivity of IPCC models (AR4 and AR5) in representing the anuall average and seasonal rainfall variation (summer and autumn) in three regions of the Northeast of Brazil between 1979 and 2000, using the CMAP - CPC (Merged Analysis of Precipitation) data as reference. The projections made by these models for the period 2040-2070 were also analyzed.

  18. Evaluation of the IPCC Models (AR4 and AR5 in the Precipitation Simulation in the Northeast of Brazil

    Directory of Open Access Journals (Sweden)

    José Brabo Alves

    2016-04-01

    Full Text Available With the simulations of the models used in the latest reports from the Intergovernmental Panel on Climate Change (IPCC, comparative studies are necessary between observations and the so-called historical run (C20 and future projections of the AR4 (A2 and AR5 (RCP8.5 experiments, in order to assess whether the AR5 models had a better performance in the representation of physical processes. This article compares the sensitivity of IPCC models (AR4 and AR5 in representing the anuall average and seasonal rainfall variation (summer and autumn in three regions of the Northeast of Brazil between 1979 and 2000, using the CMAP - CPC (Merged Analysis of Precipitation data as reference. The projections made by these models for the period 2040-2070 were also analyzed.

  19. Ar-Ar investigations on Quarternary volcanic sequences of Monte Vulture (Southern Italy)

    Science.gov (United States)

    Buettner, A.; Principe, C.; Villa, I. M.

    2003-04-01

    Volcanic sanidines and phlogopites from feldspathoid- or sanidine-bearing volcan